Sample records for alga ulva fasciata

  1. Ethanol Production from Ulva fasciata

    NASA Astrophysics Data System (ADS)

    Masutani, Evan M.; Yoza, Brandon A.

    The theoretical potential yield of Ulva fasciata as a biomass feedstock for fermentative ethanol was found to be about 310 L per tonne, dry weight. U. fasciata has numerous characteristics that render it a suitable mariculture energy crop. Specifically, it forms large complex structures that grow quickly, with high (14%) dry to wet weight percentages, holocellulose content for the dry mass of 51%, carbohydrate content of 5%, and relatively low (5%) lignin content. Enzymatic saccharification with a commercial cellulase (Accelerase) from Genencor was investigated: After a 12 hr digestion, 25% of the potential glucose was recovered from the cellulose fraction. The hydrolysate was supplemented with a modified YM medium and used directly for batch fermentation. A 12 hr incubation resulted in complete utilization of the glucose and production of ethanol. In this preliminary investigation, the ethanol yield corresponded to approximately 126 L per tonne (dry weight) of macroalga, or 43% of the theoretical alcohol yield with respect to only the cellulose and carbohydrate contents. Theoretical yields are higher when the hemicellulose fraction is considered. While sugar recovery needs further optimization, the data suggest that additional work is warranted.

  2. Enzymatic hydrolysis and production of bioethanol from common macrophytic green alga Ulva fasciata Delile.


    Trivedi, Nitin; Gupta, Vishal; Reddy, C R K; Jha, Bhavanath


    The green seaweed Ulva which proliferates fast and occurs abundantly worldwide was used as a feedstock for production of ethanol following enzymatic hydrolysis. Among the different cellulases investigated for efficient saccharification, cellulase 22119 showed the highest conversion efficiency of biomass into reducing sugars than Viscozyme L, Cellulase 22086 and 22128. Pre-heat treatment of biomass in aqueous medium at 120°C for 1h followed by incubation in 2% (v/v) enzyme for 36 h at 45°C gave a maximum yield of sugar 206.82±14.96 mg/g. The fermentation of hydrolysate gave ethanol yield of 0.45 g/g reducing sugar accounting for 88.2% conversion efficiency. These values are substantially higher than those of reported so far for both agarophytes and carrageenophytes. It was also confirmed that enzyme can be used twice without compromising on the saccharification efficiency. The findings of this study reveal that Ulva can be a potential feedstock for bioethanol production. PMID:24157682

  3. Enzymatic hydrolysis and production of bioethanol from common macrophytic green alga Ulva fasciata Delile.


    Trivedi, Nitin; Gupta, Vishal; Reddy, C R K; Jha, Bhavanath


    The green seaweed Ulva which proliferates fast and occurs abundantly worldwide was used as a feedstock for production of ethanol following enzymatic hydrolysis. Among the different cellulases investigated for efficient saccharification, cellulase 22119 showed the highest conversion efficiency of biomass into reducing sugars than Viscozyme L, Cellulase 22086 and 22128. Pre-heat treatment of biomass in aqueous medium at 120°C for 1h followed by incubation in 2% (v/v) enzyme for 36 h at 45°C gave a maximum yield of sugar 206.82±14.96 mg/g. The fermentation of hydrolysate gave ethanol yield of 0.45 g/g reducing sugar accounting for 88.2% conversion efficiency. These values are substantially higher than those of reported so far for both agarophytes and carrageenophytes. It was also confirmed that enzyme can be used twice without compromising on the saccharification efficiency. The findings of this study reveal that Ulva can be a potential feedstock for bioethanol production.

  4. In vitro antioxidant and antimicrobial activities of two Hawaiian marine Limu: Ulva fasciata (Chlorophyta) and Gracilaria salicornia (Rhodophyta).


    Vijayavel, Kannappan; Martinez, Jonathan A


    The antioxidant and antimicrobial properties of two Hawaiian marine algae (Ulva fasciata and Gracilaria salicornia) were evaluated. Ethanolic extracts of these two algae exhibited intracellular reactive 1,1-diphenyl-2-picrylhydrazyl, 2,2'-azino-bis(3-ethylbenzthiazoline)-6-sulfonic radical, nitric oxide, superoxide radical, and hydroxyl radical scavenging activities. In addition to the antioxidant activity these algae possessed appreciable antimicrobial activity and total phenolic contents. The overall results have established that these two marine algae could be used to derive bioactive compounds for a possible role as nutraceutical agents.

  5. Development and application of a marine sediment pore-water toxicity test using Ulva fasciata zoospores

    SciTech Connect

    Hooten, R.L.; Carr, R.S.


    An acute (96 h) pore-water toxicity test protocol using germination and growth of Ulva fasciata zoospores as endpoints was developed to test the toxicity of marine and estuarine sediment pore-water samples. Tests with an organic toxicant (sodium dodecyl sulfate; SDS), three metals (Cd, Cu, and Zn), and ammonia (NH{sub 3}) were conducted to determine zoospore sensitivity. Zoospore germination and gametophyte growth were as sensitive to SDS as sea urchin (Arbacia punctulata) fertilization and embryological development. Zoospore sensitivity to metals was greater than or comparable to that of adult macroalgae. Zoospores were less sensitive to NH{sub 3} than were other commonly used toxicity test organisms. Test results using this algal assay with sediment pore-water samples with high NH{sub 3} concentrations were compared with results from sea urchin fertilization and embryological development tests for the same samples. Ulva fasciata zoospore germination was not affected by samples with high NH{sub 3} concentrations that were toxic in both sea urchin tests. Zoospore tolerance of NH{sub 3} and sensitivity to other contaminants indicate that their response may be useful in toxicity identification evaluation studies with pore-water samples that contain high concentrations of unionized NH{sub 3}.

  6. Development and application of a marine sediment pore-water toxicity test using Ulva fasciata zoospores

    USGS Publications Warehouse

    Hooten, R.L.; Carr, R.S.


    An acute (96 h) pore-water toxicity test protocol using germination and growth of Ulva fasciata zoospores as endpoints was developed to test the toxicity of marine and estuarine sediment pore-water samples. Tests with an organic toxicant (sodium dodecyl sulfate; SDS), three metals (Cd, Cu, and Zn), and ammonia (NH3) were conducted to determine zoospore sensitivity. Zoospore germination and gametophyte growth were as sensitive to SDS as sea urchin (Arbacia punctulata) fertilization and embryological development. Zoospore sensitivity to metals was greater than or comparable to that of adult macroalgae. Zoospores were less sensitive to NH3 than were other commonly used toxicity test organisms. Test results using this algal assay with sediment pore-water samples with high NH3 concentrations were compared with results from sea urchin fertilization and embryological development tests for the same samples. Ulva fasciata zoospore germination was not affected by samples with high NH3 concentrations that were toxic in both sea urchin tests. Zoospore tolerance of NH3 and sensitivity to other contaminants indicate that their response may be useful in toxicity identification evaluation studies with pore-water samples that contain high concentrations of unionized NH3.

  7. Effects of partial desulfation on antioxidant and inhibition of DLD cancer cell of Ulva fasciata polysaccharide.


    Shao, Ping; Pei, Yaping; Fang, Zhongxian; Sun, Peilong


    Ulva fasciata belonging to the family Ulvaceae, commonly known as 'sea lettuce', is an abundantly growing green seaweed in coastal seashore of South China. Three different molecular weight sulfated polysaccharides (UFP1, UFP2 and UFP3) were extracted and separated from U. fasciata by hot water extraction and ultrafiltration. The three native UFP fractions had partial desulfurization by solvolytic desulfation respectively and the effect of sulfate content on the exhibition of the antioxidant and anti-tumor capacities had been evaluated and compared. The results showed that each native polysaccharide (UFP1, UFP2, UFP3) with high sulfate content exhibited better antioxidant activities compared with the partial desulfated polysaccharides (DS-UFP1, DS-UFP2, DS-UFP3). Specifically, UFP2 with relatively high sulfate content, molecular weight and uronic acid content had consistently excellent antioxidant performances. However, UFP2 demonstrated the minimal inhibitory effects on growth of DLD intestinal cancer cells. Instead, DS-UFP3 with the lowest sulfate content but highest uronic acid content and molecular weight exhibited the best antitumor activity.

  8. Bacterial extracellular polymeric substances and their effect on settlement of zoospore of Ulva fasciata.


    Singh, Ravindra Pal; Shukla, Mahendra K; Mishra, Avinash; Reddy, C R K; Jha, Bhavanath


    The extracellular polymeric substances (EPSs) secreted by Bacillus flexus (GU592213) were estimated to have the molecular weight of approximately 1528 and 33,686 kDa with the elemental composition of Na, P, Mg, C, O, Cl and S. The (1)H NMR and FT-IR analysis of EPS confirmed the presence of different aliphatic and aromatic groups. The EPS was amorphous in nature with an average particle size of 13.969 μm (d 0.5) and roughness of 193 nm. The GC-MS analysis has revealed different monosaccharides such as fucose, ribose, xylose, galactose, mannose and glucose. Oligo and polysaccharides were detected with MALDI TOF-TOF MS. The bacterial EPS for the first time tested as a natural substratum for settle of zoospores of Ulva fasciata by incubating for various durations ranging from 2h to 48 h. The zoospore settlement on EPS coated cover slips progressively increased with incubation time in axenic cultures over controls. The EPS, thus investigated in this study was found to facilitate the primary settlement of spores that play crucial role in recruitment of macroalgal communities in coastal environment including intertidal regions. PMID:23201741

  9. Influences of Ulva fasciata polysaccharide on the rheology and stabilization of cinnamaldehyde emulsions.


    Shao, Ping; Shao, Jiamei; Jiang, Yike; Sun, Peilong


    Emulsifying properties of water soluble polysaccharides from Ulva fasciata (UFP) were evaluated in cinnamaldehyde/water emulsions in terms of droplet size distribution, rheological properties, visual phase separation, and zeta-potential. The cinnamaldehyde/water (10%, wt/wt) emulsions were formulated and stabilized by different concentrations of UFP (0.1-4%, wt/wt). The obtained emulsions showed monomodal droplet size distributions with average droplet size (D[3,2]) below 1.0μm, when 3% (wt/wt) UFP was added as the emulsifying agent under a homogenization pressure of 75MPa. The rheological properties and zeta-potential of the emulsions appeared to be dependent on the UFP concentration. Furthermore, the UFP exhibited better emulsifying and stabilizing properties in the investigated system when compared to other commercial polysaccharides of gum Arabic and gum Ghatti. The results also suggested that the emulsifying and stabilizing mechanism of the UFP may not only be ascribed to its surface-active protein moiety, but also to the hydrophobicity of the polysaccharide itself. These findings provided a theoretical basis for potential utilization of UFP as a novel hydrocolloid emulsifying agent. PMID:26453847

  10. Gas Chromatography-Mass Spectrometry Analysis of Ulva fasciata (Green Seaweed) Extract and Evaluation of Its Cytoprotective and Antigenotoxic Effects.


    Rodeiro, Idania; Olguín, Sitlali; Santes, Rebeca; Herrera, José A; Pérez, Carlos L; Mangas, Raisa; Hernández, Yasnay; Fernández, Gisselle; Hernández, Ivones; Hernández-Ojeda, Sandra; Camacho-Carranza, Rafael; Valencia-Olvera, Ana; Espinosa-Aguirre, Jesús Javier


    The chemical composition and biological properties of Ulva fasciata aqueous-ethanolic extract were examined. Five components were identified in one fraction prepared from the extract by gas chromatography-mass spectrometry, and palmitic acid and its ethyl ester accounted for 76% of the total identified components. Furthermore, we assessed the extract's antioxidant properties by using the DPPH, ABTS, and lipid peroxidation assays and found that the extract had a moderate scavenging effect. In an experiment involving preexposition and coexposition of the extract (1-500 µg/mL) and benzo[a]pyrene (BP), the extract was found to be nontoxic to C9 cells in culture and to inhibit the cytotoxicity induced by BP. As BP is biotransformed by CYP1A and CYP2B subfamilies, we explored the possible interaction of the extract with these enzymes. The extract (25-50 µg/mL) inhibited CYP1A1 activity in rat liver microsomes. Analysis of the inhibition kinetics revealed a mixed-type inhibitory effect on CYP1A1 supersome. The effects of the extract on BP-induced DNA damage and hepatic CYP activity in mice were also investigated. Micronuclei induction by BP and liver CYP1A1/2 activities significantly decreased in animals treated with the extract. The results suggest that Ulva fasciata aqueous-ethanolic extract inhibits BP bioactivation and it may be a potential chemopreventive agent. PMID:26612994

  11. Gas Chromatography-Mass Spectrometry Analysis of Ulva fasciata (Green Seaweed) Extract and Evaluation of Its Cytoprotective and Antigenotoxic Effects

    PubMed Central

    Rodeiro, Idania; Olguín, Sitlali; Santes, Rebeca; Herrera, José A.; Pérez, Carlos L.; Mangas, Raisa; Hernández, Yasnay; Fernández, Gisselle; Hernández, Ivones; Hernández-Ojeda, Sandra; Camacho-Carranza, Rafael; Valencia-Olvera, Ana; Espinosa-Aguirre, Jesús Javier


    The chemical composition and biological properties of Ulva fasciata aqueous-ethanolic extract were examined. Five components were identified in one fraction prepared from the extract by gas chromatography-mass spectrometry, and palmitic acid and its ethyl ester accounted for 76% of the total identified components. Furthermore, we assessed the extract's antioxidant properties by using the DPPH, ABTS, and lipid peroxidation assays and found that the extract had a moderate scavenging effect. In an experiment involving preexposition and coexposition of the extract (1–500 µg/mL) and benzo[a]pyrene (BP), the extract was found to be nontoxic to C9 cells in culture and to inhibit the cytotoxicity induced by BP. As BP is biotransformed by CYP1A and CYP2B subfamilies, we explored the possible interaction of the extract with these enzymes. The extract (25–50 µg/mL) inhibited CYP1A1 activity in rat liver microsomes. Analysis of the inhibition kinetics revealed a mixed-type inhibitory effect on CYP1A1 supersome. The effects of the extract on BP-induced DNA damage and hepatic CYP activity in mice were also investigated. Micronuclei induction by BP and liver CYP1A1/2 activities significantly decreased in animals treated with the extract. The results suggest that Ulva fasciata aqueous-ethanolic extract inhibits BP bioactivation and it may be a potential chemopreventive agent. PMID:26612994

  12. Screening and isolation of the algicidal compounds from marine green alga Ulva intestinalis

    NASA Astrophysics Data System (ADS)

    Sun, Xue; Jin, Haoliang; Zhang, Lin; Hu, Wei; Li, Yahe; Xu, Nianjun


    Twenty species of seaweed were collected from the coast of Zhejiang, China, extracted with ethanol, and screened for algicidal activity against red tide microalgae Heterosigma akashiwo and Prorocentrum micans. Inhibitory effects of fresh and dried tißsues of green alga Ulva intestinalis were assessed and the main algicidal compounds were isolated, purified, and identified. Five seaweed species, U. intestinalis, U. fasciata, Grateloupia romosissima, Chondria crassicaulis, and Gracilariopsis lemaneiformis, were investigated for their algicidal activities. Fresh tissues of 8.0 and 16.0 mg/mL of U. intestinalis dissolved in media significantly inhibited growth of H. akashiwo and P. micans, respectively. Dried tissue and ethyl acetate (EtOAc) extracts of U. intestinalis at greater than 1.2 and 0.04 mg/mL, respectively, were fatal to H. akashiwo, while its water and EtOAc extracts in excess of 0.96 and 0.32 mg/mL, respectively, were lethal to P. micans. Three algicidal compounds in the EtOAc extracts were identified as 15-ethoxy-(6z,9z,12z)-hexadecatrienoic acid (I), (6E,9E,12E)-(2-acetoxy- β-D-glucose)-octadecatrienoic acid ester (II) and hexadecanoic acid (III). Of these, compound II displayed the most potent algicidal activity with IC50 values of 4.9 and 14.1 µg/mL for H. akashiwo and P. micans, respectively. Compound I showed moderate algicidal activity with IC50 values of 13.4 and 24.7 µg/mL for H. akashiwo and P. micans, respectively. These findings suggested that certain macroalgae or products therefrom could be used as effective biological control agents against red tide algae.

  13. Sodium and potassium uptake of Ulva - application of marine macro-algae for space agriculture

    NASA Astrophysics Data System (ADS)

    Yamashita, Masamichi; Tomita-Yokotani, Kaori; Sawaki, Nanase; Notoya, Masahiro; Hashimoto, Hirofumi

    The treatment of sodium, Na, and potassium, K, presents a challenge in space agriculture material recycling, as humans require Na and plants cannot grow at high Na concentrations. Hence, we are proposing the use of marine macro-algae to harvest K and other minerals from composted human waste. Ulva was selected for this feasibility study, since it tolerates a wide range of salinity levels. Growth capability of Ulva was examined under various total salinity levels and proportions of Na and K in the incubation medium. A homeostatic feature of Ulva was found in its intra-cellular concentration of Na and K, and in the intra-cellular ratio between Na and K (at 0.58 ± 0.30, lower than that of human metabolic waste). Intracellular concentration of K in Ulva is 20 times higher than seawater. Because of these characteristics, Ulva is a good candidate species for space agriculture.

  14. Sodium and potassium uptake of Ulva - Application of marine macro-algae for space agriculture

    NASA Astrophysics Data System (ADS)

    Yamashita, M.; Tomita-Yokotani, K.; Hashimoto, H.; Sawaki, N.; Notoya, M.


    The treatment of sodium, Na, and potassium, K, presents a challenge in space agriculture material recycling, as humans require Na and plants cannot grow at high Na concentrations. Hence, we are proposing the use of marine macro-algae to harvest K and other minerals from composted human waste. Ulva was selected for this feasibility study, since it tolerates a wide range of salinity levels. Growth capability of Ulva was examined under various total salinity levels and proportions of Na and K in the incubation medium. A homeostatic feature of Ulva was found in its intra-cellular concentration of Na and K, and in the intra-cellular ratio between Na and K (at 0.58 ± 0.30, lower than that of human metabolic waste). Intracellular concentration of K in Ulva is 20 times higher than seawater. Because of these characteristics, Ulva is a good candidate species for space agriculture.

  15. Does the abundance of girellids and kyphosids correlate with cover of the palatable green algae, Ulva spp.? A test on temperate rocky intertidal reefs.


    Ferguson, A M; Harvey, E S; Rees, M J; Knott, N A


    This study assessed whether the abundance of girellids and kyphosids was related to cover of the palatable green algae, Ulva australis and Ulva compressa, on rocky intertidal reefs in Jervis Bay, New South Wales, Australia. No relationship was found between Ulva spp. cover and abundance of Girella tricuspidata, Girella elevata and Kyphosus sydneyanus during a period of relatively low Ulva spp. cover (i.e. February 2011 to March 2011), but during a period of significantly higher Ulva spp. cover (i.e. October 2011 to November 2011) there was a strong correlation between Ulva spp. cover and G. tricuspidata abundance. Spatial analysis indicated that the abundance of G. tricuspidata was consistent across time, suggesting G. tricuspidata were not moving between reefs in response to variation in Ulva spp. cover between periods but rather that large schools of G. tricuspidata resided on reefs that had relatively higher Ulva spp. cover at certain times of the year. PMID:25557432

  16. Production of recombinant protein in Escherichia coli cultured in extract from waste product alga, Ulva lactuca.


    Rechtin, Tammy M; Hurst, Matthew; Potts, Tom; Hestekin, Jamie; Beitle, Robert; McLaughlin, John; May, Peter


    This study examined the potential for waste product alga, Ulva lactuca, to serve as a media component for recombinant protein production in Escherichia coli. To facilitate this investigation, U. lactuca harvested from Jamaica Bay was dried, and nutrients acid extracted for use as a growth media. The E. coli cell line BL21(DE3) was used to assess the effects on growth and production of recombinant green fluorescent protein (GFP). This study showed that media composed of acid extracts without further nutrient addition maintained E. coli growth and recombinant protein production. Extracts made from dried algae lots less than six-months-old were able to produce two-fold more GFP protein than traditional Lysogeny Broth media. PMID:24799463

  17. A novel ether-linked phytol-containing digalactosylglycerolipid in the marine green alga, Ulva pertusa

    SciTech Connect

    Ishibashi, Yohei; Nagamatsu, Yusuke; Miyamoto, Tomofumi; Matsunaga, Naoyuki; Okino, Nozomu; Yamaguchi, Kuniko; Ito, Makoto


    Highlights: • Alkaline-resistant galactolipid, AEGL, was found in marine algae. • The sugar moiety of AEGL is identical to that of digalactosyldiacylglycerol. • AEGL is the first identified glycolipid that possesses an ether-linked phytol. • AEGL is ubiquitously distributed in green, red and brown marine algae. - Abstract: Galactosylglycerolipids (GGLs) and chlorophyll are characteristic components of chloroplast in photosynthetic organisms. Although chlorophyll is anchored to the thylakoid membrane by phytol (tetramethylhexadecenol), this isoprenoid alcohol has never been found as a constituent of GGLs. We here described a novel GGL, in which phytol was linked to the glycerol backbone via an ether linkage. This unique GGL was identified as an Alkaline-resistant and Endogalactosylceramidase (EGALC)-sensitive GlycoLipid (AEGL) in the marine green alga, Ulva pertusa. EGALC is an enzyme that is specific to the R-Galα/β1-6Galβ1-structure of galactolipids. The structure of U. pertusa AEGL was determined following its purification to 1-O-phytyl-3-O-Galα1-6Galβ1-sn-glycerol by mass spectrometric and nuclear magnetic resonance analyses. AEGLs were ubiquitously distributed in not only green, but also red and brown marine algae; however, they were rarely detected in terrestrial plants, eukaryotic phytoplankton, or cyanobacteria.

  18. Some properties and amino acid sequence of plastocyanin from a green alga, Ulva arasakii.


    Yoshizaki, F; Fukazawa, T; Mishina, Y; Sugimura, Y


    Plastocyanin was purified from a multicellular, marine green alga, Ulva arasakii, by conventional methods to homogeneity. The oxidized plastocyanin showed absorption maxima at 252, 276.8, 460, 595.3, and 775 nm, and shoulders at 259, 265, 269, and 282.5 nm; the ratio A276.8/A595.3 was 1.5. The midpoint redox potential was determined to be 0.356 V at pH 7.0 with a ferri- and ferrocyanide system. The molecular weight was estimated to be 10,200 and 11,000 by SDS-PAGE and by gel filtration, respectively. U. arasakii also has a small amount of cytochrome c6, like Enteromorpha prolifera. The amino acid sequence of U. arasakii plastocyanin was determined by Edman degradation and by carboxypeptidase digestion of the plastocyanin, six tryptic peptides, and five staphylococcal protease peptides. The plastocyanin contained 98 amino acid residues, giving a molecular weight of 10,236 including one copper atom. The complete sequence is as follows: AQIVKLGGDDGALAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETV VRKLSTPGVY G VYCEPHAGAGMKMTITVQ. The sequence of U. arasakii plastocyanin is closet to that of the E. prolifera protein (85% homology). A phylogenetic tree of five algal and two higher plant plastocyanins was constructed by comparing the amino acid differences. The branching order is considered to be as follows: a blue-green alga, unicellular green algae, multicellular green algae, and higher plants. PMID:2509442

  19. Identification of copper-induced genes in the marine alga Ulva compressa (Chlorophyta).


    Contreras-Porcia, Loretto; Dennett, Geraldine; González, Alberto; Vergara, Eva; Medina, Cristóbal; Correa, Juan A; Moenne, Alejandra


    In order to identify genes/proteins involved in copper tolerance, the marine alga Ulva compressa was cultivated with 10 μM copper for 3 days. The activities of antioxidant enzymes ascorbate peroxidase (AP), peroxiredoxin (PRX), thioredoxin (TRX), and glutathione-S-transferase (GST) and the level of lipoperoxides were determined in the alga cultivated with and without copper addition. Antioxidant enzyme activities and lipoperoxides level increased in response to copper excess, indicating that the alga was under oxidative stress. A cDNA library was prepared using U. compressa cultivated with 10 μM copper for 3 days. A total of 3 × 10(4) clones were isolated and 480 clones were sequenced, resulting in 235 non-redundant ESTs, of which 104 encode proteins with known functions. Among them, we identified proteins involved in (1) antioxidant metabolism such as AP, PRX, TRX, GST, and metalothionein (MET), (2) signal transduction, such as calmodulin (CAM), (3) calcium-dependent protein kinase (CDPK) and nucleoside diphosphate kinase (NDK), (4) gene expression, (5) protein synthesis and degradation, and (6) chloroplast and mitochondria electron transport chains. Half of the identified proteins are potentially localized in organelles. The relative level of 18 genes, including those coding for AP, PRX, TRX, GST, MET, CAM, CDPK, and NDK were determined by quantitative RT-PCR in the alga cultivated with 10 μM copper for 0 to 7 days. Transcript levels increased in response to copper stress and most of them reached a maximum at days 3 and 5. Thus, the selected genes are induced by copper stress and they are probably involved in copper acclimation and tolerance.

  20. Acute toxicity of live and decomposing green alga Ulva ( Enteromorpha) prolifera to abalone Haliotis discus hannai

    NASA Astrophysics Data System (ADS)

    Wang, Chao; Yu, Rencheng; Zhou, Mingjiang


    From 2007 to 2009, large-scale blooms of green algae (the so-called "green tides") occurred every summer in the Yellow Sea, China. In June 2008, huge amounts of floating green algae accumulated along the coast of Qingdao and led to mass mortality of cultured abalone and sea cucumber. However, the mechanism for the mass mortality of cultured animals remains undetermined. This study examined the toxic effects of Ulva ( Enteromorpha) prolifera, the causative species of green tides in the Yellow Sea during the last three years. The acute toxicity of fresh culture medium and decomposing algal effluent of U. prolifera to the cultured abalone Haliotis discus hannai were tested. It was found that both fresh culture medium and decomposing algal effluent had toxic effects to abalone, and decomposing algal effluent was more toxic than fresh culture medium. The acute toxicity of decomposing algal effluent could be attributed to the ammonia and sulfide presented in the effluent, as well as the hypoxia caused by the decomposition process.

  1. Antioxidant capacity, polyphenol content and iron bioavailability from algae (Ulva sp., Sargassum sp. and Porphyra sp.) in human subjects.


    García-Casal, Maria N; Ramírez, José; Leets, Irene; Pereira, Ana C; Quiroga, Maria F


    Marine algae are easily produced and are good sources of Fe. If this Fe is bioavailable, algae consumption could help to combat Fe deficiency and anaemia worldwide. The objective of the present study was to evaluate Fe bioavailability, polyphenol content and antioxidant capacity from three species of marine algae distributed worldwide. A total of eighty-three subjects received maize- or wheat-based meals containing marine algae (Ulva sp., Sargassum sp. and Porphyra sp.) in different proportions (2.5, 5.0 and 7.5 g) added to the water to prepare the dough. All meals administered contained radioactive Fe. Absorption was evaluated calculating radioactive Fe incorporation in subjects' blood. The three species of marine algae were analysed for polyphenol content and reducing power. Algae significantly increased Fe absorption in maize- or wheat-based meals, especially Sargassum sp., due to its high Fe content. Increases in absorption were dose-dependent and higher in wheat- than in maize-based meals. Total polyphenol content was 10.84, 18.43 and 80.39 gallic acid equivalents/g for Ulva sp., Porphyra sp. and Sargassum sp., respectively. The antioxidant capacity was also significantly higher in Sargassum sp. compared with the other two species analysed. Ulva sp., Sargassum sp. and Porphyra sp. are good sources of bioavailable Fe. Sargassum sp. resulted in the highest Fe intake due to its high Fe content, and a bread containing 7.5 g Sargassum sp. covers daily Fe needs. The high polyphenol content found in Sargassum sp. could be partly responsible for the antioxidant power reported here, and apparently did not affect Fe absorption.

  2. Growth Promotion of a Sea Water Algae with Sterile, Ulva pertusa Kjellman, Due to Supplemental Lighting

    NASA Astrophysics Data System (ADS)

    Kosaka, Shinichi; Masuda, Atsunori; Ozawa, Tomoko; Ishiwata, Masaki; Yokoji, Shigemi; Saito, Naoki; Murakami, Katsusuke

    Ulva pertusa is widely used as human food and also to feed cultured fish. U. pertusa is expected to be used as a bio-filter for purification of breeding - circulation water in the terrestrial aquaculture of fish. Insufficient sunshine and lower temperature causes bad commercial production. In order to realize stable cultivation of U. pertusa throughout the year, experiments on the growth of a sea water algae with sterile, U. pertusa Kjellman, due to supplemental lighting were performed. An illuminance of 1×104 lx in the treatment areas and 2×104 lx in the control, when the illuminance was 8×104 lx in the greenhouse. Artificial lighting was added during the daytime in treatments 1˜3. The mounting height of each luminaire was adjusted to have a PPFD of 140 μmol m-2s-1. Each lamp had the R/FR PF ratio of 3.8, 1.2, 0.8. Considering of relationship between the growth and cumulative PPFD including daylight and supplemental lighting, the growth of the experimental area were superior to the control area. U. pertusa can be grown with warm sea water using supplemental lighting. But under the growth environment with daylight and supplemental lighting together, it is difficult to recognize whether the R/FR PF ratio influences photomorphogenesis.

  3. Green alga Ulva pertusa--a new source of bioactive compounds with antialgal activity.


    Ying-ying, Sun; Hui, Wang; Gan-lin, Guo; Yin-fang, Pu; Bin-lun, Yan; Chang-hai, Wang


    We tested the effects of solvent fractions (FA, FB, FC, and FD), which partitioned by liquid-liquid extraction from the methanol extract of Ulva pertusa, on the growth of red tide microalgae (Karenia mikimitoi, Skeletonema costatum, Alexandrium tamarense, Heterosigma akashiwo, Prorocentrum donghaiense), and FA, FB, and FC exhibited significantly antialgal activity. The chemical constituent analysis showed the existence of bioactive compounds such as phenols and alkaloids. Further, four solvent fractions were applied to silica gel column and repeated preparative TLC to produce 13 samples and their purity qualified as thin-layer chromatographic grade. Among these purified samples, FA111, FB411, FC411, FD111, and FD211 exhibited stronger antialgal activity. Furthermore, their functional groups were analyzed by colorimetric methods and UV spectra data. FD111 and FD211 were temptatively identified as alkaloids; the others were initially identified as phenolic acids. This is a preliminary study and the structure identification of these purified samples requires further investigation. While concentration of these purified samples in this algae was very small, they showed excellent effects against red tide microalgae. PMID:25724801

  4. Ornithinimicrobium algicola sp. nov., a marine actinobacterium isolated from the green alga of the genus Ulva.


    Ramaprasad, E V V; Sasikala, Ch; Ramana, Ch V


    A Gram-staining-positive, non-spore-forming actinobacterium, strain JC311T, isolated from marine green alga of the genus Ulva was studied to examine its taxonomic position. On the basis of the 16S rRNA gene sequence similarity studies, strain JC311T was shown represent a member of the genus Ornithinimicrobium and to be closely related to Ornithinimicrobium pekingense LW6T (98.6 %), Ornithinimicrobium kibberense K22-20T (98.3 %) and Ornithinimicrobium humiphilum HKI 0124T (98.1 %). However, strain JC311T showed less than 22 % DNA reassociation value (based on DNA-DNA hybridization) with O. pekingense JCM14001T, O. kibberense JCM12763T and O. humiphilum KCTC19901T. The predominant menaquinone of strain JC311T was MK-8(H4). The peptidoglycan contained l-ornithine as the diagnostic diamino acid. The polar lipid profile consisted of the lipids diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol, glycophospholipid, aminophospholipid, phospholipid and two unidentified lipids. The major fatty acids iso-C16 : 0, iso-C15 : 0, iso-C17 : 1ω9c and iso-C17 : 0 were consistent with the fatty acid patterns reported for members of the genus Ornithinimicrobium. The distinct genomic, morphological, physiological and chemotaxonomic differences from the previously described taxa support the classification of JC311T as a representative of a novel species of the genus Ornithinimicrobium, for which we propose the name Ornithinimicrobium algicola sp. nov., with the type strain JC311T ( = KCTC 39559 T =  LMG 28808T).

  5. Copper-induced synthesis of ascorbate, glutathione and phytochelatins in the marine alga Ulva compressa (Chlorophyta).


    Mellado, Macarena; Contreras, Rodrigo A; González, Alberto; Dennett, Geraldine; Moenne, Alejandra


    In order to analyze the synthesis of antioxidant and heavy metal-chelating compounds in response to copper stress, the marine alga Ulva compressa (Chlorophyta) was exposed to 10 μM copper for 7 days and treated with inhibitors of ASC synthesis, lycorine, and GSH synthesis, buthionine sulfoximine (BSO). The levels of ascorbate, in its reduced (ASC) and oxidized (DHA) forms, glutathione, in its reduced (GSH) and oxidized (GSSG) forms, and phytochelatins (PCs) were determined as well as activities of enzymes involved in ASC synthesis, L-galactose dehydrogenase (GDH) and L-galactono 1,4 lactone dehydrogenase (GLDH), and in GSH synthesis, γ-glutamylcysteine synthase (γ-GCS) and glutathione synthase (GS). The level of ASC rapidly decreased to reach a minimum at day 1 that remained low until day 7, DHA decreased until day 1 but slowly increased up to day 7 and its accumulation was inhibited by lycorine. In addition, GSH level increased to reach a maximal level at day 5 and GSSG increased up to day 7 and their accumulation was inhibited by BSO. Activities of GDH and GLDH increased until day 7 and GLDH was inhibited by lycorine. Moreover, activities of γ-GCS and GS increased until day 7 and γ-GCS was inhibited by BSO. Furthermore, PC2, PC3 and PC4, increased until day 7 and their accumulation was inhibited by BSO. Thus, copper induced the synthesis of ascorbate, glutathione and PCs in U. compressa suggesting that these compounds are involved in copper tolerance. Interestingly, U. compressa is, until now, the only ulvophyte showing ASC, GSH and PCs synthesis in response to copper excess.

  6. Biosorption of copper, cobalt and nickel by marine green alga Ulva reticulata in a packed column.


    Vijayaraghavan, K; Jegan, J; Palanivelu, K; Velan, M


    Biosorption of copper, cobalt and nickel by marine green alga Ulva reticulata were investigated in a packed bed up-flow column. The experiments were conducted to study the effect of important design parameters such as bed height and flow rate. At a bed height of 25 cm, the metal-uptake capacity of U. reticulata for copper, cobalt and nickel was found to be 56.3+/-0.24, 46.1+/-0.07 and 46.5+/-0.08 mgg(-1), respectively. The Bed Depth Service Time (BDST) model was used to analyze the experimental data. The computed sorption capacity per unit bed volume (N0) was 2580, 2245 and 1911 mgl(-1) for copper, cobalt and nickel, respectively. The rate constant (K(a)) was recorded as 0.063, 0.081 and 0.275 lmg(-1)h(-1) for copper, cobalt and nickel, respectively. In flow rate experiments, the results confirmed that the metal uptake capacity and the metal removal efficiency of U. reticulata decreased with increasing flow rate. The Thomas model was used to fit the column biosorption data at different flow rates and model constants were evaluated. The column regeneration studies were carried out for three sorption-desorption cycles. The elutant used for the regeneration of the biosorbent was 0.1 M CaCl2 at pH 3 adjusted using HCl. For all the metal ions, a decreased breakthrough time and an increased exhaustion time were observed as the regeneration cycles progressed, which also resulted in a broadened mass transfer zone. The pH variations during both sorption and desorption process have been reported. PMID:15924962

  7. Sequestration of Dimethylsulfoniopropionate (DMSP) and Acrylate from the Green Alga Ulva Spp. by the Sea Hare Aplysia juliana.


    Kamio, Michiya; Koyama, Mao; Hayashihara, Nobuko; Hiei, Kaori; Uchida, Hajime; Watanabe, Ryuichi; Suzuki, Toshiyuki; Nagai, Hiroshi


    Many animals sequester secondary metabolites from their food. In this study, we hypothesized that the sea hare Aplysia juliana sequesters secondary metabolites from green algae. To test this, we performed NMR-based metabolomic analysis on methanol extracts of Ulva spp. and A. juliana. Another sea hare, Bursatella leachii, which mainly feeds on another type of alga, was added to this analysis as an outgroup. Two body parts of the sea hares, skin and digestive glands, were used in the analysis. Principal component analysis (PCA) on the NMR data of these samples detected biomarkers common to Ulva spp. and A. juliana. This result indicates sequestration of secondary metabolites by the herbivore from the plants. The biomarker metabolites were identified as dimethylsulfoniopropionate (DMSP) and acrylate, which were concentrated in skin of A. juliana and were released from the skin of live animals when physically stressed. Thus, our NMR-based metabolomic study revealed sequestration of algae-derived secondary metabolites in skin of A. Juliana, and in the discharge of the metabolites under conditions that mimic attack by predators. PMID:27179528

  8. Flat-plate techniques for measuring reflectance of macro-algae (Ulva curvata)

    USGS Publications Warehouse

    Ramsey, Elijah W.; Rangoonwala, Amina; Thomsen, Mads Solgaard; Schwarzschild, Arthur


    We tested the consistency and accuracy of flat-plate spectral measurements (400–1000 nm) of the marine macrophyte Ulva curvata. With sequential addition of Ulva thallus layers, the reflectance progressively increased from 6% to 9% with six thalli in the visible (VIS) and from 5% to 19% with ten thalli in the near infrared (NIR). This progressive increase was simulated by a mathematical calculation based on an Ulva thallus diffuse reflectance weighted by a transmittance power series. Experimental and simulated reflectance differences that were particularly high in the NIR most likely resulted from residual water and layering structure unevenness in the experimental progression. High spectral overlap existed between fouled and non-fouled Ulva mats and the coexistent lagoon mud in the VIS, whereas in the NIR, spectral contrast was retained but substantially dampened by fouling.

  9. The sporulation of the green alga Ulva prolifera is controlled by changes in photosynthetic electron transport chain

    PubMed Central

    Wang, Hui; Lin, Apeng; Gu, Wenhui; Huan, Li; Gao, Shan; Wang, Guangce


    Sporulation and spore release are essential phases of the life cycle in algae and land plants. Ulva prolifera, which is an ideal organism for studying sporulation and spore release, was used as the experimental material in the present study. The determination of photosynthetic parameters, combined with microscopic observation, treatment with photosynthetic inhibitors, limitation of carbon acquisition, and protein mass spectrometry, was employed in this experiment. Cycle electron transport (CEF) was found enhanced at the onset of sporangia formation. The inhibition effect of dibromothymoquinone (DBMIB) towards sporulation was always strong during the sporulation process whereas the inhibition effect of 3-(3′,4′-dichlorophenyl)-1,1-dimethylurea (DCMU) was continuously declined accompanied with the progress of sporulation. The changes of photosynthesis resulted from the limitation of CO2 acquisition could stimulate sporulation onset. Quantitative protein analysis showed that enzymes involved in carbon fixation, including RUBISCO and pyruvate orthophosphate dikinase, declined during sporogenesis, while proteins involved in sporulation, including tubulin and centrin, increased. These results suggest that enhanced cyclic electron flow (CEF) and oxidation of the plastoquinone pool are essential for sporangia formation onset, and changes in photosynthetic electron transport chain have significant impacts on sporulation of the green algae. PMID:27102955

  10. The sporulation of the green alga Ulva prolifera is controlled by changes in photosynthetic electron transport chain.


    Wang, Hui; Lin, Apeng; Gu, Wenhui; Huan, Li; Gao, Shan; Wang, Guangce


    Sporulation and spore release are essential phases of the life cycle in algae and land plants. Ulva prolifera, which is an ideal organism for studying sporulation and spore release, was used as the experimental material in the present study. The determination of photosynthetic parameters, combined with microscopic observation, treatment with photosynthetic inhibitors, limitation of carbon acquisition, and protein mass spectrometry, was employed in this experiment. Cycle electron transport (CEF) was found enhanced at the onset of sporangia formation. The inhibition effect of dibromothymoquinone (DBMIB) towards sporulation was always strong during the sporulation process whereas the inhibition effect of 3-(3',4'-dichlorophenyl)-1,1-dimethylurea (DCMU) was continuously declined accompanied with the progress of sporulation. The changes of photosynthesis resulted from the limitation of CO2 acquisition could stimulate sporulation onset. Quantitative protein analysis showed that enzymes involved in carbon fixation, including RUBISCO and pyruvate orthophosphate dikinase, declined during sporogenesis, while proteins involved in sporulation, including tubulin and centrin, increased. These results suggest that enhanced cyclic electron flow (CEF) and oxidation of the plastoquinone pool are essential for sporangia formation onset, and changes in photosynthetic electron transport chain have significant impacts on sporulation of the green algae. PMID:27102955

  11. Study of the kinetics and the adsorption isotherm of cadmium(II) from aqueous solution using green algae (Ulva lactuca) biomass.


    Asnaoui, H; Laaziri, A; Khalis, M


    Batch experiments were conducted to study the adsorption of hazardous cadmium onto low-cost algae biomass in aqueous solution with respect to concentration of adsorbate, adsorbent dosage, contact time, solution pH and temperature. Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms and the isotherm constants were determined. The activation energy of adsorption was also evaluated for the adsorption of cadmium onto Ulva lactuca biomass. Experimental data were tested in terms of biosorption kinetics using pseudo-first-order and pseudo-second-order kinetic models. The results showed that the biosorption processes of Cd(II) followed well pseudo-second-order kinetics. Langmuir and Freundlich models were applied to describe the biosorption isotherm of the metal ions by Ulva lactuca biomass. Langmuir model fitted the equilibrium data better than the Freundlich isotherm. The biosorption capacity of Ulva lactuca biomass for cadmium was found to be 3.02 mg/g at pH 5.60 min equilibrium time and 20 °C. The mean free energy which was calculated was 6.24 kJ/mol for Cd(II) biosorption, which shows that the adsorption is physical. The calculated thermodynamic parameters (ΔG0, ΔH0 and ΔS0) showed that the biosorption of Cd(II) onto Ulva lactuca biomass was feasible, spontaneous and exothermic under examined conditions. The results indicate that algae Ulva lactuca could be employed as a low-cost material for the removal of metal ions from aqueous solution. PMID:26524441

  12. Isolation, purification, and identification of antialgal substances in green alga Ulva prolifera for antialgal activity against the common harmful red tide microalgae.


    Sun, Ying-ying; Wang, Hui; Guo, Gan-lin; Pu, Yin-fang; Yan, Bin-lun; Wang, Chang-hai


    Ten compounds (1~10) were successfully isolated from green algae Ulva prolifera through the combination of silica gel column chromatography, Sephadex LH-20 column chromatography and repeated preparative thin-layer chromatography. These ten compounds showed antialgal activity against red tide microalgae. Among them, compounds 3, 6, and 7 showed stronger antialgal activity against red tide microalgae. Furthermore, their structure was identified on the basis of spectroscopic data. There are three glycoglycerolipids: 1-O-octadecanoic acid-3-O-β-D-galactopyranosyl glycerol (2), 1-O-palmitoyl-3-O-β-D-galactopyranosyl glycerol (4), and 1-O-palmitoyl-2-O-oleoyl-3-O-β-D-galactopyranosyl glycerol (5); two monoglycerides: glycerol monopalmitate (1), 9-hexadecenoic acid, 2,3-dihydroxypropyl ester (3); two terpenoids: loliolide (6) and lsololiolide (7); one lipid-soluble pigments: zeaxanthin (8); one sterol: cholest-5-en-3-ol (9); and one alkaloid: pyrrolopiperazine-2,5-dione (10). These compounds were isolated from U. prolifera for the first time, and compounds 2, 3, 5, and 8 were isolated from marine macroalgae for the first time.

  13. Phylogeographical structure, distribution and genetic variation of the green algae Ulva intestinalis and U. compressa (Chlorophyta) in the Baltic Sea area.


    Leskinen, E; Alstrom-Rapaport, C; Pamilo, P


    The marine algae Ulva intestinalis and U. compressa are morphologically plastic with many overlapping characters and are therefore difficult to distinguish from each other. The present distribution of U. intestinalis and U. compressa is investigated along the salinity gradient in the Baltic Sea area through analyses of internal transcribed spacer (ITS) sequence data. Also, the amount and distribution of intraspecific genetic polymorphism in the ITS region is studied allowing inferences on the phylogeographical pattern and postglacial recolonization of the Baltic Sea area. The data show that of the two species only U. intestinalis occurs in the Baltic Sea. The distribution of U. compressa is more restricted than previously reported, and it was not found in salinities lower than 15 ppt. All of Scandinavia and the Baltic Sea were covered with ice during the last ice age and the organisms in the Baltic Sea must have colonized the area after the ice had started to melt. The genetic diversity of U. intestinalis and U. compressa in the Baltic Sea and the neighbouring area was found to be reduced compared to that in the British Isles. This reduction may be the result of either a historical reduction of diversity or an adaptation of specific clones to the northern environmental conditions. PMID:15245399

  14. The performance of hybrid titania/silica-derived xerogels as active antifouling/fouling-release surfaces against the marine alga Ulva linza: in situ generation of hypohalous acids.


    Damon, Corey A; Gatley, Caitlyn M; Beres, Joshua J; Finlay, John A; Franco, Sofia C; Clare, Anthony S; Detty, Michael R


    Mixed titania/silica xerogels were prepared using titanium tetraisopropoxide (TTIP) and tetraethoxy orthosilicate (TEOS). Xerogel properties were modified by incorporating n-octyltriethoxysilane (C8). The xerogels catalyze the oxidation of bromide and chloride with hydrogen peroxide (H2O2) to produce hypohalous acids at pH 7 and pH 8. The antifouling/ fouling-release performance of a TTIP/C8/TEOS xerogel in the presence and absence of H2O2 was evaluated for the settlement of zoospores of the marine alga Ulva linza and for the removal of sporelings (young plants). In the absence of H2O2, differences in the settlement of zoospores and removal of sporelings were not significant relative to a titanium-free C8/TEOS xerogel. Addition of H2O2 gave a significant reduction in zoospore settlement and sporeling removal relative to the C8/TEOS xerogel and relative to peroxide-free conditions. The impact of TTIP on xerogel characteristics was evaluated by comprehensive contact angle analysis, scanning electron microscopy, and X-ray photoelectron spectroscopy. PMID:27458654

  15. Photosystem I shows a higher tolerance to sorbitol-induced osmotic stress than photosystem II in the intertidal macro-algae Ulva prolifera (Chlorophyta).


    Gao, Shan; Zheng, Zhenbing; Gu, Wenhui; Xie, Xiujun; Huan, Li; Pan, Guanghua; Wang, Guangce


    The photosynthetic performance of the desiccation-tolerant, intertidal macro-algae Ulva prolifera was significantly affected by sorbitol-induced osmotic stress. Our results showed that photosynthetic activity decreased significantly with increases in sorbitol concentration. Although the partial activity of both photosystem I (PS I) and photosystem II (PS II) was able to recover after 30 min of rehydration, the activity of PS II decreased more rapidly than PS I. At 4 M sorbitol concentration, the activity of PS II was almost 0 while that of PS I was still at about one third of normal levels. Following prolonged treatment with 1 and 2 M sorbitol, the activity of PS I and PS II decreased slowly, suggesting that the effects of moderate concentrations of sorbitol on PS I and PS II were gradual. Interestingly, an increase in non-photochemical quenching occurred under these conditions in response to moderate osmotic stress, whereas it declined significantly under severe osmotic stress. These results suggest that photoprotection in U. prolifera could also be induced by moderate osmotic stress. In addition, the oxidation of PS I was significantly affected by osmotic stress. P700(+) in the thalli treated with high concentrations of sorbitol could still be reduced, as PS II was inhibited by 3-(3,4-dichlorophenyl)-1,1-dimethylurea (DCMU), but it could not be fully oxidized. This observation may be caused by the higher quantum yield of non-photochemical energy dissipation in PS I due to acceptor-side limitation (Y(NA)) during rehydration in seawater containing DCMU.

  16. Seaweed extracts and unsaturated fatty acid constituents from the green alga Ulva lactuca as activators of the cytoprotective Nrf2-ARE pathway.


    Wang, Rui; Paul, Valerie J; Luesch, Hendrik


    Increased amounts of reactive oxygen species (ROS) have been implicated in many pathological conditions, including cancer. The major machinery that the cell employs to neutralize excess ROS is through the activation of the antioxidant-response element (ARE) that controls the activation of many phase II detoxification enzymes. The transcription factor that recognizes the ARE, Nrf2, can be activated by a variety of small molecules, most of which contain an α,β-unsaturated carbonyl system. In the pursuit of chemopreventive agents from marine organisms, we built, fractionated, and screened a library of 30 field-collected eukaryotic algae from Florida. An edible green alga, Ulva lactuca, yielded multiple active fractions by ARE-luciferase reporter assay. We isolated three monounsaturated fatty acid (MUFA) derivatives as active components, including a new keto-type C18 fatty acid (1), the corresponding shorter chain C16 acid (2), and an amide derivative (3) of the C18 acid. Their chemical structures were elucidated by NMR and mass spectrometry. All three contain the conjugated enone motif between C7 and C9, which is thought to be responsible for the ARE activity. Subsequent biological studies focused on 1, the most active and abundant ARE activator isolated. C18 acid 1 induced the expression of ARE-regulated cytoprotective genes, including NAD(P)H:quinone oxidoreductase 1, heme oxygenase 1, thioredoxin reductase 1, both subunits of the glutamate-cysteine ligase (catalytic subunit and modifier subunit), and the cystine/glutamate exchange transporter, in IMR-32 human neuroblastoma cells. Its cellular activity requires the presence of Nrf2 and PI3K function, based on RNA interference and pharmacological inhibitor studies, respectively. Treatment with 1 led only to Nrf2 activation, and not the increase in production of NRF2 mRNA. To test its ARE activity and cytoprotective potential in vivo, we treated mice with a single dose of a U. lactuca fraction that was enriched with

  17. Seaweed extracts and unsaturated fatty acid constituents from the green alga Ulva lactuca as activators of the cytoprotective Nrf2–ARE pathway

    PubMed Central

    Wang, Rui; Paul, Valerie J.; Luesch, Hendrik


    Increased amounts of reactive oxygen species (ROS) have been implicated in many pathological conditions, including cancer. The major machinery that the cell employs to neutralize excess ROS is through the activation of the antioxidant-response element (ARE) that controls the activation of many phase II detoxification enzymes. The transcription factor that recognizes the ARE, Nrf2, can be activated by a variety of small molecules, most of which contain an α,β-unsaturated carbonyl system. In the pursuit of chemopreventive agents from marine organisms, we built, fractionated, and screened a library of 30 field-collected eukaryotic algae from Florida. An edible green alga, Ulva lactuca, yielded multiple active fractions by ARE–luciferase reporter assay. We isolated three monounsaturated fatty acid (MUFA) derivatives as active components, including a new keto-type C18 fatty acid (1), the corresponding shorter chain C16 acid (2), and an amide derivative (3) of the C18 acid. Their chemical structures were elucidated by NMR and mass spectrometry. All three contain the conjugated enone motif between C7 and C9, which is thought to be responsible for the ARE activity. Subsequent biological studies focused on 1, the most active and abundant ARE activator isolated. C18 acid 1 induced the expression of ARE-regulated cytoprotective genes, including NAD(P)H:quinone oxidoreductase 1, heme oxygenase 1, thioredoxin reductase 1, both subunits of the glutamate–cysteine ligase (catalytic subunit and modifier subunit), and the cystine/glutamate exchange transporter, in IMR-32 human neuroblastoma cells. Its cellular activity requires the presence of Nrf2 and PI3K function, based on RNA interference and pharmacological inhibitor studies, respectively. Treatment with 1 led only to Nrf2 activation, and not the increase in production of NRF2 mRNA. To test its ARE activity and cytoprotective potential in vivo, we treated mice with a single dose of a U. lactuca fraction that was enriched

  18. Preliminary study on the responses of three marine algae, Ulva pertusa (Chlorophyta), Gelidium amansii (Rhodophyta) and Sargassum enerve (Phaeophyta), to nitrogen source and its availability

    NASA Astrophysics Data System (ADS)

    Liu, Dongyan; Amy, Pickering; Sun, Jun


    An experiment was designed to select economically valuable macroalga species with high nutrient uptake rates. Such species cultured on a large scale could be a potential solution to eutrophication. Three macroalgae species, Ulva pertusa (Chlorophyta), Gelidium amansii (Rhodophyta) and Sargassum enerve (Phaeophyta), were chosen for the experiment because of their economic values and availability. Control and four nitrogen concentrations were achieved by adding NH{4/+} and NO{3/-}. The results indicate that the fresh weights of all species increase faster than that of control after 5 d culture. The fresh weight of Ulva pertusa increases fastest among the 3 species. However, different species show different responses to nitrogen source and its availability. They also show the advantage of using NH{4/+} than using NO{3/-}. U. pertusa grows best and shows higher capability of removing nitrogen at 200µmolL-1, but it has lower economical value. G. amansii has higher economical value but lower capability of removing nitrogen at 200 µmolL-1. The capability of nitrogen assimilation of S. enerve is higher than that of G. amansii at 200µmolL -1, but the former’s increase of fresh weight is lower than those of other two species. Then present preliminary study demonstrates that it is possible to use macroalgae as biofilters and further development of this approach could provide biologically valuable information on the source, fate, and transport of N in marine ecosystems. Caution is needed should we extrapolate these findings to natural environments.

  19. Spectral definition of the macro-algae Ulva curvata in the back-barrier bays of the Eastern Shore of Virginia, USA

    USGS Publications Warehouse

    Ramsey, Elijah W.; Rangoonwala, Amina; Solgaard, Mads; Schwarzchild, Arthur


    We have developed methods to determine the visible (VIS) to near-infrared (NIR) spectral properties of thalli and epiphytes of bloom-forming and green macrophyte Ulva curvata in back-barrier lagoons in Virginia, USA. A 2% increase in NIR thalli reflectance from winter to summer matched the drop in summer NIR transmittance. In contrast, summer and winter VIS reflectance were nearly identical while winter transmittance was 10-20% higher. NIR absorption remained at 5% but VIS absorption increased by 10-20% from winter to summer. Replicate consistency substantiated the high transmittance difference indicating thallus composition changed from summer to winter. Epiphytes increased thallus reflectance and decreased transmittance and exhibited broadband VIS and NIR absorptions in summer and selective peaks in winter. A simulation coupling water extinction with thallus reflectance and transmittance found seven submerged thalli maximized the surface reflectance enhancement.

  20. The influence of elastic modulus and thickness on the release of the soft-fouling green alga Ulva linza (syn. Enteromorpha linza) from poly(dimethylsiloxane) (PDMS) model networks.


    Chaudhury, Manoj K; Finlay, John A; Chung, Jun Young; Callow, Maureen E; Callow, James A


    The effect of modulus and film thickness on the release of adhered spores and sporelings (young plants) of the green fouling alga Ulva (syn. Enteromorpha) was investigated. PDMS elastomers of constant thickness (100 microm) but different elastic moduli were prepared by varying cross-link density with functional silicone oligomers with degrees of polymerization ranging from 18-830. This provided a 50-fold range of modulus values between 0.2 and 9.4 MPa. Three PDMS coatings of different thicknesses were tested at constant elastic modulus (0.8 MPa). The data revealed no significant increase in percentage spore removal except at the lowest modulus of 0.2 MPa although sporelings released more readily at all but the highest modulus. The influence of coating thickness was also greater for the release of sporelings compared to spores. The release data are discussed in the light of fracture mechanics models that have been applied to hard fouling. New concepts appertaining to the release of soft fouling organisms are proposed, which take into account the deformation in the adhesive base of the adherand and deformation of the PDMS film.

  1. Spectral definition of the macro-algae ulva curvata in the back-barrier bays of the eastern shore of Virginia, USA

    USGS Publications Warehouse

    Ramsey, E.; Rangoonwalaj, A.; Thomsen, M.S.; Schwarzschild, A.


    We have developed methods to determine the visible (VIS) to near-infrared (NIR) spectral properties of thalli and epiphytes of bloom-forming and green macro-phyte Ulva curvata in back-barrier lagoons in Virginia, USA. A 2% increase in NIR thalli reflectance from winter to summer (ca. 9.5%) matched the drop in summer NIR transmittance (ca. 90%). In contrast, summer and winter VIS reflectance (reaching 6%) were nearly identical while winter transmittance (ca. 85%) was 10-20% higher. NIR absorption remained at 5% but VIS absorption increased by 10-20% from winter to summer. Replicate consistency substantiated the high transmittance difference indicating thallus composition changed from summer to winter. Epiphytes increased thallus reflectance (

  2. Death by Ulva

    EPA Science Inventory

    We report on a series of field and laboratory mesocosm experiments where we examined the effects of two levels of decomposing Ulva on Spartina alterniflora growth, soil biogeochemistry, and nitrogen dynamics. Monitoring of porewater revealed rapid mineralization to ammonium from...

  3. Algae.


    Raven, John A; Giordano, Mario


    Algae frequently get a bad press. Pond slime is a problem in garden pools, algal blooms can produce toxins that incapacitate or kill animals and humans and even the term seaweed is pejorative - a weed being a plant growing in what humans consider to be the wrong place. Positive aspects of algae are generally less newsworthy - they are the basis of marine food webs, supporting fisheries and charismatic marine megafauna from albatrosses to whales, as well as consuming carbon dioxide and producing oxygen. Here we consider what algae are, their diversity in terms of evolutionary origin, size, shape and life cycles, and their role in the natural environment and in human affairs.

  4. Algae.


    Raven, John A; Giordano, Mario


    Algae frequently get a bad press. Pond slime is a problem in garden pools, algal blooms can produce toxins that incapacitate or kill animals and humans and even the term seaweed is pejorative - a weed being a plant growing in what humans consider to be the wrong place. Positive aspects of algae are generally less newsworthy - they are the basis of marine food webs, supporting fisheries and charismatic marine megafauna from albatrosses to whales, as well as consuming carbon dioxide and producing oxygen. Here we consider what algae are, their diversity in terms of evolutionary origin, size, shape and life cycles, and their role in the natural environment and in human affairs. PMID:25004359

  5. Green seaweed Ulva as a monitor for pollution in coastal waters

    SciTech Connect

    Levine, H.G.


    Methods have been developed which capitalize on the capacity of Ulva to function as a bioindicator of pollution in coastal waters. Studies have been performed evaluating the growth of both Ulva tissue discs and Ulva germlings as they relate to physical and chemical parameters of the environment. The Ulva tissue disc method for the in situ monitoring of organic load (nitrogen and phosphorus) in coastal waters was demonstrated to be marginally effective. The in situ differential growth reponse of parthenogenetically developed germlings fulfilled the monitoring objective, but multi-faceted environmental considerations introduced complications which reduced the feasibility of the germling deployment method for routine monitoring. The assessment of Ulva as a bioaccumulator was undertaken. Use of Ulva as an in situ sampling device has demonstrated appreciable success. This in situ monitor can provide concentrated samples of environmental pollutants. Analytical techniques have been employed to extract information on trace metals, pesticides, PCBs and other accumulated organohalides. Ulva is a bioacumulator which, by all standards, has much to recommend it. Precedures have been developed to reduce much of the inherent biological varation. Ulva has world-wide occurrence, and is therefore capable of providing a standard for comparison of data. This alga merits consideration as an international monitor for pollutants in the marine environment.

  6. Standard and digestive metabolism in the banded water snake, Nerodia fasciata fasciata.


    Hopkins, W A; Roe, J H; Philippi, T; Congdon, J D


    Estimating energy costs by respirometry is fundamental to many studies of the ecology, behavior and evolution of reptiles. However, traditional respirometry procedures seldom incorporate objective techniques for removal of outliers from estimates of metabolic parameters. We demonstrate how computer-automated respirometry equipment, which records many respiratory measurements over short intervals, can be coupled with mathematical procedures to produce robust estimates of pre- and post-prandial metabolism in banded water snakes (Nerodia fasciata fasciata). Standard metabolic rate of N. f. fasciata was estimated to be 1.21 ml O2/h (mass = 30.21 +/- 0.74 g) at 25 degrees C. After ingestion of a fish equaling 20% of their body mass, snakes exhibited a fivefold increase in metabolic rate with peak O2 consumption rate (VO2) reaching 6.5 ml O2/h. Total cost of digestion was 5.44 kJ, equivalent to approximately 21% of the energy in the meal. Repeated measurements of metabolism in the same individuals revealed that our methods yielded similar results, even when individuals exhibited different patterns of VO2 variation between respiratory trials. Our results underscore the importance of obtaining many VO2 measurements, coupled with objective removal of outlier values from estimates of metabolic rate, especially when metabolic values are to be interpreted in a comparative context.

  7. The origin of the Ulva macroalgal blooms in the Yellow Sea in 2013.


    Zhang, Jianheng; Huo, Yuanzi; Wu, Hailong; Yu, Kefeng; Kim, Jang Kyun; Yarish, Charles; Qin, Yutao; Liu, Caicai; Xu, Ren; He, Peimin


    Green algal blooms have occurred in the Yellow Sea for seven consecutive years from 2007 to 2013. In this study, satellite image analysis and field shipboard observations indicated that the Ulva blooms in 2013 originated in the Rudong coast. The spatial distribution of Ulva microscopic propagules in the Southern Yellow Sea also supported that the blooms originated in the Rudong coast. In addition, multi-source satellite data were used to evaluate the biomass of green algae on the Pyropia aquaculture rafts. The results showed that approximately 2784 tons of Ulva prolifera were attached to the rafts and possessed the same internal transcribed spacer and 5S rDNA sequence as the dominant species in the 2013 blooms. We conclude that the significant biomass of Ulva species on the Pyropia rafts during the harvesting season in radial tidal sand ridges played an important role in the rapid development of blooms in the Yellow Sea.

  8. Cultivation and conversion of marine macroalgae. [Gracilaria and Ulva

    SciTech Connect

    Ryther, J.H.; DeBusk, T.A.; Blakeslee, M.


    Research was conducted on the development of an alternative ocean energy farm concept that would not be dependent upon deep ocean water or other extraneous sources for its nutrient supply and that could be located in shallow, near shore, and protected coastal ocean areas. There are five tasks reported in this document: determination of the annual yield of Ulva in non-intensive cultures; evaluation of the effect of carbon concentration on Gracilaria and Ulva yields; evaluation of spray/mist culture of Ulva and Gracilaria; species screening for the production of petroleum replacement products; and synthesis analysis, and economic energy evaluation of culture data. An alternative concept to open ocean culture is a land-based energy production system utilizing saline waters from underground aquifers or enclosed coastal areas. Research was performed to evaluate growth and biomass production of all macroscopic algal species that could be obtained in adequate quantity in the central Florida area. A total of 42 species were grown in specially adapted burial vaults. These included 16 green algae (Garcilaria 4 weekshlorophyta), 2 brown algae (Phaeophyta), and 18 red algae (Rhodophyta). Of these, the most successful and suitable species were a strain of Gracilaria (a red seaweed) and Ulva (a green seaweed). These two species have a high carbohydrate content that may be anaerobically digested to methane gas. Well-nourished Gracilaria will double its biomass in 1 to 4 weeks, depending on the season, water flow, and other variables. After its biomass has doubled (i.e., from 2 to 4 kg/m/sup 2/) the incremental growth is harvested to return the crop to a starting density. Enrichment of the new starting crop following harvest could conceivably be accomplished onsite at the seaweed farm, but the rapid uptake and storage of nutrients by depleted seaweeds makes possible a simpler process, known as pulse fertilization.

  9. Inhibitory effect of extracts of Brazilian marine algae on human T-cell lymphotropic virus type 1 (HTLV-1)-induced syncytium formation in vitro.


    Romanos, MariaTeresaVillela; Andrada-Serpa, Maria José; dos, SantosMartaGonçalvesMatos; Ribeiro, AnaCristinaF; Yoneshigue-Valentin, Yocie; Costa, Sĵnia Soares; Wigg, Marcia Dutra


    Extracts from four species of Brazilian marine algae collected from the Rio de Janeiro State coast were screened to determine the inhibitory effect on HTLV-1-induced syncytium formation. Before performing the syncytium inhibition assay the 50% cytotoxic dose (CyD50) of the algal extracts was evaluated. The antiviral test was carried out in HeLa cells co-cultured with HTLV-I infected T-cell line (C91/PL cells) in the presence of marine algal extracts in the concentration inferior to that corresponding to the CyD50. It was observed that co-cultured cells exposed to Ulva fasciata extract showed 60.2% syncytium inhibition at a concentration of 2.5%. At 5% concentration, Sargassum vulgare and Vidalia obtusiloba extracts presented 78.8 and 76% syncytium inhibition, respectively. The best inhibitory activity was observed with Laminaria abyssalis that presented 100% syncytium inhibition at a concentration of 2.5%. This work shows that extracts of marine algae, mainly L. abyssalis extract, are able to inhibit the cell-to-cell contact essential for the spreading of the virus and could be useful to prevent the infection. PMID:11853002

  10. Solar ultraviolet radiation affects the activity of ribulose-1,5-bisphosphate carboxylase-oxygenase and the composition of photosynthetic and xanthophyll cycle pigments in the intertidal green alga Ulva lactuca L.


    Bischof, Kai; Kräbs, Gudrun; Wiencke, Christian; Hanelt, Dieter


    The effect of solar UV radiation on the physiology of the intertidal green macroalga Ulva lactuca L. was investigated. A natural Ulva community at the shore of Helgoland was covered with screening foils, excluding UV-B or UV-B + UV-A from the solar spectrum. In the sampled material, changes in the activity and concentration of ribulose-1,5-bisphosphate carboxylase-oxygenase (Rubisco), and the concentration of photosynthetic and xanthophyll cycle pigments were determined. Exclusion of UV radiation from the natural solar spectrum resulted in an elevated overall activity of Rubisco, related to an increase in its cellular concentration. Among the photosynthetic pigments, lutein concentration was substantially elevated under UV exclusion. In addition, marked UV effects on the xanthophyll cycle were found: exclusion of solar UV radiation (and particularly UV-B) resulted in an increased ratio of zeaxanthin concentration to the total xanthophyll content, indicating adverse effects of UV-B on the efficiency of photoprotection under high irradiances of photosynthetically active radiation. The results confirm a marked impact of present UV-B levels on macroalgal physiology under field conditions.

  11. Morphology and molecular identification of Ulva forming green tides in Qingdao, China

    NASA Astrophysics Data System (ADS)

    Kong, Fanna; Mao, Yunxiang; Cui, Fujun; Zhang, Xingkui; Gao, Zhen


    Green tides are caused by the proliferation of chlorophytes under suitable hydrographic conditions. These blooms lead to environmental degradation and negatively impact the waters and seagrass beds, as well as fishing and other recreational activities in the bay. A comprehensive ecological understanding of the bloom dynamics, including the origin and persistence, is needed to foster management decisions. The algae in the great majority of green tide blooms usually belong to two genera of Ulvophyceae, Ulva and Enteromorpha. Ulva has been observed more often in recent years. In China, green tides occurred for the first time in the middle area of the Yellow Sea in 2007, and a large-scale algae blooming broke out in the middle and southern areas of the Yellow Sea in late May 2008. We identified them as Ulva prolifera by comparative analysis of the rDNA internal transcribed spacer 1 (ITS1), 5.8S and ITS2 sequences in combination with microscopic observation. Morphological differences were found between the free-floating algae and the attached thalli. Various reproduction patterns of the free-floating algae include sexual, asexual and vegetative propagations, which played important roles in the long-term green tide persistence in China. The ITS sequences of the blooming algae were identical to those of the samples from the Lianyungang sea area but were different from the attached samples from the Qingdao sea area. The results infer that the blooms are originated from other sea areas rather than from the local attached populations.

  12. Regulation of gametogenesis and zoosporogenesis in Ulva linza (Chlorophyta): comparison with Ulva mutabilis and potential for laboratory culture

    PubMed Central

    Vesty, Eleanor F.; Kessler, Ralf W.; Wichard, Thomas; Coates, Juliet C.


    Green Ulvophyte macroalgae represent attractive model systems for understanding growth, development, and evolution. They are untapped resources for food, fuel, and high-value compounds, but can also form nuisance blooms. To fully analyze green seaweed morphogenesis, controlled laboratory-based culture of these organisms is required. To date, only a single Ulvophyte species, Ulva mutabilis Føyn, has been manipulated to complete its whole life cycle in laboratory culture and to grow continuously under axenic conditions. Such cultures are essential to address multiple key questions in Ulva development and in algal–bacterial interactions. Here we show that another Ulva species, U. linza, with a broad geographical distribution, has the potential to be grown in axenic culture similarly to U. mutabilis. U. linza can be reliably induced to sporulate (form gametes and zoospores) in the laboratory, by cutting the relevant thallus tissue into small pieces and removing extracellular inhibitors (sporulation and swarming inhibitors). The germ cells work as an ideal feed stock for standardized algae cultures. The requirement of U. linza for bacterial signals to induce its normal morphology (particularly of the rhizoids) appears to have a species-specific component. The axenic cultures of these two species pave the way for future comparative studies of algal–microbial interactions. PMID:25674100

  13. A new subspecies of Chamaea fasciata (Wrentit) from Oregon (Aves: Timaliinae)

    USGS Publications Warehouse

    Browning, M. Ralph


    Geographic variation in plumage color of Chamaea fasciata (Wrentit) from northern California and southern Oregon is related to climate. A new subspecies, Chamaea fasciata margra, is described from a disjunct population of southern interior Oregon. Colonization of C. fasciata in interior Oregon was perhaps from birds crossing coniferous forests via isolated balds of Ceonothus. Recent increases of Wrentits in interior Oregon may be in response to habitat alterations (deforestation, fires) and concurrent global warming.

  14. The Complete Chloroplast and Mitochondrial Genomes of the Green Macroalga Ulva sp. UNA00071828 (Ulvophyceae, Chlorophyta)

    PubMed Central

    Melton, James T.; Leliaert, Frederik; Tronholm, Ana; Lopez-Bautista, Juan M.


    Sequencing mitochondrial and chloroplast genomes has become an integral part in understanding the genomic machinery and the phylogenetic histories of green algae. Previously, only three chloroplast genomes (Oltmannsiellopsis viridis, Pseudendoclonium akinetum, and Bryopsis hypnoides) and two mitochondrial genomes (O. viridis and P. akinetum) from the class Ulvophyceae have been published. Here, we present the first chloroplast and mitochondrial genomes from the ecologically and economically important marine, green algal genus Ulva. The chloroplast genome of Ulva sp. was 99,983 bp in a circular-mapping molecule that lacked inverted repeats, and thus far, was the smallest ulvophycean plastid genome. This cpDNA was a highly compact, AT-rich genome that contained a total of 102 identified genes (71 protein-coding genes, 28 tRNA genes, and three ribosomal RNA genes). Additionally, five introns were annotated in four genes: atpA (1), petB (1), psbB (2), and rrl (1). The circular-mapping mitochondrial genome of Ulva sp. was 73,493 bp and follows the expanded pattern also seen in other ulvophyceans and trebouxiophyceans. The Ulva sp. mtDNA contained 29 protein-coding genes, 25 tRNA genes, and two rRNA genes for a total of 56 identifiable genes. Ten introns were annotated in this mtDNA: cox1 (4), atp1 (1), nad3 (1), nad5 (1), and rrs (3). Double-cut-and-join (DCJ) values showed that organellar genomes across Chlorophyta are highly rearranged, in contrast to the highly conserved organellar genomes of the red algae (Rhodophyta). A phylogenomic investigation of 51 plastid protein-coding genes showed that Ulvophyceae is not monophyletic, and also placed Oltmannsiellopsis (Oltmannsiellopsidales) and Tetraselmis (Chlorodendrophyceae) closely to Ulva (Ulvales) and Pseudendoclonium (Ulothrichales). PMID:25849557

  15. Quantitative, molecular and growth analyses of Ulva microscopic propagules in the coastal sediment of Jiangsu province where green tides initially occurred.


    Liu, Feng; Pang, Shao Jun; Zhao, Xiao Bo; Hu, Chuan Ming


    From 2007 to 2011, large-scale green tides formed by unattached filamentous alga, Ulva prolifera in Ulva linza-procera-prolifera complex, have initially occurred in Jiangsu coasts of China. The real niche or the substrate(s) on which U. prolifera attaches before it starts to float is still under debate. However, great numbers of Ulva propagules would be supposed to exist in the microscopic, overwintering stage for the next spring's bloom in coastal environments. This study was designed to confirm the above prediction and investigate abundance, species composition and growth characteristics of Ulva propagules in the sediments. Quantification result showed that Ulva propagules widely distributed in the sediments and the abundance of these isolates did not change much over a 3-month testing period at low temperature in darkness. Molecular data based on three DNA markers revealed that four Ulva species existed in the sediments, among which green-tide forming alga, U. prolifera, was included. Elevated levels of temperature, irradiance as well as nutrients in seawater greatly facilitated recovery and growth of propagules. Results of this investigation indicated the possibility of microscopic propagules turning directly into floating biomass in season when temperature, irradiance and nutrients together meet the required levels in questioned coastal water area.

  16. Quantitative, molecular and growth analyses of Ulva microscopic propagules in the coastal sediment of Jiangsu province where green tides initially occurred.


    Liu, Feng; Pang, Shao Jun; Zhao, Xiao Bo; Hu, Chuan Ming


    From 2007 to 2011, large-scale green tides formed by unattached filamentous alga, Ulva prolifera in Ulva linza-procera-prolifera complex, have initially occurred in Jiangsu coasts of China. The real niche or the substrate(s) on which U. prolifera attaches before it starts to float is still under debate. However, great numbers of Ulva propagules would be supposed to exist in the microscopic, overwintering stage for the next spring's bloom in coastal environments. This study was designed to confirm the above prediction and investigate abundance, species composition and growth characteristics of Ulva propagules in the sediments. Quantification result showed that Ulva propagules widely distributed in the sediments and the abundance of these isolates did not change much over a 3-month testing period at low temperature in darkness. Molecular data based on three DNA markers revealed that four Ulva species existed in the sediments, among which green-tide forming alga, U. prolifera, was included. Elevated levels of temperature, irradiance as well as nutrients in seawater greatly facilitated recovery and growth of propagules. Results of this investigation indicated the possibility of microscopic propagules turning directly into floating biomass in season when temperature, irradiance and nutrients together meet the required levels in questioned coastal water area. PMID:22225862

  17. Ulva (Chlorophyta, Ulvales) Biodiversity in the North Adriatic Sea (Mediterranean, Italy): Cryptic Species and New Introductions.


    Wolf, Marion A; Sciuto, Katia; Andreoli, Carlo; Moro, Isabella


    Ulva Linnaeus (Ulvophyceae, Ulvales) is a genus of green algae widespread in different aquatic environments. Members of this genus show a very simple morphology and a certain degree of phenotypic plasticity, heavily influenced by environmental conditions, making difficult the delineation of species by morphological features alone. Most studies dealing with Ulva biodiversity in Mediterranean waters have been based only on morphological characters and a modern taxonomic revision of this genus in the Mediterranean is not available. We report here the results of an investigation on the diversity of Ulva in the North Adriatic Sea based on molecular analyses. Collections from three areas, two of which subject to intense shipping traffic, were examined, as well as historical collections of Ulva stored in the Herbarium Patavinum of the University of Padova, Italy. Molecular analyses based on partial sequences of the rbcL and tufA genes revealed the presence of six different species, often with overlapping morphologies: U. californica Wille, U. flexuosa Wulfen, U. rigida C. Agardh, U. compressa Linnaeus, U. pertusa Kjellman, and one probable new taxon. U. californica is a new record for the Mediterranean and U. pertusa is a new record for the Adriatic. Partial sequences obtained from historical collections show that most of the old specimens are referable to U. rigida. No specimens referable to the two alien species were found among the old herbarium specimens. The results indicate that the number of introduced seaweed species and their impact on Mediterranean communities have been underestimated, due to the difficulties in species identification of morphologically simple taxa as Ulva.

  18. Macroalgae mitigation potential for fish aquaculture effluents: an approach coupling nitrogen uptake and metabolic pathways using Ulva rigida and Enteromorpha clathrata.


    Aníbal, Jaime; Madeira, Hélder T; Carvalho, Liliana F; Esteves, Eduardo; Veiga-Pires, Cristina; Rocha, Carlos


    Aquaculture effluents are rich in nitrogen compounds that may enhance local primary productivity, leading to the development of algae blooms. The goal of this study was to assess the potential use of naturally occurring green macroalgae (Ulva and Enteromorpha) as bioremediators for nitrogen-rich effluents from a fish aquaculture plant, by evaluating their respective uptake dynamics under controlled conditions. Ulva and Enteromorpha were incubated separately in aquaculture effluent from a local pilot station. Algae tissue and water samples were collected periodically along 4 h. For each sample, nitrate, nitrite, and ammonia concentrations were quantified in the effluent, while internal algae reserve pools and nitrate reductase activity (NRA) were determined within the algae tissues. Both macroalgae absorbed all dissolved inorganic nitrogen compounds in less than 1 h, favoring ammonia over nitrate. Ulva stored nitrate temporarily as an internal reserve and only used it after ammonia availability decreased, whereas Enteromorpha stored and metabolized ammonia and nitrate simultaneously. These distinct dynamics of ammonia and nitrate uptake supported an increase in NRA during the experiment. This study supports the hypothesis that Ulva or Enteromorpha can be used as bioremediators in aquaculture effluents to mitigate excess of dissolved inorganic nitrogen.

  19. The green seaweed Ulva: a model system to study morphogenesis.


    Wichard, Thomas; Charrier, Bénédicte; Mineur, Frédéric; Bothwell, John H; Clerck, Olivier De; Coates, Juliet C


    Green macroalgae, mostly represented by the Ulvophyceae, the main multicellular branch of the Chlorophyceae, constitute important primary producers of marine and brackish coastal ecosystems. Ulva or sea lettuce species are some of the most abundant representatives, being ubiquitous in coastal benthic communities around the world. Nonetheless the genus also remains largely understudied. This review highlights Ulva as an exciting novel model organism for studies of algal growth, development and morphogenesis as well as mutualistic interactions. The key reasons that Ulva is potentially such a good model system are: (i) patterns of Ulva development can drive ecologically important events, such as the increasing number of green tides observed worldwide as a result of eutrophication of coastal waters, (ii) Ulva growth is symbiotic, with proper development requiring close association with bacterial epiphytes, (iii) Ulva is extremely developmentally plastic, which can shed light on the transition from simple to complex multicellularity and (iv) Ulva will provide additional information about the evolution of the green lineage.

  20. Thermochemical hydrolysis of macroalgae Ulva for biorefinery: Taguchi robust design method.


    Jiang, Rui; Linzon, Yoav; Vitkin, Edward; Yakhini, Zohar; Chudnovsky, Alexandra; Golberg, Alexander


    Understanding the impact of all process parameters on the efficiency of biomass hydrolysis and on the final yield of products is critical to biorefinery design. Using Taguchi orthogonal arrays experimental design and Partial Least Square Regression, we investigated the impact of change and the comparative significance of thermochemical process temperature, treatment time, %Acid and %Solid load on carbohydrates release from green macroalgae from Ulva genus, a promising biorefinery feedstock. The average density of hydrolysate was determined using a new microelectromechanical optical resonator mass sensor. In addition, using Flux Balance Analysis techniques, we compared the potential fermentation yields of these hydrolysate products using metabolic models of Escherichia coli, Saccharomyces cerevisiae wild type, Saccharomyces cerevisiae RN1016 with xylose isomerase and Clostridium acetobutylicum. We found that %Acid plays the most significant role and treatment time the least significant role in affecting the monosaccharaides released from Ulva biomass. We also found that within the tested range of parameters, hydrolysis with 121 °C, 30 min 2% Acid, 15% Solids could lead to the highest yields of conversion: 54.134-57.500 gr ethanol kg(-1) Ulva dry weight by S. cerevisiae RN1016 with xylose isomerase. Our results support optimized marine algae utilization process design and will enable smart energy harvesting by thermochemical hydrolysis.

  1. Thermochemical hydrolysis of macroalgae Ulva for biorefinery: Taguchi robust design method

    PubMed Central

    Jiang, Rui; Linzon, Yoav; Vitkin, Edward; Yakhini, Zohar; Chudnovsky, Alexandra; Golberg, Alexander


    Understanding the impact of all process parameters on the efficiency of biomass hydrolysis and on the final yield of products is critical to biorefinery design. Using Taguchi orthogonal arrays experimental design and Partial Least Square Regression, we investigated the impact of change and the comparative significance of thermochemical process temperature, treatment time, %Acid and %Solid load on carbohydrates release from green macroalgae from Ulva genus, a promising biorefinery feedstock. The average density of hydrolysate was determined using a new microelectromechanical optical resonator mass sensor. In addition, using Flux Balance Analysis techniques, we compared the potential fermentation yields of these hydrolysate products using metabolic models of Escherichia coli, Saccharomyces cerevisiae wild type, Saccharomyces cerevisiae RN1016 with xylose isomerase and Clostridium acetobutylicum. We found that %Acid plays the most significant role and treatment time the least significant role in affecting the monosaccharaides released from Ulva biomass. We also found that within the tested range of parameters, hydrolysis with 121 °C, 30 min 2% Acid, 15% Solids could lead to the highest yields of conversion: 54.134–57.500 gr ethanol kg−1 Ulva dry weight by S. cerevisiae RN1016 with xylose isomerase. Our results support optimized marine algae utilization process design and will enable smart energy harvesting by thermochemical hydrolysis. PMID:27291594

  2. Thermochemical hydrolysis of macroalgae Ulva for biorefinery: Taguchi robust design method.


    Jiang, Rui; Linzon, Yoav; Vitkin, Edward; Yakhini, Zohar; Chudnovsky, Alexandra; Golberg, Alexander


    Understanding the impact of all process parameters on the efficiency of biomass hydrolysis and on the final yield of products is critical to biorefinery design. Using Taguchi orthogonal arrays experimental design and Partial Least Square Regression, we investigated the impact of change and the comparative significance of thermochemical process temperature, treatment time, %Acid and %Solid load on carbohydrates release from green macroalgae from Ulva genus, a promising biorefinery feedstock. The average density of hydrolysate was determined using a new microelectromechanical optical resonator mass sensor. In addition, using Flux Balance Analysis techniques, we compared the potential fermentation yields of these hydrolysate products using metabolic models of Escherichia coli, Saccharomyces cerevisiae wild type, Saccharomyces cerevisiae RN1016 with xylose isomerase and Clostridium acetobutylicum. We found that %Acid plays the most significant role and treatment time the least significant role in affecting the monosaccharaides released from Ulva biomass. We also found that within the tested range of parameters, hydrolysis with 121 °C, 30 min 2% Acid, 15% Solids could lead to the highest yields of conversion: 54.134-57.500 gr ethanol kg(-1) Ulva dry weight by S. cerevisiae RN1016 with xylose isomerase. Our results support optimized marine algae utilization process design and will enable smart energy harvesting by thermochemical hydrolysis. PMID:27291594

  3. Suitability of Tillandsia usneoides and Aechmea fasciata for biomonitoring toxic elements under tropical seasonal climate.


    Giampaoli, Patricia; Wannaz, Eduardo D; Tavares, Armando R; Domingos, Marisa


    Aechmea fasciata was evaluated for the first time as a biomonitor of toxic elements, in comparison to the biomonitoring capacity of Tillandsia usneoides, a well-established biomonitor bromeliad species. Plants of both species were exposed to air pollutants from industrial, urban, and agricultural sources, under the tropical seasonal climate, from June/2011 to April/2013, in five sites of São Paulo State, Brazil, for 8 consecutive exposure periods of 12 weeks each. The levels of essential and non-essential elements, including trace metals, were quantified at the end of each exposure. T. usneoides and A. fasciata indicated N, Fe, Zn, Co, Cr, and V as air contaminants in the studied sites, during wet and dry seasons and both species were recommended for qualitative biomonitoring. Concentration levels of N, Ca, S, Fe, Zn, Cu, B, Co, and Ni were significantly higher in T. usneoides than in A. fasciata. However, A. fasciata showed a higher effective retention capacity of Ni, Pb, V, Cu, Fe, Cr, and Co during field exposure, as indicated by the estimate of enrichment factor relative to basal concentrations. This species is more suitable for detecting the atmospheric pollution level of those metals than the T. usneoides. Both species indicated adequately the seasonal differences in the pollution levels of several elements, but T. usneoides presented higher ability for biomonitoring the spatial variations and for indicating more properly the sources of each element in the studied region than the A. fasciata. PMID:26844661

  4. Determination of Volatile Compounds in Four Commercial Samples of Japanese Green Algae Using Solid Phase Microextraction Gas Chromatography Mass Spectrometry

    PubMed Central

    Yoshikawa, Keisuke; Fujita, Akira; Mase, Nobuyuki; Watanabe, Naoharu


    Green algae are of great economic importance. Seaweed is consumed fresh or as seasoning in Japan. The commercial value is determined by quality, color, and flavor and is also strongly influenced by the production area. Our research, based on solid phase microextraction gas chromatography mass spectrometry (SPME-GC-MS), has revealed that volatile compounds differ intensely in the four varieties of commercial green algae. Accordingly, 41 major volatile compounds were identified. Heptadecene was the most abundant compound from Okayama (Ulva prolifera), Tokushima (Ulva prolifera), and Ehime prefecture (Ulva linza). Apocarotenoids, such as ionones, and their derivatives were prominent volatiles in algae from Okayama (Ulva prolifera) and Tokushima prefecture (Ulva prolifera). Volatile, short chained apocarotenoids are among the most potent flavor components and contribute to the flavor of fresh, processed algae, and algae-based products. Benzaldehyde was predominant in seaweed from Shizuoka prefecture (Monostroma nitidum). Multivariant statistical analysis (PCA) enabled simple discrimination of the samples based on their volatile profiles. This work shows the potential of SPME-GC-MS coupled with multivariant analysis to discriminate between samples of different geographical and botanical origins and form the basis for development of authentication methods of green algae products, including seasonings. PMID:24592162

  5. Natural Abundance 14C Content of Dibutyl Phthalate (DBP) from Three Marine Algae

    PubMed Central

    Namikoshi, Michio; Fujiwara, Takeshi; Nishikawa, Teruaki; Ukai, Kazuyo


    Analysis of the natural abundance 14C content of dibutyl phthalate (DBP) from two edible brown algae, Undaria pinnatifida and Laminaria japonica, and a green alga, Ulva sp., revealed that the DBP was naturally produced. The natural abundance 14C content of di-(2-ethylhexyl) phthalate (DEHP) obtained from the same algae was about 50–80% of the standard sample and the 14C content of the petrochemical (industrial) products of DBP and DEHP were below the detection limit.

  6. Antioxidant and anticancer activities of selected persian gulf algae.


    Namvar, F; Baharara, J; Mahdi, A A


    In the present study, the effect of red (Gracillaria corticata), green (Ulva fasciata) and brown (Sargassum ilicifolium) seaweeds alcoholic extract, against five important human cancer cell lines (MCF-7, MDA-MB-231, HeLa, HepG2, and HT-29) proliferation, apoptosis and cell cycle arrest were evaluated. The reducing activity and total polyphenol content were also investigated. MTT assay was used for cytotoxicity test. Morphological alterations were examined using phase contrast, fluorescent and electron microscopy. All the extracts were antiproliferative against all the cancer cell lines, dose-dependently, with G. corticata methanol extract (GCME) having the greatest inhibition activity against MCF-7 cell line. The percentage of apoptosis increased from 18 to 78 %. The cell cycle analysis also showed that GCME can induce apoptosis which confirm by TEM. Algal extract reducing activities were as follows: G. corticata > S. ilicifolium > U. fasciata. The GCME is a good source of potential complementary and alternative functional food for prevention and treatment of cancer. PMID:24478544

  7. Antihepatotoxic nature of Ulva reticulata (Chlorophyceae) on acetaminophen-induced hepatoxicity in experimental rats.


    Balaji Raghavendra Rao, H; Sathivel, A; Devaki, T


    Ulva reticulata, a marine edible green alga, is a known source of proteins, vitamins, and sulfated polysaccharides. Though there are many reports in the literature regarding the composition and antiviral property of Ulva sp., studies of the antihepatotoxic property of green seaweeds in animal model are scarce. We have studied the antihepatotoxic nature of this marine green edible alga, U. reticulata, in a hot water extract (150 mg/kg of body weight for a period of 15 days) against acetaminophen- induced hepatotoxicity in experimental albino rats. The acetaminophen-induced rats showed significant elevation in levels of the serum marker enzymes aspartate transaminase and alanine transaminase and of lipid peroxides in liver tissue with decreased levels of antioxidant enzymes such as superoxide dismutase and catalase. The levels of reduced glutathione and vitamins (E and C) were also decreased in the liver tissue of acetaminophen-intoxicated rats. The oral pretreatment with a hot water extract of U. reticulata reduced the hepatotoxicity triggered by acetaminophen considerably by improving the antioxidant status in experimental animals with depleted levels of lipid peroxides. These results indicate that the oral pretreatment with a hot water extract of U. reticulata in rats is effective in reducing the hepatic oxidative stress via free radical scavenging properties, suggesting an antihepatotoxic activity. PMID:15671697

  8. Interactions of silver nanoparticles with the marine macroalga, Ulva lactuca.


    Turner, Andrew; Brice, David; Brown, Murray T


    The marine macroalga, Ulva lactuca, has been exposed for 48 h to different concentrations of Ag added as either silver nanoparticles (AgNP) or aqueous metal (AgNO(3)) and the resulting toxicity, estimated from reductions in quenching of chlorophyll-a fluorescence, and accumulation of Ag measured. Aqueous Ag was toxic at available concentrations as low as about 2.5 μg l(-1) and exhibited considerable accumulation that could be defined by the Langmuir equation. AgNP were not phytotoxic to the macroalga at available Ag concentrations up to at least 15 μg l(-1) and metal measured in U. lactuca was attributed to a physical association of nanoparticles at the algal surface. At higher AgNP concentrations, a dose-response relationship was observed that was similar to that for aqueous Ag recorded at much lower concentrations. These findings suggest that AgNP are only indirectly toxic to marine algae through the dissolution of Ag(+) ions into bulk sea water, albeit at concentrations orders of magnitude greater than those predicted in the environment. PMID:21877230

  9. Physiological and Biochemical Responses of Ulva prolifera and Ulva linza to Cadmium Stress

    PubMed Central

    Jiang, He-ping; Gao, Bing-bing; Li, Wen-hui; Zhu, Ming; Zheng, Chun-fang; Zheng, Qing-song; Wang, Chang-hai


    Responses of Ulva prolifera and Ulva linza to Cd2+ stress were studied. We found that the relative growth rate (RGR), Fv/Fm, and actual photochemical efficiency of PSII (Yield) of two Ulvaspecies were decreased under Cd2+ treatments, and these reductions were greater in U. prolifera than in U. linza. U. prolifera accumulated more cadmium than U. linza under Cd2+ stress. While U. linza showed positive osmotic adjustment ability (OAA) at a wider Cd2+ range than U. prolifera. U. linza had greater contents of N, P, Na+, K+, and amino acids than U. prolifera. A range of parameters (concentrations of cadmium, Ca2+, N, P, K+, Cl−, free amino acids (FAAs), proline, organic acids and soluble protein, Fv/Fm, Yield, OAA, and K+/Na+) could be used to evaluate cadmium resistance in Ulva by correlation analysis. In accordance with the order of the absolute values of correlation coefficient, contents of Cd2+ and K+, Yield, proline content, Fv/Fm, FAA content, and OAA value of Ulva were more highly related to their adaptation to Cd2+ than the other eight indices. Thus, U. linza has a better adaptation to Cd2+ than U. prolifera, which was due mainly to higher nutrient content and stronger OAA and photosynthesis in U. linza. PMID:23533346

  10. Metabolic factors influencing the sodium and potassium distribution in Ulva lactuca.




    1. Methods for the use of the marine green alga, Ulva lactuca, in studies on electrolyte metabolism are described. 2. The effect of illumination and iodoacetate on the potassium and sodium content, as well as the influence of light and running sea water on the iodoacetate effect was investigated. The rate of exchange of cellular potassium ion for K(42) under conditions of light and dark at 20 and 30 degrees C. was studied. 3. Ulva maintained in the dark for long periods loses some potassium and gains sodium, both effects being reversed upon illumination. The presence of 0.001 M iodoacetate in the dark causes a marked progressive loss of potassium and gain of sodium, phenomena which do not occur when the alga is illuminated. Evidence for the penetration of the inhibitor into the cell in the presence of light is presented. The iodoacetate effect on potassium and sodium content, once established, can be "washed out" of the alga when the plant is placed in light and running sea water without the inhibitor. Illumination and increased temperature each favor a more rapid exchange of tissue for environmental potassium ion. 4. In the interpretation of these findings it is emphasized that metabolic work, perhaps in the form of ion transports, must be done by the cell to compensate for the continual flow of potassium ion and sodium ion with their respective concentration gradients and thus maintain homeostasis within the cell. Evidence is presented which indicates separate mechanisms for the distribution of sodium and potassium in this organism. It is further suggested that the degradation of phosphoglyceric acid, an important glycolytic and photosynthetic intermediate, or one of the products of its metabolism supplied the energy for these ion transports(s). The role of permeability per se is considered. PMID:13052903

  11. Melatonin as an antioxidant and its semi-lunar rhythm in green macroalga Ulva sp.


    Tal, Ofir; Haim, Abraham; Harel, Orna; Gerchman, Yoram


    The presence and role of melatonin in plants are still under debate owing to difficulties of identification and quantification. Accordingly, although it has been frequently proposed that melatonin acts as an antioxidant in phototrophic organisms, experimental data on its physiological role are scarce. This study describes the use of a rapid and simple new method for quantification of melatonin in the marine macroalga Ulva sp., organisms routinely exposed to tide-related environmental stresses and known for their high tolerance to abiotic conditions. The method was used here to show that exposure to oxidative stress-inducing environmental conditions (elevated temperature and heavy metals) induced a rise in melatonin level in the algae. Addition of exogenous melatonin alleviated the algae from cadmium-induced stress. Interestingly, although the algae were taken from a culture growing free floating and kept under constant photoperiod and water level, they exhibited a semi-lunar rhythm of melatonin levels that correlated with predicted spring tides. The correlation can probably be interpreted as reflecting preparation for predicted low tides, when the algae are exposed to increasing temperature, desiccation, and salinity, all known to induce oxidative stress. Given the simplicity of the described method it can easily be adapted for the study of melatonin in many other phototrophic organisms. These results provide, for the first time, experimental data that support both an antioxidant role for melatonin and its semi-lunar rhythm in macroalgae.

  12. The green seaweed Ulva: a model system to study morphogenesis

    PubMed Central

    Wichard, Thomas; Charrier, Bénédicte; Mineur, Frédéric; Bothwell, John H.; Clerck, Olivier De; Coates, Juliet C.


    Green macroalgae, mostly represented by the Ulvophyceae, the main multicellular branch of the Chlorophyceae, constitute important primary producers of marine and brackish coastal ecosystems. Ulva or sea lettuce species are some of the most abundant representatives, being ubiquitous in coastal benthic communities around the world. Nonetheless the genus also remains largely understudied. This review highlights Ulva as an exciting novel model organism for studies of algal growth, development and morphogenesis as well as mutualistic interactions. The key reasons that Ulva is potentially such a good model system are: (i) patterns of Ulva development can drive ecologically important events, such as the increasing number of green tides observed worldwide as a result of eutrophication of coastal waters, (ii) Ulva growth is symbiotic, with proper development requiring close association with bacterial epiphytes, (iii) Ulva is extremely developmentally plastic, which can shed light on the transition from simple to complex multicellularity and (iv) Ulva will provide additional information about the evolution of the green lineage. PMID:25745427

  13. Eutrophication and macroalgal blooms in temperate and tropical coastal waters: nutrient enrichment experiments with Ulva spp.

    PubMed Central

    Teichberg, Mirta; Fox, Sophia E; Olsen, Ylva S; Valiela, Ivan; Martinetto, Paulina; Iribarne, Oscar; Muto, Elizabeti Yuriko; Petti, Monica A V; Corbisier, Thaïs N; Soto-Jiménez, Martín; Páez-Osuna, Federico; Castro, Paula; Freitas, Helena; Zitelli, Andreina; Cardinaletti, Massimo; Tagliapietra, Davide


    Receiving coastal waters and estuaries are among the most nutrient-enriched environments on earth, and one of the symptoms of the resulting eutrophication is the proliferation of opportunistic, fast-growing marine seaweeds. Here, we used a widespread macroalga often involved in blooms, Ulva spp., to investigate how supply of nitrogen (N) and phosphorus (P), the two main potential growth-limiting nutrients, influence macroalgal growth in temperate and tropical coastal waters ranging from low- to high-nutrient supplies. We carried out N and P enrichment field experiments on Ulva spp. in seven coastal systems, with one of these systems represented by three different subestuaries, for a total of nine sites. We showed that rate of growth of Ulva spp. was directly correlated to annual dissolved inorganic nitrogen (DIN) concentrations, where growth increased with increasing DIN concentration. Internal N pools of macroalgal fronds were also linked to increased DIN supply, and algal growth rates were tightly coupled to these internal N pools. The increases in DIN appeared to be related to greater inputs of wastewater to these coastal waters as indicated by high δ15N signatures of the algae as DIN increased. N and P enrichment experiments showed that rate of macroalgal growth was controlled by supply of DIN where ambient DIN concentrations were low, and by P where DIN concentrations were higher, regardless of latitude or geographic setting. These results suggest that understanding the basis for macroalgal blooms, and management of these harmful phenomena, will require information as to nutrient sources, and actions to reduce supply of N and P in coastal waters concerned.

  14. Evaluation of antifouling activity of eight commercially available organic chemicals against the early foulers marine bacteria and Ulva spores.


    Bhattarai, Hari Datta; Paudel, Babita; Park, Nam-Sik; Lee, Kwang Soo; Shin, Hyun-Woung


    Environmental impacts caused by tin and copper based commercial antifouling (AF) paints were proved to be detrimental to aquatic ecosystems. Therefore, a search of environmental friendly AF compounds to be used in marine paint to protect the surface of maritime developmental structures from the unwanted biofouling is a burning issue of the present time. Commercially available eight organic chemicals--allyl isothiocyanate, beta-myrecene, cis-3-hexenyl acetate, citral, ethyl heptanoate, eugenol, methyl caproate, and octyl alcohol were evaluated forAF activities using both laboratory and field assays. The test chemicals were found to repel the target motile marine bacteria--Alteromonas marina, Bacillus atrophaeus, Roseobactergallaeciensis and Shewanella oneidensis and motile spores of the green alga, Ulva pertusa. The bacterial and Ulva spore repulsion activities of the test chemicals were measured by chemotaxis and agar diffusion methods respectively interestingly these test chemicals were less toxic to the test fouling species. The toxicity of the test chemicals was measured by using antibiotic assay disks against the bacteria and motility test against Ulva spores. Moreover, in field assay, all test chemicals showed a perfect performance ofAF activity showing no fouling during the experimental period of one year Such results and commercial as well as technical feasibility of the test chemicals firmly showed the possibility of using as alternatives of the existing toxic AF agents.

  15. Ulva linza zoospore sensitivity to systematic variation of surface topography

    NASA Astrophysics Data System (ADS)

    Sheats, Julian Taylor

    The use of surface topographical microstructure is abundant in nature. The lotus plant uses a fractal-like topography to create a highly non-wetting surface that self-cleans as water drops take dirt particles with them as they roll off. Analysis of how topography affects surface interactions offers a unique opportunity to attack a problem that affects our economy and societal health significantly. The attachment of biological material to manmade surfaces can be looked at as fouling or directed adhesion. Marine fouling on ship hulls costs the United States $600 million each year due to increased fuel usage caused by drag. Hospital-acquired methicillin-resistant Staphylococcus aureus infections cause thousands of deaths annually as a result of colonization of hospital surfaces. The lack of biocompatible synthetic surfaces for implants such as vascular grafts lead to restenosis as cells are unable to develop a natural interaction with the graft surface. In each circumstance there is much to learn about the complicated attachment process. This work expands the investigation of the role of topography in the attachment of the green fouling algae Ulva linza to poly(dimethylsiloxane) surfaces. Spore attachment density was correlated to the Wenzel roughness ratio on low surface energy, high-modulus poly(dimethylsiloxane)-grafted-silicon topographies. The role of topography on a scale less than the size of a spore was investigated on nano-roughened poly(dimethylsiloxane) elastomer surfaces. For a specific group of patterns, the spatial distribution of spores attached to topographies was quantitatively analyzed and shown to correlate with feature dimensions.

  16. The Mitochondrial Genomes of Aquila fasciata and Buteo lagopus (Aves, Accipitriformes): Sequence, Structure and Phylogenetic Analyses

    PubMed Central

    Jiang, Lan; Chen, Juan; Wang, Ping; Ren, Qiongqiong; Yuan, Jian; Qian, Chaoju; Hua, Xinghong; Guo, Zhichun; Zhang, Lei; Yang, Jianke; Wang, Ying; Zhang, Qin; Ding, Hengwu; Bi, De; Zhang, Zongmeng; Wang, Qingqing; Chen, Dongsheng; Kan, Xianzhao


    The family Accipitridae is one of the largest groups of non-passerine birds, including 68 genera and 243 species globally distributed. In the present study, we determined the complete mitochondrial sequences of two species of accipitrid, namely Aquila fasciata and Buteo lagopus, and conducted a comparative mitogenome analysis across the family. The mitogenome length of A. fasciata and B. lagopus are 18,513 and 18,559 bp with an A + T content of 54.2% and 55.0%, respectively. For both the two accipitrid birds mtDNAs, obvious positive AT-skew and negative GC-skew biases were detected for all 12 PCGs encoded by the H strand, whereas the reverse was found in MT-ND6 encoded by the L strand. One extra nucleotide‘C’is present at the position 174 of MT-ND3 gene of A. fasciata, which is not observed at that of B. lagopus. Six conserved sequence boxes in the Domain II, named boxes F, E, D, C, CSBa, and CSBb, respectively, were recognized in the CRs of A. fasciata and B. lagopus. Rates and patterns of mitochondrial gene evolution within Accipitridae were also estimated. The highest dN/dS was detected for the MT-ATP8 gene (0.32493) among Accipitridae, while the lowest for the MT-CO1 gene (0.01415). Mitophylogenetic analysis supported the robust monophyly of Accipitriformes, and Cathartidae was basal to the balance of the order. Moreover, we performed phylogenetic analyses using two other data sets (two mitochondrial loci, and combined nuclear and mitochondrial loci). Our results indicate that the subfamily Aquilinae and all currently polytypic genera of this subfamily are monophyletic. These two novel mtDNA data will be useful in refining the phylogenetic relationships and evolutionary processes of Accipitriformes. PMID:26295156

  17. [Marine algae of Baja California Sur, Mexico: nutritional value].


    Carrillo Domínguez, Silvia; Casas Valdez, Margarita; Ramos Ramos, Felipe; Pérez-Gil, Fernando; Sánchez Rodríguez, Ignacio


    The Baja California Peninsula is one of the richest regions of seaweed resources in México. The objective of this study was to determine the chemical composition of some marine algae species of Baja California Sur, with an economical potential due to their abundance and distribution, and to promote their use as food for human consumption and animal feeding. The algae studied were Green (Ulva spp., Enteromorpha intestinalis, Caulerpa sertularoides, Bryopsis hypnoides), Red (Laurencia johnstonii, Spyridia filamentosa, Hypnea valentiae) and Brown (Sargassum herporizum, S. sinicola, Padina durvillaei, Hydroclathrus clathrathus, Colpomenia sinuosa). The algae were dried and ground before analysis. In general, the results showed that algae had a protein level less than 11%, except L. johnstonii with 18% and low energy content. The ether extract content was lower than 1%. However, the algae were a good source of carbohydrates and inorganic matter.

  18. Larvicidal algae.


    Marten, Gerald G


    Although most algae are nutritious food for mosquito larvae, some species kill the larvae when ingested in large quantities. Cyanobacteria (blue-green algae) that kill larvae do so by virtue of toxicity. While blue-green algae toxins may offer possibilities for delivery as larvicides, the toxicity of live blue-green algae does not seem consistent enough for live algae to be useful for mosquito control. Certain species of green algae in the order Chlorococcales kill larvae primarily because they are indigestible. Where these algae are abundant in nature, larvae consume them to the exclusion of other food and then starve. Under the right circumstances, it is possible to introduce indigestible algae into a breeding habitat so they become abundant enough to render it unsuitable for mosquito production. The algae can persist for years, even if the habitat dries periodically. The main limitation of indigestible algae lies in the fact that, under certain conditions, they may not replace all the nutritious algae in the habitat. More research on techniques to ensure complete replacement will be necessary before indigestible algae can go into operational use for mosquito control.

  19. High iron content and bioavailability in humans from four species of marine algae.


    García-Casal, Maria N; Pereira, Ana C; Leets, Irene; Ramírez, José; Quiroga, Maria F


    Searching for economical, nonconventional sources of iron is important in underdeveloped countries to combat iron deficiency and anemia. Our objective was to study iron, vitamin C, and phytic acid composition and also iron bioavailability from 4 species of marine algae included in a rice-based meal. Marine algae (Ulva sp, Sargassum sp, Porphyra sp, and Gracilariopsis sp) were analyzed for monthly variations in iron and for ascorbic acid and phytic acid concentrations. A total of 96 subjects received rice-based meals containing the 4 species of marine algae in different proportions, raw or cooked. All meals contained radioactive iron. Absorption was evaluated by calculating the radioactive iron incorporation in subjects' blood. Iron concentrations in algae were high and varied widely, depending on the species and time of year. The highest iron concentrations were found in Sargassum (157 mg/100 g) and Gracilariopsis (196 mg/100 g). Phytates were not detected in the algae and ascorbic acid concentration fluctuated between 38 microg/g dry weight (Ulva) and 362 microg/g dry weight (Sargassum). Algae significantly increased iron absorption in rice-based meals. Cooking did not affect iron absorption compared with raw algae. Results indicate that Ulva sp, Sargassum sp, Porphyra sp, and Gracilariopsis sp are good sources of ascorbic acid and bioavailable iron. The percentage of iron absorption was similar among all algae tested, although Sargassum sp resulted in the highest iron intake. Based on these results, and on the high reproduction rates of algae during certain seasons, promoting algae consumption in some countries could help to improve iron nutrition.

  20. Activity patterns and time budgeting of Aplysia fasciata under field and laboratory conditions.


    Susswein, A J; Gev, S; Feldman, E; Markovich, S


    Activity patterns of Aplysia fasciata were observed in a protected port environment and in an aquarium. In both, major activities were feeding and mating, which collectively took up about 45% of the total time of the animals. Active behaviors occurred primarily at night; much of the day was spent in the inactive state. Activities were highly synchronized, with large numbers of animals performing the same behaviors simultaneously at a specific time. Mating and eating occurred primarily at different times; relatively few animals were observed performing these behaviors simultaneously. Many animals laying eggs were simultaneously mating as females.

  1. Effects of food deprivation upon behavioral patterns and time budgeting of Aplysia fasciata.


    Susswein, A J


    Effects of food deprivation upon time devoted to different behaviors in Aplysia fasciata were investigated. Time invested in mating, egg-laying, swimming, and movement in place was increased, and time spent immobile and crawling was decreased. Time of occurrence of behaviors was highly synchronized, but differed from that seen when food was available. Changes in behavior seem to be adaptive to conditions in which food is scarce: increased motility may lead to finding sites where food is present, while increased egg-laying and mating may ensure survival of progeny. Behavioral changes can be readily accounted for by removal of postingestive stimuli signaling satiation.

  2. The effects of chloramphenicol on Ulva lactuca.


    Leston, Sara; Nunes, Margarida; Viegas, Ivan; Ramos, Fernando; Pardal, Miguel Ângelo


    The administration of pharmacological substances in the food producing industry is a crucial and long established practice in ensuring animal welfare. However, a very high percentage of the drugs used will directly or indirectly be present in the various compartments of natural ecosystems therefore constituting a source of pollution. The reactions that these active compounds may impose on non-target organisms are still widely unknown and further research is essential. Also, new approaches on monitoring are necessary and in this sense, the present work aimed to assess the persistence of chloramphenicol (a banned but illegally used antibiotic) in seawater, together with its effects on the growth of the green macroalgae Ulva lactuca. Moreover, the potential use of this species as a bioindicator was assessed. Results showed CAP presented an exponential degradation pattern in seawater with concentrations decreasing faster than expected. As for the effects on U. lactuca it acted as a growth promoter also contradicting the initial assumptions. Regarding the role of this species in biomonitoring it successfully took up CAP in solution while reflecting the concentrations present conferring it good characteristics as a bioindicator. On the other hand, this ability points to a possibility of CAP being accumulated and transferred along the trophic web through the consumption of U. lactuca by organisms in higher levels. PMID:23395526

  3. Molecular identification of green algae from the rafts based infrastructure of Porphyra yezoensis.


    Shen, Qi; Li, Hongye; Li, Yan; Wang, Zongling; Liu, Jiesheng; Yang, Weidong


    To provide more information on the origin of the Ulva prolifera bloom in Qingdao sea area in China from 2007 to 2011, the diversity of green algae growing on the rafts of Porphyra yezoensis on the coast in Jiangsu Province was investigated based on ITS, rbcL and 5S sequences. Eighty-four of green algal samples from various sites and cruises in 2010 and 2011 were collected. According to ITS and rbcL sequences, samples from the rafts of P. yezoensis fell into four clades: Ulva linza-procera-prolifera (LPP) complex, Ulva flexuosa, Blidingia sp. and Urospora spp. However, based on the 5S rDNA, a more resolved DNA marker, only one of the 84 samples belonged to U. prolifera. Combined with the previous reports, it is likely that U. prolifera bloom in Qingdao sea area might consist of more than one origin, and Porphyra cultivation rafts might be one of the causes. PMID:22858010

  4. Molecular identification of green algae from the rafts based infrastructure of Porphyra yezoensis.


    Shen, Qi; Li, Hongye; Li, Yan; Wang, Zongling; Liu, Jiesheng; Yang, Weidong


    To provide more information on the origin of the Ulva prolifera bloom in Qingdao sea area in China from 2007 to 2011, the diversity of green algae growing on the rafts of Porphyra yezoensis on the coast in Jiangsu Province was investigated based on ITS, rbcL and 5S sequences. Eighty-four of green algal samples from various sites and cruises in 2010 and 2011 were collected. According to ITS and rbcL sequences, samples from the rafts of P. yezoensis fell into four clades: Ulva linza-procera-prolifera (LPP) complex, Ulva flexuosa, Blidingia sp. and Urospora spp. However, based on the 5S rDNA, a more resolved DNA marker, only one of the 84 samples belonged to U. prolifera. Combined with the previous reports, it is likely that U. prolifera bloom in Qingdao sea area might consist of more than one origin, and Porphyra cultivation rafts might be one of the causes.

  5. Comparison of chlorophyll and photosynthesis parameters of floating and attached Ulva prolifera.


    Lin, Apeng; Shen, Songdong; Wang, Guangce; Yi, Qianqian; Qiao, Hongjin; Niu, Jianfeng; Pan, Guanghua


    In mid-May 2008 a serious green tide caused mainly by floating Ulva prolifera (Müller) J. Agardh (Chlorophyta, Ulvales) thalli struck the coastal area of Qingdao, China. To understand the present physiological conditions of the floating alga, in this work both laboratory and field investigations were conducted on the floating U. prolifera thalli in comparison with the attached U. prolifera thalli collected from the area. The floating thalli of three distinctively different colors and attached thalli at three different stages of sporangium formation process were characterized under a microscope, while their photosynthetic parameters were determined with chlorophyll fluorescence technology. On the other hand, the sporangium formation status of the floating U. prolifera thalli was surveyed both in the laboratory and in the field. Comparisons showed that both of the paired morphological characteristics and the paired physiological parameters of the floating and attached U. prolifera thalli were consistent. Furthermore, some spores were confirmed in the field and some motile particles were found within the floating thalli. These results suggest that the floating U. prolifera thalli with different colors could be at different stages of sporangium formation. However, our results also showed that the floating alga thalli have only a limited reproductive potential. This might limit the duration and the further geographic expansion of the green algal bloom.

  6. Seasonal changes in nutrient limitation and nitrate sources in the green macroalga Ulva lactuca at sites with and without green tides in a northeastern Pacific embayment.


    Van Alstyne, Kathryn L


    In Penn Cove, ulvoid green algal mats occur annually. To examine seasonal variation in their causes, nitrogen and carbon were measured in Ulva lactuca in May, July, and September and stable nitrogen and oxygen isotope ratios were quantified in U. lactuca, Penn Cove seawater, upwelled water from Saratoga Passage, water near the Skagit River outflow, and effluents from wastewater treatment facilities. Ulvoid growth was nitrogen limited and the sources of nitrogen used by the algae changed during the growing season. Algal nitrogen concentrations were 0.85-4.55% and were highest in September and at sites where algae were abundant. Upwelled waters were the primary nitrogen source for the algae, but anthropogenic sources also contributed to algal growth towards the end of the growing season. This study suggests that small nitrogen inputs can result in crossing a "tipping point", causing the release of nutrient limitation and localized increases in algal growth. PMID:26725866

  7. Carcinoplax fasciata, a new species of deep-water goneplacid crab from southwestern India (Crustacea: Decapoda: Brachyura: Goneplacoidea).


    Ng, Peter K L; Kumar, Appukuttannair Biju


    A new species of Carcinoplax H. Milne Edwards, 1852 (family Goneplacidae) is described from southern India. Carcinoplax fasciata n. sp. is closest to C. specularis Rathbun, 1914, but can be distinguished by its different coloration in life as well as structures of the carapace surface, anterolateral armature, supraorbital margin, chela and male first gonopod.

  8. Carcinoplax fasciata, a new species of deep-water goneplacid crab from southwestern India (Crustacea: Decapoda: Brachyura: Goneplacoidea).


    Ng, Peter K L; Kumar, Appukuttannair Biju


    A new species of Carcinoplax H. Milne Edwards, 1852 (family Goneplacidae) is described from southern India. Carcinoplax fasciata n. sp. is closest to C. specularis Rathbun, 1914, but can be distinguished by its different coloration in life as well as structures of the carapace surface, anterolateral armature, supraorbital margin, chela and male first gonopod. PMID:27515615



    Mareš, Jan; Leskinen, Elina; Sitkowska, Małgorzata; Skácelová, Olga; Blomster, Jaanika


    A set of 18 freshwater and morphologically similar marine samples of Ulva were collected from inland and coastal waters throughout Europe to assess their taxonomic identity and invasive potential. An additional 11 specimens were obtained from herbaria. The material was studied using a combination of classical morphological methods and molecular techniques; the latter included sequencing of the nuclear internal transcribed spacer (ITS) region (ITS1-5.8S-ITS2) and the chloroplast RUBISCO LSU (rbcL) gene and comparison of the ITS2 secondary structure predictions. Based on classical methods, all the specimens could be determined as U. flexuosa Wulfen and could be further divided into three groups matching three infraspecific taxa. This pattern was generally well supported by molecular phylogenetic analyses. All sequenced samples formed a monophyletic lineage within Ulva, showing a putative synapomorphy in the ITS2 secondary structure. The individual subspecies corresponded to phylogenetic clusters within this lineage. In freshwater habitats, the dominant taxon was U. flexuosa subsp. pilifera, but subsp. paradoxa was also occasionally recorded. In marine habitats, only U. flexuosa subsp. flexuosa and subsp. paradoxa were located. These findings support the view that U. flexuosa subsp. pilifera is primarily a freshwater alga that probably dominates in Europe. As confirmed by the study of herbarium specimens, U. flexuosa should be regarded as indigenous, although it has a tendency to form blooms under certain conditions. Besides clarifying the identity of prevailing European freshwater Ulva, the study provides novel data concerning the distribution and morphological plasticity within the U. flexuosa complex.

  10. Cultivation of macroscopic marine algae

    SciTech Connect

    Ryther, J.H.


    The red alga Gracilaria tikvahiae may be grown outdoors year-round in central Florida with yields averaging 35.5 g dry wt/m/sup 2/.day, greater than the most productive terrestrial plants. This occurs only when the plants are in a suspended culture, with vigorous aeration and an exchange of 25 or more culture volumes of enriched seawater per day, which is not cost-effective. A culture system was designed in which Gracilaria, stocked at a density of 2 kg wet wt/m/sup 2/, grows to double its biomass in one to two weeks; it is then harvested to its starting density, and anaerobically digested to methane. The biomass is soaked for 6 hours in the digester residue, storing enough nutrients for two weeks' growth in unenriched seawater. The methane is combusted for energy and the waste gas is fed to the culture to provide mixing and CO/sub 2/, eliminating the need for aeration and seawater exchange. The green alga Ulva lactuca, unlike Gracilaria, uses bicarbonate as a photosynthesis carbon source, and can grow at high pH, with little or no free CO/sub 2/. It can therefore produce higher yields than Gracilaria in low water exchange conditions. It is also more efficiently converted to methane than is Gracilaria, but cannot tolerate Florida's summer temperatures so cannot be grown year-round. Attempts are being made to locate or produce a high-temperature tolerant strain.

  11. The Study of Algae

    ERIC Educational Resources Information Center

    Rushforth, Samuel R.


    Included in this introduction to the study of algae are drawings of commonly encountered freshwater algae, a summary of the importance of algae, descriptions of the seven major groups of algae, and techniques for collection and study of algae. (CS)

  12. Antimicrobial activity of Ulva reticulata and its endophytes

    NASA Astrophysics Data System (ADS)

    Dhanya, K. I.; Swati, V. I.; Vanka, Kanth Swaroop; Osborne, W. J.


    Seaweeds are known to exhibit various antimicrobial properties, since it harbours an enormous range of indigenous bioactive compounds. The emergence of drug resistant strains has directed to the identification of prospective metabolites from seaweed and its endophytes, thereby exploiting the properties in resisting bacterial diseases. The current study was aimed to assess the antimicrobial activity of extracts obtained from Ulva reticulate, for which metabolites of Ulva reticulata and its endophytes were extracted and assessed against human pathogens like Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Salmonella typhi, and Bacillus subtilis. It was observed that the hexane extract of isolate VITDSJ2 was effective against all the tested pathogens but a significant inhibition was observed for Staphylococcus aureus and Escherichia coli. Further, Gas chromatography coupled with Mass spectroscopy (GC-MS) revealed the existence of phenol, 3, 5-bis (1, 1-dimethylethyl) in the crude hexane extract which is well-known to possess antibacterial activity. The effective isolate VITDSJ2 was identified to be the closest neighbour of Pseudomonas stutzeri by phenotypic and genotypic methods. The crude extracts of the seaweed Ulva reticulata was also screened for antibacterial activity and the hexane extract was effective in showing inhibition against all the tested pathogens. The compound in the crude extract of Ulva reticulata was identified as hentriacontane using GC-MS. The extracts obtained from dichloromethane did not show significant activity in comparison with the hexane extracts. Hence the metabolites of Ulva reticulata and the bacterial secondary metabolites of the endophytes could be used in the treatment of bacterial infections.

  13. Feeding preferences and the nutritional value of tropical algae for the abalone Haliotis asinina.


    Angell, Alex R; Pirozzi, Igor; de Nys, Rocky; Paul, Nicholas A


    Understanding the feeding preferences of abalone (high-value marine herbivores) is integral to new species development in aquaculture because of the expected link between preference and performance. Performance relates directly to the nutritional value of algae--or any feedstock--which in turn is driven by the amino acid content and profile, and specifically the content of the limiting essential amino acids. However, the relationship between feeding preferences, consumption and amino acid content of algae have rarely been simultaneously investigated for abalone, and never for the emerging target species Haliotis asinina. Here we found that the tropical H. asinina had strong and consistent preferences for the red alga Hypnea pannosa and the green alga Ulva flexuosa, but no overarching relationship between protein content (sum of amino acids) and preference existed. For example, preferred Hypnea and Ulva had distinctly different protein contents (12.64 vs. 2.99 g 100 g(-1)) and the protein-rich Asparagopsis taxiformis (>15 g 100 g(-1) of dry weight) was one of the least preferred algae. The limiting amino acid in all algae was methionine, followed by histidine or lysine. Furthermore we demonstrated that preferences can largely be removed using carrageenan as a binder for dried alga, most likely acting as a feeding attractant or stimulant. The apparent decoupling between feeding preference and algal nutritive values may be due to a trade off between nutritive values and grazing deterrence associated with physical and chemical properties.

  14. Feeding Preferences and the Nutritional Value of Tropical Algae for the Abalone Haliotis asinina

    PubMed Central

    Angell, Alex R.; Pirozzi, Igor; de Nys, Rocky; Paul, Nicholas A.


    Understanding the feeding preferences of abalone (high-value marine herbivores) is integral to new species development in aquaculture because of the expected link between preference and performance. Performance relates directly to the nutritional value of algae – or any feedstock – which in turn is driven by the amino acid content and profile, and specifically the content of the limiting essential amino acids. However, the relationship between feeding preferences, consumption and amino acid content of algae have rarely been simultaneously investigated for abalone, and never for the emerging target species Haliotis asinina. Here we found that the tropical H. asinina had strong and consistent preferences for the red alga Hypnea pannosa and the green alga Ulva flexuosa, but no overarching relationship between protein content (sum of amino acids) and preference existed. For example, preferred Hypnea and Ulva had distinctly different protein contents (12.64 vs. 2.99 g 100 g−1) and the protein-rich Asparagopsis taxiformis (>15 g 100 g−1 of dry weight) was one of the least preferred algae. The limiting amino acid in all algae was methionine, followed by histidine or lysine. Furthermore we demonstrated that preferences can largely be removed using carrageenan as a binder for dried alga, most likely acting as a feeding attractant or stimulant. The apparent decoupling between feeding preference and algal nutritive values may be due to a trade off between nutritive values and grazing deterrence associated with physical and chemical properties. PMID:22719967

  15. Prevalence and mechanism of polyunsaturated aldehydes production in the green tide forming macroalgal genus Ulva (Ulvales, Chlorophyta).


    Alsufyani, Taghreed; Engelen, Aschwin H; Diekmann, Onno E; Kuegler, Stefan; Wichard, Thomas


    Lipoxygenase/hydroperoxide lyase mediated transformations convert polyunsaturated fatty acids into various oxylipins. First, lipoxygenases catalyze fatty acid oxidation to fatty acid hydroperoxides. Subsequently, breakdown reactions result in a wide array of metabolites with multiple physiological and ecological functions. These fatty acid transformations are highly diverse in marine algae and play a crucial rule in e.g., signaling, chemical defense, and stress response often mediated through polyunsaturated aldehydes (PUAs). In this study, green tide-forming macroalgae of the genius Ulva (Chlorophyta) were collected at various sampling sites in the lagoon of the Ria Formosa (Portugal) and were surveyed for PUAs. We demonstrated that sea-lettuce like but not tube-like morphotypes produce elevated amounts of volatile C10-polyunsaturated aldehydes (2,4,7-decatrienal and 2,4-decadienal) upon tissue damage. Moreover, morphogenetic and phylogenetic analyses of the collected Ulva species revealed chemotaxonomic significance of the perspective biosynthetic pathways. The aldehydes are derived from omega-3 and omega-6 polyunsaturated fatty acids (PUFA) with 20 or 18 carbon atoms including eicosapentaenoic acid (C20:5 n-3), arachidonic acid (C20:4 n-6), stearidonic acid (C18:4 n-3), and γ-linolenic acid (C18:3 n-6). We present first evidences that lipoxygenase-mediated (11-LOX and 9-LOX) eicosanoid and octadecanoid pathways catalyze the transformation of C20- and C18-polyunsaturated fatty acids into PUAs and concomitantly into short chain hydroxylated fatty acids.

  16. Genetic diversity of Ulva prolifera population in Qingdao coastal water during the green algal blooms revealed by microsatellite.


    Li, Yue; Huang, Hong-Jia; Li, Hongye; Liu, Jiesheng; Yang, Weidong


    Green tides have occurred in Qingdao coast in China for seven consecutive years from 2007 to 2013. To provide information on the genetic structure of these blooms, 210 free-floating green algae samples isolated from the green tide in Qingdao coast on June 19, 2013 were identified based on the ITS, rbcL and 5S sequence, and genetic diversity was investigated by microsatellite markers. According to ITS, rbcL and 5S sequence, all the 210 samples belonged to Ulva prolifera. Nei's genetic diversity and Shannon index estimated using eight microsatellite markers indicated that the genetic diversity of U. prolifera population within Qingdao's green bloom in 2013 was low. Taking into account previous reports about life history and physiology of U. prolifera, we proposed that the limited origin area of the free-floating biomass and asexual reproduction of U. prolifera might be responsible for the lower diversity of free floating U. prolifera. PMID:27412412

  17. Genetic diversity of Ulva prolifera population in Qingdao coastal water during the green algal blooms revealed by microsatellite.


    Li, Yue; Huang, Hong-Jia; Li, Hongye; Liu, Jiesheng; Yang, Weidong


    Green tides have occurred in Qingdao coast in China for seven consecutive years from 2007 to 2013. To provide information on the genetic structure of these blooms, 210 free-floating green algae samples isolated from the green tide in Qingdao coast on June 19, 2013 were identified based on the ITS, rbcL and 5S sequence, and genetic diversity was investigated by microsatellite markers. According to ITS, rbcL and 5S sequence, all the 210 samples belonged to Ulva prolifera. Nei's genetic diversity and Shannon index estimated using eight microsatellite markers indicated that the genetic diversity of U. prolifera population within Qingdao's green bloom in 2013 was low. Taking into account previous reports about life history and physiology of U. prolifera, we proposed that the limited origin area of the free-floating biomass and asexual reproduction of U. prolifera might be responsible for the lower diversity of free floating U. prolifera.

  18. Strong Endemism of Bloom-Forming Tubular Ulva in Indian West Coast, with Description of Ulva paschima Sp. Nov. (Ulvales, Chlorophyta)

    PubMed Central

    Bast, Felix; John, Aijaz Ahmad; Bhushan, Satej


    Ulva intestinalis and Ulva compressa are two bloom-forming morphologically-cryptic species of green seaweeds widely accepted as cosmopolitan in distribution. Previous studies have shown that these are two distinct species that exhibit great morphological plasticity with changing seawater salinity. Here we present a phylogeographic assessment of tubular Ulva that we considered belonging to this complex collected from various marine and estuarine green-tide occurrences in a ca. 600 km stretch of the Indian west coast. Maximum Likelihood and Bayesian Inference phylogenetic reconstructions using ITS nrDNA revealed strong endemism of Indian tubular Ulva, with none of the Indian isolates forming part of the already described phylogenetic clades of either U. compressa or U. intestinalis. Due to the straightforward conclusion that Indian isolates form a robust and distinct phylogenetic clade, a description of a new bloom-forming species, Ulva paschima Bast, is formally proposed. Our phylogenetic reconstructions using Neighbor-Joining method revealed evolutionary affinity of this new species with Ulva flexuosa. This is the first molecular assessment of Ulva from the Indian Subcontinent. PMID:25329833

  19. Isolation, expression and characterization of rbcL gene from Ulva prolifera J. Agardh (Ulvophyceae, Chlorophyta)

    NASA Astrophysics Data System (ADS)

    Shao, Zhanru; Li, Wei; Guo, Hui; Duan, Delin


    Ulva prolifera is a typical green alga in subtidal areas and can grow tremendously fast. A highly efficient Rubisco enzyme which is encoded by UpRbcL gene may contribute to the rapid growth. In this study, the full-length UpRbcL open reading frame (ORF) was identified, which encoded a protein of 474 amino acids. Phylogenetic analysis of UpRbcL sequences revealed that Chlorophyta had a closer genetic relationship with higher plants than with Rhodophyta and Phaeophyta. The two distinct residues (aa11 and aa91) were presumed to be unique for Rubisco catalytic activity. The predicted three-dimensional structure showed that one α/β-barrel existed in the C-terminal region, and the sites for Mg2+ coordination and CO2 fixation were also located in this region. Gene expression profile indicated that UpRbcL was expressed at a higher level under light exposure than in darkness. When the culture temperature reached 35°C, the expression level of UpRbcL was 2.5-fold lower than at 15°C, and the carboxylase activity exhibited 13.8-fold decrease. UpRbcL was heterologously expressed in E. coli and was purified by Ni2+ affinity chromatography. The physiological and biochemical characterization of recombinant Rubisco will be explored in the future.

  20. Intra-organismal distribution of tetrodotoxin in two species of blue-ringed octopuses (Hapalochlaena fasciata and H. lunulata).


    Williams, Becky L; Caldwell, Roy L


    In-depth studies on the intra-organismal distribution of toxin may yield valuable clues about potential ecological functions. The distribution of tetrodotoxin (TTX) in previously unexamined tissues of two species of blue-ringed octopuses, wild-caught Hapalochlaena fasciata and Hapalochlaena lunulata from the aquarium industry, was surveyed. Tissues from each individual were examined separately. Tetrodotoxin was detected in posterior salivary gland (PSG), arm, mantle, anterior salivary glands, digestive gland, testes contents, brachial heart, nephridia, gill, and oviducal gland of H. fasciata. By contrast TTX was found only in the PSG, mantle tissue, and ink of H. lunulata. The highest concentrations of TTX resided in the PSG of both species; however, the arms and mantle contained the greatest absolute amounts of TTX. Minimum total amounts of TTX per octopus ranged from 60 to 405 microg in H. fasciata and from 0 to 174 microg in H. lunulata and correlated well with the amounts in the PSG. Transport of TTX in the blood is loosely suggested by the presence of the toxin in blood-rich organs such as the gill and brachial hearts. The distributional data also suggest both offensive and defensive functions of TTX.

  1. Intra-organismal distribution of tetrodotoxin in two species of blue-ringed octopuses (Hapalochlaena fasciata and H. lunulata).


    Williams, Becky L; Caldwell, Roy L


    In-depth studies on the intra-organismal distribution of toxin may yield valuable clues about potential ecological functions. The distribution of tetrodotoxin (TTX) in previously unexamined tissues of two species of blue-ringed octopuses, wild-caught Hapalochlaena fasciata and Hapalochlaena lunulata from the aquarium industry, was surveyed. Tissues from each individual were examined separately. Tetrodotoxin was detected in posterior salivary gland (PSG), arm, mantle, anterior salivary glands, digestive gland, testes contents, brachial heart, nephridia, gill, and oviducal gland of H. fasciata. By contrast TTX was found only in the PSG, mantle tissue, and ink of H. lunulata. The highest concentrations of TTX resided in the PSG of both species; however, the arms and mantle contained the greatest absolute amounts of TTX. Minimum total amounts of TTX per octopus ranged from 60 to 405 microg in H. fasciata and from 0 to 174 microg in H. lunulata and correlated well with the amounts in the PSG. Transport of TTX in the blood is loosely suggested by the presence of the toxin in blood-rich organs such as the gill and brachial hearts. The distributional data also suggest both offensive and defensive functions of TTX. PMID:19481562

  2. Changes to the biomass and species composition of Ulva sp. on Porphyra aquaculture rafts, along the coastal radial sandbank of the Southern Yellow Sea.


    Huo, Yuanzi; Han, Hongbin; Shi, Honghua; Wu, Hailong; Zhang, Jianheng; Yu, Kefeng; Xu, Ren; Liu, Caicai; Zhang, Zhenglong; Liu, Kefu; He, Peimin; Ding, Dewen


    Compositions, changes and biomass of attached Ulva species on Porphyra rafts along the radial sandbank in the Yellow Sea were investigated, and potential contributions to green tides was analyzed. Ulva prolifera, Ulva flexuosa and Ulva linza were all appeared throughout the investigated period. U. prolifera and U. flexuosa dominated attached Ulva population on Porphyra rafts. Attached Ulva species biomass showed obviously spatial and temporal variations. Temperature, Ulva microscopic propagules and human activities were main factors to influence attached Ulva species biomass. The total attached Ulva species biomass was more than 20,000 fresh weight tons in April, and the green tide causative species U. prolifera accounted 51.03% in April 2013 before green tides occurred. The high biomass of attached Ulva species would contribute most to green tides in the Yellow Sea. But how attached Ulva species on Porphyra rafts contributing to green tides in the Yellow Sea should be further studied.

  3. Changes to the biomass and species composition of Ulva sp. on Porphyra aquaculture rafts, along the coastal radial sandbank of the Southern Yellow Sea.


    Huo, Yuanzi; Han, Hongbin; Shi, Honghua; Wu, Hailong; Zhang, Jianheng; Yu, Kefeng; Xu, Ren; Liu, Caicai; Zhang, Zhenglong; Liu, Kefu; He, Peimin; Ding, Dewen


    Compositions, changes and biomass of attached Ulva species on Porphyra rafts along the radial sandbank in the Yellow Sea were investigated, and potential contributions to green tides was analyzed. Ulva prolifera, Ulva flexuosa and Ulva linza were all appeared throughout the investigated period. U. prolifera and U. flexuosa dominated attached Ulva population on Porphyra rafts. Attached Ulva species biomass showed obviously spatial and temporal variations. Temperature, Ulva microscopic propagules and human activities were main factors to influence attached Ulva species biomass. The total attached Ulva species biomass was more than 20,000 fresh weight tons in April, and the green tide causative species U. prolifera accounted 51.03% in April 2013 before green tides occurred. The high biomass of attached Ulva species would contribute most to green tides in the Yellow Sea. But how attached Ulva species on Porphyra rafts contributing to green tides in the Yellow Sea should be further studied. PMID:25691340

  4. Feeding preferences of mesograzers on aquacultured Gracilaria and sympatric algae

    PubMed Central

    Cruz-Rivera, Edwin; Friedlander, Michael


    While large grazers can often be excluded effectively from algal aquaculture operations, smaller herbivores such as small crustaceans and gastropods may be more difficult to control. The susceptibility of three Gracilaria species to herbivores was evaluated in multiple-choice experiments with the amphipod Ampithoe ramondi and the crab Acanthonyx lunulatus. Both mesograzers are common along the Mediterranean coast of Israel. When given a choice, the amphipod preferred to consume Gracilaria lemaneiformis significantly more than either G. conferta or G. cornea. The crab, however, consumed equivalent amounts of G. lemaneiformis and G. conferta, but did not consume G. cornea. Organic content of these algae, an important feeding cue for some mesograzers, could not account for these differences. We further assessed the susceptibility of a candidate species for aquaculture, G. lemaneiformis, against local algae, including common epiphytes. When given a choice of four algae, amphipods preferred the green alga Ulva lactuca over Jania rubens. However, consumption of U. lactuca was equivalent to those of G. lemaneiformis and Padina pavonica. In contrast, the crab showed a marked and significant preference for G. lemaneiformis above any of the other three algae offered. Our results suggest that G. cornea is more resistant to herbivory from common mesograzers and that, contrary to expectations, mixed cultures or epiphyte growth on G. lemaneiformis cannot reduce damage to this commercially appealing alga if small herbivores are capable of recruiting into culture ponds. Mixed cultures may be beneficial when culturing other Gracilaria species. PMID:22711945

  5. Effects of chronic dietary exposure to trace elements on banded water snakes (Nerodia fasciata).


    Hopkins, William A; Roe, John H; Snodgrass, Joel W; Staub, Brandon P; Jackson, Brian P; Congdon, Justin D


    Little currently is known about the accumulation or effects of contaminants on reptiles. To date, most studies examining reptile exposure to trace elements report tissue burdens of field-captured animals, but seldom provide insight into the dose, duration, or mode of exposure involved. For two years, we fed juvenile banded water snakes (Nerodia fasciata) prey items collected from a coal ash-contaminated site that contained elevated levels of As, Cd, Cu, Se, Sr, and V. With the exception of Cu, snakes accumulated significant concentrations of elements, usually in a dose-dependent manner. Accumulation varied significantly among liver, kidney, and gonads, and in most cases between sexes. Selenium accumulation was most notable, greatly exceeding established toxicity thresholds for other vertebrates. Despite the high concentrations of pollutants accumulated, snakes exposed to the contaminated diet survived through the study and exhibited normal food consumption, growth, condition factor, overwinter survival and mass loss, metabolic rate, and gonadosomatic index. The results of this study confirm that diet can be a significant route of exposure to trace elements in snakes and indicate that further studies on snakes are warranted to better understand their responses to contaminants.

  6. Ecology and control of an introduced population of Southern Watersnakes (Nerodia fasciata) in southern California

    USGS Publications Warehouse

    Reed, Robert; Todd, Brian D; Miano, Oliver J.; Canfield, Mark; Fisher, Robert N.; McMartin, Louanne


    Native to the southeastern United States, Southern Watersnakes (Nerodia fasciata) are known from two sites in California, but their ecological impacts are poorly understood. We investigated the ecology of Southern Watersnakes in Machado Lake, Harbor City, Los Angeles County, California, including an assessment of control opportunities. We captured 306 watersnakes as a result of aquatic trapping and hand captures. We captured snakes of all sizes (162–1063 mm snout–vent length [SVL], 3.5–873.3 g), demonstrating the existence of a well-established population. The smallest reproductive female was 490 mm SVL and females contained 12–46 postovulatory embryos (mean  =  21). Small watersnakes largely consumed introduced Western Mosquitofish (Gambusia affinis), while larger snakes specialized on larval and metamorph American Bullfrogs (Lithobates catesbeianus) and Green Sunfish (Lepomis cyanellus). Overall capture per unit effort (CPUE) in traps declined with time during an intensive 76-d trapping bout, but CPUE trends varied considerably among traplines and it is unlikely that the overall decline in CPUE represented a major decrease in the snake population size. Although we found no direct evidence that Southern Watersnakes are affecting native species in Machado Lake, this population may serve as a source for intentional or unintentional transportation of watersnakes to bodies of water containing imperiled native prey species or potential competitors.

  7. Population structure, dynamics and production of Hydrobia ulvae (Pennant) (Mollusca: Prosobranchia) along an eutrophication gradient in the Mondego estuary (Portugal)

    NASA Astrophysics Data System (ADS)

    Lillebø, Ana Isabel; Pardal, Miguel Ângelo; Marques, João Carlos


    Eutrophication in the Mondego estuary gave rise to qualitative changes in the benthic community, involving the replacement of eelgrass, Zostera noltii, by green algae such as Enteromorpha spp. and Ulva sp. It seems reasonable to assume that, through time, such changes may determine a selected new trophic structure. Hydrobia ulvae, a dominant species in terms of abundance and biomass, was studied with regard to life history, population dynamics and productivity in relation to changing environmental conditions along the eutrophication gradient. The purpose was to examine to what extent this species may adapt to the new emergent conditions. During the study period, H. ulvae population exhibited both temporal and spatial density variations. The settlement pattern did not change along the eutrophication gradient, and took place in March, June, July and September. However, the population was denser in the less eutrophied areas, corresponding to Z. noltii meadows, when compared to the eutrophied ones, where Enteromorpha spp. blooms are usually observed. Growth was continuous through life but growth rates were higher during spring, decreased from early summer to mid fall and practically ceased during winter, and then gradually increased again up to spring. Life span was estimated as 21 ± 3 months. Growth productivity (P) was estimated as 93.7 g AFDW .m -2.year -1in the Z. noltii meadows, 15.2 g AFDW .m -2.year -1in the eutrophied area, and 30.3 g AFDW .m -2.year -1in the strongly eutrophied area. Elimination productivity (E) was estimated as 30.0 g AFDW .m -2.year -1in the Z. noltii meadows, 51.8 g AFDW .m -2.year -1in the eutrophied area, and 97.5 g AFDW .m -2.year -1in the strongly eutrophied area. The average annual biomass ( overlineB) (standing stock) of the population was estimated as 70.2 g AFDW .m -2in the Z. noltii meadows, 5.5 g AFDW .m -2in the eutrophied area, and 7.4 g AFDW .m -2in the strongly eutrophied area. ratios were estimated as 1.3 and 4.8 in the Z

  8. Projecting Invasion Risk of Non-Native Watersnakes (Nerodia fasciata and Nerodia sipedon) in the Western United States

    PubMed Central

    Rose, Jonathan P.; Todd, Brian D.


    Species distribution models (SDMs) are increasingly used to project the potential distribution of introduced species outside their native range. Such studies rarely explicitly evaluate potential conflicts with native species should the range of introduced species expand. Two snake species native to eastern North America, Nerodia fasciata and Nerodia sipedon, have been introduced to California where they represent a new stressor to declining native amphibians, fish, and reptiles. To project the potential distributions of these non-native watersnakes in western North America, we built ensemble SDMs using MaxEnt, Boosted Regression Trees, and Random Forests and habitat and climatic variables. We then compared the overlap between the projected distribution of invasive watersnakes and the distributions of imperiled native amphibians, fish, and reptiles that can serve as prey or competitors for the invaders, to estimate the risk to native species posed by non-native watersnakes. Large areas of western North America were projected to be climatically suitable for both species of Nerodia according to our ensemble SDMs, including much of central California. The potential distributions of both N. fasciata and N. sipedon overlap extensively with the federally threatened Giant Gartersnake, Thamnophis gigas, which inhabits a similar ecological niche. N. fasciata also poses risk to the federally threatened California Tiger Salamander, Ambystoma californiense, whereas N. sipedon poses risk to some amphibians of conservation concern, including the Foothill Yellow-legged Frog, Rana boylii. We conclude that non-native watersnakes in California can likely inhabit ranges of several native species of conservation concern that are expected to suffer as prey or competing species for these invaders. Action should be taken now to eradicate or control these invasions before detrimental impacts on native species are widespread. Our methods can be applied broadly to quantify the risk posed by

  9. On the recurrent Ulva prolifera blooms in the Yellow Sea and East China Sea

    NASA Astrophysics Data System (ADS)

    Hu, Chuanmin; Li, Daqiu; Chen, Changsheng; Ge, Jianzhong; Muller-Karger, Frank E.; Liu, Junpeng; Yu, Feng; He, Ming-Xia


    A massive bloom of the green macroalgae Ulva prolifera (previously known as Enteromorpha prolifera) occurred in June 2008 in the Yellow Sea (YS), resulting in perhaps the largest "green tide" event in history. Using a novel index (Floating Algae Index) and multiresolution remote sensing data from MODIS and Landsat, we show that U. prolifera patches appeared nearly every year between April and July 2000-2009 in the YS and/or East China Sea (ECS), which all originated from the nearshore Subei Bank. A finite volume numerical circulation model, driven by realistic forcing and boundary conditions, confirmed this finding. Analysis of meteorological/environmental data and information related to local aquaculture activities strongly supports the hypothesis that the recurrent U. prolifera in the YS and ECS resulted from aquaculture of the seaweed Porphyra yezoensis (or nori) conducted along the 200 km shoreline of the Subei Bank north of the Changjiang (Yangtze) River mouth. Given the continuous growth in aquaculture efforts in the region, similar macroalgae bloom events, such as the summer 2008 event, are likely to occur in the future, particularly between May and July. This was confirmed by the 2009 bloom event in the same regions and the same period. The profit of the local P. yezoensis aquaculture industry (˜16,000 Ha in 2007) is estimated as U.S. 53 million, yet the cost to manage the impact of the summer 2008 U. prolifera bloom exceeded U.S. 100 million. Therefore, better strategies are required to balance the economic benefit of seaweed aquaculture and the costs of environmental impacts.

  10. AfAP2-1, An Age-Dependent Gene of Aechmea fasciata, Responds to Exogenous Ethylene Treatment

    PubMed Central

    Lei, Ming; Li, Zhi-Ying; Wang, Jia-Bin; Fu, Yun-Liu; Ao, Meng-Fei; Xu, Li


    The Bromeliaceae family is one of the most morphologically diverse families with a pantropical distribution. To schedule an appropriate flowering time for bromeliads, ethylene is commonly used to initiate flower development in adult plants. However, the mechanism by which ethylene induces flowering in adult bromeliads remains unknown. Here, we identified an APETALA2 (AP2)-like gene, AfAP2-1, in Aechmea fasciata. AfAP2-1 contains two AP2 domains and is a nuclear-localized protein. It functions as a transcriptional activator, and the activation domain is located in the C-terminal region. The expression level of AfAP2-1 is higher in juvenile plants than in adult plants, and the AfAP2-1 transcript level was rapidly and transiently reduced in plants treated with exogenous ethylene. Overexpression of AfAP2-1 in Arabidopsis thaliana results in an extremely delayed flowering phenotype. These results suggested that AfAP2-1 responds to ethylene and is a putative age-dependent flowering regulator in A. fasciata. PMID:26927090

  11. AfAP2-1, An Age-Dependent Gene of Aechmea fasciata, Responds to Exogenous Ethylene Treatment.


    Lei, Ming; Li, Zhi-Ying; Wang, Jia-Bin; Fu, Yun-Liu; Ao, Meng-Fei; Xu, Li


    The Bromeliaceae family is one of the most morphologically diverse families with a pantropical distribution. To schedule an appropriate flowering time for bromeliads, ethylene is commonly used to initiate flower development in adult plants. However, the mechanism by which ethylene induces flowering in adult bromeliads remains unknown. Here, we identified an APETALA2 (AP2)-like gene, AfAP2-1, in Aechmea fasciata. AfAP2-1 contains two AP2 domains and is a nuclear-localized protein. It functions as a transcriptional activator, and the activation domain is located in the C-terminal region. The expression level of AfAP2-1 is higher in juvenile plants than in adult plants, and the AfAP2-1 transcript level was rapidly and transiently reduced in plants treated with exogenous ethylene. Overexpression of AfAP2-1 in Arabidopsis thaliana results in an extremely delayed flowering phenotype. These results suggested that AfAP2-1 responds to ethylene and is a putative age-dependent flowering regulator in A. fasciata. PMID:26927090

  12. Methods for the induction of reproduction in a tropical species of filamentous ulva.


    Carl, Christina; de Nys, Rocky; Lawton, Rebecca J; Paul, Nicholas A


    The green seaweed Ulva is a major fouling organism but also an edible aquaculture product in Asia. This study quantified for the first time the effect of key factors on the reproduction of a tropical species of filamentous Ulva (Ulva sp. 3). The controlled timing of release of swarmers (motile reproductive bodies) was achieved when experiments were initiated in the early afternoon by exposing the thalli to a temperature shock (4°C) for 10 min and subsequently placing them into autoclaved filtered seawater under a 12 h light: 12 h dark photoperiod at 25°C. The release of swarmers then peaked two days after initiation. In contrast, segmentation, dehydration, salinity or time of initiation of experiments had no effect of any magnitude on reproduction. The released swarmers were predominantly biflagellate (95%), negatively phototactic and germinated without complementary gametes. This indicates that Ulva sp. 3 has a simple asexual life history dominated by biflagellate zoids.

  13. Metal accumulation and oxidative stress responses in Ulva spp. in the presence of nocturnal pulses of metals from sediment: a field transplantation experiment under eutrophic conditions.


    Pereira, Patrícia; de Pablo, Hilda; Guilherme, Sofia; Carvalho, Susana; Santos, Maria Ana; Vale, Carlos; Pacheco, Mário


    In aquatic systems under eutrophic conditions, remobilization of metals from sediment to the overlying water may occur. Consequently, adaptive responses of local organisms could result from the accumulation of metals intermittently released from the sediment. In summer 2007, a field transplantation experiment was performed in the Óbidos lagoon (Portugal) with Ulva spp. comprising three short-term exposures (between 15:30-23:30; 23:30-07:30; 07:30-15:30) during a 24-h period. In each period, Ulva spp. was collected at a reference site located in the lower lagoon (LL) and transplanted to a eutrophic site located at the Barrosa branch (BB), characterized by moderate metal contamination. For comparison purposes, macroalgae samples were simultaneously exposed at LL under the same conditions. Both sites were surveyed in short-time scales (2-4 h) for the analysis of the variability of physical-chemical parameters in the water and metal levels in suspended particulate matter. The ratios to Al of particulate Mn, Fe, Cu and Pb increased during the period of lower water oxygenation at the eutrophic site, reaching 751 × 10⁻⁴, 0.67, 12 × 10⁻⁴, 9.9 × 10⁻⁴, respectively, confirming the release of metals from the sediment to water during the night. At the reference site, dissolved oxygen oscillated around 100%, Mn/Al ratios were considerably lower (81 × 10⁻⁴-301 × 10⁻⁴) compared to BB (234 × 10⁻⁴-790 × 10⁻⁴), and no increases of metal/Al ratios were found during the night. In general, algae uptake of Mn, Cu, Fe, Pb and Cd was significantly higher at the eutrophic site compared to the reference site. The results confirmed the potential of Ulva spp. as bioindicator of metal contamination and its capability to respond within short periods. An induction of SOD, an inhibition of CAT and the increase of LPO were recorded in Ulva spp. exposed at BB (between 23:30 and 7:30) probably as a response to the higher incorporation of Mn, Fe and Pb in

  14. Evaluation of the contamination of marine algae (seaweed) from the St. Lawrence River and likely to be consumed by humans

    SciTech Connect

    Phaneuf, D.; Cote, I.; Dumas, P.; Ferron, L.A.; LeBlanc, A.


    The goal of the study was to assess the contamination of marine algae (seaweeds) growing in the St. Lawrence River estuary and Gulf of St. Lawrence and to evaluate the risks to human health from the consumption of these algae. Algae were collected by hand at low tide. A total of 10 sites on the north and south shores of the St. Lawrence as well as in Baie des Chaleurs were sampled. The most frequently collected species of algae were Fucus vesiculosus, Ascophyllum nodosum, Laminaria Longicruris, Palmaria palmata, Ulva lactuca, and Fucus distichus. Alga samples were analyzed for metals iodine, and organochlorines. A risk assessment was performed using risk factors. In general, concentrations in St. Lawrence algae were not very high. Consequently, health risks associated with these compounds in St. Lawrence algae were very low. Iodine concentration, on the other hand, could be of concern with regard to human health. Regular consumption of algae, especially of Laminaria sp., could result in levels of iodine sufficient to cause thyroid problems. For regular consumers, it would be preferable to choose species with low iodine concentrations, such as U. lactuca and P. palmata, in order to prevent potential problems. Furthermore, it would also be important to assess whether preparation for consumption or cooking affects the iodine content of algae. Algae consumption may also have beneficial health effects. Scientific literature has shown that it is a good source of fiber and vitamins, especially vitamin B{sub 12}.

  15. Studies of marine macroalgae: saline desert water cultivation and effects of environmental stress on proximate composition. Final subcontract report. [Gracilaria tikvahiae; Ulva lactuca

    SciTech Connect

    Ryther, J.H.; DeBusk, T.A.; Peterson, J.E.


    The results presented in this report address the growth potential of marine macroalgae cultivated in desert saline waters, and the effects of certain environmental stresses (e.g., nitrogen, salinity, and temperature) on the proximate composition of several marine macroalgae. Two major desert saline water types were assayed for their ability to support the growth of Gracilaria, Ulva, and Caulerpa. Both water types supported short term growth, but long term growth was not supported. Carbohydrate levels in Gracilaria were increased by cultivation under conditions of high salinity, low temperature, and low nitrogen and phosphorous availability. Data suggests that it may be possible to maximize production of useful proximate constituents by cultivating the algae under optimum conditions for growth, and then holding the resulting biomass under the environmental conditions which favor tissue accumulation of the desired storage products. 16 refs., 21 figs., 19 tabs.

  16. Abiotic factors influencing biomass accumulation of green tide causing Ulva spp. on Pyropia culture rafts in the Yellow Sea, China.


    Keesing, John K; Liu, Dongyan; Shi, Yajun; Wang, Yujue


    Annually recurrent green-tides in the Yellow Sea have been shown to result from direct disposal into the sea of fouling Ulva from Pyropia aquaculture. The role abiotic factors play in Ulva biomass accumulation on rafts was studied to find ways to mitigate this problem. Dissolved inorganic nitrogen (DIN) was very high at all sites, but the highest Ulva biomass was associated with the lowest DIN and anthropogenic N. Under luxuriant background nutrient conditions, variability in temperature and periods of emersion, rather than pH, light and salinity determined Ulva biomass. Two dominant species of Ulva displayed differing tolerances to temperature and desiccation which helped explain why Ulva prolifera dominates floating green-tides. Rather than trying to mitigate green-tides only by reducing nutrient pollution, an earlier harvest of Pyropia in southern Jiangsu Province especially before temperatures increase greatly above 10°C during April, could reduce the biomass of U. prolifera disposed from rafts.

  17. Abiotic factors influencing biomass accumulation of green tide causing Ulva spp. on Pyropia culture rafts in the Yellow Sea, China.


    Keesing, John K; Liu, Dongyan; Shi, Yajun; Wang, Yujue


    Annually recurrent green-tides in the Yellow Sea have been shown to result from direct disposal into the sea of fouling Ulva from Pyropia aquaculture. The role abiotic factors play in Ulva biomass accumulation on rafts was studied to find ways to mitigate this problem. Dissolved inorganic nitrogen (DIN) was very high at all sites, but the highest Ulva biomass was associated with the lowest DIN and anthropogenic N. Under luxuriant background nutrient conditions, variability in temperature and periods of emersion, rather than pH, light and salinity determined Ulva biomass. Two dominant species of Ulva displayed differing tolerances to temperature and desiccation which helped explain why Ulva prolifera dominates floating green-tides. Rather than trying to mitigate green-tides only by reducing nutrient pollution, an earlier harvest of Pyropia in southern Jiangsu Province especially before temperatures increase greatly above 10°C during April, could reduce the biomass of U. prolifera disposed from rafts. PMID:26936121

  18. Parameters affecting the analytical profile of fatty acids in the macroalgal genus Ulva.


    McCauley, Janice I; Meyer, Barbara J; Winberg, Pia C; Skropeta, Danielle


    The fatty acids (FA) of Ulva have potential to contribute to nutrition. However the large variability of FA profiles of Ulva species; thus the quality and quantity of FA in relation to nutrition is poorly defined. Herein we investigate the FA profile of 74 cultured Ulva samples crossing five culture regimes, six extraction regimes and four post-harvesting processes. This is compared alongside a comprehensive review of FA profiles of Ulva spp. With regard to the literature, Ulva is characterised by C16:0 (30.5±11.5%), C18:3 n-3 (14.5±6.3%), C18:4 n-3 (12.5±5.4%), C16:4 n-3 (8.9±4.8%) and C18:1 n-7 (10.1±4.0%). The investigated Ulva fell within the reported range of specific FA. High nutrient conditions showed the most desirable FA profile for health, along with the highest total FA content (56mgg(-1) dry weight equivalent) when extracted with an optimised protocol. PMID:27173571

  19. De novo sequencing and analysis of the Ulva linza transcriptome to discover putative mechanisms associated with its successful colonization of coastal ecosystems

    PubMed Central


    Background The green algal genus Ulva Linnaeus (Ulvaceae, Ulvales, Chlorophyta) is well known for its wide distribution in marine, freshwater, and brackish environments throughout the world. The Ulva species are also highly tolerant of variations in salinity, temperature, and irradiance and are the main cause of green tides, which can have deleterious ecological effects. However, limited genomic information is currently available in this non-model and ecologically important species. Ulva linza is a species that inhabits bedrock in the mid to low intertidal zone, and it is a major contributor to biofouling. Here, we presented the global characterization of the U. linza transcriptome using the Roche GS FLX Titanium platform, with the aim of uncovering the genomic mechanisms underlying rapid and successful colonization of the coastal ecosystems. Results De novo assembly of 382,884 reads generated 13,426 contigs with an average length of 1,000 bases. Contiguous sequences were further assembled into 10,784 isotigs with an average length of 1,515 bases. A total of 304,101 reads were nominally identified by BLAST; 4,368 isotigs were functionally annotated with 13,550 GO terms, and 2,404 isotigs having enzyme commission (EC) numbers were assigned to 262 KEGG pathways. When compared with four other full sequenced green algae, 3,457 unique isotigs were found in U. linza and 18 conserved in land plants. In addition, a specific photoprotective mechanism based on both LhcSR and PsbS proteins and a C4-like carbon-concentrating mechanism were found, which may help U. linza survive stress conditions. At least 19 transporters for essential inorganic nutrients (i.e., nitrogen, phosphorus, and sulphur) were responsible for its ability to take up inorganic nutrients, and at least 25 eukaryotic cytochrome P450s, which is a higher number than that found in other algae, may be related to their strong allelopathy. Multi-origination of the stress related proteins, such as glutamate

  20. Algae in Fish Feed: Performances and Fatty Acid Metabolism in Juvenile Atlantic Salmon

    PubMed Central

    Norambuena, Fernando; Hermon, Karen; Skrzypczyk, Vanessa; Emery, James A.; Sharon, Yoni; Beard, Alastair; Turchini, Giovanni M.


    Algae are at the base of the aquatic food chain, producing the food resources that fish are adapted to consume. Previous studies have proven that the inclusion of small amounts (<10% of the diet) of algae in fish feed (aquafeed) resulted in positive effects in growth performance and feed utilisation efficiency. Marine algae have also been shown to possess functional activities, helping in the mediation of lipid metabolism, and therefore are increasingly studied in human and animal nutrition. The aim of this study was to assess the potentials of two commercially available algae derived products (dry algae meal), Verdemin (derived from Ulva ohnoi) and Rosamin (derived from diatom Entomoneis spp.) for their possible inclusion into diet of Atlantic Salmon (Salmo salar). Fish performances, feed efficiency, lipid metabolism and final product quality were assessed to investigated the potential of the two algae products (in isolation at two inclusion levels, 2.5% and 5%, or in combination), in experimental diets specifically formulated with low fish meal and fish oil content. The results indicate that inclusion of algae product Verdemin and Rosamin at level of 2.5 and 5.0% did not cause any major positive, nor negative, effect in Atlantic Salmon growth and feed efficiency. An increase in the omega-3 long-chain polyunsaturated fatty acid (n-3 LC-PUFA) content in whole body of fish fed 5% Rosamin was observed. PMID:25875839

  1. Algae in fish feed: performances and fatty acid metabolism in juvenile Atlantic Salmon.


    Norambuena, Fernando; Hermon, Karen; Skrzypczyk, Vanessa; Emery, James A; Sharon, Yoni; Beard, Alastair; Turchini, Giovanni M


    Algae are at the base of the aquatic food chain, producing the food resources that fish are adapted to consume. Previous studies have proven that the inclusion of small amounts (<10% of the diet) of algae in fish feed (aquafeed) resulted in positive effects in growth performance and feed utilisation efficiency. Marine algae have also been shown to possess functional activities, helping in the mediation of lipid metabolism, and therefore are increasingly studied in human and animal nutrition. The aim of this study was to assess the potentials of two commercially available algae derived products (dry algae meal), Verdemin (derived from Ulva ohnoi) and Rosamin (derived from diatom Entomoneis spp.) for their possible inclusion into diet of Atlantic Salmon (Salmo salar). Fish performances, feed efficiency, lipid metabolism and final product quality were assessed to investigated the potential of the two algae products (in isolation at two inclusion levels, 2.5% and 5%, or in combination), in experimental diets specifically formulated with low fish meal and fish oil content. The results indicate that inclusion of algae product Verdemin and Rosamin at level of 2.5 and 5.0% did not cause any major positive, nor negative, effect in Atlantic Salmon growth and feed efficiency. An increase in the omega-3 long-chain polyunsaturated fatty acid (n-3 LC-PUFA) content in whole body of fish fed 5% Rosamin was observed.

  2. Algae in fish feed: performances and fatty acid metabolism in juvenile Atlantic Salmon.


    Norambuena, Fernando; Hermon, Karen; Skrzypczyk, Vanessa; Emery, James A; Sharon, Yoni; Beard, Alastair; Turchini, Giovanni M


    Algae are at the base of the aquatic food chain, producing the food resources that fish are adapted to consume. Previous studies have proven that the inclusion of small amounts (<10% of the diet) of algae in fish feed (aquafeed) resulted in positive effects in growth performance and feed utilisation efficiency. Marine algae have also been shown to possess functional activities, helping in the mediation of lipid metabolism, and therefore are increasingly studied in human and animal nutrition. The aim of this study was to assess the potentials of two commercially available algae derived products (dry algae meal), Verdemin (derived from Ulva ohnoi) and Rosamin (derived from diatom Entomoneis spp.) for their possible inclusion into diet of Atlantic Salmon (Salmo salar). Fish performances, feed efficiency, lipid metabolism and final product quality were assessed to investigated the potential of the two algae products (in isolation at two inclusion levels, 2.5% and 5%, or in combination), in experimental diets specifically formulated with low fish meal and fish oil content. The results indicate that inclusion of algae product Verdemin and Rosamin at level of 2.5 and 5.0% did not cause any major positive, nor negative, effect in Atlantic Salmon growth and feed efficiency. An increase in the omega-3 long-chain polyunsaturated fatty acid (n-3 LC-PUFA) content in whole body of fish fed 5% Rosamin was observed. PMID:25875839

  3. Microdistribution of tetrodotoxin in two species of blue-ringed octopuses (Hapalochlaena lunulata and Hapalochlaena fasciata) detected by fluorescent immunolabeling.


    Williams, Becky L; Stark, Michael R; Caldwell, Roy L


    Blue-ringed octopuses (genus Hapalochlaena) possess the potent neurotoxin tetrodotoxin (TTX). We examined the microdistribution of TTX in ten tissues of Hapalochlaena lunulata and Hapalochlaena fasciata by immunolabeling for fluorescent light microscopy (FLM). We visualized TTX throughout the posterior salivary gland, but the toxin was concentrated in cells lining the secretory tubules within the gland. Tetrodotoxin was present just beneath the epidermis of the integument (mantle and arms) and also concentrated in channels running through the dermis. This was suggestive of a TTX transport mechanism in the blood of the octopus, which would also explain the presence of the toxin in the blood-rich brachial hearts, gills, nephridia, and highly vascularized Needham's sac (testes contents). We also present the first report of TTX in any cephalopod outside of the genus Hapalochlaena. A specimen of Octopus bocki from French Polynesia contained a small amount of TTX in the digestive gland.

  4. Electroantennogram Responses of the Tea Slug Moth, Iragoides fasciata to Some Plant Volatiles Associated with Tea, Camellia sinensis

    PubMed Central

    Huang, An-Ping; Bao, Xiao-Cun; Liu, Ben-Ying; Wang, Yuan-Jiang; Zhou, Ling-Yun; Ning, J ing; Han, Bao-Yu


    Electroantennogram responses to a wide range of plant volatile compounds that have been identified in tea plants Camellia sinensis L. (Ericales: Theaceae) were recorded from males and females of the tea slug moth, Iragoides fasciata Moore (Lepidoptera: Limacodidae). The responses to 26 compounds, belonging to several chemical classes, and two mixtures were evaluated. The results showed significantly different electroantennogram responses to the different chemicals, as well as significantly different responses according to gender. The green leaf volatile components elicited significantly greater responses in males. In general, the antennae of males were more sensitive, and responded more strongly, to most of the compounds. Responses to sesquiterpenoids were lower in both males and females. Dose-dependent response studies indicated differences in response between genders and concentrations, suggesting the existence of sexual dimorphism. Compounds belonging to the green leaf volatiles class appeared to be important clues in host-plant selection by this oligophagous species. PMID:23414096

  5. Microdistribution of tetrodotoxin in two species of blue-ringed octopuses (Hapalochlaena lunulata and Hapalochlaena fasciata) detected by fluorescent immunolabeling.


    Williams, Becky L; Stark, Michael R; Caldwell, Roy L


    Blue-ringed octopuses (genus Hapalochlaena) possess the potent neurotoxin tetrodotoxin (TTX). We examined the microdistribution of TTX in ten tissues of Hapalochlaena lunulata and Hapalochlaena fasciata by immunolabeling for fluorescent light microscopy (FLM). We visualized TTX throughout the posterior salivary gland, but the toxin was concentrated in cells lining the secretory tubules within the gland. Tetrodotoxin was present just beneath the epidermis of the integument (mantle and arms) and also concentrated in channels running through the dermis. This was suggestive of a TTX transport mechanism in the blood of the octopus, which would also explain the presence of the toxin in the blood-rich brachial hearts, gills, nephridia, and highly vascularized Needham's sac (testes contents). We also present the first report of TTX in any cephalopod outside of the genus Hapalochlaena. A specimen of Octopus bocki from French Polynesia contained a small amount of TTX in the digestive gland. PMID:22983011

  6. Ulva prolifera monitoring by GF-1 wide field-of-view sensor data

    NASA Astrophysics Data System (ADS)

    Liang, Wenxiu; Li, Junsheng; Zhou, Demin; Shen, Qian; Zhang, Fangfang; Zhang, Haobin


    Ulva prolifera, a kind of green macroalgae, is nontoxic itself, however, its bloom has bad effects on the marine environment, coastal scene, water sports and seashore tourism. Monitoring of the Ulva prolifera by remote sensing technology has the advantages of wide coverage, rapidness, low cost and dynamic monitoring over a long period of time. The GF-1 satellite was launched in April 2013, which provides a new suitable remote sensing data source for monitoring the Ulva prolifera. At present, segmenting image with a threshold is the most widely used method in Ulva prolifera extraction by remote sensing data, because it is simple and easy to operate. However, the threshold value is obtained through visual analysis or using a fixed statistical value, and could not be got automatically. Facing this problem, we proposed a new method, which can obtain the segmentation threshold automatically based on the local maximum gradient value. This method adopted the average NDVI value of local maximum gradient points as the threshold, and could get an appropriate segmentation threshold automatically for each image. The preliminary results showed that this method works well in monitoring Ulva prolifera by GF-1 WFV data.

  7. Heavy metal determinations in algae, mussels and clams. Their possible employment for assessing the sea water quality criteria

    NASA Astrophysics Data System (ADS)

    Locatelli, C.


    An empirical criterion for a possible classification of sea water quality is proposed. It is based on the knowledge of metal content in algae (Ulva Rigida) mussels (Mytilus Galloprovincialis) and clams (Tapes Philippinarum), three species present in marine ecosystems. The elements considered are Hg, Cu, Pb, Cd, Zn, Ni and Cr. The anatytical technique employed is Atomic Absorption Spectroscopy (AAS). The analytical procedure has been verified on three standard reference materials : Sea Water BCR-CRM 403, Ulva Lactuca BCR-CRM 279 and Mussel Tissue BCR-CRM 278. For all the elements, in addition to detection limits, accuracy and precision are given : the former, expressed as retative error (e). and the latter, expressed as relative standard deviation (sr), were in all cases lower than 6%.

  8. Magnetic separation of algae


    Nath, Pulak; Twary, Scott N.


    Described herein are methods and systems for harvesting, collecting, separating and/or dewatering algae using iron based salts combined with a magnetic field gradient to separate algae from an aqueous solution.

  9. The effects of the nitrofuran furaltadone on Ulva lactuca.


    Leston, Sara; Nunes, Margarida; Viegas, Ivan; Lemos, Marco F L; Freitas, Andreia; Barbosa, Jorge; Ramos, Fernando; Pardal, Miguel A


    The use of pharmaceuticals in the food production industry as prophylatic and therapeutic agents is necessary to promote animal health, but may entail significant consequences to natural ecosystems, especially in the cases of overdosing and use of banned pharmaceuticals. The vast effects that antibiotics released into the environment have on non-target organisms are already under the scope of researchers but little attention has been given to primary producers such as macroalgae. The present study assessed furaltadone's, an antibacterial agent illegally used for veterinary purposes, uptake capacity by Ulva lactuca and its effect in the growth of this cosmopolitan macroalgae. Differences in macroalgal growth were shown when submitted to prophylactic and therapeutic concentrations of furaltadone in the water (16 and 32 μg mL⁻¹, respectively). The therapeutic concentration caused higher growth impairment than the prophylactic treatment did, with 87.5% and 58% reductions respectively. Furthermore, together with data collected from the accumulation assays, with values of internal concentrations as high as 18.84 μg g⁻¹ WW, suggest that the macroalgae U. lactuca should be included in field surveys as a biomonitor for the detection of nitrofurans. PMID:21109284

  10. Analysis of expressed sequence tags from the Ulva prolifera (Chlorophyta)

    NASA Astrophysics Data System (ADS)

    Niu, Jianfeng; Hu, Haiyan; Hu, Songnian; Wang, Guangce; Peng, Guang; Sun, Song


    In 2008, a green tide broke out before the sailing competition of the 29th Olympic Games in Qingdao. The causative species was determined to be Enteromorpha prolifera ( Ulva prolifera O. F. Müller), a familiar green macroalga along the coastline of China. Rapid accumulation of a large biomass of floating U. prolifera prompted research on different aspects of this species. In this study, we constructed a nonnormalized cDNA library from the thalli of U. prolifera and acquired 10 072 high-quality expressed sequence tags (ESTs). These ESTs were assembled into 3 519 nonredundant gene groups, including 1 446 clusters and 2 073 singletons. After annotation with the nr database, a large number of genes were found to be related with chloroplast and ribosomal protein, GO functional classification showed 1 418 ESTs participated in photosynthesis and 1 359 ESTs were responsible for the generation of precursor metabolites and energy. In addition, rather comprehensive carbon fixation pathways were found in U. prolifera using KEGG. Some stress-related and signal transduction-related genes were also found in this study. All the evidences displayed that U. prolifera had substance and energy foundation for the intense photosynthesis and the rapid proliferation. Phylogenetic analysis of cytochrome c oxidase subunit I revealed that this green-tide causative species is most closely affiliated to Pseudendoclonium akinetum (Ulvophyceae).

  11. Ulvan, a Sulfated Polysaccharide from Green Algae, Activates Plant Immunity through the Jasmonic Acid Signaling Pathway

    PubMed Central

    Jaulneau, Valérie; Lafitte, Claude; Jacquet, Christophe; Fournier, Sylvie; Salamagne, Sylvie; Briand, Xavier; Esquerré-Tugayé, Marie-Thérèse; Dumas, Bernard


    The industrial use of elicitors as alternative tools for disease control needs the identification of abundant sources of them. We report on an elicitor obtained from the green algae Ulva spp. A fraction containing most exclusively the sulfated polysaccharide known as ulvan-induced expression of a GUS gene placed under the control of a lipoxygenase gene promoter. Gene expression profiling was performed upon ulvan treatments on Medicago truncatula and compared to phytohormone effects. Ulvan induced a gene expression signature similar to that observed upon methyl jasmonate treatment (MeJA). Involvement of jasmonic acid (JA) in ulvan response was confirmed by detecting induction of protease inhibitory activity and by hormonal profiling of JA, salicylic acid (SA) and abscisic acid (ABA). Ulvan activity on the hormonal pathway was further consolidated by using Arabidopsis hormonal mutants. Altogether, our results demonstrate that green algae are a potential reservoir of ulvan elicitor which acts through the JA pathway. PMID:20445752

  12. Adsorbents for apheresis prepared from polysaccharides of algae that threaten ecosystem services.


    Kanno, Kenichi; Tanigawa, Tetsuya; Fujita, Yoshihiro; Ohnaka, Naoto; Kubo, Yuichiro; Yoshida, Kaito; Kojima, Kota; Nakata, Koshiro; Shimohara, Masafumi


    In this work, we investigated whether materials isolated from algae that threaten ecosystems can be used for human benefit. We converted acidic polysaccharides (ulvan) from the alga Ulva pertusa into soft hydrogel materials. In addition to ulvan, the hydrogels also contained alginate in a polyion complex with chitosan. Cross-linking the hydrogel with glutaraldehyde reduced polysaccharide elution from the polyion complex gel. We also found that both ulvan-chitosan and alginate-chitosan gels were able to remove urea and heavy metals from aqueous solution. This is clinically significant, since during apheresis, toxic compounds such as urea have to be removed from the bloodstream of patients. Importantly, albumin was not removed by the hydrogels, implying that this vital protein can be returned to the bloodstream following dialysis. PMID:25146760

  13. Ulva additions alter soil biogeochemistry and negatively impact Spartina alterniflora growth

    EPA Science Inventory

    Decaying mats of Ulva can be washed into salt marshes by the tides as large wrack deposits, especially in eutrophic estuaries, where they can negatively impact marsh vegetation. We report on a series of field and laboratory mesocosm experiments where we examined the effects of d...


    EPA Science Inventory

    Ulva lactuca (sea lettuce) is a cosmopolitan marine attached green seaweed capable of sequestering high environmental levels of ammonia. Ammonia can be acutely toxic to marine organisms and is often found in dredged sediments from highly industrial areas or from areas with high c...

  15. Trichomonas stableri n. sp., an agent of trichomonosis in Pacific Coast band-tailed pigeons (Patagioenas fasciata monilis).


    Girard, Yvette A; Rogers, Krysta H; Gerhold, Richard; Land, Kirkwood M; Lenaghan, Scott C; Woods, Leslie W; Haberkern, Nathan; Hopper, Melissa; Cann, Jeff D; Johnson, Christine K


    Trichomonas gallinae is a ubiquitous flagellated protozoan parasite, and the most common etiologic agent of epidemic trichomonosis in columbid and passerine species. In this study, free-ranging Pacific Coast band-tailed pigeons (Patagioenas fasciata monilis) in California (USA) were found to be infected with trichomonad protozoa that were genetically and morphologically distinct from T. gallinae. In microscopic analysis, protozoa were significantly smaller in length and width than T. gallinae and were bimodal in morphology. Phylogenetic analysis of the ITS1/5.8S/ITS2, rpb1, and hydrogenosomal Fe-hydrogenase regions revealed that the protozoan shares an ancestor with Trichomonas vaginalis, the sexually-transmitted agent of trichomoniasis in humans. Clinical and pathologic features of infected birds were similar to infections with T. gallinae. Evidence presented here strongly support taxonomical distinction of this parasite, which we hereby name Trichomonas stableri n. sp. This work contributes to a growing body of evidence that T. gallinae is not the sole etiologic agent of avian trichomonosis, and that the incorporation of molecular tools is critical in the investigation of infectious causes of mortality in birds. PMID:24918075

  16. Trichomonas stableri n. sp., an agent of trichomonosis in Pacific Coast band-tailed pigeons (Patagioenas fasciata monilis)☆

    PubMed Central

    Girard, Yvette A.; Rogers, Krysta H.; Gerhold, Richard; Land, Kirkwood M.; Lenaghan, Scott C.; Woods, Leslie W.; Haberkern, Nathan; Hopper, Melissa; Cann, Jeff D.; Johnson, Christine K.


    Trichomonas gallinae is a ubiquitous flagellated protozoan parasite, and the most common etiologic agent of epidemic trichomonosis in columbid and passerine species. In this study, free-ranging Pacific Coast band-tailed pigeons (Patagioenas fasciata monilis) in California (USA) were found to be infected with trichomonad protozoa that were genetically and morphologically distinct from T. gallinae. In microscopic analysis, protozoa were significantly smaller in length and width than T. gallinae and were bimodal in morphology. Phylogenetic analysis of the ITS1/5.8S/ITS2, rpb1, and hydrogenosomal Fe-hydrogenase regions revealed that the protozoan shares an ancestor with Trichomonas vaginalis, the sexually-transmitted agent of trichomoniasis in humans. Clinical and pathologic features of infected birds were similar to infections with T. gallinae. Evidence presented here strongly support taxonomical distinction of this parasite, which we hereby name Trichomonas stableri n. sp. This work contributes to a growing body of evidence that T. gallinae is not the sole etiologic agent of avian trichomonosis, and that the incorporation of molecular tools is critical in the investigation of infectious causes of mortality in birds. PMID:24918075

  17. Combined effects of light intensity and NH{4/+}-enrichment on growth, pigmentation, and photosynthetic performance of Ulva prolifera (Chlorophyta)

    NASA Astrophysics Data System (ADS)

    Xu, Zhiguang; Wu, Haiyi; Zhan, Dongmei; Sun, Fuxin; Sun, Jianzhang; Wang, Guangce


    The aim of this study was to investigate the effects of light intensity and enhanced nitrogen supply on the growth and photosynthesis of the green-tide macroalga, Ulva prolifera. Thalli of U. prolifera were grown in natural or NH{4/+}-enriched seawater under two different light intensities for 7 days, and then the growth rate, pigmentation, and photosynthetic performance of the thalli were evaluated. The results show that the relative growth rate (RGR) was markedly higher under the high light level than under the low light level. Enrichment with NH{4/+} enhanced the RGR under high light intensity, but did not affect RGR under low light intensity. In low light conditions, NH{4/+} -enrichment resulted in a marked decrease in the maximal photosynthetic rate ( P m) and the maximum carbon fixation rate ( V max), but it did not affect the half saturation constant for carbon ( K 0.5) or the ratio of V max to K 0.5, which reflects the carbon acquisition efficiency. In high light conditions, P m, K 0.5, and the dark respiration rate ( R d) increased under NH{4/+} enrichment, but V max and the V max / K 0.5 ratio decreased. Regardless of the light intensity, NH{4/+}-enrichment did not affect the apparent photosynthetic efficiency ( α), which reflects the ability of the alga to use light energy at low light levels. Under both low and high light intensities, the chlorophyll a (Chl a), chlorophyll b (Chl b), and carotenoids (Car) contents in thalli were higher in NH{4/+}-enriched than in natural seawater, except that there was a decrease in the Chl b content of thalli in NH{4/+}-enriched seawater under low light intensity. Therefore, NH{4/+} enrichment improved the growth and photosynthetic performance of U. prolifera under high light intensity, but not under low light intensity. We discuss the possible mechanisms underlying these physiological responses.

  18. The Seeding and Cultivation of a Tropical Species of Filamentous Ulva for Algal Biomass Production

    PubMed Central

    Carl, Christina; de Nys, Rocky; Paul, Nicholas A.


    Filamentous species of Ulva are ideal for cultivation because they are robust with high growth rates and maintained across a broad range of environments. Temperate species of filamentous Ulva are commercially cultivated on nets which can be artificially ‘seeded’ under controlled conditions allowing for a high level of control over seeding density and consequently biomass production. This study quantified for the first time the seeding and culture cycle of a tropical species of filamentous Ulva (Ulva sp. 3) and identified seeding density and nursery period as key factors affecting growth and biomass yield. A seeding density of 621,000 swarmers m-1 rope in combination with a nursery period of five days resulted in the highest growth rate and correspondingly the highest biomass yield. A nursery period of five days was optimal with up to six times the biomass yield compared to ropes under either shorter or longer nursery periods. These combined parameters of seeding density and nursery period resulted in a specific growth rate of more than 65% day−1 between 7 and 10 days of outdoor cultivation post-nursery. This was followed by a decrease in growth through to 25 days. This study also demonstrated that the timing of harvest is critical as the maximum biomass yield of 23.0±8.8 g dry weight m−1 (228.7±115.4 g fresh weight m−1) was achieved after 13 days of outdoor cultivation whereas biomass degraded to 15.5±7.3 g dry weight m−1 (120.2±71.8 g fresh weight m−1) over a longer outdoor cultivation period of 25 days. Artificially seeded ropes of Ulva with high biomass yields over short culture cycles may therefore be an alternative to unattached cultivation in integrated pond-based aquaculture systems. PMID:24897115

  19. Antibacterial substances from marine algae isolated from Jeddah coast of Red sea, Saudi Arabia.


    Al-Saif, Sarah Saleh Abdu-Llah; Abdel-Raouf, Nevein; El-Wazanani, Hend A; Aref, Ibrahim A


    Marine algae are known to produce a wide variety of bioactive secondary metabolites and several compounds have been derived from them for prospective development of novel drugs by the pharmaceutical industries. However algae of the Red sea have not been adequately explored for their potential as a source of bioactive substances. In this context Ulva reticulata, Caulerpa occidentalis, Cladophora socialis, Dictyota ciliolata, and Gracilaria dendroides isolated from Red sea coastal waters of Jeddah, Saudi Arabia, were evaluated for their potential for bioactivity. Extracts of the algae selected for the study were prepared using ethanol, chloroform, petroleum ether and water, and assayed for antibacterial activity against Escherichia coli ATCC 25322, Pseudomonas aeruginosa ATCC 27853, Stapylococcus aureus ATCC 29213, and Enterococcus faecalis ATCC 29212. It was found that chloroform was most effective followed by ethanol, petroleum ether and water for the preparation of algal extract with significant antibacterial activities, respectively. Results also indicated that the extracts of red alga G. dendroides were more efficient against the tested bacterial strains followed by green alga U. reticulata, and brown algae D. ciliolata. Chemical analyses showed that G. dendroides recorded the highest percentages of the total fats and total proteins, followed by U. reticulata, and D. ciliolate. Among the bioflavonoids determined Rutin, Quercetin and Kaempherol were present in high percentages in G. dendroides, U. reticulata, and D. ciliolate. Estimation of saturated and unsaturated fatty acids revealed that palmitic acid was present in highest percentage in all the algal species analyzed. Amino acid analyses indicated the presence of free amino acids in moderate contents in all the species of algae. The results indicated scope for utilizing these algae as a source of antibacterial substances.

  20. Antibacterial substances from marine algae isolated from Jeddah coast of Red sea, Saudi Arabia

    PubMed Central

    Al-Saif, Sarah Saleh Abdu-llah; Abdel-Raouf, Nevein; El-Wazanani, Hend A.; Aref, Ibrahim A.


    Marine algae are known to produce a wide variety of bioactive secondary metabolites and several compounds have been derived from them for prospective development of novel drugs by the pharmaceutical industries. However algae of the Red sea have not been adequately explored for their potential as a source of bioactive substances. In this context Ulva reticulata, Caulerpa occidentalis, Cladophora socialis, Dictyota ciliolata, and Gracilaria dendroides isolated from Red sea coastal waters of Jeddah, Saudi Arabia, were evaluated for their potential for bioactivity. Extracts of the algae selected for the study were prepared using ethanol, chloroform, petroleum ether and water, and assayed for antibacterial activity against Escherichia coli ATCC 25322, Pseudomonas aeruginosa ATCC 27853, Stapylococcus aureus ATCC 29213, and Enterococcus faecalis ATCC 29212. It was found that chloroform was most effective followed by ethanol, petroleum ether and water for the preparation of algal extract with significant antibacterial activities, respectively. Results also indicated that the extracts of red alga G. dendroides were more efficient against the tested bacterial strains followed by green alga U. reticulata, and brown algae D. ciliolata. Chemical analyses showed that G. dendroides recorded the highest percentages of the total fats and total proteins, followed by U. reticulata, and D. ciliolate. Among the bioflavonoids determined Rutin, Quercetin and Kaempherol were present in high percentages in G. dendroides, U. reticulata, and D. ciliolate. Estimation of saturated and unsaturated fatty acids revealed that palmitic acid was present in highest percentage in all the algal species analyzed. Amino acid analyses indicated the presence of free amino acids in moderate contents in all the species of algae. The results indicated scope for utilizing these algae as a source of antibacterial substances. PMID:24596500

  1. Pheophorbide and pheophytin a-like pigments as useful markers for intertidal microphytobenthos grazing by Hydrobia ulvae

    NASA Astrophysics Data System (ADS)

    Cartaxana, P.; Jesus, B.; Brotas, V.


    Pigment degradation by Hydrobia ulvae, feeding on an intertidal mudflat dominated by diatoms, was studied in the laboratory. HPLC analysis identified significantly higher amounts of pheopigments in grazed sediment and a decrease in the concentrations of major chlorophylls ( a and c1+ c2) and carotenoides (fucoxanthin, diadinoxanthin, and β-carotene). Grazing by H. ulvae leads to a stronger pheophorbide a accumulation relative to pheophytin a. Dominant chlorophyll a degradation products were the less polar pheophorbide a4 and pheophytin a2. These pigments were identified in very high concentrations in H. ulvae faecal pellets. Although a major disadvantage of the HPLC method is the uncertainty regarding the extent and rate of pigment conversion into colourless products, these data strongly suggest the possible use of pheophorbide a4 and pheophytin a2 as useful markers for intertidal microphytobenthos grazing by H. ulvae.

  2. Algae Derived Biofuel

    SciTech Connect

    Jahan, Kauser


    One of the most promising fuel alternatives is algae biodiesel. Algae reproduce quickly, produce oils more efficiently than crop plants, and require relatively few nutrients for growth. These nutrients can potentially be derived from inexpensive waste sources such as flue gas and wastewater, providing a mutual benefit of helping to mitigate carbon dioxide waste. Algae can also be grown on land unsuitable for agricultural purposes, eliminating competition with food sources. This project focused on cultivating select algae species under various environmental conditions to optimize oil yield. Membrane studies were also conducted to transfer carbon di-oxide more efficiently. An LCA study was also conducted to investigate the energy intensive steps in algae cultivation.



    Rogers, Krysta H; Girard, Yvette A; Koenig, Walter D; Johnson, Christine K


    :   Avian trichomonosis, a disease typically caused by the protozoan parasite Trichomonas gallinae , is a well recognized cause of death in many avian species. In California, US, trichomonosis has caused periodic epidemics in Pacific Coast Band-tailed Pigeons ( Patagioenas fasciata monilis). We summarize reported mortality events and investigate ecologic drivers and population impacts associated with epidemic mortality due to trichomonosis in Band-tailed Pigeons. Between 1945 and 2014, 59 mortality events involving Band-tailed Pigeons were reported in California with the number of reported events increasing over time. Estimated mortality for these events was variable, ranging between 10 and 10,000 pigeons. Events were most-frequently reported in Monterey (19%; 11/59) and San Luis Obispo (8%; 5/59) counties. Events often started in January (32%; 9/28) and February (50%; 14/28) and lasted 5-68 d. Impacts of mortality events on pigeon populations were indicated by Breeding Bird Survey and Christmas Bird Count abundance indices, which showed a decline in outbreak years compared to nonoutbreak years. Environmental conditions most associated with outbreak years included higher average temperatures between January and March, the period most associated with mortality events, and lower average precipitation in December just prior to mortality events. In Monterey County, events tended to occur in winters following higher acorn production of coast live oaks ( Quercus agrifolia ) in the fall. Weather and food abundance could be related to increased transmission or enhanced viability of Trichomonas spp. Although estimated mortality due to avian trichomonosis was highly variable across years, cumulative losses were substantial and likely to have a negative impact on population size.



    Rogers, Krysta H; Girard, Yvette A; Koenig, Walter D; Johnson, Christine K


    :   Avian trichomonosis, a disease typically caused by the protozoan parasite Trichomonas gallinae , is a well recognized cause of death in many avian species. In California, US, trichomonosis has caused periodic epidemics in Pacific Coast Band-tailed Pigeons ( Patagioenas fasciata monilis). We summarize reported mortality events and investigate ecologic drivers and population impacts associated with epidemic mortality due to trichomonosis in Band-tailed Pigeons. Between 1945 and 2014, 59 mortality events involving Band-tailed Pigeons were reported in California with the number of reported events increasing over time. Estimated mortality for these events was variable, ranging between 10 and 10,000 pigeons. Events were most-frequently reported in Monterey (19%; 11/59) and San Luis Obispo (8%; 5/59) counties. Events often started in January (32%; 9/28) and February (50%; 14/28) and lasted 5-68 d. Impacts of mortality events on pigeon populations were indicated by Breeding Bird Survey and Christmas Bird Count abundance indices, which showed a decline in outbreak years compared to nonoutbreak years. Environmental conditions most associated with outbreak years included higher average temperatures between January and March, the period most associated with mortality events, and lower average precipitation in December just prior to mortality events. In Monterey County, events tended to occur in winters following higher acorn production of coast live oaks ( Quercus agrifolia ) in the fall. Weather and food abundance could be related to increased transmission or enhanced viability of Trichomonas spp. Although estimated mortality due to avian trichomonosis was highly variable across years, cumulative losses were substantial and likely to have a negative impact on population size. PMID:27187033

  5. Subsequent influences of feeding intact green seaweed Ulva lactuca to growing lambs on the seminal and testicular characteristics in rams.


    Samara, E M; Okab, A B; Abdoun, K A; El-Waziry, A M; Al-Haidary, A A


    The present experiment was designed to investigate the subsequent influences of supplementing different levels of intact green seaweed Ulva lactuca (0%, 3%, and 5% DM) to growing sexually immature lambs during the growth period (74 d) on the seminal and testicular characteristics of sexually mature rams. Ulva lactuca was manually collected, adequately prepared, and then incorporated into lambs' diets. Eighteen male 3-mo-old lambs of the Awassi breed with a mean BW of 22.57 kg (SD = 1.08) were randomly assigned into treatments. The obtained results indicate that offering Ulva lactuca at the level of 3% or 5% DM to lambs during the growth period had no subsequent impacts (P > 0.05) on liver and kidney functions as well as blood water balance in rams, thereby suggesting that Ulva lactuca can be safely supplemented to lambs during growing. However, our findings point out that feeding a lamb diet supplemented with intact Ulva lactuca failed to demonstrate any subsequent benefit (P > 0.05) on the growth performance, thermoregulatory responses, and plasma oxidative status in rams. Above all, it was clearly evident that supplementing intact Ulva lactuca to lambs had demonstrated subsequent negative influences (P < 0.05) on seminal and testicular characteristics of rams, more noticeably observed at the 5% DM inclusion rate than at 3%. These results were manifested by the inferior (P < 0.05) seminal quality, reduced (P < 0.05) testicular morphometry, changes (P < 0.05) in testicular histopathology, defective (P < 0.05) endocrine signaling, and increased (P < 0.05) seminal oxidative stress in rams fed diets supplemented with Ulva lactuca during the growth period compared to control rams. The deleterious impacts of feeding intact Ulva lactuca on spermatogenesis and germ cell loss were proven to be attributed to the dysfunction of Sertoli cells. Collectively, these results provide novel insights on the subsequent influences of dietary supplementation of intact Ulva lactuca to

  6. Blue-green algae


    “Blue-green algae” describes a large and diverse group of simple, plant-like organisms found in salt water and some large fresh water lakes. Blue-green algae products are used for many conditions, but so ...

  7. Evaluation of ultrasonic, acid, thermo-alkaline and enzymatic pre-treatments on anaerobic digestion of Ulva rigida for biogas production.


    Karray, Raida; Hamza, Manel; Sayadi, Sami


    Pre-treatment of macroalgae has received considerable research globally due to its influence on the technical, economic and environmental sustainability of algae biogas production. Some of the most promising pre-treatment methods require the application of chemicals, enzymatic, and mechanical. This study focused on these pre-treatments of Ulva rigida for biogas production. The evaluation of different pre-treatment in terms of reducing sugar yields demonstrates that 3.62, 2.88, 2.53 and 7.3g/L of reducing sugar was obtained in acid catalysis, thermoalkaline, ultrasonication and enzymatic pre-treatment, respectively. However in crude macroalgae only 0.6g/L of reducing sugar was given. After anaerobic digestion, the enzymatic hydrolysis was demonstrated the best biogas yield than other pre-treatment which reached 626.5mL/gCODint with 62.65% of biodegradability. The best demonstrated method which uses crude broth of Aspergillus niger showed an effective and environmentally friendly strategy for enhancing the biogas production yields after the anaerobic digestion.

  8. Evaluation of ultrasonic, acid, thermo-alkaline and enzymatic pre-treatments on anaerobic digestion of Ulva rigida for biogas production.


    Karray, Raida; Hamza, Manel; Sayadi, Sami


    Pre-treatment of macroalgae has received considerable research globally due to its influence on the technical, economic and environmental sustainability of algae biogas production. Some of the most promising pre-treatment methods require the application of chemicals, enzymatic, and mechanical. This study focused on these pre-treatments of Ulva rigida for biogas production. The evaluation of different pre-treatment in terms of reducing sugar yields demonstrates that 3.62, 2.88, 2.53 and 7.3g/L of reducing sugar was obtained in acid catalysis, thermoalkaline, ultrasonication and enzymatic pre-treatment, respectively. However in crude macroalgae only 0.6g/L of reducing sugar was given. After anaerobic digestion, the enzymatic hydrolysis was demonstrated the best biogas yield than other pre-treatment which reached 626.5mL/gCODint with 62.65% of biodegradability. The best demonstrated method which uses crude broth of Aspergillus niger showed an effective and environmentally friendly strategy for enhancing the biogas production yields after the anaerobic digestion. PMID:25855526

  9. Lipid Composition, Fatty Acids and Sterols in the Seaweeds Ulva armoricana, and Solieria chordalis from Brittany (France): An Analysis from Nutritional, Chemotaxonomic, and Antiproliferative Activity Perspectives.


    Kendel, Melha; Wielgosz-Collin, Gaëtane; Bertrand, Samuel; Roussakis, Christos; Bourgougnon, Nathalie; Bedoux, Gilles


    Lipids from the proliferative macroalgae Ulva armoricana (Chlorophyta) and Solieria chordalis (Rhodophyta) from Brittany, France, were investigated. The total content of lipids was 2.6% and 3.0% dry weight for U. armoricana and S. chordalis, respectively. The main fractions of S. chordalis were neutral lipids (37%) and glycolipids (38%), whereas U. armoricana contained mostly neutral lipids (55%). Polyunsaturated fatty acids (PUFA) represented 29% and 15% of the total lipids in U. armoricana and S. chordalis, respectively. In both studied algae, the phospholipids were composed of PUFA for 18%. In addition, PUFA were shown to represent 9% and 4.5% of glycolipids in U. armoricana and S. chordalis, respectively. The essential PUFA were 16:4n-3, 18:4n-3, 18:2n-3, 18:2n-6, and 22:6n-3 in U. armoricana, and 20:4n-6 and 20:5n-3 in S. chordalis. It is important to notice that six 2-hydroxy-, three 3-hydroxy-, and two monounsaturated hydroxy fatty acids were also identified and may provide a chemotaxonomic basis for algae. These seaweeds contained interesting compounds such as squalene, α-tocopherol, cholest-4-en-3-one and phytosterols. The antiproliferative effect was evaluated in vitro on human non-small-cell bronchopulmonary carcinoma line (NSCLC-N6) with an IC50 of 23 μg/mL for monogalactosyldiacylglycerols isolated from S. chordalis and 24 μg/mL for digalactosyldiacylglycerols from U. armoricana. These results confirm the potentialities of valorization of these two species in the fields of health, nutrition and chemotaxonomy.

  10. Methanosarcina Play an Important Role in Anaerobic Co-Digestion of the Seaweed Ulva lactuca: Taxonomy and Predicted Metabolism of Functional Microbial Communities

    PubMed Central

    FitzGerald, Jamie A.; Allen, Eoin; Wall, David M.; Jackson, Stephen A.; Murphy, Jerry D.; Dobson, Alan D. W.


    Macro-algae represent an ideal resource of third generation biofuels, but their use necessitates a refinement of commonly used anaerobic digestion processes. In a previous study, contrasting mixes of dairy slurry and the macro-alga Ulva lactuca were anaerobically digested in mesophilic continuously stirred tank reactors for 40 weeks. Higher proportions of U. lactuca in the feedstock led to inhibited digestion and rapid accumulation of volatile fatty acids, requiring a reduced organic loading rate. In this study, 16S pyrosequencing was employed to characterise the microbial communities of both the weakest (R1) and strongest (R6) performing reactors from the previous work as they developed over a 39 and 27-week period respectively. Comparing the reactor communities revealed clear differences in taxonomy, predicted metabolic orientation and mechanisms of inhibition, while constrained canonical analysis (CCA) showed ammonia and biogas yield to be the strongest factors differentiating the two reactor communities. Significant biomarker taxa and predicted metabolic activities were identified for viable and failing anaerobic digestion of U. lactuca. Acetoclastic methanogens were inhibited early in R1 operation, followed by a gradual decline of hydrogenotrophic methanogens. Near-total loss of methanogens led to an accumulation of acetic acid that reduced performance of R1, while a slow decline in biogas yield in R6 could be attributed to inhibition of acetogenic rather than methanogenic activity. The improved performance of R6 is likely to have been as a result of the large Methanosarcina population, which enabled rapid removal of acetic acid, providing favourable conditions for substrate degradation. PMID:26555136

  11. Lipid Composition, Fatty Acids and Sterols in the Seaweeds Ulva armoricana, and Solieria chordalis from Brittany (France): An Analysis from Nutritional, Chemotaxonomic, and Antiproliferative Activity Perspectives

    PubMed Central

    Kendel, Melha; Wielgosz-Collin, Gaëtane; Bertrand, Samuel; Roussakis, Christos; Bourgougnon, Nathalie; Bedoux, Gilles


    Lipids from the proliferative macroalgae Ulva armoricana (Chlorophyta) and Solieria chordalis (Rhodophyta) from Brittany, France, were investigated. The total content of lipids was 2.6% and 3.0% dry weight for U. armoricana and S. chordalis, respectively. The main fractions of S. chordalis were neutral lipids (37%) and glycolipids (38%), whereas U. armoricana contained mostly neutral lipids (55%). Polyunsaturated fatty acids (PUFA) represented 29% and 15% of the total lipids in U. armoricana and S. chordalis, respectively. In both studied algae, the phospholipids were composed of PUFA for 18%. In addition, PUFA were shown to represent 9% and 4.5% of glycolipids in U. armoricana and S. chordalis, respectively. The essential PUFA were 16:4n-3, 18:4n-3, 18:2n-3, 18:2n-6, and 22:6n-3 in U. armoricana, and 20:4n-6 and 20:5n-3 in S. chordalis. It is important to notice that six 2-hydroxy-, three 3-hydroxy-, and two monounsaturated hydroxy fatty acids were also identified and may provide a chemotaxonomic basis for algae. These seaweeds contained interesting compounds such as squalene, α-tocopherol, cholest-4-en-3-one and phytosterols. The antiproliferative effect was evaluated in vitro on human non-small-cell bronchopulmonary carcinoma line (NSCLC-N6) with an IC50 of 23 μg/mL for monogalactosyldiacylglycerols isolated from S. chordalis and 24 μg/mL for digalactosyldiacylglycerols from U. armoricana. These results confirm the potentialities of valorization of these two species in the fields of health, nutrition and chemotaxonomy. PMID:26404323

  12. Inorganic nitrogen control in wastewater treatment ponds from a fish farm (Orbetello, Italy): denitrification versus Ulva uptake.


    Bartoli, Marco; Nizzoli, Daniele; Naldi, Mariachiara; Vezzulli, Luigi; Porrello, Salvatore; Lenzi, Mauro; Viaroli, Pierluigi


    The aim of this study was to quantify the N removal efficiency of an Ulva-based phytotreatment system receiving wastewaters from a land-based fish farm (Orbetello, Italy), to identify the main biogeochemical pathways involved and to provide basic guidelines for treatment implementation and management. Fluxes of O2 and nutrients in bare and in Ulva colonised sediments were assessed by light/dark core incubations; denitrification by the isotope pairing technique and Ulva growth by in situ incubation of macroalgal disks in cages. O2 and nutrient budgets were estimated as sum of individual processes and further verified by 24-h investigations of overall inlet and outlet loads. Ulva uptake (up to 7.8 mmol Nm(-2) h(-1)) represented a net sink for water column and regenerated NH4+ whilst N removal via denitrification (10-170 micromol Nm(-2) h(-1)) accounted for a small percentage of inorganic nitrogen load (<5%). Laboratory experiments demonstrated a high potential for denitrification (over 800 microM Nm(-2) h(-1)) indicating that N loss could be enhanced. The control of Ulva standing stocks by optimised harvesting of surplus biomass may represent an effective strategy to maximise DIN removal and could result in the assimilation of approximately 50% of produced inorganic nitrogen. PMID:16045942

  13. Clocks in algae.


    Noordally, Zeenat B; Millar, Andrew J


    As major contributors to global oxygen levels and producers of fatty acids, carotenoids, sterols, and phycocolloids, algae have significant ecological and commercial roles. Early algal models have contributed much to our understanding of circadian clocks at physiological and biochemical levels. The genetic and molecular approaches that identified clock components in other taxa have not been as widely applied to algae. We review results from seven species: the chlorophytes Chlamydomonas reinhardtii, Ostreococcus tauri, and Acetabularia spp.; the dinoflagellates Lingulodinium polyedrum and Symbiodinium spp.; the euglenozoa Euglena gracilis; and the red alga Cyanidioschyzon merolae. The relative simplicity, experimental tractability, and ecological and evolutionary diversity of algal systems may now make them particularly useful in integrating quantitative data from "omic" technologies (e.g., genomics, transcriptomics, metabolomics, and proteomics) with computational and mathematical methods.

  14. Effects of solar UV-B radiation on canopy structure of Ulva communities from southern Spain.


    Bischof, Kai; Peralta, Gloria; Kräbs, Gudrun; Van De Poll, Willem H; Pérez-Lloréns, José Lucas; Breeman, Anneke M


    Within the sheltered creeks of Cádiz bay, Ulva thalli form extended mat-like canopies. The effect of solar ultraviolet radiation on photosynthetic activity, the composition of photosynthetic and xanthophyll cycle pigments, and the amount of RubisCO, chaperonin 60 (CPN 60), and the induction of DNA damage in Ulva aff. rotundata Bliding from southern Spain was assessed in the field. Samples collected from the natural community were covered by screening filters, generating different radiation conditions. During daily cycles, individual thalli showed photoinhibitory effects of the natural solar radiation. This inhibition was even more pronounced in samples only exposed to photosynthetically active radiation (PAR). Strongly increased heat dissipation in these samples indicated the activity of regulatory mechanisms involved in dynamic photoinhibition. Adverse effects of UV-B radiation on photosynthesis were only observed in combination with high levels of PAR, indicating the synergistic effects of the two wavelength ranges. In samples exposed either to PAR+UV-A or to UV-B+UV-A without PAR, no inhibition of photosynthetic quantum yield was found in the course of the day. At the natural site, the top layer of the mat-like canopies is generally completely bleached. Artificially designed Ulva canopies exhibited fast bleaching of the top layer under the natural solar radiation conditions, while this was not observed in canopies either shielded from UV or from PAR. The bleached first layer of the canopies acts as a selective UV-B filter, and thus prevents subcanopy thalli from exposure to harmful radiation. This was confirmed by the differences in photosynthetic activity, pigment composition, and the concentration of RubisCO in thalli with different positions within the canopy. In addition, the induction of the stress protein CPN 60 under UV exposure and the low accumulation of DNA damage indicate the presence of physiological protection mechanisms against harmful UV-B. A

  15. Cytotoxicity of fucosterol containing fraction of marine algae against breast and colon carcinoma cell line

    PubMed Central

    Khanavi, Mahnaz; Gheidarloo, Razieh; Sadati, Nargess; Ardekani, Mohammad Reza Shams; Nabavi, Seyed Mohammad Bagher; Tavajohi, Shohreh; Ostad, Seyed Nasser


    Context: Marine algae produce different secondary metabolites with a wide range of biological activities. Many studies have been achieved on the screening of biological effects of marine organisms and a lot of active compounds were isolated and characterized. Aims: In an attempt to find cytotoxic compound of hexane fraction, isolation, identification, and cytotoxicity of active compound of this fraction were performed. Materials and Methods: In this study, total methanolic (70%) extract and partition fractions of hexane, chloroform (CHCl3), ethyl acetate (EtOAc), and MeOH–H2O of Sargassum angustifolium, Chondria dasyphylla, and Ulva flexuosa, collected from coastlines of the Persian Gulf in south of Iran, were studied against colon carcinoma (HT-29), colorectal adenocarcinoma (Caco-2), breast ductal carcinoma (T47D), and Swiss mouse embryo fibroblast (NIH 3T3) cell lines by MTT assay. Statistical Analysis Used: IC50 (median growth inhibitory concentration) values were calculated by Sigmaplot (10) software. Results: Hexane fraction of Chondria dasyphylla (IC50 82.26 ± 4.09 μg/ml) and MeOH-H2O fraction of Ulva flexuosa (IC50 116.92 ± 8.58 μg/ml) showed cytotoxic activity against proliferation of T47D cells. Hexane fraction of Sargassum angustifolium was also observed for cytotoxicity against T47D and HT-29 cell lines (IC50 166.42 ± 26.7 and 190.24 ± 52.8 μg/ml), respectively. An investigation of a component from the hexane fraction of Sargassum angustifolium yielded a steroidal metabolite, fucosterol, with cytotoxicity in T47D and HT29 (IC50 27.94 ± 9.3 and 70.41 ± 7.5 μg/ml). Conclusions: These results indicated that fucosterol, the most abundant phytosterol in brown algae, is responsible for cytotoxic effect of this extract against breast and colon carcinoma cell lines. PMID:22438665

  16. Grazing on green algae by the periwinkle Littorina littorea in the Wadden Sea

    NASA Astrophysics Data System (ADS)

    Wilhelmsen, U.; Reise, K.


    On sedimentary tidal flats in the Wadden Sea near the Island of Sylt, the periwinkle Littorina littorea occurred preferentially on clusters and beds of mussels and on shell beds (100 to 350 m-2), achieved moderate densities on green algal patches or mats (20 to 50 m-2), and remained rare on bare sediments (<5 m-2). Green algae covering>10% of sediment surface appeared in summer on approximately one third of the tidal zone, mainly in the upper and sheltered parts and almost never on mussel and shell beds. In feeding experiments, L. littorea ingested more of the dominant alge, Enteromorpha, than of Ulva, irrespective of whether or not algae were fresh or decaying. The tough thalli of Chaetomorpha were hardly consumed. Snails feeding on Enteromorpha produced fecal pellets from which new growth of Enteromorpha started. In the absence of periwinkles, Enteromorpha developed on mussels and the attached fucoids. Experimentally increased snail densities on sediments prevented green algal development, but the snails were unable to graze down established algal mats. It is concluded that natural densities of L. littorea hardly affect the ephemeral mass development of green algae on sediments. However, where the snails occur at high densities, i.e. on mussel beds, green algal development may be prevented.

  17. Optimization study on the hydrogen peroxide pretreatment and production of bioethanol from seaweed Ulva prolifera biomass.


    Li, Yinping; Cui, Jiefen; Zhang, Gaoli; Liu, Zhengkun; Guan, Huashi; Hwang, Hueymin; Aker, Winfred G; Wang, Peng


    The seaweed Ulva prolifera, distributed in inter-tidal zones worldwide, contains a large percentage of cellulosic materials. The technical feasibility of using U. prolifera residue (UPR) obtained after extraction of polysaccharides as a renewable energy resource was investigated. An environment-friendly and economical pretreatment process was conducted using hydrogen peroxide. The hydrogen peroxide pretreatment improved the efficiency of enzymatic hydrolysis. The resulting yield of reducing sugar reached a maximum of 0.42g/g UPR under the optimal pretreatment condition (hydrogen peroxide 0.2%, 50°C, pH 4.0, 12h). The rate of conversion of reducing sugar in the concentrated hydrolysates to bioethanol reached 31.4% by Saccharomyces cerevisiae fermentation, which corresponds to 61.7% of the theoretical maximum yield. Compared with other reported traditional processes on Ulva biomass, the reducing sugar and bioethanol yield are substantially higher. Thus, hydrogen peroxide pretreatment is an effective enhancement of the process of bioethanol production from the seaweed U. prolifera.

  18. Optimization study on the hydrogen peroxide pretreatment and production of bioethanol from seaweed Ulva prolifera biomass.


    Li, Yinping; Cui, Jiefen; Zhang, Gaoli; Liu, Zhengkun; Guan, Huashi; Hwang, Hueymin; Aker, Winfred G; Wang, Peng


    The seaweed Ulva prolifera, distributed in inter-tidal zones worldwide, contains a large percentage of cellulosic materials. The technical feasibility of using U. prolifera residue (UPR) obtained after extraction of polysaccharides as a renewable energy resource was investigated. An environment-friendly and economical pretreatment process was conducted using hydrogen peroxide. The hydrogen peroxide pretreatment improved the efficiency of enzymatic hydrolysis. The resulting yield of reducing sugar reached a maximum of 0.42g/g UPR under the optimal pretreatment condition (hydrogen peroxide 0.2%, 50°C, pH 4.0, 12h). The rate of conversion of reducing sugar in the concentrated hydrolysates to bioethanol reached 31.4% by Saccharomyces cerevisiae fermentation, which corresponds to 61.7% of the theoretical maximum yield. Compared with other reported traditional processes on Ulva biomass, the reducing sugar and bioethanol yield are substantially higher. Thus, hydrogen peroxide pretreatment is an effective enhancement of the process of bioethanol production from the seaweed U. prolifera. PMID:27132221

  19. Trophic plasticity of the gastropod Hydrobia ulvae within an intertidal bay (Roscoff, France): A stable isotope evidence

    NASA Astrophysics Data System (ADS)

    Riera, P.


    The study investigated the trophic ecology of the gastropod Hydrobia ulvae in different habitat types within an intertidal bay. The results point out two major trophic pathways involving H.ulvae in this bay. On the one hand, in sandy/muddy sediments Hydrobia derives most of its energy from allochtonous detritus derived from Enteromorpha sp and the total SOM pool. In addition, in these sediments, the phototrophic purple bacteria mats played a substantial trophic role in the diet of Hydrobia. On the other hand, in a Spartina maritima marsh, the gastropod appears firstly dependent of autochtonous detritus derived from this plant. The minor contribution of microphytobenthos to the diet of Hydrobia is consistent with a relatively low presence of epipelic diatoms at the sampling sites. These results provide evidence that the trophic ecology of H.ulvae inhabiting intertidal sediments is quite plastic and does not necessarily rely primarly on microphytobenthos. Consequently, in a single bay, the small spatial scale variability in the origin and availability of detritus have direct implications on the food incorporation by H.ulvae.

  20. Overview on Biological Activities and Molecular Characteristics of Sulfated Polysaccharides from Marine Green Algae in Recent Years

    PubMed Central

    Wang, Lingchong; Wang, Xiangyu; Wu, Hao; Liu, Rui


    Among the three main divisions of marine macroalgae (Chlorophyta, Phaeophyta and Rhodophyta), marine green algae are valuable sources of structurally diverse bioactive compounds and remain largely unexploited in nutraceutical and pharmaceutical areas. Recently, a great deal of interest has been developed to isolate novel sulfated polysaccharides (SPs) from marine green algae because of their numerous health beneficial effects. Green seaweeds are known to synthesize large quantities of SPs and are well established sources of these particularly interesting molecules such as ulvans from Ulva and Enteromorpha, sulfated rhamnans from Monostroma, sulfated arabinogalactans from Codium, sulfated galacotans from Caulerpa, and some special sulfated mannans from different species. These SPs exhibit many beneficial biological activities such as anticoagulant, antiviral, antioxidative, antitumor, immunomodulating, antihyperlipidemic and antihepatotoxic activities. Therefore, marine algae derived SPs have great potential for further development as healthy food and medical products. The present review focuses on SPs derived from marine green algae and presents an overview of the recent progress of determinations of their structural types and biological activities, especially their potential health benefits. PMID:25257786

  1. Origin of the algae.


    Perasso, R; Baroin, A; Qu, L H; Bachellerie, J P; Adoutte, A


    Eukaryotic algae are traditionally separated into three broad divisions: the rhodophytes, the chromophytes and the chlorophytes. The evolutionary relationships between these groups, their links with other eukaryotes and with other photosynthetic groups, such as euglenophytes and cryptophytes, have been the subject of much debate and speculation. Here we analyse partial sequences of the large (28S) cytoplasmic ribosomal RNA from ten new species of protists belonging to various groups of unicellular algae. By combining them with the homologous sequences from 14 other unicellular and multicellular eukaryotes, we show that rhodophytes, chromophytes and chlorophytes emerge as three distinct groups late among eukaryotes, that is, close to the metazoa-metaphytes radiation. This implies a relatively late occurrence of eukaryotic photosynthetic symbiosis. We also provide details of intra- and inter-phyla relationships.

  2. Genomics of Volvocine Algae

    PubMed Central

    Umen, James G.; Olson, Bradley J.S.C.


    Volvocine algae are a group of chlorophytes that together comprise a unique model for evolutionary and developmental biology. The species Chlamydomonas reinhardtii and Volvox carteri represent extremes in morphological diversity within the Volvocine clade. Chlamydomonas is unicellular and reflects the ancestral state of the group, while Volvox is multicellular and has evolved numerous innovations including germ-soma differentiation, sexual dimorphism, and complex morphogenetic patterning. The Chlamydomonas genome sequence has shed light on several areas of eukaryotic cell biology, metabolism and evolution, while the Volvox genome sequence has enabled a comparison with Chlamydomonas that reveals some of the underlying changes that enabled its transition to multicellularity, but also underscores the subtlety of this transition. Many of the tools and resources are in place to further develop Volvocine algae as a model for evolutionary genomics. PMID:25883411

  3. The effects of feedstock pre-treatment and pyrolysis temperature on the production of biochar from the green seaweed Ulva.


    Roberts, David A; de Nys, Rocky


    Green seaweeds from the genus Ulva are a promising feedstock for the production of biochar for carbon (C) sequestration and soil amelioration. Ulva can be cultivated in waste water from land-based aquaculture and Ulva blooms ("green tides") strand millions of tons of biomass on coastal areas of Europe and China each year. The conversion of Ulva into biochar could recycle C and nutrients from eutrophic water into agricultural production. We produce biochar from Ulva ohnoi, cultivated in waste water from an aquaculture facility, and characterize its suitability for C sequestration and soil amelioration through bio-chemical analyses and plant growth experiments. Two biomass pre-treatments (fresh water rinsing to reduce salt, and pelletisation to increase density) were crossed with four pyrolysis temperatures (300-750 °C). Biomass rinsing decreased the ash and increased the C content of the resulting biochar. However, biochar produced from un-rinsed biomass had a higher proportion of fixed C and a higher yield. C sequestration decreased with increasing pyrolysis temperatures due to the combination of lower yield and lower total C content of biochar produced at high temperatures. Biochar produced from un-rinsed biomass at 300 °C had the greatest gravimetric C sequestration (110-120 g stable C kg(-1) seaweed). Biochar produced from un-pelletised Ulva enhanced plant growth three-fold in low fertility soils when the temperature of pyrolysis was less than 450 °C. The reduced effectiveness of the high-temperature biochars (>450 °C) was due to a lower N and higher salt content. Soil ameliorated with biochar produced from pelletised biomass had suppressed plant germination and growth. The most effective biochar for C sequestration and soil amelioration was produced from un-rinsed and un-pelletised Ulva at 300 °C. The green tide that occurs annually along the Shandong coastline in China generates sufficient biomass (200,000 tons dry weight) to ameliorate 12,500

  4. The effects of feedstock pre-treatment and pyrolysis temperature on the production of biochar from the green seaweed Ulva.


    Roberts, David A; de Nys, Rocky


    Green seaweeds from the genus Ulva are a promising feedstock for the production of biochar for carbon (C) sequestration and soil amelioration. Ulva can be cultivated in waste water from land-based aquaculture and Ulva blooms ("green tides") strand millions of tons of biomass on coastal areas of Europe and China each year. The conversion of Ulva into biochar could recycle C and nutrients from eutrophic water into agricultural production. We produce biochar from Ulva ohnoi, cultivated in waste water from an aquaculture facility, and characterize its suitability for C sequestration and soil amelioration through bio-chemical analyses and plant growth experiments. Two biomass pre-treatments (fresh water rinsing to reduce salt, and pelletisation to increase density) were crossed with four pyrolysis temperatures (300-750 °C). Biomass rinsing decreased the ash and increased the C content of the resulting biochar. However, biochar produced from un-rinsed biomass had a higher proportion of fixed C and a higher yield. C sequestration decreased with increasing pyrolysis temperatures due to the combination of lower yield and lower total C content of biochar produced at high temperatures. Biochar produced from un-rinsed biomass at 300 °C had the greatest gravimetric C sequestration (110-120 g stable C kg(-1) seaweed). Biochar produced from un-pelletised Ulva enhanced plant growth three-fold in low fertility soils when the temperature of pyrolysis was less than 450 °C. The reduced effectiveness of the high-temperature biochars (>450 °C) was due to a lower N and higher salt content. Soil ameliorated with biochar produced from pelletised biomass had suppressed plant germination and growth. The most effective biochar for C sequestration and soil amelioration was produced from un-rinsed and un-pelletised Ulva at 300 °C. The green tide that occurs annually along the Shandong coastline in China generates sufficient biomass (200,000 tons dry weight) to ameliorate 12,500

  5. The performance of aminoalkyl/fluorocarbon/hydrocarbon-modified xerogel coatings against the marine alga Ectocarpus crouaniorum: relative roles of surface energy and charge.


    Evariste, Emmanuelle; Gatley, Caitlyn M; Detty, Michael R; Callow, Maureen E; Callow, James A


    The effect of a series of xerogel coatings modified with aminoalkyl/fluorocarbon/hydrocarbon groups on the adhesion of a new test species, the filamentous brown alga Ectocarpus crouaniorum, has been explored, and compared with the green alga Ulva linza. The results showed that E. crouaniorum adhered weakly to the less polar, low wettability coatings in the series, but stronger adhesion was shown on polar, higher surface energy coatings containing aminoalkyl groups. The results from a separate series of coatings tuned to have similar surface energies and polarities after immersion in artificial seawater (ASW), but widely different surface charges, demonstrated that surface charge was more important than surface energy and polarity in determining the adhesion strength of both E. crouaniorum and U. linza on xerogel coatings. No correlation was found between adhesion and contact angle hysteresis. X-ray photoelectron spectroscopy analysis of samples after immersion in ASW confirmed the presence of charged ammonium groups on the surface of the aminoalkylated coatings.

  6. Exposure of the marine deposit feeder Hydrobia ulvae to sediment associated LAS.


    Mauffret, A; Rico-Rico, A; Temara, A; Blasco, J


    Linear Alkylbenzene Sulfonates (LAS) effects (mortality, egestion rate, behaviour) on the marine deposit feeder Hydrobia ulvae were assessed in whole-sediment and water-only systems. The results were combined with a bioenergetic-based kinetic model of exposure pathways to account for the observed toxicity. The 10-d LC50 value based on the freely dissolved fraction was 9.3 times lower in spiked sediment (0.152 +/- 0.001 (95% CI) mg/L) than in water-only (1.390 +/- 0.020 (95% CI) mg/L). Consequently, the actual 10-d LC50 value (208 mg/kg) was overestimated by the Equilibrium Partitioning calculation (1629 mg/kg). This suggests that the sediment associated LAS fraction was bioavailable to the snails. It could also be due to modifications in physiological parameters in absence of sediment, the organism natural substrate.

  7. Allelopathic interactions between the macroalga Ulva pertusa and eight microalgal species

    NASA Astrophysics Data System (ADS)

    Nan, Chunrong; Zhang, Haizhi; Zhao, Guangqiang


    Growth of Ulva pertusa and eight microalgal species, Heterosigma akashiwo, Skeletonema costatum, Tetraselmis subcordiformis, Nitzschia closterium, Chaetoceros gracile, Chroomonas placoidea 1967, Isochrysis galbana 8701, and Alexandrium tamarense, was examined in a series of batch, semi-continuous and isolated co-cultures ( U. pertusa and one microalgal species). The results of the experiments with co-cultures confirmed the secretion of allelopathic substances by U. pertusa. Growth was significantly ( p<0.05) suppressed in each of the macroalgal species in batch co-cultures, nutrient replete semi-continuous co-cultures and isolated co-cultures. The percentage growth reduction varied between 42 and 100% in batch co-cultures, between 28 and 100% in semi-continuous co-cultures, and between 21 and 100% in isolated co-cultures. In addition, we examined the potential allelopathic effect of U. pertusa culture filtrate. The Ulva culture filtrate significantly ( p<0.01) inhibited the growth of C. placoidea from 2 days after incubation until the end of the experiment, and it exhibited no inhibitory effect on the growth of the other microalgal species. This may suggest that the allelochemicals released from U. pertusa are rapidly degradable. The microalgae tested exhibited different (stimulatory, inhibitory or no) effects on the growth of U. pertusa. U. pertusa grew faster with H. akashiwo (+16%) and S. costatum (+9%), less with T. subcordiformis (-20%), N. closterium (-23%) and C. gracile (-30%), but was not significantly affected by I. galbana, A. tamarense and C. placoidea. The microalgae tested exhibited no clear allelopathic effects on U. pertusa.

  8. Evaluating aquatic toxicity by visual inspection of thallus color in the green macroalga Ulva: testing a novel bioassay.


    Han, Young-Seok; Brown, Murray T; Park, Gyoung Soo; Han, Taejun


    A novel bioassaythat uses visual inspection of reproduction of the aquatic green macroalga Ulva has been developed for testing toxic chemicals. The method employs a technique to quantify percentage reproduction based on thallus color change during the progression of reproduction. The validity of visual inspection as a reliable method was supported by a high test score (80.4) from a test of the ability of 97 first year university students with no biology background to evaluate reproduction by visual observation after 30 min training. The sensitivity of the method was assessed using a reference toxicant (sodium dodecyl sulfate; SDS; EC50 = 7.1 mg x L(-1)), heavy metals Cu (0.063 mg x L(-1)), Cd (0.217 mg x L(-1, Pb (0.840 mg x L(-1)), Zn (0.966 mg x L(-1)), formalin (1.458 mg x L(-1)), diesel fuel (3.7 mL x L(-1)), and is shown to be similar or better than more established aquatic toxicity bioassays. Toxicity data obtained by the Ulva bioassay for elutriates of sludge collected from nine different locations were directly compared with the commercially available Microtox test. Ulva reproduction was significantly inhibited in all elutriates with the greatest and least toxic effects, estimated by toxicity units (TU) observed in elutriates from industrial waste (13.1 TU) and a filtration bed (4.8 TU), whereas values ranging from 1 to 4.5 TU were obtained from the Microtox test, confirming that the Ulva bioassay is more sensitive. Correlation analyses for EC50 data versus the concentrations of toxicants in the sludge indicated a significant relationship between toxicity and four heavy meals (Cd, Cu, Pb, Zn) for the Ulva bioassay but no such correlation was detected by the Microtox test. The new bioassay method is simple to use, easy to interpret, economical, and eco-relevant so would be a valuable addition to aquatic toxicity testing protocols for a wide range of toxicants. Moreover, since Ulva has a wide geographical distribution and species have similar reproductive

  9. Miocene Coralline algae

    SciTech Connect

    Bosence, D.W.J.


    The coralline algae (Order Corallinales) were sedimentologically and ecologically important during the Miocene, a period when they were particularly abundant. The many poorly described and illustrated species and the lack of quantitative data in coralline thalli make specific determinations particularly difficult, but some species are well known and widespread in the Tethyan area. The sedimentologic importance of the Miocene coralline algae is reflected in the abundance of in-situ coralline buildups, rhodoliths, and coralline debris facies at Malta and Spain; similar sequences are known throughout the Tethyan Miocene. In-situ buildups vary from leafy crustose biostromes to walled reefs with dense coralline crusts and branches. Growth forms are apparently related to hydraulic energy. Rhodoliths vary from leafy, crustose, and open-branched forms in muddy sediments to dense, crustose, and radial-branching forms in coarse grainstones. Rhodolith form and internal structure correlate closely with hydraulic energy. Coralline genera are conservative and, as such, are useful in paleoenvironmental analysis. Of particular interest are the restricted depth ranges of recent coralline genera. More research is needed on the sedimentology, paleoecology, and systematics of the Cenozoic corallines, as they have particular value in paleoenvironmental analysis.

  10. Establishment of caudal fin cell lines from tropical ornamental fishes Puntius fasciatus and Pristolepis fasciata endemic to the Western Ghats of India.


    Swaminathan, T Raja; Basheer, V S; Gopalakrishnan, A; Rathore, Gaurav; Chaudhary, Dharmendra K; Kumar, Raj; Jena, J K


    Two new cell lines, PFF and CFF were established from the caudal fin of the Puntius fasciatus, and Pristolepis fasciata respectively. Since their initiation, these cell lines (PFF and CFF) have been subcultured in L-15 medium with 10% fetal bovine serum for more than 35 passages at 28°C and both the cell lines were characterized. Karyotyping analysis of PFF and CFF cells at 25th passage indicated that the modal chromosome number was 2n=50 and 2n=48 respectively. The cell line was cryopreserved in liquid nitrogen at -196°C and could be recovered from storage after six months with good cell viability. Polymerase chain reaction amplification of the fragments of two mitochondrial genes, 16S rRNA and COI confirmed that the cell lines originated from the respective species. The bacterial extracellular products from Vibrio cholerae MTCC3904 and Aeromonas hydrophila were found to be toxic to PFF and CFF. Both the cells were resistant to the marine viral nervous necrosis virus (VNNV). No CPE could be found in both cell lines inoculated with the fish samples and cell culture supernatants were demonstrated free of SVC, iridovirus and KHV by molecular methods. These results indicated the absence of SVC, iridovirus and KHV in the ornamental fishes collected from the Western Ghats of India.

  11. Cellular Auxin Transport in Algae.


    Zhang, Suyun; van Duijn, Bert


    The phytohormone auxin is one of the main directors of plant growth and development. In higher plants, auxin is generated in apical plant parts and transported from cell-to-cell in a polar fashion. Auxin is present in all plant phyla, and the existence of polar auxin transport (PAT) is well established in land plants. Algae are a group of relatively simple, autotrophic, photosynthetic organisms that share many features with land plants. In particular, Charophyceae (a taxon of green algae) are closest ancestors of land plants. In the study of auxin function, transport and its evolution, the algae form an interesting research target. Recently, proof for polar auxin transport in Chara species was published and auxin related research in algae gained more attention. In this review we discuss auxin transport in algae with respect to land plants and suggest directions for future studies. PMID:27135491

  12. Cellular Auxin Transport in Algae.


    Zhang, Suyun; van Duijn, Bert


    The phytohormone auxin is one of the main directors of plant growth and development. In higher plants, auxin is generated in apical plant parts and transported from cell-to-cell in a polar fashion. Auxin is present in all plant phyla, and the existence of polar auxin transport (PAT) is well established in land plants. Algae are a group of relatively simple, autotrophic, photosynthetic organisms that share many features with land plants. In particular, Charophyceae (a taxon of green algae) are closest ancestors of land plants. In the study of auxin function, transport and its evolution, the algae form an interesting research target. Recently, proof for polar auxin transport in Chara species was published and auxin related research in algae gained more attention. In this review we discuss auxin transport in algae with respect to land plants and suggest directions for future studies.

  13. Larvicidal Activity against Aedes aegypti and Molluscicidal Activity against Biomphalaria glabrata of Brazilian Marine Algae

    PubMed Central

    Guedes, Elíca Amara Cecília; de Carvalho, Cenira M.; Ribeiro Junior, Karlos Antonio Lisboa; Lisboa Ribeiro, Thyago Fernando; de Barros, Lurdiana Dayse; de Lima, Maria Raquel Ferreira; Prado Moura, Flávia de Barros; Goulart Sant'Ana, Antônio Euzebio


    This study investigated the biological activities of five benthic marine algae collected from Northeastern Region of Brazil. The tested activities included larvicidal activity against Aedes aegypti, molluscicidal activity against Biomphalaria glabrata, and toxicity against Artemia salina. Extracts of Ulva lactuca (Chlorophyta), Padina gymnospora, Sargassum vulgare (Phaeophyta), Hypnea musciformis, and Digenea simplex (Rhodophyta) were prepared using different solvents of increasing polarity, including dichloromethane, methanol, ethanol, and water. Of the extracts screened, the dichloromethane extracts of H. musciformis and P. gymnospora exhibited the highest activities and were subjected to bioassay-guided fractionation in hexane and chloroform. The chloroform fractions of the P. gymnospora and H. musciformis extracts showed molluscicidal activity at values below 40 μg·mL−1 (11.1460 μg·mL−1 and 25.8689 μg·mL−1, resp.), and the chloroform and hexane fractions of P. gymnospora showed larvicidal activity at values below 40 μg·mL−1 (29.018 μg·mL−1 and 17.230 μg·mL−1, resp.). The crude extracts were not toxic to A. salina, whereas the chloroform and hexane fractions of P. gymnospora (788.277 μg·mL−1 and 706.990 μg·mL−1) showed moderate toxicity, indicating that the toxic compounds present in these algae are nonpolar. PMID:24688787

  14. Larvicidal Activity against Aedes aegypti and Molluscicidal Activity against Biomphalaria glabrata of Brazilian Marine Algae.


    Guedes, Elíca Amara Cecília; de Carvalho, Cenira M; Ribeiro Junior, Karlos Antonio Lisboa; Lisboa Ribeiro, Thyago Fernando; de Barros, Lurdiana Dayse; de Lima, Maria Raquel Ferreira; Prado Moura, Flávia de Barros; Goulart Sant'ana, Antônio Euzebio


    This study investigated the biological activities of five benthic marine algae collected from Northeastern Region of Brazil. The tested activities included larvicidal activity against Aedes aegypti, molluscicidal activity against Biomphalaria glabrata, and toxicity against Artemia salina. Extracts of Ulva lactuca (Chlorophyta), Padina gymnospora, Sargassum vulgare (Phaeophyta), Hypnea musciformis, and Digenea simplex (Rhodophyta) were prepared using different solvents of increasing polarity, including dichloromethane, methanol, ethanol, and water. Of the extracts screened, the dichloromethane extracts of H. musciformis and P. gymnospora exhibited the highest activities and were subjected to bioassay-guided fractionation in hexane and chloroform. The chloroform fractions of the P. gymnospora and H. musciformis extracts showed molluscicidal activity at values below 40  μ g·mL(-1) (11.1460  μ g·mL(-1) and 25.8689  μ g·mL(-1), resp.), and the chloroform and hexane fractions of P. gymnospora showed larvicidal activity at values below 40  μ g·mL(-1) (29.018  μ g·mL(-1) and 17.230  μ g·mL(-1), resp.). The crude extracts were not toxic to A. salina, whereas the chloroform and hexane fractions of P. gymnospora (788.277  μ g·mL(-1) and 706.990  μ g·mL(-1)) showed moderate toxicity, indicating that the toxic compounds present in these algae are nonpolar. PMID:24688787

  15. Green energy from marine algae: biogas production and composition from the anaerobic digestion of Irish seaweed species.


    Vanegas, C H; Bartlett, J


    Marine algae have emerged as an alternative feedstock for the production of a number of renewable fuels, including biogas. In addition to energy potential, other characteristics make them attractive as an energy source, including their ability to absorb carbon dioxide (CO2), higher productivity rates than land-based crops and the lack of water use or land competition. For Ireland, biofuels from marine algae can play an important role by reducing imports of fossil fuels as well as providing the necessary energy in rural communities. In this study, five potential seaweed species common in Irish waters, Saccorhiza polyschides, Ulva sp., Laminaria digitata, Fucus serratus and Saccharina latissima, were co-digested individually with bovine slurry. Batch reactors of 120ml and 1000ml were set up and incubated at 35 degrees C to investigate their suitability for production of biogas. Digesters fed with S. latissima produced the maximum methane yield (335 ml g volatile solids(-1) (g(VS)(-1) followed by S. polyschides with 255 ml g(VS)(-1). L. digitata produced 246ml g(VS)(-1) and the lowest yields were from the green seaweed Ulva sp. 191ml g(VS)(-1). The methane and CO2 percentages ranged between 50-72% and 10-45%, respectively. The results demonstrated that the seaweed species investigated are good feedstocks candidates for the production of biogas and methane as a source of energy. Their use on a large-scale process will require further investigation to increase yields and reduce production costs.

  16. Algal Bioremediation of Waste Waters from Land-Based Aquaculture Using Ulva: Selecting Target Species and Strains

    PubMed Central

    Lawton, Rebecca J.; Mata, Leonardo; de Nys, Rocky; Paul, Nicholas A.


    The optimised reduction of dissolved nutrient loads in aquaculture effluents through bioremediation requires selection of appropriate algal species and strains. The objective of the current study was to identify target species and strains from the macroalgal genus Ulva for bioremediation of land-based aquaculture facilities in Eastern Australia. We surveyed land-based aquaculture facilities and natural coastal environments across three geographic locations in Eastern Australia to determine which species of Ulva occur naturally in this region and conducted growth trials at three temperature treatments on a subset of samples from each location to determine whether local strains had superior performance under local environmental conditions. DNA barcoding using the markers ITS and tufA identified six species of Ulva, with U. ohnoi being the most common blade species and U. sp. 3 the most common filamentous species. Both species occurred at multiple land-based aquaculture facilities in Townsville and Brisbane and multiple strains of each species grew well in culture. Specific growth rates of U. ohnoi and U. sp. 3 were high (over 9% and 15% day−1 respectively) across temperature treatments. Within species, strains of U. ohnoi had higher growth in temperatures corresponding to local conditions, suggesting that strains may be locally adapted. However, across all temperature treatments Townsville strains had the highest growth rates (11.2–20.4% day−1) and Sydney strains had the lowest growth rates (2.5–8.3% day−1). We also found significant differences in growth between strains of U. ohnoi collected from the same geographic location, highlighting the potential to isolate and cultivate fast growing strains. In contrast, there was no clearly identifiable competitive strain of filamentous Ulva, with multiple species and strains having variable performance. The fast growth rates and broad geographical distribution of U. ohnoi make this an ideal species to target for

  17. Algal bioremediation of waste waters from land-based aquaculture using ulva: selecting target species and strains.


    Lawton, Rebecca J; Mata, Leonardo; de Nys, Rocky; Paul, Nicholas A


    The optimised reduction of dissolved nutrient loads in aquaculture effluents through bioremediation requires selection of appropriate algal species and strains. The objective of the current study was to identify target species and strains from the macroalgal genus Ulva for bioremediation of land-based aquaculture facilities in Eastern Australia. We surveyed land-based aquaculture facilities and natural coastal environments across three geographic locations in Eastern Australia to determine which species of Ulva occur naturally in this region and conducted growth trials at three temperature treatments on a subset of samples from each location to determine whether local strains had superior performance under local environmental conditions. DNA barcoding using the markers ITS and tufA identified six species of Ulva, with U. ohnoi being the most common blade species and U. sp. 3 the most common filamentous species. Both species occurred at multiple land-based aquaculture facilities in Townsville and Brisbane and multiple strains of each species grew well in culture. Specific growth rates of U. ohnoi and U. sp. 3 were high (over 9% and 15% day(-1) respectively) across temperature treatments. Within species, strains of U. ohnoi had higher growth in temperatures corresponding to local conditions, suggesting that strains may be locally adapted. However, across all temperature treatments Townsville strains had the highest growth rates (11.2-20.4% day(-1)) and Sydney strains had the lowest growth rates (2.5-8.3% day(-1)). We also found significant differences in growth between strains of U. ohnoi collected from the same geographic location, highlighting the potential to isolate and cultivate fast growing strains. In contrast, there was no clearly identifiable competitive strain of filamentous Ulva, with multiple species and strains having variable performance. The fast growth rates and broad geographical distribution of U. ohnoi make this an ideal species to target for

  18. Ecology of Harmful Algae

    NASA Astrophysics Data System (ADS)

    Roelke, Daniel L.


    Edna Graneli and Jefferson T. Turner, Editors;Ecological Studies Series, Vol. 189; Springer; ISBN 3540322094; 413 pp.; 2006; $195 Harmful algal blooms (HABs) affect commercially and recreationally important species, human health, and ecosystem functioning. Hallmark events are the visually stunning blooms where waters are discolored and filled with ichthyotoxin-producing algae that lead to large fish kills. Of most concern, however, are HABs that pose a threat to human health. For example, some phycotoxins bioaccumulate in the guts and tissues of commercially and recreationally important species that when consumed by humans, may result in nausea, paralysis, memory loss, and even death. In addition to the deleterious impacts of phycotoxins, HABs can be problematic in other ways. For example, the decay of blooms often leads to low dissolved oxygen in subsurface waters. Blooms also reduce light penetration into the water column. Both processes disrupt ecosystems and in some cases have completely destroyed benthic communities.

  19. Sulphur fate and anaerobic biodegradation potential during co-digestion of seaweed biomass (Ulva sp.) with pig slurry.


    Peu, P; Sassi, J-F; Girault, R; Picard, S; Saint-Cast, Patricia; Béline, F; Dabert, P


    Seaweed (Ulva sp.) stranded on beaches were utilized as co-substrate for anaerobic digestion of pig slurry in three-month co-digestion tests in pilot scale anaerobic digesters in the laboratory. The methanogenic potential of Ulva sp. was low compared to that of other potential co-substrates available for use by farmers: 148 N m3CH4/t of volatile solids or 19 N m3CH4/t of crude product. When used as a co-substrate with pig manure (48%/52% w/w), Ulva sp. seaweed did not notably disrupt the process of digestion; however, after pilot stabilisation, biogas produced contained 3.5% H2S, making it unsuitable for energy recovery without treatment. Sequentially addition of the sulphate reduction inhibitor, potassium molybdate, to a final concentration of 3mM, temporarily reduced H2S emissions, but was unable to sustain this reduction over the three-month period. According to these pilot tests, the use of seaweed stranded on beaches as co-substrate in farm-based biogas plants shows some limitations. PMID:21982451

  20. Ploidy Distribution of the Harmful Bloom Forming Macroalgae Ulva spp. in Narragansett Bay, Rhode Island, USA, Using Flow Cytometry Methods

    PubMed Central

    Swanson, John-David; McFarland, Malcolm


    Macroalgal blooms occur worldwide and have the potential to cause severe ecological and economic damage. Narragansett Bay, RI is a eutrophic system that experiences summer macroalgal blooms composed mostly of Ulva compressa and Ulva rigida, which have biphasic life cycles with separate haploid and diploid phases. In this study, we used flow cytometry to assess ploidy levels of U. compressa and U. rigida populations from five sites in Narragansett Bay, RI, USA, to assess the relative contribution of both phases to bloom formation. Both haploid gametophytes and diploid sporophytes were present for both species. Sites ranged from a relative overabundance of gametophytes to a relative overabundance of sporophytes, compared to the null model prediction of √2 gametophytes: 1 sporophyte. We found significant differences in cell area between ploidy levels for each species, with sporophyte cells significantly larger than gametophyte cells in U. compressa and U. rigida. We found no differences in relative growth rate between ploidy levels for each species. Our results indicate the presence of both phases of each of the two dominant bloom forming species throughout the bloom season, and represent one of the first studies of in situ Ulva life cycle dynamics. PMID:26918869

  1. Ploidy Distribution of the Harmful Bloom Forming Macroalgae Ulva spp. in Narragansett Bay, Rhode Island, USA, Using Flow Cytometry Methods.


    Potter, Elaine E; Thornber, Carol S; Swanson, John-David; McFarland, Malcolm


    Macroalgal blooms occur worldwide and have the potential to cause severe ecological and economic damage. Narragansett Bay, RI is a eutrophic system that experiences summer macroalgal blooms composed mostly of Ulva compressa and Ulva rigida, which have biphasic life cycles with separate haploid and diploid phases. In this study, we used flow cytometry to assess ploidy levels of U. compressa and U. rigida populations from five sites in Narragansett Bay, RI, USA, to assess the relative contribution of both phases to bloom formation. Both haploid gametophytes and diploid sporophytes were present for both species. Sites ranged from a relative overabundance of gametophytes to a relative overabundance of sporophytes, compared to the null model prediction of √2 gametophytes: 1 sporophyte. We found significant differences in cell area between ploidy levels for each species, with sporophyte cells significantly larger than gametophyte cells in U. compressa and U. rigida. We found no differences in relative growth rate between ploidy levels for each species. Our results indicate the presence of both phases of each of the two dominant bloom forming species throughout the bloom season, and represent one of the first studies of in situ Ulva life cycle dynamics. PMID:26918869

  2. Saturating light and not increased carbon dioxide under ocean acidification drives photosynthesis and growth in Ulva rigida (Chlorophyta)

    PubMed Central

    Rautenberger, Ralf; Fernández, Pamela A; Strittmatter, Martina; Heesch, Svenja; Cornwall, Christopher E; Hurd, Catriona L; Roleda, Michael Y


    Carbon physiology of a genetically identified Ulva rigida was investigated under different CO2(aq) and light levels. The study was designed to answer whether (1) light or exogenous inorganic carbon (Ci) pool is driving growth; and (2) elevated CO2(aq) concentration under ocean acidification (OA) will downregulate CAext-mediated dehydration and alter the stable carbon isotope (δ13C) signatures toward more CO2 use to support higher growth rate. At pHT 9.0 where CO2(aq) is <1 μmol L−1, inhibition of the known use mechanisms, that is, direct uptake through the AE port and CAext-mediated dehydration decreased net photosynthesis (NPS) by only 56–83%, leaving the carbon uptake mechanism for the remaining 17–44% of the NPS unaccounted. An in silico search for carbon-concentrating mechanism elements in expressed sequence tag libraries of Ulva found putative light-dependent transporters to which the remaining NPS can be attributed. The shift in δ13C signatures from –22‰ toward –10‰ under saturating light but not under elevated CO2(aq) suggest preference and substantial use to support photosynthesis and growth. U. rigida is Ci saturated, and growth was primarily controlled by light. Therefore, increased levels of CO2(aq) predicted for the future will not, in isolation, stimulate Ulva blooms. PMID:25750714

  3. Fuel From Algae: Scaling and Commercialization of Algae Harvesting Technologies

    SciTech Connect


    Broad Funding Opportunity Announcement Project: Led by CEO Ross Youngs, AVS has patented a cost-effective dewatering technology that separates micro-solids (algae) from water. Separating micro-solids from water traditionally requires a centrifuge, which uses significant energy to spin the water mass and force materials of different densities to separate from one another. In a comparative analysis, dewatering 1 ton of algae in a centrifuge costs around $3,400. AVS’s Solid-Liquid Separation (SLS) system is less energy-intensive and less expensive, costing $1.92 to process 1 ton of algae. The SLS technology uses capillary dewatering with filter media to gently facilitate water separation, leaving behind dewatered algae which can then be used as a source for biofuels and bio-products. The biomimicry of the SLS technology emulates the way plants absorb and spread water to their capillaries.

  4. [From algae to "functional foods"].


    Vadalà, M; Palmieri, B


    In the recent years, a growing interest for nutraceutical algae (tablets, capsules, drops) has been developed, due to their effective health benefits, as a potential alternative to the classic drugs. This review explores the use of cyanobacterium Spirulina, the microalgae Chlorella, Dunaliella, Haematococcus, and the macroalgae Klamath, Ascophyllum, Lithothamnion, Chondrus, Hundaria, Glacilaria, Laminaria, Asparagopsis, Eisenia, Sargassum as nutraceuticals and dietary supplements, in terms of production, nutritional components and evidence-based health benefits. Thus, our specific goals are: 1) Overview of the algae species currently used in nutraceuticals; 2) Description of their characteristics, action mechanisms, and possible side effects; 3) Perspective of specific algae clinical investigations development. PMID:26378764

  5. Transgenic algae engineered for higher performance

    SciTech Connect

    Unkefer, Pat J; Anderson, Penelope S; Knight, Thomas J


    The present disclosure relates to transgenic algae having increased growth characteristics, and methods of increasing growth characteristics of algae. In particular, the disclosure relates to transgenic algae comprising a glutamine phenylpyruvate transaminase transgene and to transgenic algae comprising a glutamine phenylpyruvate transaminase transgene and a glutamine synthetase.

  6. Fatty acid profiles indicate the habitat of mud snails Hydrobia ulvae within the same estuary: Mudflats vs. seagrass meadows

    NASA Astrophysics Data System (ADS)

    Coelho, Helena; Lopes da Silva, Teresa; Reis, Alberto; Queiroga, Henrique; Serôdio, João; Calado, Ricardo


    Mud snails Hydrobia ulvae occupy different habitats in complex estuarine ecosystems. In order to determine if fatty acid profiles displayed by mud snails can be used to identify the habitat that they occupy within the same estuary, fatty acids of H. ulvae from one mudflat and one seagrass meadow in the Ria de Aveiro (Portugal) were analyzed and compared to those displayed by microphytobenthos (MPB), the green leaves (epiphyte-free) of Zostera noltii, as well as those exhibited by the epiphytic community colonizing this seagrass. MPB and epiphytic diatom-dominated samples displayed characteristic fatty acids, such as 16:1 n-7 and 20:5 n-3, while 18:2 n-6 and 18:3 n-3 were the dominant fatty acids in the green leaves of Z. noltii. Significant differences between the fatty acid profiles of H. ulvae specimens sampled in the mudflat and the seagrass meadow could be identified, with those from the mudflat displaying higher levels of fatty acids known to be characteristic of MPB. This result points towards the well known existence of grazing activity on MPB by mud snails. The fatty acid profiles displayed by H. ulvae inhabiting the seagrass meadows show no evidence of direct bioaccumulation of the two most abundant polyunsaturated fatty acids of Z. noltii (18:2 n-6 and 18:3 n-3) in the mud snails, which probably indicates that either these compounds can be metabolized to produce energy, used as precursors for the synthesis of essential fatty acids, or that the snails do not consume seagrass leaves at all. Moreover, the fatty acid profiles of mud snails inhabiting the seagrass meadows revealed the existence of substantial inputs from microalgae, suggesting that the epiphytic community colonizing the leaves of Z. noltii displays an important role on the diet of these organisms. This assumption is supported by the high levels of 20:5 n-3 and 22:6 n-3 recorded in mud snails sampled from seagrass meadows. In conclusion, fatty acid analyses of H. ulvae can be successfully used

  7. Algae fuel clean electricity generation

    SciTech Connect

    O'Sullivan, D.


    The paper describes plans for a 600-kW pilot generating unit, fueled by diesel and Chlorella, a green alga commonly seen growing on the surface of ponds. The plant contains Biocoil units in which Chlorella are grown using the liquid effluents from sewage treatment plants and dissolved carbon dioxide from exhaust gases from the combustion unit. The algae are partially dried and fed into the combustor where diesel fuel is used to maintain ignition. Diesel fuel is also used for start-up and as a backup fuel for seasonal shifts that affect the algae growing conditions. Since the algae use the carbon dioxide emitted during the combustion process, the process will not contribute to global warming.

  8. A biomonitoring study: trace metals in algae and molluscs from Tyrrhenian coastal areas.


    Conti, Marcelo Enrique; Cecchetti, Gaetano


    Marine organisms were evaluated as possible biomonitors of heavy metal contamination in marine coastal areas. Concentrations of Cd, Cr, Cu, Pb, and Zn were measured in the green algae Ulva lactuca L., the brown algae Padina pavonica (L.) Thivy, the bivalve mollusc Mytilus galloprovincialis Lamarck, and the two gastropod molluscs Monodonta turbinata Born and Patella cerulea L. collected at six coastal stations in the area of the Gulf of Gaeta (Tyrrhenian Sea, central Italy). The coastal area of the Regional Park of Gianola and Monte di Scauri (a "Protected Sea Park" area) was chosen as a control site. Seawater samples were also collected in each site to assess soluble and total metal concentrations and to gain additional information on both the environmental conditions of the area and possible bioaccumulation patterns. Metal concentrations detected in algae and molluscs did not show significant differences among all stations studied. Moreover, statistical analyses (ANOVA, multiple comparison tests, cluster analysis) showed that the Sea Park station was not significantly different from the others. The hypothesis that the Protected Sea Park would be cleaner than the others must therefore be reconsidered. Data from this study were also compared with those previously obtained from uncontaminated sites in the Sicilian Sea, Italy. The results show clearly differences between these two marine ecosystems. The species examined showed great accumulations of metals, with concentration factors (CFs) higher than 10,000 with respect to the concentrations (soluble fractions) in marine waters. Metal concentrations recorded in this area may be used for background levels for intraspecific comparison within the Tyrrhenian area, a body of water about which information is still very scarce.

  9. Multi-sensor monitoring of Ulva prolifera blooms in the Yellow Sea using different methods

    NASA Astrophysics Data System (ADS)

    Xu, Qing; Zhang, Hongyuan; Cheng, Yongcun


    The massive Ulva (U.) prolifera bloom in the Yellow Sea was first observed and reported in summer of 2008. After that, the green tide event occurred every year and influenced coastal areas of Jiangsu and Shandong provinces of China. Satellite remote sensing plays an important role in monitoring the floating macroalgae. In this paper, U. prolifera patches are detected from quasisynchronous satellite images with different spatial resolution, i.e., Aqua MODIS (Moderate Resolution Imaging Spectroradiometer), HJ-1A/B (China Small Satellite Constellation for Environment and Disaster Monitoring and Forecasting), CCD (Charge-Coupled Device), Landsat 8 OLI (Operational Land Imager), and ENVISAT (Environmental Satellite) ASAR (Advanced Synthetic Aperture Radar) images. Two comparative experiments are performed to explore the U. prolifera monitoring abilities by different data using detection methods such as NDVI (Normalized Difference Vegetation Index) with different thresholds. Results demonstrate that spatial resolution is an important factor affecting the extracted area of the floating macroalgae. Due to the complexity of Case II sea water characteristics in the Yellow Sea, a fixed threshold NDVI method is not suitable for U. prolifera monitoring. A method with adaptive ability in time and space, e.g., the threshold selection method proposed by Otsu (1979), is needed here to obtain accurate information on the floating macroalgae.

  10. Photosynthetic adaptation strategy of Ulva prolifera floating on the sea surface to environmental changes.


    Zhao, Xinyu; Tang, Xuexi; Zhang, Huanxin; Qu, Tongfei; Wang, Ying


    For 8 consecutive years, a green tide has originated in the southern Yellow Sea and spread to the Qingdao offshore area. The causative species, Ulva prolifera, always forms a very thick thallus mat that is capable of drifting long distances over long periods. During this process, although the thalli face disturbance by complex environmental factors, they maintain high biomass and proliferation. We hypothesized that some form of photosynthetic adaptation strategy must exist to protect the thalli. Therefore, we studied the different photosynthetic response characteristics of the surface and lower layers of the floating thallus mats, and investigated the physiological and molecular-level adaptation mechanisms. The results showed that: (1) U. prolifera has strong photosynthetic capability that ensures it can gain sufficient energy to increase its biomass and adapt to long-distance migration. (2) Surface layer thalli adapt to the complex environment by dissipating excess energy via photosynthetic quantum control (energy quenching and energy redistribution between PSII/PSI) to avoid irreversible damage to the photosynthetic system. (3) Lower layer thalli increase their contents of Chlorophyll a (Chl a) and Chlorophyll b (Chl b) and decrease their Chl a/Chl b ratio to improve their ability to use light energy. (4) U. prolifera has strong photosynthetic plasticity and can adapt to frequent exchange between the surface and lower layer environments because of wave disturbance. Pigment component changes, energy quenching, and energy redistribution between PSII/PSI contribute to this photosynthetic plasticity.

  11. Microwave-assisted direct liquefaction of Ulva prolifera for bio-oil production by acid catalysis.


    Zhuang, Yingbin; Guo, Jingxue; Chen, Limei; Li, Demao; Liu, Junhai; Ye, Naihao


    Production of bio-oil by microwave-assisted direct liquefaction (MADL) of Ulva prolifera was investigated, and the bio-oil was analyzed by elementary analysis, Fourier transform infrared spectroscopic analysis (FT-IR), and gas chromatography-mass spectrometry (GC-MS). The results indicate that the liquefaction yield is influenced by the microwave power, liquefaction temperature, liquefaction time, catalyst content, solvent-to-feedstock ratio and moisture content. The maximum liquefaction yield of U. prolifera (moisture content of 8%) was 84.81%, which was obtained under microwave power of 600 W for 30 min at 180 °C with solvent-to-feedstock ratio of 16:1 and 6% H(2)SO(4). The bio-oil was composed of benzenecarboxylic acid, diethyl phthalate, long-chain fatty acids (C(13) to C(18)), fatty acid methyl esters and water. The results suggest that U. prolifera is a viable eco-friendly, green feedstock substitute for biofuels and chemicals production. PMID:22609667



    Kuwano, Kazuyoshi; Hashioka, Takashi; Nishihara, Gregory N; Iima, Masafumi


    The present study was designed to develop a technique for crossing and to gain insight into how sexual reproduction contributes to the maintenance of local populations of Ulva compressa L. To examine the durations of gamete motility and conjugation ability, freshly released gametes were incubated for various periods of time prior to mixing both mating types. The conjugation ability of the gametes gradually declined after being released from the thalli when the gametes were incubated without mixing with the opposite mating type. The ability to conjugate decreased by half after 6 h, although most of the gametes remained motile. The gametes released 4 h later had the same level of conjugation ability when mixed immediately after releasing. When the mature thalli were wrapped in a moist paper towel to prevent gametes from being released, the gametes were preservable for 7 h without a significant decrease in their conjugation ability. Conjugation occurred soon after mixing gametes of both mating types and reached a plateau after 30 s. However, conjugation rates did not exceed a rate of ∼70%, even though freshly released gametes were used. Interestingly, a portion of the gametes newly conjugated 30 min after mixing both mating types, and conjugation rates reached a second plateau at ∼90%. Gametes with delayed conjugation are provided some period of time that allows them to be transported away and increases their chances of mating with more distant populations, thus contributing to the maintenance of genetic variation. PMID:27009729

  13. Allelopathic Interactions between the Opportunistic Species Ulva prolifera and the Native Macroalga Gracilaria lichvoides

    PubMed Central

    Zhang, Xiaowen; Fan, Xiao; Wang, Yitao; Li, Demao; Wang, Wei; Zhuang, Zhimeng; Ye, Naihao


    Allelopathy, one type of direct plant competition, can be a potent mechanism through which plant communities are structured. The aim of this study was to determine whether allelopathic interactions occur between the opportunistic green tide-forming species Ulva prolifera and the native macroalga Gracilaria lichvoides, both of which were collected from the coastline of East China sea. In laboratory experiments, the presence of G. lichvoides at 1.25 g wet weight L−1 significantly inhibited growth and photosynthesis of U. prolifera at concentrations of 1.25, 2.50, and 3.75 g wet weight L−1 (p<0.05) in both semi-continuous co-culture assays and in co-culture assays without nutrient supplementation. In contrast, although U. prolifera had a density effect on G. lichvoides, the differences among treatments were not significant (p>0.05). Culture medium experiments further confirmed that some allelochemicals may be released by both of the tested macroalgae, and these could account for the observed physiological inhibition of growth and photosynthesis. Moreover, the native macroalgae G. lichvoides was a stronger competitor than the opportunistic species U. prolifera. Collectively, the results of the present study represent a significant advance in exploring ecological questions about the effects of green tide blooms on the macroalgal community. PMID:22496758

  14. Microwave-assisted direct liquefaction of Ulva prolifera for bio-oil production by acid catalysis.


    Zhuang, Yingbin; Guo, Jingxue; Chen, Limei; Li, Demao; Liu, Junhai; Ye, Naihao


    Production of bio-oil by microwave-assisted direct liquefaction (MADL) of Ulva prolifera was investigated, and the bio-oil was analyzed by elementary analysis, Fourier transform infrared spectroscopic analysis (FT-IR), and gas chromatography-mass spectrometry (GC-MS). The results indicate that the liquefaction yield is influenced by the microwave power, liquefaction temperature, liquefaction time, catalyst content, solvent-to-feedstock ratio and moisture content. The maximum liquefaction yield of U. prolifera (moisture content of 8%) was 84.81%, which was obtained under microwave power of 600 W for 30 min at 180 °C with solvent-to-feedstock ratio of 16:1 and 6% H(2)SO(4). The bio-oil was composed of benzenecarboxylic acid, diethyl phthalate, long-chain fatty acids (C(13) to C(18)), fatty acid methyl esters and water. The results suggest that U. prolifera is a viable eco-friendly, green feedstock substitute for biofuels and chemicals production.

  15. Allelopathic interactions between the opportunistic species Ulva prolifera and the native macroalga Gracilaria lichvoides.


    Xu, Dong; Gao, Zhengquan; Zhang, Xiaowen; Fan, Xiao; Wang, Yitao; Li, Demao; Wang, Wei; Zhuang, Zhimeng; Ye, Naihao


    Allelopathy, one type of direct plant competition, can be a potent mechanism through which plant communities are structured. The aim of this study was to determine whether allelopathic interactions occur between the opportunistic green tide-forming species Ulva prolifera and the native macroalga Gracilaria lichvoides, both of which were collected from the coastline of East China sea. In laboratory experiments, the presence of G. lichvoides at 1.25 g wet weight L(-1) significantly inhibited growth and photosynthesis of U. prolifera at concentrations of 1.25, 2.50, and 3.75 g wet weight L(-1) (p<0.05) in both semi-continuous co-culture assays and in co-culture assays without nutrient supplementation. In contrast, although U. prolifera had a density effect on G. lichvoides, the differences among treatments were not significant (p>0.05). Culture medium experiments further confirmed that some allelochemicals may be released by both of the tested macroalgae, and these could account for the observed physiological inhibition of growth and photosynthesis. Moreover, the native macroalgae G. lichvoides was a stronger competitor than the opportunistic species U. prolifera. Collectively, the results of the present study represent a significant advance in exploring ecological questions about the effects of green tide blooms on the macroalgal community.

  16. Photosynthetic adaptation strategy of Ulva prolifera floating on the sea surface to environmental changes.


    Zhao, Xinyu; Tang, Xuexi; Zhang, Huanxin; Qu, Tongfei; Wang, Ying


    For 8 consecutive years, a green tide has originated in the southern Yellow Sea and spread to the Qingdao offshore area. The causative species, Ulva prolifera, always forms a very thick thallus mat that is capable of drifting long distances over long periods. During this process, although the thalli face disturbance by complex environmental factors, they maintain high biomass and proliferation. We hypothesized that some form of photosynthetic adaptation strategy must exist to protect the thalli. Therefore, we studied the different photosynthetic response characteristics of the surface and lower layers of the floating thallus mats, and investigated the physiological and molecular-level adaptation mechanisms. The results showed that: (1) U. prolifera has strong photosynthetic capability that ensures it can gain sufficient energy to increase its biomass and adapt to long-distance migration. (2) Surface layer thalli adapt to the complex environment by dissipating excess energy via photosynthetic quantum control (energy quenching and energy redistribution between PSII/PSI) to avoid irreversible damage to the photosynthetic system. (3) Lower layer thalli increase their contents of Chlorophyll a (Chl a) and Chlorophyll b (Chl b) and decrease their Chl a/Chl b ratio to improve their ability to use light energy. (4) U. prolifera has strong photosynthetic plasticity and can adapt to frequent exchange between the surface and lower layer environments because of wave disturbance. Pigment component changes, energy quenching, and energy redistribution between PSII/PSI contribute to this photosynthetic plasticity. PMID:27262405

  17. Role of Ulva lactuca Extract in Alleviation of Salinity Stress on Wheat Seedlings

    PubMed Central

    Ibrahim, Wael M.; Ali, Refaat M.; Hemida, Khaulood A.; Sayed, Makram A.


    Seaweeds are potentially excellent sources of highly bioactive materials that could represent useful leads in the alleviation of salinity stress. The effects of presoaking wheat grains in water extract of Ulva lactuca on growth, some enzymatic activities, and protein pattern of salinized plants were investigated in this study. Algal presoaking of grains demonstrated a highly significant enhancement in the percentage of seed germination and growth parameters. The activity of superoxide dismutase (SOD) and catalase (CAT) increased with increasing the algal extract concentration while activity of ascorbate peroxidase (APX) and glutathione reductase (GR) was decreased with increasing concentration of algal extract more than 1% (w/v). The protein pattern of wheat seedling showed 12 newly formed bands as result of algal extract treatments compared with control. The bioactive components in U. lactuca extract such as ascorbic acid, betaine, glutathione, and proline could potentially participate in the alleviation of salinity stress. Therefore, algal presoaking is proved to be an effective technique to improve the growth of wheat seedlings under salt stress conditions. PMID:25436231

  18. The expansion of Ulva prolifera O.F. Müller macroalgal blooms in the Yellow Sea, PR China, through asexual reproduction.


    Zhang, Jianheng; Kim, Jang Kyun; Yarish, Charles; He, Peimin


    Since 2007, Ulva macroalgal blooms have occurred along the coastal areas of the Yellow Sea, China. These blooms are dominated by fragments of Ulva prolifera in the early stages of development. The objectives of this study were to identify the primary mode of asexual reproduction for U. prolifera and to evaluate the contribution of these thalli fragments to the formation of blooms. Four different growth and reproductive strategies of U. prolifera segments were found including: 1) tubular diameter becoming larger; 2) formation of new branches; 3) release of zoids; and 4) polarized growth. This is the first report showing the development of numerous blade-lets from a single segment, which is remarkably different from previous studies on other Ulva species. The results in the present study provide critical information to understand how this species is able to support its explosive growth during a bloom. PMID:26856643

  19. The expansion of Ulva prolifera O.F. Müller macroalgal blooms in the Yellow Sea, PR China, through asexual reproduction.


    Zhang, Jianheng; Kim, Jang Kyun; Yarish, Charles; He, Peimin


    Since 2007, Ulva macroalgal blooms have occurred along the coastal areas of the Yellow Sea, China. These blooms are dominated by fragments of Ulva prolifera in the early stages of development. The objectives of this study were to identify the primary mode of asexual reproduction for U. prolifera and to evaluate the contribution of these thalli fragments to the formation of blooms. Four different growth and reproductive strategies of U. prolifera segments were found including: 1) tubular diameter becoming larger; 2) formation of new branches; 3) release of zoids; and 4) polarized growth. This is the first report showing the development of numerous blade-lets from a single segment, which is remarkably different from previous studies on other Ulva species. The results in the present study provide critical information to understand how this species is able to support its explosive growth during a bloom.

  20. Culture and Hybridization Experiments on an Ulva Clade Including the Qingdao Strain Blooming in the Yellow Sea

    PubMed Central

    Hiraoka, Masanori; Ichihara, Kensuke; Zhu, Wenrong; Ma, Jiahai; Shimada, Satoshi


    In the summer of 2008, immediately prior to the Beijing Olympics, a massive green tide of the genus Ulva covered the Qingdao coast of the Yellow Sea in China. Based on molecular analyses using the nuclear encoded rDNA internal transcribed spacer (ITS) region, the Qingdao strains dominating the green tide were reported to be included in a single phylogenetic clade, currently regarded as a single species. On the other hand, our detailed phylogenetic analyses of the clade, using a higher resolution DNA marker, suggested that two genetically separate entities could be included within the clade. However, speciation within the Ulva clade has not yet been examined. We examined the occurrence of an intricate speciation within the clade, including the Qingdao strains, via combined studies of culture, hybridization and phylogenetic analysis. The two entities separated by our phylogenetic analyses of the clade were simply distinguished as U. linza and U. prolifera morphologically by the absence or presence of branches in cultured thalli. The inclusion of sexual strains and several asexual strains were found in each taxon. Hybridizations among the sexual strains also supported the separation by a partial gamete incompatibility. The sexually reproducing Qingdao strains crossed with U. prolifera without any reproductive boundary, but a complete reproductive isolation to U. linza occurred by gamete incompatibility. The results demonstrate that the U. prolifera group includes two types of sexual strains distinguishable by crossing affinity to U. linza. Species identification within the Ulva clade requires high resolution DNA markers and/or hybridization experiments and is not possible by reliance on the ITS markers alone. PMID:21573216

  1. Neuroprotective Effects of Marine Algae

    PubMed Central

    Pangestuti, Ratih; Kim, Se-Kwon


    The marine environment is known as a rich source of chemical structures with numerous beneficial health effects. Among marine organisms, marine algae have been identified as an under-exploited plant resource, although they have long been recognized as valuable sources of structurally diverse bioactive compounds. Presently, several lines of studies have provided insight into biological activities and neuroprotective effects of marine algae including antioxidant, anti-neuroinflammatory, cholinesterase inhibitory activity and the inhibition of neuronal death. Hence, marine algae have great potential to be used for neuroprotection as part of pharmaceuticals, nutraceuticals and functional foods. This contribution presents an overview of marine algal neuroprotective effects and their potential application in neuroprotection. PMID:21673890

  2. Polysaccharides of the red algae.


    Usov, Anatolii I


    Red algae (Rhodophyta) are known as the source of unique sulfated galactans, such as agar, agarose, and carrageenans. The wide practical uses of these polysaccharides are based on their ability to form strong gels in aqueous solutions. Gelling polysaccharides usually have molecules built up of repeating disaccharide units with a regular distribution of sulfate groups, but most of the red algal species contain more complex galactans devoid of gelling ability because of various deviations from the regular structure. Moreover, several red algae may contain sulfated mannans or neutral xylans instead of sulfated galactans as the main structural polysaccharides. This chapter is devoted to a description of the structural diversity of polysaccharides found in the red algae, with special emphasis on the methods of structural analysis of sulfated galactans. In addition to the structural information, some data on the possible use of red algal polysaccharides as biologically active polymers or as taxonomic markers are briefly discussed.

  3. Isolation, structure, and surfactant properties of polysaccharides from Ulva lactuca L. from South China Sea.


    Tian, Hua; Yin, Xueqiong; Zeng, Qinghuan; Zhu, Li; Chen, Junhua


    Two polysaccharides (ULP1 and ULP2) were isolated through ultrasonic-assisted extraction from green seaweed Ulva lactuca L. which was collected from the South China Sea. The highest yield of 17.57% was obtained under the conditions of 2% NaOH, 90 °C, material/water mass ratio 1:80, liquid extraction 5h and subsequent ultrasound-assisted extraction 1h. The structure of ULPs were characterized with periodate oxidation followed by Smith degradation, (1)H NMR, (13)C NMR spectroscopy, FTIR, and GPC. The molecular weights of ULP1 and ULP2 were 189 kDa and 230 kDa, respectively. The structural characteristics of ULP1 and ULP2 were quite similar. They were composed of rhamnose, xylose, glucose, and glucuronic acid. The content of rhamnose, xylose, glucose, glucuronic acid, sulfate was 51.2%, 12.3%, 20.1%, 16.4%, 12.0% for ULP1, respectively, and 60.8%, 14.2%, 8.2%, 16.8%, 26.8%, respectively, for ULP2. Both ULP1 and ULP2 showed good surface activity. 5 mg/mL ULP1 (2.62×10(-2) mmol/L) decreased the water surface tension to 51.63 mN/m. The critical micellar concentration of ULP1 and ULP2 was 1.01 mg/mL (5.3×10(-3) mmol/L) and 1.14 mg/mL (5.0×10(-3) mmol/L), respectively.

  4. In vitro exposure of Ulva lactuca Linnaeus (Chlorophyta) to gasoline - Biochemical and morphological alterations.


    Pilatti, Fernanda Kokowicz; Ramlov, Fernanda; Schmidt, Eder Carlos; Kreusch, Marianne; Pereira, Débora Tomazi; Costa, Christopher; de Oliveira, Eva Regina; Bauer, Cláudia M; Rocha, Miguel; Bouzon, Zenilda Laurita; Maraschin, Marcelo


    Refined fuels have considerable share of pollution of marine ecosystems. Gasoline is one of the most consumed fuel worldwide, but its effects on marine benthic primary producers are poorly investigated. In this study, Ulva lactuca was chosen as a biological model due to its cosmopolitan nature and tolerance to high levels and wide range of xenobiotics and our goal was to evaluate the effects of gasoline on ultrastructure and metabolism of that seaweed. The experimental design consisted of in vitro exposure of U. lactuca to four concentrations of gasoline (0.001%, 0.01%, 0.1%, and 1.0%, v/v) over 30 min, 1 h, 12 h, and 24 h, followed by cytochemical, SEM, and biochemical analysis. Increase in the number of cytoplasmic granules, loss of cell turgor, cytoplasmic shrinkage, and alterations in the mucilage were some of the ultrastructural alterations observed in thalli exposed to gasoline. Decrease in carotenoid and polyphenol contents, as well as increase of soluble sugars and starch contents were associated with the time of exposure to the xenobiotic. In combination, the results revealed important morphological and biochemical alterations in the phenotype of U. lactuca upon acute exposure to gasoline. This seaweed contain certain metabolites assigned as candidates to biomarkers of the environmental stress investigated and it is thought to be a promise species for usage in coastal ecosystems perturbation monitoring system. In addition, the findings suggest that U. lactuca is able to metabolize gasoline hydrocarbons and use them as energy source, acting as bioremediator of marine waters contaminated by petroleum derivatives. PMID:27192480

  5. In vitro exposure of Ulva lactuca Linnaeus (Chlorophyta) to gasoline - Biochemical and morphological alterations.


    Pilatti, Fernanda Kokowicz; Ramlov, Fernanda; Schmidt, Eder Carlos; Kreusch, Marianne; Pereira, Débora Tomazi; Costa, Christopher; de Oliveira, Eva Regina; Bauer, Cláudia M; Rocha, Miguel; Bouzon, Zenilda Laurita; Maraschin, Marcelo


    Refined fuels have considerable share of pollution of marine ecosystems. Gasoline is one of the most consumed fuel worldwide, but its effects on marine benthic primary producers are poorly investigated. In this study, Ulva lactuca was chosen as a biological model due to its cosmopolitan nature and tolerance to high levels and wide range of xenobiotics and our goal was to evaluate the effects of gasoline on ultrastructure and metabolism of that seaweed. The experimental design consisted of in vitro exposure of U. lactuca to four concentrations of gasoline (0.001%, 0.01%, 0.1%, and 1.0%, v/v) over 30 min, 1 h, 12 h, and 24 h, followed by cytochemical, SEM, and biochemical analysis. Increase in the number of cytoplasmic granules, loss of cell turgor, cytoplasmic shrinkage, and alterations in the mucilage were some of the ultrastructural alterations observed in thalli exposed to gasoline. Decrease in carotenoid and polyphenol contents, as well as increase of soluble sugars and starch contents were associated with the time of exposure to the xenobiotic. In combination, the results revealed important morphological and biochemical alterations in the phenotype of U. lactuca upon acute exposure to gasoline. This seaweed contain certain metabolites assigned as candidates to biomarkers of the environmental stress investigated and it is thought to be a promise species for usage in coastal ecosystems perturbation monitoring system. In addition, the findings suggest that U. lactuca is able to metabolize gasoline hydrocarbons and use them as energy source, acting as bioremediator of marine waters contaminated by petroleum derivatives.

  6. Formation of algae growth constitutive relations for improved algae modeling.

    SciTech Connect

    Gharagozloo, Patricia E.; Drewry, Jessica Louise.


    This SAND report summarizes research conducted as a part of a two year Laboratory Directed Research and Development (LDRD) project to improve our abilities to model algal cultivation. Algae-based biofuels have generated much excitement due to their potentially large oil yield from relatively small land use and without interfering with the food or water supply. Algae mitigate atmospheric CO2 through metabolism. Efficient production of algal biofuels could reduce dependence on foreign oil by providing a domestic renewable energy source. Important factors controlling algal productivity include temperature, nutrient concentrations, salinity, pH, and the light-to-biomass conversion rate. Computational models allow for inexpensive predictions of algae growth kinetics in these non-ideal conditions for various bioreactor sizes and geometries without the need for multiple expensive measurement setups. However, these models need to be calibrated for each algal strain. In this work, we conduct a parametric study of key marine algae strains and apply the findings to a computational model.

  7. Microscopic Gardens: A Close Look at Algae.

    ERIC Educational Resources Information Center

    Foote, Mary Ann


    Describes classroom activities using algae, including demonstration of eutrophication, examination of mating strains, and activities with Euglena. Includes on algal morphology/physiology, types of algae, and field sources for collecting these organisms. (JN)

  8. 21 CFR 184.1120 - Brown algae.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1120 Brown algae. (a) Brown algae are seaweeds of the species...

  9. 21 CFR 184.1120 - Brown algae.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1120 Brown algae. (a) Brown algae are seaweeds of the species...

  10. 21 CFR 184.1120 - Brown algae.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1120 Brown algae. (a) Brown algae are seaweeds of the species...

  11. 21 CFR 184.1120 - Brown algae.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1120 Brown algae. (a) Brown algae are seaweeds of the species...

  12. 21 CFR 184.1121 - Red algae.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1121 Red algae. (a) Red algae are seaweeds of the species...

  13. 21 CFR 184.1121 - Red algae.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1121 Red algae. (a) Red algae are seaweeds of the species...

  14. 21 CFR 184.1121 - Red algae.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1121 Red algae. (a) Red algae are seaweeds of the species...

  15. 21 CFR 184.1121 - Red algae.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1121 Red algae. (a) Red algae are seaweeds of the species...

  16. 21 CFR 184.1121 - Red algae.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD....1121 Red algae. (a) Red algae are seaweeds of the species Gloiopeltis furcata, Porphyra...

  17. 21 CFR 184.1120 - Brown algae.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD....1120 Brown algae. (a) Brown algae are seaweeds of the species Analipus japonicus, Eisenia...

  18. Biological importance of marine algae

    PubMed Central

    El Gamal, Ali A.


    Marine organisms are potentially prolific sources of highly bioactive secondary metabolites that might represent useful leads in the development of new pharmaceutical agents. Algae can be classified into two main groups; first one is the microalgae, which includes blue green algae, dinoflagellates, bacillariophyta (diatoms)… etc., and second one is macroalgae (seaweeds) which includes green, brown and red algae. The microalgae phyla have been recognized to provide chemical and pharmacological novelty and diversity. Moreover, microalgae are considered as the actual producers of some highly bioactive compounds found in marine resources. Red algae are considered as the most important source of many biologically active metabolites in comparison to other algal classes. Seaweeds are used for great number of application by man. The principal use of seaweeds as a source of human food and as a source of gums (phycocollides). Phycocolloides like agar agar, alginic acid and carrageenan are primarily constituents of brown and red algal cell walls and are widely used in industry. PMID:23960716

  19. Magnetite and Magnetotaxis in Algae

    PubMed Central

    de Araujo, F. F. Torres; Pires, M. A.; Frankel, R. B.; Bicudo, C. E. M.


    Magnetotactic algae of the genus Anisonema (Euglenophyceae) have been isolated from a coastal mangrove swamp in northeastern Brazil. The magnetotactic response is based on a permanent magnetic dipole moment per cell ∼7 10-10 emu. Each cell contains many magnetite (Fe3O4) particles organized in chains. ImagesFIGURE 2FIGURE 1FIGURE 3 PMID:19431684

  20. Algae. LC Science Tracer Bullet.

    ERIC Educational Resources Information Center

    Niskern, Diana, Comp.

    The plants and plantlike organisms informally grouped together as algae show great diversity of form and size and occur in a wide variety of habitats. These extremely important photosynthesizers are also economically significant. For example, some species contaminate water supplies; others provide food for aquatic animals and for man; still others…

  1. The appearance of Ulva laetevirens (Ulvophyceae, Chlorophyta) in the northeast coast of the United States of America

    NASA Astrophysics Data System (ADS)

    Mao, Yunxiang; Kim, Jang Kyun; Wilson, Roderick; Yarish, Charles


    Introduced species may outcompete or hybridize with native species, resulting in the loss of native biodiversity or even alteration of ecosystem processes. In this study, we reported an alien distromatic Ulva species, which was found in an embayment (Holly Pond) connected with Long Island Sound, USA. The morphological and anatomical observations in combination with molecular data were used for its identification to species. Anatomy of collected specimens showed that the cell shape in rhizoidal and basal regions was round and the marginal teeth along the basal and median region were not found. These characteristics were primarily identical to the diagnostic characteristics of Ulva laetevirens Areschoug (Chlorophyta). The plastid-encoding tufA and nucleusencoding ITS1 were used for its molecular identification. Phylogenetic analysis for the tufA gene placed the specimens from Holly Pond in a well-supported clade along with published sequences of U. laetevirens identified early without any sequence divergence. In ITS tree, the sample also formed well-supported clades with the sequences of U. laetevirens with an estimated sequence divergence among the taxa in these clades as low as 1%. These findings confirmed the morpho-anatomical conclusion. Native to Australia, this species was reported in several countries along the Mediterranean coast after the late of 1990s. This is the first time that U. laetevirens is found in the northeast coast of United States and the second record for Atlantic North America.

  2. Antioxidant system responses in two co-occurring green-tide algae under stress conditions

    NASA Astrophysics Data System (ADS)

    Wang, Ying; Zhao, Xinyu; Tang, Xuexi


    Green tides have occurred every year from 2007 to 2014 in the Yellow Sea. Ulva prolifera (Müller) J. Agardh has been identified as the bloom-forming alga, co-occurring with U. intestinalis. We observed distinct strategies for both algal species during green tides. U. prolifera exhibited a high abundance initially and then decreased dramatically, while U. intestinalis persisted throughout. The antioxidant system responses of these two macroalgae were compared in the late phase of a green tide (in-situ) and after laboratory acclimation. Lipid peroxidation and antioxidant system responses differed significantly between the two. Malondialdehyde and hydrogen peroxide contents increased significantly in-situ in U. prolifera, but not in U. intestinalis. In U. prolifera, we observed a significant decrease in total antioxidant ability (T-AOC), antioxidant enzymes (SOD and Apx), and non-enzyme antioxidants (GSH and AsA) in-situ. U. intestinalis showed the same pattern of T-AOC and SOD, but its Gpx, Apx, and GSH responses did not differ significantly. The results suggest that U. prolifera was more susceptible than U. intestinalis to the harsh environmental changes during the late phase of a Yellow Sea green tide. The boom and bust strategy exhibited by U. prolifera and the persistence of U. intestinalis can be explained by differences in enzyme activity and antioxidant systems.

  3. Seasonal patterns and recruitment dynamics of green tide-forming Ulva species along the intertidal rocky shores of the southern coast of Korea

    NASA Astrophysics Data System (ADS)

    Park, Sang Rul


    The abundance of two Ulva species in unmanipulated and artificial plots was investigated to better understand the ecological aspects of green tides on the intertidal rocky shore of the southern coast of Korea from July 1998 to January 2001. Artificial substrates were made on ceramic tiles (200 cm2) using a mixture of cement and rock and were set up on the rocky substrate in the lower intertidal zone using a hammer and anchor bolts. These settling plates were replaced every 1-2 months. Two Ulva species were recruited continuously for 3-4 months each year. U. pertusa was recruited during summer-autumn, whereas U. linza was recruited during winter-early spring or spring-early summer. However, U. pertusa dominated in the monitoring plots compared with the experimental period, with the exception of 2 months (February and March 2000). These results indicated that U. pertusa may be the main contributor to green tides along the intertidal rocky shores. The two Ulva species showed a positive relationship between density and biomass. This suggests that the physical removal of Ulva masses should be conducted during the early growing season. I hope this study provides valuable information for determining management policies for green tides on intertidal rocky shores.

  4. Cytotoxicity and antimicrobial activity of marine macro algae (Dictyotaceae and Ulvaceae) from the Persian Gulf.


    Mashjoor, Sakineh; Yousefzadi, Morteza; Esmaeili, Mohamad Ali; Rafiee, Roya


    Pharmaceutical industry now accept the worlds ocean which contains a vast array of organisms with unique biological properties, as a major frontier for medical investigation. Bioactive compounds with different modes of action, such as, antiproliferative, antioxidant, antimicrotubule, have been isolated from marine sources, specifically macro and micro algae, and cyanobacteria. The aim of this work was to investigate antimicrobial and cytotoxic activities of the extracts of marine macro algae Ulva flexuosa, Padina antillarum and Padina boergeseni from the northern coasts of the Persian Gulf, Qeshm Island, Iran, against three cell lines including MCF7, HeLa and Vero, as well as their inhibitory effects against a wide array (i.e. n = 11) of pathogenic bacteria and fungi. Antimicrobial activity of the marine macro algal extracts was assessed using a disc diffusion method; an MTT cytotoxicity assay was employed to test the effects of the extracts on each cancer cell line. The algal extracts showed considerable antimicrobial activity against the majority of the tested bacteria and fungi. Both ethyl acetate and methanol extracts at the highest concentration (100 µg/ml) caused cell death, with the IC50 values calculated for each cell type and each algal extracts. Results are exhibited a higher decrease in the viability of the cells treated at the highest concentration of marine macro algal ethyl acetate extracts compared to the methanol extracts (78.9 % death in Vero cells by ethyl acetate extracts from U. flexuosa). Despite, the ethyl acetate extracts with lower dose- response of cells, exhibited better cytotoxic activity than methanol extracts (IC50: 55.26 μg/ml in Vero cells by ethyl acetate extracts from U. flexuosa). Based on the findings, it is concluded that the marine macro algal extracts from the Persian Gulf possess antibacterial and cytotoxic potential, which could be considered for future applications in medicine and identifying novel drugs from the

  5. The remote sensing of algae

    NASA Technical Reports Server (NTRS)

    Thorne, J. F.


    State agencies need rapid, synoptic and inexpensive methods for lake assessment to comply with the 1972 Amendments to the Federal Water Pollution Control Act. Low altitude aerial photography may be useful in providing information on algal type and quantity. Photography must be calibrated properly to remove sources of error including airlight, surface reflectance and scene-to-scene illumination differences. A 550-nm narrow wavelength band black and white photographic exposure provided a better correlation to algal biomass than either red or infrared photographic exposure. Of all the biomass parameters tested, depth-integrated chlorophyll a concentration correlated best to remote sensing data. Laboratory-measured reflectance of selected algae indicate that different taxonomic classes of algae may be discriminated on the basis of their reflectance spectra.

  6. Algae control for hydrogeneration canals

    SciTech Connect

    Grahovac, P.


    The purpose of this Cooperative Research and Development Agreement (CRADA) was to assess and develop control practices for nuisance algae growth in power canal that delivers water to hydro-generation facilities. This growth results in expenditures related not only to lost generation but also labor and materials costs associated with implementing remediation procedures. On an industry-wide basis these costs associated with nuisance algal growth are estimated to be several million dollars per year.

  7. Parasites in algae mass culture

    PubMed Central

    Carney, Laura T.; Lane, Todd W.


    Parasites are now known to be ubiquitous across biological systems and can play an important role in modulating algal populations. However, there is a lack of extensive information on their role in artificial ecosystems such as algal production ponds and photobioreactors. Parasites have been implicated in the demise of algal blooms. Because individual mass culture systems often tend to be unialgal and a select few algal species are in wide scale application, there is an increased potential for parasites to have a devastating effect on commercial scale monoculture. As commercial algal production continues to expand with a widening variety of applications, including biofuel, food and pharmaceuticals, the parasites associated with algae will become of greater interest and potential economic impact. A number of important algal parasites have been identified in algal mass culture systems in the last few years and this number is sure to grow as the number of commercial algae ventures increases. Here, we review the research that has identified and characterized parasites infecting mass cultivated algae, the techniques being proposed and or developed to control them, and the potential impact of parasites on the future of the algal biomass industry. PMID:24936200

  8. Halogenated Compounds from Marine Algae

    PubMed Central

    Cabrita, Maria Teresa; Vale, Carlos; Rauter, Amélia Pilar


    Marine algae produce a cocktail of halogenated metabolites with potential commercial value. Structures exhibited by these compounds go from acyclic entities with a linear chain to complex polycyclic molecules. Their medical and pharmaceutical application has been investigated for a few decades, however other properties, such as antifouling, are not to be discarded. Many compounds were discovered in the last years, although the need for new drugs keeps this field open as many algal species are poorly screened. The ecological role of marine algal halogenated metabolites has somehow been overlooked. This new research field will provide valuable and novel insight into the marine ecosystem dynamics as well as a new approach to comprehending biodiversity. Furthermore, understanding interactions between halogenated compound production by algae and the environment, including anthropogenic or global climate changes, is a challenging target for the coming years. Research of halogenated metabolites has been more focused on macroalgae than on phytoplankton. However, phytoplankton could be a very promising material since it is the base of the marine food chain with quick adaptation to environmental changes, which undoubtedly has consequences on secondary metabolism. This paper reviews recent progress on this field and presents trends on the role of marine algae as producers of halogenated compounds. PMID:20948909

  9. Evaluation of anticoagulant activity of two algal polysaccharides.


    Faggio, C; Pagano, M; Dottore, A; Genovese, G; Morabito, M


    Marine algae are important sources of phycocolloids like agar, carrageenans and alginates used in industrial applications. Algal polysaccharides have emerged as an important class of bioactive products showing interesting properties. The aim of our study was to evaluate the potential uses as anticoagulant drugs of algal sulphate polysaccharides extracted from Ulva fasciata (Chlorophyta) and Agardhiella subulata (Rhodophyta) collected in Ganzirri Lake (Cape Peloro Lagoon, north-eastern Sicily, Italy). Toxicity of algal extracts through trypan blue test and anticoagulant action measured by activated partial thromboplastin time (APTT), prothrombin time (PT) test has been evaluated. Algal extracts showed to prolong the PT and APTT during the coagulation cascade and to avoid the blood coagulation of samples. Furthermore, the algal extracts lack toxic effects towards cellular metabolism and their productions are relatively at low cost. This permits to consider the algae as the biological source of the future.

  10. Influence of synthetic surfactants on the uptake of Pd, Cd and Pb by the marine macroalga, Ulva lactuca.


    Masakorala, Kanaji; Turner, Andrew; Brown, Murray T


    Uptake of Pd, Cd and Pb by the marine macroalga, Ulva lactuca, has been studied in the presence of an anionic (sodium dodecyl sulphate, SDS), cationic (hexadecyltrimethylammonium bromide; HDTMA) and non-ionic (Triton X-100; TX) surfactant. Compared with the surfactant-free system, metal sorption was reduced in the presence of SDS or TX. Neither surfactant, however, had any measurable impact on cell membrane permeability, determined by leakage of dissolved free amino acids (DFAA), or on metal internalisation. We attribute these observations to the stabilisation of aqueous Cd and Pb by SDS and the shielding of otherwise amenable sorption sites by TX. Presence of HDTMA resulted in a reduction in the extent of both sorption and internalisation of all metals and a significant increase in the leakage of DFAA. Thus, by enhancing membrane permeability, HDTMA exerts the greatest influence on metal behaviour in the presence of U. lactuca.

  11. Effects of ulvoid (Ulva spp.) accumulation on the structure and function of eelgrass (Zostera marina L.) bed.


    Sugimoto, Kenji; Hiraoka, Kiyonori; Ohta, Seiji; Niimura, Yoko; Terawaki, Toshinobu; Okada, Mitsumasa


    The objective of this study is to clarify the effect of ulvoid (Ulva spp.) accumulation on the structure and function of an eelgrass bed by the coast of Iwakuni, Seto Inland Sea, Japan. We monitored eelgrass shoot density and volume of ulvoid accumulation in the study site and evaluated effects of the accumulated ulvoid canopy on the percent survival, seedling density, growth rates, photosynthetic photon flux density (PPFD) and carbon contents of eelgrass. Eelgrass shoot density decreased by the accumulation of ulvoid. Also, seedling density decreased by the increase in the ulvoid volumes. Shoot density, seedling density and leaf elongation were negatively correlated with ulvoid volume. Carbon contents in eelgrass decreased by the accumulation of ulvoid (canopy height: 25cm). These results suggest that accumulation of ulvoid bloom has significant negative impacts on the structure and function of eelgrass bed, i.e. decreases in vegetative shoot density, seedling density, shoot height and growth rate.

  12. Stochastic Forecasting of Algae Blooms in Lakes

    SciTech Connect

    Wang, Peng; Tartakovsky, Daniel M.; Tartakovsky, Alexandre M.


    We consider the development of harmful algae blooms (HABs) in a lake with uncertain nutrients inflow. Two general frameworks, Fokker-Planck equation and the PDF methods, are developed to quantify the resultant concentration uncertainty of various algae groups, via deriving a deterministic equation of their joint probability density function (PDF). A computational example is examined to study the evolution of cyanobacteria (the blue-green algae) and the impacts of initial concentration and inflow-outflow ratio.

  13. Alterations in seawater pH and CO 2 affect calcification and photosynthesis in the tropical coralline alga, Hydrolithon sp. (Rhodophyta)

    NASA Astrophysics Data System (ADS)

    Semesi, I. Sware; Kangwe, Juma; Björk, Mats


    Calcification in the marine environment is the basis for the accretion of carbonate in structures such as coral reefs, algal ridges and carbonate sands. Among the organisms responsible for such calcification are the Corallinaceae (Rhodophyta), recognised as major contributors to the process world-wide. Hydrolithon sp. is a coralline alga that often forms rhodoliths in the Western Indian Ocean. In Zanzibar, it is commonly found in shallow lagoons, where it often grows within seagrass beds and/or surrounded by green algae such as Ulva sp. Since seagrasses in Zanzibar have recently been shown to raise the pH of the surrounding seawater during the day, and since calcification rates are sensitive to pH, which changes the saturation state of calcium carbonate, we measured the effects of pH on photosynthetic and calcification rates of this alga. It was found that pH had significant effects on both calcification and photosynthesis. While increased pH enhanced calcification rates both in the light and in the dark at pH >8.6, photosynthetic rates decreased. On the other hand, an increase in dissolved CO 2 concentration to ˜26 μmol kg -1 (by bubbling with air containing 0.9 mbar CO 2) caused a decrease in seawater pH which resulted in 20% less calcification after 5 days of exposure, while enhancing photosynthetic rates by 13%. The ecological implications of these findings is that photosynthetically driven changes in water chemistry by surrounding plants can affect calcification rates of coralline algae, as may future ocean acidification resulting from elevated atmospheric CO 2.

  14. Hydrogen metabolism of photosynthetic bacteria and algae

    SciTech Connect

    Kumazawa, S.; Mitsui, A.


    The metabolism, metabolic pathways and biochemistry of hydrogen in photosynthetic bacteria and algae are reviewed. Detailed information on the occurrence and measurement of hydrogenase activity is presented. Hydrogen production rates for different species of algae and bacteria are presented. 173 references, 1 figure, 7 tables.

  15. SSMILes: Measuring the Nutrient Tolerance of Algae.

    ERIC Educational Resources Information Center

    Hedgepeth, David J.


    Presents an activity integrating mathematics and science intended to introduce students to the use of metric measurement of mass as a way to increase the meaningfulness of observations about variables in life sciences. Involves measuring the nutrient tolerance of algae. Contains a reproducible algae nutrient graph. (Author/MKR)

  16. Take a Dip! Culturing Algae Is Easy.

    ERIC Educational Resources Information Center

    James, Daniel E.


    Describes laboratory activities using algae as the organisms of choice. These include examination of typical algal cells, demonstration of alternation of generations, sexual reproduction in Oedogonium, demonstration of phototaxis, effect of nitrate concentration on Ankistrodesmus, and study of competition between two algae in the same environment.…

  17. Nutritional And Taste Characteristics Of Algae

    NASA Technical Reports Server (NTRS)

    Karel, M.; Nakhost, Z.


    Report describes investigation of chemical composition of blue-green algae Synechococcus 6311, as well as preparation of protein isolate from green alga Scenedesmus obliquus and incorporation into variety of food products evaluated for taste. Part of program to investigate growth of microalgae aboard spacecraft for use as food.

  18. Effect of Dead Algae on Soil Permeability

    SciTech Connect

    Harvey, R.S.


    Since existing basins support heavy growths of unicellular green algae which may be killed by temperature variation or by inadvertent pH changes in waste and then deposited on the basin floor, information on the effects of dead algae on soil permeability was needed. This study was designed to show the effects of successive algal kills on the permeability of laboratory soil columns.


    EPA Science Inventory

    Two green algal morphotypes, filamentous species (e.g., Chaetomorpha spp.) and flattened or tubular (e.g.,Ulva spp. and Enteromorpha spp.) were collected from 63 sites within the Yaquina Bay estuary (Newport, OR) and used to compare an in situ volumetric biomass estimator to the...

  20. Antarctic sea ice thickness affects algae populations

    NASA Astrophysics Data System (ADS)

    Schultz, Colin


    In the waters off Antarctica, algae grow and live in the sea ice that surrounds the southern continent—a floating habitat sure to change as the planet warms. As with most aquatic ecosystems, microscopic algae form the base of the Southern Ocean food web. Distinct algae populations reside in the sea ice surface layers, on the ice's underside, and within the floating ice itself. The algae that reside on the floating ice's underside are particularly important for the region's krill population, while those on the interior or surface layers are less accessible. Understanding how changing sea ice properties will affect the regional biology, then, depends on understanding how algae populations interact with the ice.

  1. The ice nucleation activity of extremophilic algae.


    Kviderova, Jana; Hajek, Josef; Worland, Roger M


    Differences in the level of cold acclimation and cryoprotection estimated as ice nucleation activity in snow algae (Chlamydomonas cf. nivalis and Chloromonas nivalis), lichen symbiotic algae (Trebouxia asymmetrica, Trebouxia erici and Trebouxia glomerata), and a mesophilic strain (Chlamydomonas reinhardti) were evaluated. Ice nucleation activity was measured using the freezing droplet method. Measurements were performed using suspensions of cells of A750 (absorbance at 750 nm) ~ 1, 0.1, 0.01 and 0.001 dilutions for each strain. The algae had lower ice nucleation activity, with the exception of Chloromonas nivalis contaminated by bacteria. The supercooling points of the snow algae were higher than those of lichen photobionts. The supercooling points of both, mesophilic and snow Chlamydomonas strains were similar. The lower freezing temperatures of the lichen algae may reflect either the more extreme and more variable environmental conditions of the original localities or the different cellular structure of the strains examined.

  2. Composting of waste algae: a review.


    Han, Wei; Clarke, William; Pratt, Steven


    Although composting has been successfully used at pilot scale to manage waste algae removed from eutrophied water environments and the compost product applied as a fertiliser, clear guidelines are not available for full scale algae composting. The review reports on the application of composting to stabilize waste algae, which to date has mainly been macro-algae, and identifies the peculiarities of algae as a composting feedstock, these being: relatively low carbon to nitrogen (C/N) ratio, which can result in nitrogen loss as NH3 and even N2O; high moisture content and low porosity, which together make aeration challenging; potentially high salinity, which can have adverse consequence for composting; and potentially have high metals and toxin content, which can affect application of the product as a fertiliser. To overcome the challenges that these peculiarities impose co-compost materials can be employed.

  3. Flocculation of model algae under shear.

    SciTech Connect

    Pierce, Flint; Lechman, Jeremy B.


    We present results of molecular dynamics simulations of the flocculation of model algae particles under shear. We study the evolution of the cluster size distribution as well as the steady-state distribution as a function of shear rates and algae interaction parameters. Algal interactions are modeled through a DLVO-type potential, a combination of a HS colloid potential (Everaers) and a yukawa/colloid electrostatic potential. The effect of hydrodynamic interactions on aggregation is explored. Cluster strucuture is determined from the algae-algae radial distribution function as well as the structure factor. DLVO parameters including size, salt concentration, surface potential, initial volume fraction, etc. are varied to model different species of algae under a variety of environmental conditions.

  4. Algae inhibition experiment and load characteristics of the algae solution

    NASA Astrophysics Data System (ADS)

    Xiong, L.; Gao, J. X.; Zhang, Y. X.; Yang, Z. K.; Zhang, D. Q.; He, W.


    It is necessary to inhibit microbial growth in an industrial cooling water system. This paper has developed a Monopolar/Bipolar polarity high voltage pulser with load adaptability for an algal experimental study. The load characteristics of the Chlorella pyrenoidosa solution were examined, and it was found that the solution load is resistive. The resistance is related to the plate area, concentration, and temperature of the solution. Furthermore, the pulser's treatment actually inhibits the algae cell growth. This article also explores the influence of various parameters of electric pulses on the algal effect. After the experiment, the optimum pulse parameters were determined to be an electric field intensity of 750 V/cm, a pulse width per second of 120μs, and monopolar polarity.

  5. Microbodies of the alga Chara.


    Stabenau, Helmut; Säftel, Werner; Winkler, Uwe


    Chara fragilis possesses microbodies with a remarkably large size of up to 2 micro m in diameter. Many of the organelles contain huge nucleoids of amorphous material or paracrystalline inclusions. After isolation of the organelles by gradient centrifugation the specific density of the microbodies was determined to be 1.25 g cm-3. Catalase, glycolate oxidase and hydroxypyruvate reductase as well as enzymes of the fatty acid beta-oxidation pathway were demonstrated to be constituents of the microbodies in Chara indicating that they are similar to those in green leaves. The data obtained are in agreement with the view that the Charophyceae and especially the algae in the subgroup of Charales are very closely related to the land plants.

  6. Algae biodiesel - a feasibility report

    PubMed Central


    Background Algae biofuels have been studied numerous times including the Aquatic Species program in 1978 in the U.S., smaller laboratory research projects and private programs. Results Using Molina Grima 2003 and Department of Energy figures, captial costs and operating costs of the closed systems and open systems were estimated. Cost per gallon of conservative estimates yielded $1,292.05 and $114.94 for closed and open ponds respectively. Contingency scenarios were generated in which cost per gallon of closed system biofuels would reach $17.54 under the generous conditions of 60% yield, 50% reduction in the capital costs and 50% hexane recovery. Price per gallon of open system produced fuel could reach $1.94 under generous assumptions of 30% yield and $0.2/kg CO2. Conclusions Current subsidies could allow biodiesel to be produced economically under the generous conditions specified by the model. PMID:22540986

  7. Adaptability of free-floating green tide algae in the Yellow Sea to variable temperature and light intensity.


    Cui, Jianjun; Zhang, Jianheng; Huo, Yuanzi; Zhou, Lingjie; Wu, Qing; Chen, Liping; Yu, Kefeng; He, Peimin


    In this study, the influence of temperature and light intensity on the growth of seedlings and adults of four species of green tide algae (Ulvaprolifera, Ulvacompressa, Ulva flexuosa and Ulvalinza) from the Yellow Sea was evaluated. The results indicated that the specific growth rate (SGR) of seedlings was much higher than that of adults for the four species. The adaptability of U. prolifera is much wider: Adult daily SGRs were the highest among the four species at 15-20 °C with 10-600 μmol · m(-2) · s(-1) and 25-30 °C with 200-600 μmol · m(-2) · s(-1). SGRs were 1.5-3.5 times greater than the other three species at 15-25 °C with 200-600 μmol · m(-2) · s(-1). These results indicate that U. prolifera has better tolerance to high temperature and light intensity than the other three species, which may in part explain why only U. prolifera undergoes large-scale outbreaks and floats to the Qingdao coast while the other three species decline and disappear at the early stage of blooming.

  8. Bacterial diversity in surface water of the Yellow Sea during and after a green alga tide in 2008

    NASA Astrophysics Data System (ADS)

    Guo, Cong; Li, Fuchao; Jiang, Peng; Liu, Zhaopu; Qin, Song


    From May to August 2008, a large "green tide", consisting of the alga Ulva ( Enteromorpha) prolifera, occurred in the Yellow Sea, China, affecting the local marine ecosystem and human activities. We investigated the influence of the green tide on the microbial community in the surface seawater, at four sites from July to August 2008, using bacterial 16S rRNA gene clone libraries. We sequenced 228 clones of unique patterns identified by restriction fragment length polymorphism (RFLP) techniques. The results show that 228 sequenced clones fell into six bacterial phyla: Proteobacteria, Bacteroidetes, Cyanobacteria, Verrucomicrobia, Actinobacteria, and Planctomycetes. Alphaproteobacteria (33%), Gammaproteobacteria (25%), Bacteroidetes (23%) and Cyanobacteria (9%) dominated the assemblage. Comparison between samples collected in July (during the tide) and those collected in August (after the tide) showed that, in the microbial community, diversities of Alphaproteobacteria and Cyanobacteria increased after the tide, while those of Gammaproteobacteria and Bacteroidetes decreased. These results indicate that the green tide influenced the growth of some bacteria, and provide information for further studies on the interactions and relationships between U. prolifera and the bacterial community. This study suggests that microbial community analysis is a good approach to monitoring green tides.

  9. DGDG and Glycolipids in Plants and Algae.


    Kalisch, Barbara; Dörmann, Peter; Hölzl, Georg


    Photosynthetic organelles in plants and algae are characterized by the high abundance of glycolipids, including the galactolipids mono- and digalactosyldiacylglycerol (MGDG, DGDG) and the sulfolipid sulfoquinovosyldiacylglycerol (SQDG). Glycolipids are crucial to maintain an optimal efficiency of photosynthesis. During phosphate limitation, the amounts of DGDG and SQDG increase in the plastids of plants, and DGDG is exported to extraplastidial membranes to replace phospholipids. Algae often use betaine lipids as surrogate for phospholipids. Glucuronosyldiacylglycerol (GlcADG) is a further glycolipid that accumulates under phosphate deprived conditions. In contrast to plants, a number of eukaryotic algae contain very long chain polyunsaturated fatty acids of 20 or more carbon atoms in their glycolipids. The pathways and genes for galactolipid and sulfolipid synthesis are largely conserved between plants, Chlorophyta, Rhodophyta and algae with complex plastids derived from secondary or tertiary endosymbiosis. However, the relative contribution of the endoplasmic reticulum- and plastid-derived lipid pathways for glycolipid synthesis varies between plants and algae. The genes for glycolipid synthesis encode precursor proteins imported into the photosynthetic organelles. While most eukaryotic algae contain the plant-like galactolipid (MGD1, DGD1) and sulfolipid (SQD1, SQD2) synthases, the red alga Cyanidioschyzon harbors a cyanobacterium-type DGDG synthase (DgdA), and the amoeba Paulinella, derived from a more recent endosymbiosis event, contains cyanobacterium-type enzymes for MGDG and DGDG synthesis (MgdA, MgdE, DgdA). PMID:27023231

  10. Algae Biofuel in the Nigerian Energy Context

    NASA Astrophysics Data System (ADS)

    Elegbede, Isa; Guerrero, Cinthya


    The issue of energy consumption is one of the issues that have significantly become recognized as an important topic of global discourse. Fossil fuels production reportedly experiencing a gradual depletion in the oil-producing nations of the world. Most studies have relatively focused on biofuel development and adoption, however, the awareness of a prospect in the commercial cultivation of algae having potential to create economic boost in Nigeria, inspired this research. This study aims at exploring the potential of the commercialization of a different but commonly found organism, algae, in Nigeria. Here, parameters such as; water quality, light, carbon, average temperature required for the growth of algae, and additional beneficial nutrients found in algae were analysed. A comparative cum qualitative review of analysis was used as the study made use of empirical findings on the work as well as the author's deductions. The research explored the cultivation of algae with the two major seasonal differences (i.e. rainy and dry) in Nigeria as a backdrop. The results indicated that there was no significant difference in the contribution of algae and other sources of biofuels as a necessity for bioenergy in Nigeria. However, for an effective sustainability of this prospect, adequate measures need to be put in place in form of funding, provision of an economically-enabling environment for the cultivation process as well as proper healthcare service in the face of possible health hazard from technological processes. Further studies can seek to expand on the potential of cultivating algae in the Harmattan season.

  11. DGDG and Glycolipids in Plants and Algae.


    Kalisch, Barbara; Dörmann, Peter; Hölzl, Georg


    Photosynthetic organelles in plants and algae are characterized by the high abundance of glycolipids, including the galactolipids mono- and digalactosyldiacylglycerol (MGDG, DGDG) and the sulfolipid sulfoquinovosyldiacylglycerol (SQDG). Glycolipids are crucial to maintain an optimal efficiency of photosynthesis. During phosphate limitation, the amounts of DGDG and SQDG increase in the plastids of plants, and DGDG is exported to extraplastidial membranes to replace phospholipids. Algae often use betaine lipids as surrogate for phospholipids. Glucuronosyldiacylglycerol (GlcADG) is a further glycolipid that accumulates under phosphate deprived conditions. In contrast to plants, a number of eukaryotic algae contain very long chain polyunsaturated fatty acids of 20 or more carbon atoms in their glycolipids. The pathways and genes for galactolipid and sulfolipid synthesis are largely conserved between plants, Chlorophyta, Rhodophyta and algae with complex plastids derived from secondary or tertiary endosymbiosis. However, the relative contribution of the endoplasmic reticulum- and plastid-derived lipid pathways for glycolipid synthesis varies between plants and algae. The genes for glycolipid synthesis encode precursor proteins imported into the photosynthetic organelles. While most eukaryotic algae contain the plant-like galactolipid (MGD1, DGD1) and sulfolipid (SQD1, SQD2) synthases, the red alga Cyanidioschyzon harbors a cyanobacterium-type DGDG synthase (DgdA), and the amoeba Paulinella, derived from a more recent endosymbiosis event, contains cyanobacterium-type enzymes for MGDG and DGDG synthesis (MgdA, MgdE, DgdA).

  12. Winogradskyella eckloniae sp. nov., a marine bacterium isolated from the brown alga Ecklonia cava.


    Kim, Ji-Young; Park, So-Hyun; Seo, Ga-Young; Kim, Young-Ju; Oh, Duck-Chul


    A novel bacterial strain, designated EC29(T), was isolated from the brown alga Ecklonia cava collected on Jeju Island, Republic of Korea. Cells of strain EC29(T) were Gram-stain-negative, aerobic, rod-shaped and motile by gliding. Growth was observed at 10-30 °C (optimum, 20-25 °C), at pH 6.0-9.5 (optimum, pH 7.5) and in the presence of 1-5% (w/v) NaCl. Phylogenetic analyses based on the 16S rRNA gene sequence revealed that the strain belonged to the genus Winogradskyella. Strain EC29(T) exhibited the highest 16S rRNA gene sequence similarities, of 96.5-97.8%, to the type strains of Winogradskyella pulchriflava EM106(T), Winogradskyella echinorum KMM 6211(T) and Winogradskyella ulvae KMM 6390(T). Strain EC29(T) exhibited < 27% DNA-DNA relatedness with Winogradskyella pulchriflava EM106(T) and Winogradskyella echinorum KMM 6211(T). The predominant fatty acids of strain EC29(T) were iso-C15 : 0, iso-C15 : 1 G, C15 : 0, iso-C17 : 0 3-OH, iso-C15 : 0 3-OH and anteiso-C15 : 0. The DNA G+C content was 31.1 mol% and the major respiratory quinone was menaquinone-6 (MK-6). Based on a polyphasic study, strain EC29(T) is considered to represent a novel species of the genus Winogradskyella, for which the name Winogradskyella eckloniae sp. nov. is proposed. The type strain is EC29(T) ( = KCTC 32172(T) = JCM 18703(T)). PMID:25979633

  13. Errors When Extracting Oil from Algae

    NASA Astrophysics Data System (ADS)

    Murphy, E.; Treat, R.; Ichiuji, T.


    Oil is in popular demand, but the worldwide amount of oil is decreasing and prices for it are steadily increasing. Leading scientists have been working to find a solution of attaining oil in an economically and environmentally friendly way. Researchers at the U.S. Department of Energy's Pacific Northwest National Laboratory (PNNL) have determined that "a small mixture of algae and water can be turned into crude oil in less than an hour" (Sheehan, Duhahay, Benemann, Poessler). There are various ways of growing the algae, such as closed loop and open loop methods, as well as processes of extracting oil, such as hydrothermal liquefaction and the hexane-solvent method. Our objective was to grow the algae (C. reinhardtii) and extract oil from it using NaOH and HCl, because we had easy access to those specific chemicals. After two trials of attempted algae growth, we discovered that a bacteria was killing off the algae. This led us to further contemplation on how this dead algae and bacteria are affecting our environment, and the organisms within it. Eutrophication occurs when excess nutrients stimulate rapid growth of algae in an aquatic environment. This can clog waterways and create algal blooms in blue-green algae, as well as neurotoxic red tide phytoplankton. These microscopic algae die upon consumption of the nutrients in water and are degraded by bacteria. The bacteria respires and creates an acidic environment with the spontaneous conversion of carbon dioxide to carbonic acid in water. This process of degradation is exactly what occurred in our 250 mL flask. When the phytoplankton attacked our algae, it created a hypoxic environment, which eliminated any remaining amounts of oxygen, carbon dioxide, and nutrients in the water, resulting in a miniature dead zone. These dead zones can occur almost anywhere where there are algae and bacteria, such as the ocean, and make it extremely difficult for any organism to survive. This experiment helped us realize the

  14. Method and apparatus for processing algae

    SciTech Connect

    Chew, Geoffrey; Reich, Alton J.; Dykes, Jr., H. Waite; Di Salvo, Roberto


    Methods and apparatus for processing algae are described in which a hydrophilic ionic liquid is used to lyse algae cells. The lysate separates into at least two layers including a lipid-containing hydrophobic layer and an ionic liquid-containing hydrophilic layer. A salt or salt solution may be used to remove water from the ionic liquid-containing layer before the ionic liquid is reused. The used salt may also be dried and/or concentrated and reused. The method can operate at relatively low lysis, processing, and recycling temperatures, which minimizes the environmental impact of algae processing while providing reusable biofuels and other useful products.

  15. 21 CFR 73.275 - Dried algae meal.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 1 2013-04-01 2013-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  16. 21 CFR 73.275 - Dried algae meal.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 1 2012-04-01 2012-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  17. 21 CFR 73.275 - Dried algae meal.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 1 2011-04-01 2011-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  18. 21 CFR 73.275 - Dried algae meal.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 1 2014-04-01 2014-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  19. 21 CFR 73.275 - Dried algae meal.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Dried algae meal. 73.275 Section 73.275 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.275 Dried algae meal. (a) Identity. The color additive dried algae meal is a dried mixture of algae cells (genus Spongiococcum, separated from its culture...

  20. Indirect and direct effects of salinity on the quantity and quality of total amino acids in Ulva ohnoi (Chlorophyta).


    Angell, Alex R; Mata, Leonardo; de Nys, Rocky; Paul, Nicholas A


    Salinity can affect the quantity and quality of total amino acids (TAAs) in seaweeds indirectly by altering growth rates and thereby diluting or concentrating the amino acid content of the biomass, or directly by altering the synthesis of specific amino acids and osmolytes. This study attempted to partition the indirect and direct effects of salinity on the quantity and quality of TAAs in the green seaweed Ulva ohnoi by culturing it under a range of salinities without nutrient limitation. Both the quantity and quality of TAAs varied across the salinity treatments. Quantity was most strongly related to the growth rate of the seaweed and was highest in the slowest growing seaweed. In contrast, the quality of TAAs (individual amino acids as a proportion of total content) was most strongly related to salinity for all amino acids, although this varied substantially among individual amino acids. Increases in salinity were positively correlated with the proportion of proline (46% increase), tyrosine (36% increase), and histidine (26% increase), whereas there was a negative correlation with alanine (29% decrease). The proportion of methionine, with strong links to the synthesis of the osmolyte dimethylsulfoniopropionate, did not correlate linearly with salinity and instead was moderately higher at the optimal salinities for growth. These results show that salinity simultaneously affects the quantity and quality of TAAs in seaweed through both indirect and direct mechanisms, with growth rates playing the overarching role in determining the quantity of TAAs. PMID:26986668

  1. An evaluation of the toxicity and bioaccumulation of thallium in the coastal marine environment using the macroalga, Ulva lactuca.


    Turner, Andrew; Furniss, Oliver


    Thallium(I) has been added to cultures of the marine macroalga, Ulva lactuca, for a period of 48 h and the accumulation of the metal and its effects on the photochemical efficiency of photosystem II (PS II) measured. Thallium elicited a measurable toxic response above concentrations of 10 μg L⁻¹ in both coastal seawater (salinity 33) and estuarine water (salinity 20). The accumulation of Tl was defined by a linear relationship with aqueous Tl and accumulation factors of about 900 mL g⁻¹ in both media. Thallium accumulated by U. lactuca that was resistant to an EDTA extraction and, by operational definition, internalised, exceeded 90% in both cases. Accumulation and toxicity of Tl in the presence of a ∼10⁵-fold excess of its biogeochemical analogue, potassium, suggests that Tl has a high intrinsic phytotoxicity and that its mode of action involves permeation of the cell membrane as Tl⁺ through NaCl-KCl co-transporter sites rather than (or in addition to) transport through K⁺ ion channels.

  2. Effects of five antifouling biocides on settlement and growth of zoospores from the marine macroalga Ulva lactuca L.


    Wendt, Ida; Arrhenius, Åsa; Backhaus, Thomas; Hilvarsson, Annelie; Holm, Kristina; Langford, Katherine; Tunovic, Timur; Blanck, Hans


    Antifouling biocides are found in the marine ecosystem were they can affect non-target organisms. In this study the effects of five antifouling biocides on the settlement and growth of Ulva lactuca zoospores were investigated. The biocides investigated were copper (Cu(2+)), 4,5-dichloro-2-n-octyl-3(2H)-isothiazolone (DCOIT), triphenylborane pyridine (TPBP), tolylfluanid and medetomidine. Full concentration-response curves where determined for each compound. EC50 values were determined for copper, DCOIT, TPBP and tolylfluanid, all of which inhibited settlement and growth in a concentration dependent manner with the following toxicity ranking; tolylfluanid (EC50 80 nmol L(-1)) ~ DCOIT (EC50 83 nmol L(-1)) > TPBP (EC50 400 nmol L(-1)) > Cu(2+) (EC50 2,000 nmol L(-1)). Medetomidine inhibited settlement and growth only at the extreme concentration of 100,000 nmol L(-1) (93% effect). The low toxicity is possibly a consequence of a lack of receptors that medetomidine can bind to in the U. lactuca zoospores. PMID:23846394

  3. Growth responses of Ulva prolifera to inorganic and organic nutrients: Implications for macroalgal blooms in the southern Yellow Sea, China

    PubMed Central

    Li, Hongmei; Zhang, Yongyu; Han, Xiurong; Shi, Xiaoyong; Rivkin, Richard B.; Legendre, Louis


    The marine macrophyte Ulva prolifera is the dominant green-tide-forming seaweed in the southern Yellow Sea, China. Here we assessed, in the laboratory, the growth rate and nutrient uptake responses of U. prolifera to different nutrient treatments. The growth rates were enhanced in incubations with added organic and inorganic nitrogen [i.e. nitrate (NO3−), ammonium (NH4+), urea and glycine] and phosphorus [i.e. phosphate (PO43−), adenosine triphosphate (ATP) and glucose 6-phosphate (G-6-P)], relative to the control. The relative growth rates of U. prolifera were higher when enriched with dissolved organic nitrogen (urea and glycine) and phosphorus (ATP and G-6-P) than inorganic nitrogen (NO3− and NH4+) and phosphorus (PO43−). In contrast, the affinity was higher for inorganic than organic nutrients. Field data in the southern Yellow Sea showed significant inverse correlations between macroalgal biomass and dissolved organic nutrients. Our laboratory and field results indicated that organic nutrients such as urea, glycine and ATP, may contribute to the development of macroalgal blooms in the southern Yellow Sea. PMID:27199215

  4. [Effects of Ulva pertusa and Gracilaria lemaneiformis on growth of Heterosigma akashiwo (Raphidophyceae) in co-culture].


    Wang, You; Yu, Zhi-ming; Song, Xiu-xian; Zhang, Shan-dong


    We studied the effects of fresh tissue and culture medium filtrate of two species of macroalgae, Ulva pertusa (Chlorophyta) and Gracilaria lemaneiformis (Rhodophyta) on growth of Heterosigma akashiwo (Raphidophyceae) in co-culture. Both U. pertusa and G. lemaneiformis, and especially their fresh tissues, significantly impede the growth of H. akashiwo. Carbonate limitations and the presence of environment bacteria are not necessary for the negative effects of macroalgal on H. akashiwo. The simultaneous nutrient assays show that nitrate and phosphate are almost exhausted in the G. lemaneiformis co-culture system, but remain at acceptable levels in the U. pertusa system, when all cells of H. akashiwo are completely dead. When f/2 medium is supplied daily to G. lemaneiformis culture, the growth of H. akashiwo is greatly inhibited but not completely terminated. Furthermore, different amounts of fresh seaweed tissue, and culture medium filtrate prepared from different macroalgal concentrations are analyzed to determine their effects on the growth of H. akashiwo. The results show a positive correlation between the initial macroalgal concentration and the negative effects they exert on the co-cultured microalgae. Results suggest that the allelopathic effects of U. pertusa may be essential for negative effects on H. akashiwo; however, the combined roles of allelopathy and nutrient competition may be responsible for the negative effect of G. lemaneiformis the release of allelochemicals by U. pertusa.

  5. Growth responses of Ulva prolifera to inorganic and organic nutrients: Implications for macroalgal blooms in the southern Yellow Sea, China.


    Li, Hongmei; Zhang, Yongyu; Han, Xiurong; Shi, Xiaoyong; Rivkin, Richard B; Legendre, Louis


    The marine macrophyte Ulva prolifera is the dominant green-tide-forming seaweed in the southern Yellow Sea, China. Here we assessed, in the laboratory, the growth rate and nutrient uptake responses of U. prolifera to different nutrient treatments. The growth rates were enhanced in incubations with added organic and inorganic nitrogen [i.e. nitrate (NO3(-)), ammonium (NH4(+)), urea and glycine] and phosphorus [i.e. phosphate (PO4(3-)), adenosine triphosphate (ATP) and glucose 6-phosphate (G-6-P)], relative to the control. The relative growth rates of U. prolifera were higher when enriched with dissolved organic nitrogen (urea and glycine) and phosphorus (ATP and G-6-P) than inorganic nitrogen (NO3(-) and NH4(+)) and phosphorus (PO4(3-)). In contrast, the affinity was higher for inorganic than organic nutrients. Field data in the southern Yellow Sea showed significant inverse correlations between macroalgal biomass and dissolved organic nutrients. Our laboratory and field results indicated that organic nutrients such as urea, glycine and ATP, may contribute to the development of macroalgal blooms in the southern Yellow Sea. PMID:27199215

  6. Growth responses of Ulva prolifera to inorganic and organic nutrients: Implications for macroalgal blooms in the southern Yellow Sea, China

    NASA Astrophysics Data System (ADS)

    Li, Hongmei; Zhang, Yongyu; Han, Xiurong; Shi, Xiaoyong; Rivkin, Richard B.; Legendre, Louis


    The marine macrophyte Ulva prolifera is the dominant green-tide-forming seaweed in the southern Yellow Sea, China. Here we assessed, in the laboratory, the growth rate and nutrient uptake responses of U. prolifera to different nutrient treatments. The growth rates were enhanced in incubations with added organic and inorganic nitrogen [i.e. nitrate (NO3‑), ammonium (NH4+), urea and glycine] and phosphorus [i.e. phosphate (PO43‑), adenosine triphosphate (ATP) and glucose 6-phosphate (G-6-P)], relative to the control. The relative growth rates of U. prolifera were higher when enriched with dissolved organic nitrogen (urea and glycine) and phosphorus (ATP and G-6-P) than inorganic nitrogen (NO3‑ and NH4+) and phosphorus (PO43‑). In contrast, the affinity was higher for inorganic than organic nutrients. Field data in the southern Yellow Sea showed significant inverse correlations between macroalgal biomass and dissolved organic nutrients. Our laboratory and field results indicated that organic nutrients such as urea, glycine and ATP, may contribute to the development of macroalgal blooms in the southern Yellow Sea.

  7. Pyogenic Flexor Tenosynovitis Caused by Shewanella algae.


    Fluke, Erin C; Carayannopoulos, Nikoletta L; Lindsey, Ronald W


    Pyogenic flexor tenosynovitis is an orthopedic emergency most commonly caused by Staphylococcus aureus and streptococci and occasionally, when associated with water exposure, Mycobacterium marinum. Shewanella algae, a gram-negative bacillus found in warm saltwater environments, has infrequently been reported to cause serious soft tissue infections and necrosis. In this case, S. algae caused complicated flexor tenosynovitis requiring open surgical irrigation and debridement. Flexor tenosynovitis caused by S. algae rapidly presented with all 4 Kanavel cardinal signs as well as subcutaneous purulence, ischemia, and necrosis, thus meeting the requirements for Pang et al group III classification of worst prognosis. Because of its rarity and virulence, S. algae should always be considered in cases of flexor tenosynovitis associated with traumatic water exposure to treat and minimize morbidity appropriately.

  8. 2011 Biomass Program Platform Peer Review: Algae

    SciTech Connect

    Yang, Joyce


    This document summarizes the recommendations and evaluations provided by an independent external panel of experts at the 2011 U.S. Department of Energy Biomass Program’s Algae Platform Review meeting.

  9. Collection, Isolation and Culture of Marine Algae.

    ERIC Educational Resources Information Center

    James, Daniel E.


    Methods of collecting, isolating, and culturing microscopic and macroscopic marine algae are described. Three different culture media list of chemicals needed and procedures for preparing Erdschreiber's and Provasoli's E. S. media. (BC)

  10. Stochastic Forecasting of Algae Blooms in Lakes

    SciTech Connect

    Wang, Peng; Tartakovsky, Daniel M.; Tartakovsky, Alexandre M.


    We consider a general framework to predict the development of harmful algal blooms (HABs) in a lake driven by uncertain parameters. To quantify the concentration uncertainty of those algae groups via their joint probabilistic density function (PDF), we explore an approach based on the Fokker-Planck equation. Our result is presented in an example where abundant nutrients contribute to the proliferation of cyanobacteria and other minor algae groups.

  11. Antioxidant Activity of Hawaiian Marine Algae

    PubMed Central

    Kelman, Dovi; Posner, Ellen Kromkowski; McDermid, Karla J.; Tabandera, Nicole K.; Wright, Patrick R.; Wright, Anthony D.


    Marine algae are known to contain a wide variety of bioactive compounds, many of which have commercial applications in pharmaceutical, medical, cosmetic, nutraceutical, food and agricultural industries. Natural antioxidants, found in many algae, are important bioactive compounds that play an important role against various diseases and ageing processes through protection of cells from oxidative damage. In this respect, relatively little is known about the bioactivity of Hawaiian algae that could be a potential natural source of such antioxidants. The total antioxidant activity of organic extracts of 37 algal samples, comprising of 30 species of Hawaiian algae from 27 different genera was determined. The activity was determined by employing the FRAP (Ferric Reducing Antioxidant Power) assays. Of the algae tested, the extract of Turbinaria ornata was found to be the most active. Bioassay-guided fractionation of this extract led to the isolation of a variety of different carotenoids as the active principles. The major bioactive antioxidant compound was identified as the carotenoid fucoxanthin. These results show, for the first time, that numerous Hawaiian algae exhibit significant antioxidant activity, a property that could lead to their application in one of many useful healthcare or related products as well as in chemoprevention of a variety of diseases including cancer. PMID:22412808

  12. Carotenoids in algae: distributions, biosyntheses and functions.


    Takaichi, Shinichi


    For photosynthesis, phototrophic organisms necessarily synthesize not only chlorophylls but also carotenoids. Many kinds of carotenoids are found in algae and, recently, taxonomic studies of algae have been developed. In this review, the relationship between the distribution of carotenoids and the phylogeny of oxygenic phototrophs in sea and fresh water, including cyanobacteria, red algae, brown algae and green algae, is summarized. These phototrophs contain division- or class-specific carotenoids, such as fucoxanthin, peridinin and siphonaxanthin. The distribution of α-carotene and its derivatives, such as lutein, loroxanthin and siphonaxanthin, are limited to divisions of Rhodophyta (macrophytic type), Cryptophyta, Euglenophyta, Chlorarachniophyta and Chlorophyta. In addition, carotenogenesis pathways are discussed based on the chemical structures of carotenoids and known characteristics of carotenogenesis enzymes in other organisms; genes and enzymes for carotenogenesis in algae are not yet known. Most carotenoids bind to membrane-bound pigment-protein complexes, such as reaction center, light-harvesting and cytochrome b(6)f complexes. Water-soluble peridinin-chlorophyll a-protein (PCP) and orange carotenoid protein (OCP) are also established. Some functions of carotenoids in photosynthesis are also briefly summarized.

  13. Biogas production experimental research using algae.


    Baltrėnas, Pranas; Misevičius, Antonas


    The current study is on the the use of macro-algae as feedstock for biogas production. Three types of macro-algae, Cladophora glomerata (CG), Chara fragilis (CF), and Spirogyra neglecta (SN), were chosen for this research. The experimental studies on biogas production were carried out with these algae in a batch bioreactor. In the bioreactor was maintained 35 ± 1°C temperature. The results showed that the most appropriate macro-algae for biogas production are Spirogyra neglecta (SN) and Cladophora glomerata (CG). The average amount of biogas obtained from the processing of SN - 0.23 m(3)/m(3)d, CG - 0.20 m(3)/m(3)d, and CF - 0.12 m(3)/m(3)d. Considering the concentration of methane obtained during the processing of SN and CG, which after eight days and until the end of the experiment exceeded 60%, it can be claimed that biogas produced using these algae is valuable. When processing CF, the concentration of methane reached the level of 50% only by the final day of the experiment, which indicates that this alga is less suitable for biogas production.


    PubMed Central

    Brown, R. Malcolm; Franke, Werner W.; Kleinig, Hans; Falk, Heinz; Sitte, Peter


    The cell wall of the marine chrysophycean alga Pleurochrysis scherfellii is composed of distinct wall fragments embedded in a gelatinous mass. The latter is a polysaccharide of pectic character which is rich in galactose and ribose. These wall fragments are identified as scales. They have been isolated and purified from the vegetative mother cell walls after zoospore formation. Their ultrastructure is described in an electron microscope study combining sectioning, freeze-etch, and negative staining techniques. The scales consist of a layer of concentrically arranged microfibrils (ribbons with cross-sections of 12 to 25 x 25 to 40 A) and underlying radial fibrils of similar dimensions. Such a network-plate is densely coated with particles which are assumed to be identical to the pectic component. The microfibrils are resistant to strong alkaline treatment and have been identified as cellulose by different methods, including sugar analysis after total hydrolysis, proton resonance spectroscopical examination (NMR spectroscopy) of the benzoylated product, and diverse histochemical tests. The formation and secretion of the scales can be followed along the maturing Golgi cisternae starting from a pronounced dilated "polymerization center" as a completely intracisternal process which ends in the exocytotic extrusion of the scales. The scales reveal the very same ultrastructure within the Golgi cisternae as they do in the cell wall. The present finding represents the first evidence on cellulose formation by the Golgi apparatus and is discussed in relation to a basic scheme for cellulose synthesis in plant cells in general. PMID:5513606

  15. Linking sewage pollution and water quality to spatial patterns of Porites lobata growth anomalies in Puako, Hawaii.


    Yoshioka, Reyn M; Kim, Catherine J S; Tracy, Allison M; Most, Rebecca; Harvell, C Drew


    Sewage pollution threatens the health of coastal populations and ecosystems, including coral reefs. We investigated spatial patterns of sewage pollution in Puako, Hawaii using enterococci concentrations and δ(15)N Ulva fasciata macroalgal bioassays to assess relationships with the coral disease Porites lobata growth anomalies (PGAs). PGA severity and enterococci concentrations were high, spatially variable, and positively related. Bioassay algal δ(15)N showed low sewage pollution at the reef edge while high values of resident algae indicated sewage pollution nearshore. Neither δ(15)N metric predicted PGA measures, though bioassay δ(15)N was negatively related to coral cover. Furthermore, PGA prevalence was much higher than previously recorded in Hawaii and the greater Indo-Pacific, highlighting Puako as an area of concern. Although further work is needed to resolve the relationship between sewage pollution and coral cover and disease, these results implicate sewage pollution as a contributor to diminished reef health.

  16. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats

    PubMed Central

    Holzinger, Andreas; Allen, Michael C.; Deheyn, Dimitri D.


    Snow algae and green algae living in aeroterrestrial habitats are ideal obbjects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charopyhte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorbance spectra of these microalgae in the waveband of 400-900 nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance in the wave band of 400-550 nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did not change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400 – 500 nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation. PMID:27442511

  17. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats.


    Holzinger, Andreas; Allen, Michael C; Deheyn, Dimitri D


    Snow algae and green algae living in aeroterrestrial habitats are ideal objects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charophyte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorption spectra of these microalgae in the waveband of 400-900nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance between 400-550nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this high absorbance was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did hardly change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400-500nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation. PMID:27442511

  18. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats.


    Holzinger, Andreas; Allen, Michael C; Deheyn, Dimitri D


    Snow algae and green algae living in aeroterrestrial habitats are ideal objects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charophyte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorption spectra of these microalgae in the waveband of 400-900nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance between 400-550nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this high absorbance was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did hardly change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400-500nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation.

  19. PPR proteins of green algae.


    Tourasse, Nicolas J; Choquet, Yves; Vallon, Olivier


    Using the repeat finding algorithm FT-Rep, we have identified 154 pentatricopeptide repeat (PPR) proteins in nine fully sequenced genomes from green algae (with a total of 1201 repeats) and grouped them in 47 orthologous groups. All data are available in a database, PPRdb, accessible online at Based on phylogenetic trees generated from the repeats, we propose evolutionary scenarios for PPR proteins. Two PPRs are clearly conserved in the entire green lineage: MRL1 is a stabilization factor for the rbcL mRNA, while HCF152 binds in plants to the psbH-petB intergenic region. MCA1 (the stabilization factor for petA) and PPR7 (a short PPR also acting on chloroplast mRNAs) are conserved across the entire Chlorophyta. The other PPRs are clade-specific, with evidence for gene losses, duplications, and horizontal transfer. In some PPR proteins, an additional domain found at the C terminus provides clues as to possible functions. PPR19 and PPR26 possess a methyltransferase_4 domain suggesting involvement in RNA guanosine methylation. PPR18 contains a C-terminal CBS domain, similar to the CBSPPR1 protein found in nucleoids. PPR16, PPR29, PPR37, and PPR38 harbor a SmR (MutS-related) domain similar to that found in land plants pTAC2, GUN1, and SVR7. The PPR-cyclins PPR3, PPR4, and PPR6, in addition, contain a cyclin domain C-terminal to their SmR domain. PPR31 is an unusual PPR-cyclin containing at its N terminus an OctotricoPeptide Repeat (OPR) and a RAP domain. We consider the possibility that PPR proteins with a SmR domain can introduce single-stranded nicks in the plastid chromosome.

  20. PPR proteins of green algae

    PubMed Central

    Tourasse, Nicolas J; Choquet, Yves; Vallon, Olivier


    Using the repeat finding algorithm FT-Rep, we have identified 154 pentatricopeptide repeat (PPR) proteins in nine fully sequenced genomes from green algae (with a total of 1201 repeats) and grouped them in 47 orthologous groups. All data are available in a database, PPRdb, accessible online at Based on phylogenetic trees generated from the repeats, we propose evolutionary scenarios for PPR proteins. Two PPRs are clearly conserved in the entire green lineage: MRL1 is a stabilization factor for the rbcL mRNA, while HCF152 binds in plants to the psbH-petB intergenic region. MCA1 (the stabilization factor for petA) and PPR7 (a short PPR also acting on chloroplast mRNAs) are conserved across the entire Chlorophyta. The other PPRs are clade-specific, with evidence for gene losses, duplications, and horizontal transfer. In some PPR proteins, an additional domain found at the C terminus provides clues as to possible functions. PPR19 and PPR26 possess a methyltransferase_4 domain suggesting involvement in RNA guanosine methylation. PPR18 contains a C-terminal CBS domain, similar to the CBSPPR1 protein found in nucleoids. PPR16, PPR29, PPR37, and PPR38 harbor a SmR (MutS-related) domain similar to that found in land plants pTAC2, GUN1, and SVR7. The PPR-cyclins PPR3, PPR4, and PPR6, in addition, contain a cyclin domain C-terminal to their SmR domain. PPR31 is an unusual PPR-cyclin containing at its N terminus an OctotricoPeptide Repeat (OPR) and a RAP domain. We consider the possibility that PPR proteins with a SmR domain can introduce single-stranded nicks in the plastid chromosome. PMID:24021981

  1. A method for genotype validation and primer assessment in heterozygote-deficient species, as demonstrated in the prosobranch mollusc Hydrobia ulvae

    PubMed Central

    Brownlow, Robert J; Dawson, Deborah A; Horsburgh, Gavin J; Bell, James J; Fish, John D


    Background In studies where microsatellite markers are employed, it is essential that the primers designed will reliably and consistently amplify target loci. In populations conforming to Hardy-Weinberg equilibrium (HWE), screening for unreliable markers often relies on the identification of heterozygote deficiencies and subsequent departures from HWE. However, since many populations naturally deviate from HWE, such as many marine invertebrates, it can be difficult to distinguish heterozygote deficiencies resulting from unreliable markers from natural processes. Thus, studies of populations that are suspected to deviate from HWE naturally would benefit from a method to validate genotype data-sets and test the reliability of the designed primers. Levels of heterozygosity are reported for the prosobranch mollusc Hydrobia ulvae (Pennant) together with a method of genotype validation and primer assessment that utilises two primer sets for each locus. Microsatellite loci presented are the first described for the species Hydrobia ulvae; the five loci presented will be of value in further study of populations of H. ulvae. Results We have developed a novel method of testing primer reliability in naturally heterozygote deficient populations. After the design of an initial primer set, genotyping in 48 Hydrobia ulvae specimens using a single primer set (Primer set_A) revealed heterozygote deficiency in six of the seven loci examined. Redesign of six of the primer pairs (Primer set_B), re-genotyping of the successful individuals from Primer set_A using Primer set_B, and comparison of genotypes between the two primer sets, enabled the identification of two loci (Hulv-06 & Hulv-07) that showed a high degree of discrepancy between primer sets A and B (0% & only 25% alleles matching, respectively), suggesting unreliability in these primers. The discrepancies included changes from heterozygotes to homozygotes or vice versa, and some individuals who also displayed new alleles of

  2. [Algae removal of high algae raw water by coagulation enhanced by ozonation].


    Liu, Hai-Long; Yang, Dong; Zhao, Zhi-Yong; Li, Zheng-Jian; Cheng, Fang-Qin


    Apparent molecular weight distribution (AMWD) and resin fractionation were used to characterize organic matters of the raw water. Removal of algae, change and removal of dissolved organic carbon (DOC), disinfection by products (DBPs) control during the preozonation enhanced coagulation treatments in the jar-scale and pilot-scale experiment were studied. Algae activity (AA) was measured and used to elucidate the mechanisms of algae removal by above treatments. Results show that algae removal can be improved distinctively by proper preozonation, as the ozone dose 1.0 mg x L(-1), for instance. Algae removal could be increased from 55%-85% by traditional coagulation to 95% by enhanced coagulation after preozonation; and the best removal achieved 99.3% with ozone 1.0 mg x L(-1) and PACl 3.0 mg x L(-1); the residual THMFP (Trihalomethanes formation potential) was lowered from 117 microg x L(-1) by traditional coagulation to 46 microg x L(-1). But higher dose of ozone (as > or = 2.0 mg x L(-1)) impairs organic matter removal, although it decreases algae activity further. Significant differences were found in algae removal by AA detection between ozonation and traditional coagulation. Traditional coagulation had little effect on AA no matter the different PAC1 doses; while AA decreased clearly after ozonation. AA was lowered below 12 under 0.5-2.0 mg x L(-1) ozonation; and it kept decreasing with increase of ozone dosage. During the following coagulation, coagulant or some of its hydrolysised components enhanced the AA decrease by ozonation. Compared to the method of normal microscopy counting, AA test expresses the influence of algae living state by water treatment processes more clearly; which would provide treatment process designer with more distinct information about algae removal mechanisms and how to arrange the treatment processes to improve algae removal.

  3. Nitrate and phosphate regimes induced lipidomic and biochemical changes in the intertidal macroalga Ulva lactuca (Ulvophyceae, Chlorophyta).


    Kumari, Puja; Kumar, Manoj; Reddy, C R K; Jha, Bhavanath


    This study was carried out in order to understand the lipid and biochemical alterations resulting from different nutritional regimes of nitrate and phosphate in Ulva lactuca. The algal thalli cultured in artificial seawater (ASW) showed higher levels of carbohydrates and non-polar lipids and increased phosphatase activities, accompanied by degradation of polar lipids, proteins and pigments. Further, higher levels of lipid hydroperoxides indicated reative oxygen species (ROS)-mediated non-enzymatic lipid peroxidation due to nutritional limitation-induced oxidative stress. Those thalli cultured in ASW supplemented with nitrate showed responses corresponding to nitrate addition, such as an increase in pigments, monogalactosyldiacylglycerols, polyunsaturated fatty acids and nitrate reductase. In addition, these thalli showed partial induction of phosphatases, low phospholipids, and high sulfolipid and 1,2-diacylglyceryl-3-O-4'-(N,N,N-trimethyl)-homoserine (DGTS) due to phosphate limitation. Similarly, algal thalli cultured in ASW supplemented with phosphate showed down-regulation of phosphatases, an increase in phospholipids due to availability of phosphate as well as a decrease in nitrate reductase, pigment, monogalactosyldiacylglycerols and polyunsaturated fatty acids due to nitrate limitation. On the other hand, algal thalli cultured in ASW supplemented with both nitrate and phosphate showed recovery of lost pigments and proteins, a high monogalactosyldiacylglycerol/digalactosyldiacylglycerol ratio, high unsaturation and high oxylipin levels (both C18 and C20). Further, the accumulation of indole-3-acetic acid in nutrient-limited thalli and of kinetin and kinetin riboside in nutrient-supplemented thalli indicated their antagonistic roles under nutrient stress. Thus, U. lactuca copes with nitrate and phosphate nutritional stress by altering the metabolic pathways involved in lipid biosynthesis including a shift in lipid classes, fatty acids, oxylipins and indole-3

  4. Development and Characterization of Somatic Hybrids of Ulva reticulata Forsskål (×) Monostroma oxyspermum (Kutz.)Doty

    PubMed Central

    Gupta, Vishal; Kumari, Puja; Reddy, CRK


    Ulvophycean species with diverse trait characteristics provide an opportunity to create novel allelic recombinant variants. The present study reports the development of seaweed variants with improved agronomic traits through protoplast fusion between Monostroma oxyspermum (Kutz.) Doty and Ulva reticulata Forsskål. A total of 12 putative hybrids were screened based on the variations in morphology and total DNA content over the fusion partners. DNA-fingerprinting by inter simple sequence repeat (ISSR) and amplified fragment length polymorphism (AFLP) analysis confirmed genomic introgression in the hybrids. The DNA fingerprint revealed sharing of parental alleles in regenerated hybrids and a few alleles that were unique to hybrids. The epigenetic variations in hybrids estimated in terms of DNA methylation polymorphism also revealed sharing of methylation loci with both the fusion partners. The functional trait analysis for growth showed a hybrid with heterotic trait (DGR% = 36.7 ± 1.55%) over the fusion partners U. reticulata (33.2 ± 2.6%) and M. oxyspermum (17.8 ± 1.77%), while others were superior to the mid-parental value (25.2 ± 2.2%) (p < 0.05). The fatty acid (FA) analysis of hybrids showed notable variations over fusion partners. Most hybrids showed increased polyunsaturated FAs (PUFAs) compared to saturated FAs (SFAs) and mainly includes the nutritionally important linoleic acid, α-linolenic acid, oleic acid, stearidonic acid, and docosahexaenoic acid. The other differences observed include superior cellulose content and antioxidative potential in hybrids over fusion partners. The hybrid varieties with superior traits developed in this study unequivocally demonstrate the significance of protoplast fusion technique in developing improved varients of macroalgae. PMID:25688248

  5. A Strategy for the Proliferation of Ulva prolifera, Main Causative Species of Green Tides, with Formation of Sporangia by Fragmentation

    PubMed Central

    Gao, Shan; Chen, Xiaoyuan; Yi, Qianqian; Wang, Guangce; Pan, Guanghua; Lin, Apeng; Peng, Guang


    Ulva prolifera, a common green seaweed, is one of the causative species of green tides that occurred frequently along the shores of Qingdao in 2008 and had detrimental effects on the preparations for the 2008 Beijing Olympic Games sailing competition, since more than 30 percent of the area of the games was invaded. In view of the rapid accumulation of the vast biomass of floating U. prolifera in green tides, we investigated the formation of sporangia in disks of different diameters excised from U. prolifera, changes of the photosynthetic properties of cells during sporangia formation, and development of spores. The results suggested that disks less than 1.00 mm in diameter were optimal for the formation of sporangia, but there was a small amount of spore release in these. The highest percentage of area of spore release occurred in disks that were 2.50 mm in diameter. In contrast, sporangia were formed only at the cut edges of larger disks (3.00 mm, 3.50 mm, and 4.00 mm in diameter). Additionally, the majority of spores liberated from the disks appeared vigorous and developed successfully into new individuals. These results implied that fragments of the appropriate size from the U. prolifera thalli broken by a variety of factors via producing spores gave rise to the rapid proliferation of the seaweed under field conditions, which may be one of the most important factors to the rapid accumulation of the vast biomass of U. prolifera in the green tide that occurred in Qingdao, 2008. PMID:20052408

  6. Biological toxicity of lanthanide elements on algae.


    Tai, Peidong; Zhao, Qing; Su, Dan; Li, Peijun; Stagnitti, Frank


    The biological toxicity of lanthanides on marine monocellular algae was investigated. The specific objective of this research was to establish the relationship between the abundance in the seawater of lanthanides and their biological toxicities on marine monocellular algae. The results showed that all single lanthanides had similar toxic effects on Skeletonema costatum. High concentrations of lanthanides (29.04+/-0.61 micromol L(-1)) resulted in 50% reduction in growth of algae compared to the controls (0 micromol L(-1)) after 96 h (96 h-EC50). The biological toxicity of 13 lanthanides on marine monocellular algae was unrelated with the abundance of different lanthanide elements in nature, and the "Harkins rule" was not appropriate for the lanthanides. A mixed solution that contained equivalent concentrations of each lanthanide element had the same inhibition effect on algae cells as each individual lanthanide element at the same total concentration. This phenomenon is unique compared to the groups of other elements in the periodic table. Hence, we speculate that the monocellular organisms might not be able to sufficiently differentiate between the almost chemically identical lanthanide elements.

  7. Studies on marine algae for haemagglutinic activity.


    Alam, M T; Usmanghani, K


    Lectins (agglutinins) are important in medical and immunological applications. Phytohaemagglutinins have been found useful in blood banking. Keeping in view of these facts, the marine algae found at Karachi coastal region have been screened for agglutinic activity by using human erythrocytes of A, B, AB and 0 group. Altogether 53 algal samples were collected and subjected to extraction, fractionation serial dilution and titre determinations. The total marine algae screened for haemagglutinic activity were 44 out of these 14, 13 and 17 belonged to Chlorophyta, Phaeophyta, and Rhodophyta respectively. Among these three groups the Rhodophyta showed the highest number of lytic activity. The green marine alga Valoniopsis pachynema showed a titre value between 2(2) and 2(3), which is statistically significant. In case of brown marine algae Colpomenia sinuosa was found to be active (titre 2(3)), while Dictyota dichotoma, D. indica and Iyengaria stellata, furnished week titre value as 2(2). The red marine algae screened were 17, out of these 4 spp. showed significant activity (titre 2(3)), and these are Gelidium usmanghani, Gracilaria foliifera Hypnea pannosa and Hynea valentiae. While Scinaia fascicularis, Scinaia indica and Champia parvula were found to be weak in their onset on human erythrocytes. The results obtained were quite in agreement with those reported in the literature. PMID:16414751

  8. Biological toxicity of lanthanide elements on algae.


    Tai, Peidong; Zhao, Qing; Su, Dan; Li, Peijun; Stagnitti, Frank


    The biological toxicity of lanthanides on marine monocellular algae was investigated. The specific objective of this research was to establish the relationship between the abundance in the seawater of lanthanides and their biological toxicities on marine monocellular algae. The results showed that all single lanthanides had similar toxic effects on Skeletonema costatum. High concentrations of lanthanides (29.04+/-0.61 micromol L(-1)) resulted in 50% reduction in growth of algae compared to the controls (0 micromol L(-1)) after 96 h (96 h-EC50). The biological toxicity of 13 lanthanides on marine monocellular algae was unrelated with the abundance of different lanthanide elements in nature, and the "Harkins rule" was not appropriate for the lanthanides. A mixed solution that contained equivalent concentrations of each lanthanide element had the same inhibition effect on algae cells as each individual lanthanide element at the same total concentration. This phenomenon is unique compared to the groups of other elements in the periodic table. Hence, we speculate that the monocellular organisms might not be able to sufficiently differentiate between the almost chemically identical lanthanide elements. PMID:20547408

  9. Controlled regular locomotion of algae cell microrobots.


    Xie, Shuangxi; Jiao, Niandong; Tung, Steve; Liu, Lianqing


    Algae cells can be considered as microrobots from the perspective of engineering. These organisms not only have a strong reproductive ability but can also sense the environment, harvest energy from the surroundings, and swim very efficiently, accommodating all these functions in a body of size on the order of dozens of micrometers. An interesting topic with respect to random swimming motions of algae cells in a liquid is how to precisely control them as microrobots such that they swim according to manually set routes. This study developed an ingenious method to steer swimming cells based on the phototaxis. The method used a varying light signal to direct the motion of the cells. The swimming trajectory, speed, and force of algae cells were analyzed in detail. Then the algae cell could be controlled to swim back and forth, and traverse a crossroad as a microrobot obeying specific traffic rules. Furthermore, their motions along arbitrarily set trajectories such as zigzag, and triangle were realized successfully under optical control. Robotize algae cells can be used to precisely transport and deliver cargo such as drug particles in microfluidic chip for biomedical treatment and pharmacodynamic analysis. The study findings are expected to bring significant breakthrough in biological drives and new biomedical applications.

  10. Estimation of alga growth stage and lipid content growth rate

    NASA Technical Reports Server (NTRS)

    Embaye, Tsegereda N. (Inventor); Trent, Jonathan D. (Inventor)


    Method and system for estimating a growth stage of an alga in an ambient fluid. Measured light beam absorption or reflection values through or from the alga and through an ambient fluid, in each of two or more wavelength sub-ranges, are compared with reference light beam absorption values for corresponding wavelength sub-ranges for in each alga growth stage to determine (1) which alga growth stage, if any, is more likely and (2) whether estimated lipid content of the alga is increasing or has peaked. Alga growth is preferably terminated when lipid content has approximately reached a maximum value.

  11. Genome of the red alga Porphyridium purpureum.


    Bhattacharya, Debashish; Price, Dana C; Chan, Cheong Xin; Qiu, Huan; Rose, Nicholas; Ball, Steven; Weber, Andreas P M; Arias, Maria Cecilia; Henrissat, Bernard; Coutinho, Pedro M; Krishnan, Anagha; Zäuner, Simone; Morath, Shannon; Hilliou, Frédérique; Egizi, Andrea; Perrineau, Marie-Mathilde; Yoon, Hwan Su


    The limited knowledge we have about red algal genomes comes from the highly specialized extremophiles, Cyanidiophyceae. Here, we describe the first genome sequence from a mesophilic, unicellular red alga, Porphyridium purpureum. The 8,355 predicted genes in P. purpureum, hundreds of which are likely to be implicated in a history of horizontal gene transfer, reside in a genome of 19.7 Mbp with 235 spliceosomal introns. Analysis of light-harvesting complex proteins reveals a nuclear-encoded phycobiliprotein in the alga. We uncover a complex set of carbohydrate-active enzymes, identify the genes required for the methylerythritol phosphate pathway of isoprenoid biosynthesis, and find evidence of sexual reproduction. Analysis of the compact, function-rich genome of P. purpureum suggests that ancestral lineages of red algae acted as mediators of horizontal gene transfer between prokaryotes and photosynthetic eukaryotes, thereby significantly enriching genomes across the tree of photosynthetic life.

  12. Algae control problems and practices workshop

    SciTech Connect

    Pryfogle, P.A.; Ghio, G.


    Western water resources are continuously facing increased demand from industry and the public. Consequently, many of these resources are required to perform multiple tasks as they cycle through the ecosystem. Many plants and animals depend upon these resources for growth. Algae are one group of plants associated with nutrient and energy cycles in many aquatic ecosystems. Although most freshwater algae are microscopic in size, they are capable of dominating and proliferating to the extent that the value of the water resource for both industrial and domestic needs is compromised. There is a great diversity of aquatic environments and systems in which algae may be found, and there are many varieties of treatment and control techniques available to reduce the impacts of excessive growth. This workshop was organized to exchange information about these control problems and practices.

  13. Genome of the red alga Porphyridium purpureum

    PubMed Central

    Bhattacharya, Debashish; Price, Dana C.; Xin Chan, Cheong; Qiu, Huan; Rose, Nicholas; Ball, Steven; Weber, Andreas P. M.; Cecilia Arias, Maria; Henrissat, Bernard; Coutinho, Pedro M.; Krishnan, Anagha; Zäuner, Simone; Morath, Shannon; Hilliou, Frédérique; Egizi, Andrea; Perrineau, Marie-Mathilde; Yoon, Hwan Su


    The limited knowledge we have about red algal genomes comes from the highly specialized extremophiles, Cyanidiophyceae. Here, we describe the first genome sequence from a mesophilic, unicellular red alga, Porphyridium purpureum. The 8,355 predicted genes in P. purpureum, hundreds of which are likely to be implicated in a history of horizontal gene transfer, reside in a genome of 19.7 Mbp with 235 spliceosomal introns. Analysis of light-harvesting complex proteins reveals a nuclear-encoded phycobiliprotein in the alga. We uncover a complex set of carbohydrate-active enzymes, identify the genes required for the methylerythritol phosphate pathway of isoprenoid biosynthesis, and find evidence of sexual reproduction. Analysis of the compact, function-rich genome of P. purpureum suggests that ancestral lineages of red algae acted as mediators of horizontal gene transfer between prokaryotes and photosynthetic eukaryotes, thereby significantly enriching genomes across the tree of photosynthetic life. PMID:23770768

  14. Turning Algae into Energy in New Mexico


    Sayre, Richard; Olivares, Jose; Lammers, Peter


    Los Alamos National Laboratory, as part of the New Mexico Consortium - comprised of New Mexico's major research universities, the Lab, and key industry partners - is conducting research into using algae as a feed stock for a renewable source of fuels, and other products. There are hundreds of thousands of different algae species on Earth. They account for approximately half of the net photosynthesis on the planet, yet they have not been used in any kind of a large scale by humanity, with just a few exceptions. And yet, the biomass is easy to transform into useful products, including fuels, and they contain many other natural products that have high value. In this video Los Alamos and New Mexico State University scientists outline the opportunities and challenges of using science to turn algae into energy.

  15. Turning Algae into Energy in New Mexico

    SciTech Connect

    Sayre, Richard; Olivares, Jose; Lammers, Peter


    Los Alamos National Laboratory, as part of the New Mexico Consortium - comprised of New Mexico's major research universities, the Lab, and key industry partners - is conducting research into using algae as a feed stock for a renewable source of fuels, and other products. There are hundreds of thousands of different algae species on Earth. They account for approximately half of the net photosynthesis on the planet, yet they have not been used in any kind of a large scale by humanity, with just a few exceptions. And yet, the biomass is easy to transform into useful products, including fuels, and they contain many other natural products that have high value. In this video Los Alamos and New Mexico State University scientists outline the opportunities and challenges of using science to turn algae into energy.

  16. Role of sediment organic matter quality and feeding history in dietary absorption and accumulation of pyrene in the mud snail (Hydrobia ulvae).


    Granberg, Maria E; Forbes, Thomas L


    Organic matter (OM) input to marine sediments varies seasonally both in quantity and quality. Because sedimentary OM (SOM) constitutes food for many benthic organisms, its properties should affect the dietary uptake of sediment-associated contaminants. We explored the effect of SOM quality/food value on short- and long-term pyrene accumulation in the mud snail (Hydrobia ulvae) and performed dual-tracer pulse-chase experiments to investigate the feeding mechanisms driving dietary pyrene uptake. The quality of the SOM was manipulated by enriching sediments either with high-quality microalgae or low-quality lignin, adding equal amounts of total organic carbon. Long- and short-term bioaccumulation increased with increasing SOM quality, as did pyrene ingestion rate (IR(pyr)), which also was affected by feeding history. By feeding selectively, snails concentrated pyrene 10-fold in ingested compared to ambient sediment, independent of SOM quality. Average pyrene absorption efficiency (AE(pyr): -65%) varied inversely with SOM quality and IR(pyr). Both AE(pyr) and gut passage time (alpha 1/IR(pyr)) agreed with theoretical models incorporating the time-dependence of absorption efficiency. Thus, SOM quality moderates dietary contaminant uptake in deposit feeders, and in H. ulvae, this occurs via OM-induced alterations of ingestion rate. Consequently, enhanced sediment-associated contaminant uptake is predicted for deposit feeders following phytoplankton blooms, principally because of OM quality-driven increases in the ingestion rate. PMID:16629138

  17. Roseimaritima ulvae gen. nov., sp. nov. and Rubripirellula obstinata gen. nov., sp. nov. two novel planctomycetes isolated from the epiphytic community of macroalgae.


    Bondoso, Joana; Albuquerque, Luciana; Nobre, M Fernanda; Lobo-da-Cunha, Alexandre; da Costa, Milton S; Lage, Olga Maria


    Four isolates, belonging to the deep-branching phylum Planctomycetes, were recovered from the biofilm of two marine macroalgae, Ulva sp. and Laminaria sp., from the Northern coast of Portugal. These strains were light pink- or red-pigmented; the cells were variable in shape and usually organized in rosettes. They had a dimorphic cell cycle with budding reproduction. The organisms were chemoheterotrophic, strictly aerobic and mesophilic. The 16S rRNA gene sequence analysis showed that the strains belong to the family Planctomycetaceae with Rhodopirellula as the closest genus. The isolates form two separate branches (strain LF1(T) forms one branch and the strains UC8(T), UF3 and UF42 form a second branch) clearly separated from Rhodopirellula baltica with 94.2% and 93.8% 16S rRNA gene sequence similarity, respectively. Based on differential characteristics that distinguish the novel genera from R. baltica, such as cell size and shape, ultrastructure, enzymatic activities, substrate utilization pattern, fatty acid composition, phospholipid profiles and phylogeny we propose that the isolates represent two novel genera of the order Planctomycetales, Roseimaritima ulvae gen. nov., sp. nov. (type strain is UC8(T)=DSM 25454(T)=LMG 27778(T)) and Rubripirellula obstinata gen. nov., sp. nov. (type strain is LF1(T)=LMG 27779(T)=CECT 8602(T)).

  18. Phylogenetic analyses of four species of Ulva and Monostroma grevillei using ITS, rbc L and 18S rDNA sequence data

    NASA Astrophysics Data System (ADS)

    Lin, Zhongheng; Shen, Songdong; Chen, Weizhou; Li, Huihui


    Chlorophyta species are common in the southern and northern coastal areas of China. In recent years, frequent green tide incidents in Chinese coastal waters have raised concerns and attracted the attention of scientists. In this paper, we sequenced the 18S rDNA genes, the internal transcribed spacer (ITS) regions and the rbc L genes in seven organisms and obtained 536-566 bp long ITS sequences, 1 377-1 407 bp long rbc L sequences and 1 718-1 761 bp long partial 18S rDNA sequences. The GC base pair content was highest in the ITS regions and lowest in the rbc L genes. The sequencing results showed that the three Ulva prolifera (or U. pertusa) gene sequences from Qingdao and Nan'ao Island were identical. The ITS, 18S rDNA and rbc L genes in U. prolifera and U. pertusa from different sea areas in China were unchanged by geographic distance. U. flexuosa had the least evolutionary distance from U. californica in both the ITS regions (0.009) and the 18S rDNA (0.002). These data verified that Ulva and Enteromorpha are not separate genera.

  19. Suitability of the marine prosobranch snail Hydrobia ulvae for sediment toxicity assessment: A case study with the anionic surfactant linear alkylbenzene sulphonate (LAS).


    Hampel, M; Moreno-Garrido, I; González-Mazo, E; Blasco, J


    Individuals of the mudsnail Hydrobia ulvae (Pennant) (Mollusca: Prosobranchia) were exposed to sediments spiked with increasing concentrations (1.59-123.13mgkg(-1) dry weight) of the anionic surfactant linear alkylbenzene sulphonate (LAS) which is employed in the formulation of laundry powders and liquids, as well as hand dishwashing products. The suitability of the selected organism, H. ulvae for routine sediment toxicity testing was evaluated by measuring acute toxicity recording survival. Sublethal toxicity was evaluated as total number of produced veliger larvae per treatment throughout the test (9d). Mortality has shown to be a reliable and reproducible indicator of acute toxicity. LC(50) values were comprised between 203.4 (48h) and 94.3mgkg(-1) (9d) dry weight. As sublethal endpoint, the total number of produced larvae showed to be a useful indicator of toxicity for this organism. The number of produced larvae increased at lower exposure concentrations, whereas at the highest LAS concentration, the number of produced larvae decreased. This is the first report of acute and sublethal toxicity of sediment associated LAS for this species.

  20. Role of sediment organic matter quality and feeding history in dietary absorption and accumulation of pyrene in the mud snail (Hydrobia ulvae).


    Granberg, Maria E; Forbes, Thomas L


    Organic matter (OM) input to marine sediments varies seasonally both in quantity and quality. Because sedimentary OM (SOM) constitutes food for many benthic organisms, its properties should affect the dietary uptake of sediment-associated contaminants. We explored the effect of SOM quality/food value on short- and long-term pyrene accumulation in the mud snail (Hydrobia ulvae) and performed dual-tracer pulse-chase experiments to investigate the feeding mechanisms driving dietary pyrene uptake. The quality of the SOM was manipulated by enriching sediments either with high-quality microalgae or low-quality lignin, adding equal amounts of total organic carbon. Long- and short-term bioaccumulation increased with increasing SOM quality, as did pyrene ingestion rate (IR(pyr)), which also was affected by feeding history. By feeding selectively, snails concentrated pyrene 10-fold in ingested compared to ambient sediment, independent of SOM quality. Average pyrene absorption efficiency (AE(pyr): -65%) varied inversely with SOM quality and IR(pyr). Both AE(pyr) and gut passage time (alpha 1/IR(pyr)) agreed with theoretical models incorporating the time-dependence of absorption efficiency. Thus, SOM quality moderates dietary contaminant uptake in deposit feeders, and in H. ulvae, this occurs via OM-induced alterations of ingestion rate. Consequently, enhanced sediment-associated contaminant uptake is predicted for deposit feeders following phytoplankton blooms, principally because of OM quality-driven increases in the ingestion rate.

  1. Roseimaritima ulvae gen. nov., sp. nov. and Rubripirellula obstinata gen. nov., sp. nov. two novel planctomycetes isolated from the epiphytic community of macroalgae.


    Bondoso, Joana; Albuquerque, Luciana; Nobre, M Fernanda; Lobo-da-Cunha, Alexandre; da Costa, Milton S; Lage, Olga Maria


    Four isolates, belonging to the deep-branching phylum Planctomycetes, were recovered from the biofilm of two marine macroalgae, Ulva sp. and Laminaria sp., from the Northern coast of Portugal. These strains were light pink- or red-pigmented; the cells were variable in shape and usually organized in rosettes. They had a dimorphic cell cycle with budding reproduction. The organisms were chemoheterotrophic, strictly aerobic and mesophilic. The 16S rRNA gene sequence analysis showed that the strains belong to the family Planctomycetaceae with Rhodopirellula as the closest genus. The isolates form two separate branches (strain LF1(T) forms one branch and the strains UC8(T), UF3 and UF42 form a second branch) clearly separated from Rhodopirellula baltica with 94.2% and 93.8% 16S rRNA gene sequence similarity, respectively. Based on differential characteristics that distinguish the novel genera from R. baltica, such as cell size and shape, ultrastructure, enzymatic activities, substrate utilization pattern, fatty acid composition, phospholipid profiles and phylogeny we propose that the isolates represent two novel genera of the order Planctomycetales, Roseimaritima ulvae gen. nov., sp. nov. (type strain is UC8(T)=DSM 25454(T)=LMG 27778(T)) and Rubripirellula obstinata gen. nov., sp. nov. (type strain is LF1(T)=LMG 27779(T)=CECT 8602(T)). PMID:25487949

  2. Microspectroscopy of the photosynthetic compartment of algae.


    Evangelista, Valtere; Frassanito, Anna Maria; Passarelli, Vincenzo; Barsanti, Laura; Gualtieri, Paolo


    We performed microspectroscopic evaluation of the pigment composition of the photosynthetic compartments of algae belonging to different taxonomic divisions and higher plants. The feasibility of microspectroscopy for discriminating among species and/or phylogenetic groups was tested on laboratory cultures. Gaussian bands decompositions and a fitting algorithm, together with fourth-derivative transformation of absorbance spectra, provided a reliable discrimination among chlorophylls a, b and c, phycobiliproteins and carotenoids. Comparative analysis of absorption spectra highlighted the evolutionary grouping of the algae into three main lineages in accordance with the most recent endosymbiotic theories.


    EPA Science Inventory

    The standard WASP7 eutrophication module includes nitrogen and phosphorus cycling, dissolved oxygen-organic matter interactions, and phytoplankton kinetics. In many shallow streams and rivers, however, the attached algae (benthic algae, or periphyton, attached to submerged substr...


    PubMed Central

    Emerson, Robert; Green, Lowell


    A manometric method for measuring photosynthesis in marine algae is described. Photosynthesis in the red alga Gigartina harveyana is shown to be similar in all important respects to photosynthesis in Chlorella and other Chlorophyceae. PMID:19872816

  5. An Overview of Algae Biofuel Production and Potential Environmental Impact

    EPA Science Inventory

    Algae are among the most potentially significant sources of sustainable biofuels in the future of renewable energy. A feedstock with virtually unlimited applicability, algae can metabolize various waste streams (e.g., municipal wastewater, carbon dioxide from industrial flue gas)...

  6. [Accumulation of polycyclic arenes in Baltic Sea algae].


    Veldre, I A; Itra, A R; Paal'me, L P; Kukk, Kh A


    The paper presents data on the level of benzo(a)pyrene (BP) and some other polycyclic arenes in alga and phanerogam specimens from different gulfs of the Baltic Sea. Algae were shown to absorb BP from sea water. The mean concentration of BP in sea water was under 0.004 microgram/1, while in algae it ranged 0.1-21.2 micrograms/kg dry weight. Algae accumulate BP to a higher degree than phanerogams. The highest concentrations of BP were found in algae Enteromorpha while the lowest ones in Furcellaria. In annual green algae, BP level was higher in autumn, i. e. at the end of vegetation period, than in spring. Brown algae Fucus vesiculosus is recommended for monitoring polycyclic arene pollution in the area from Vormsi Island to Käsmu and green algae Cladophora or Enteromorpha in the eastern part of the Finnish Gulf.

  7. [Accumulation of polycyclic arenes in Baltic Sea algae].


    Veldre, I A; Itra, A R; Paal'me, L P; Kukk, Kh A


    The paper presents data on the level of benzo(a)pyrene (BP) and some other polycyclic arenes in alga and phanerogam specimens from different gulfs of the Baltic Sea. Algae were shown to absorb BP from sea water. The mean concentration of BP in sea water was under 0.004 microgram/1, while in algae it ranged 0.1-21.2 micrograms/kg dry weight. Algae accumulate BP to a higher degree than phanerogams. The highest concentrations of BP were found in algae Enteromorpha while the lowest ones in Furcellaria. In annual green algae, BP level was higher in autumn, i. e. at the end of vegetation period, than in spring. Brown algae Fucus vesiculosus is recommended for monitoring polycyclic arene pollution in the area from Vormsi Island to Käsmu and green algae Cladophora or Enteromorpha in the eastern part of the Finnish Gulf. PMID:4060672

  8. Use of Brown Algae to Demonstrate Natural Products Techniques.

    ERIC Educational Resources Information Center

    Porter, Lee A.


    Background information is provided on the natural products found in marine organisms in general and the brown algae in particular. Also provided are the procedures needed to isolate D-mannitol (a primary metabolite) and cholesterol from brown algae. (JN)

  9. Neonatal sepsis caused by Shewanella algae: A case report.


    Charles, Marie Victor Pravin; Srirangaraj, Sreenivasan; Kali, Arunava


    Sepsis remains a leading cause of mortality among neonates, especially in developing countries. Most cases of neonatal sepsis are attributed to Escherichia coli and other members of the Enterobacteriaceae family. Shewanella algae (S. algae) is a gram-negative saprophytic bacillus, commonly associated with the marine environment, which has been isolated from humans. Early onset neonatal sepsis caused by S. algae is uncommon. We report a case of S. algae blood stream infection in a newborn with early onset neonatal sepsis.

  10. 21 CFR 73.185 - Haematococcus algae meal.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Haematococcus algae meal. 73.185 Section 73.185... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.185 Haematococcus algae meal. (a) Identity. (1) The color additive haematococcus algae meal consists of the comminuted and dried cells of the...

  11. 21 CFR 73.185 - Haematococcus algae meal.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 1 2011-04-01 2011-04-01 false Haematococcus algae meal. 73.185 Section 73.185... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.185 Haematococcus algae meal. (a) Identity. (1) The color additive haematococcus algae meal consists of the comminuted and dried cells of the...

  12. 21 CFR 73.185 - Haematococcus algae meal.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 1 2012-04-01 2012-04-01 false Haematococcus algae meal. 73.185 Section 73.185... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.185 Haematococcus algae meal. (a) Identity. (1) The color additive haematococcus algae meal consists of the comminuted and dried cells of the...

  13. 21 CFR 73.185 - Haematococcus algae meal.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 1 2013-04-01 2013-04-01 false Haematococcus algae meal. 73.185 Section 73.185... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.185 Haematococcus algae meal. (a) Identity. (1) The color additive haematococcus algae meal consists of the comminuted and dried cells of the...

  14. 21 CFR 73.185 - Haematococcus algae meal.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 1 2014-04-01 2014-04-01 false Haematococcus algae meal. 73.185 Section 73.185... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.185 Haematococcus algae meal. (a) Identity. (1) The color additive haematococcus algae meal consists of the comminuted and dried cells of the...

  15. How to Identify and Control Water Weeds and Algae.

    ERIC Educational Resources Information Center

    Applied Biochemists, Inc., Mequon, WI.

    Included in this guide to water management are general descriptions of algae, toxic algae, weed problems in lakes, ponds, and canals, and general discussions of mechanical, biological and chemical control methods. In addition, pictures, descriptions, and recommended control methods are given for algae, 6 types of floating weeds, 18 types of…

  16. Research and development for algae-based technologies in Korea: a review of algae biofuel production.


    Hong, Ji Won; Jo, Seung-Woo; Yoon, Ho-Sung


    This review covers recent research and development (R&D) activities in the field of algae-based biofuels in Korea. As South Korea's energy policy paradigm has focused on the development of green energies, the government has funded several algae biofuel R&D consortia and pilot projects. Three major programs have been launched since 2009, and significant efforts are now being made to ensure a sustainable supply of algae-based biofuels. If these R&D projects are executed as planned for the next 10 years, they will enable us to overcome many technical barriers in algae biofuel technologies and help Korea to become one of the leading countries in green energy by 2020.

  17. Spirulina: The Alga That Can End Malnutrition.

    ERIC Educational Resources Information Center

    Fox, Ripley D.


    One approach to eliminating malnutrition worldwide is to grow spirulina in recycled village wastes. Spirulina is a blue-green alga and a natural concentrated food. Spirulina can give poor villages a nutritional food supplement they can grow themselves and can reduce infectious disease at the same time. (Author/RM)

  18. Fucoidans — sulfated polysaccharides of brown algae

    NASA Astrophysics Data System (ADS)

    Usov, Anatolii I.; Bilan, M. I.


    The methods of isolation of fucoidans and determination of their chemical structures are reviewed. The fucoidans represent sulfated polysaccharides of brown algae, the composition of which varies from simple fucan sulfates to complex heteropolysaccharides. The currently known structures of such biopolymers are presented. A variety of the biological activities of fucoidans is briefly summarised.

  19. Pheromone signaling during sexual reproduction in algae.


    Frenkel, Johannes; Vyverman, Wim; Pohnert, Georg


    Algae are found in all aquatic and many terrestrial habitats. They are dominant in phytoplankton and biofilms thereby contributing massively to global primary production. Since algae comprise photosynthetic representatives of the various protoctist groups their physiology and appearance is highly diverse. This diversity is also mirrored in their characteristic life cycles that exhibit various facets of ploidy and duration of the asexual phase as well as gamete morphology. Nevertheless, sexual reproduction in unicellular and colonial algae usually has as common motive that two specialized, sexually compatible haploid gametes establish physical contact and fuse. To guarantee mating success, processes during sexual reproduction are highly synchronized and regulated. This review focuses on sex pheromones of algae that play a key role in these processes. Especially, the diversity of sexual strategies as well as of the compounds involved are the focus of this contribution. Discoveries connected to algal pheromone chemistry shed light on the role of key evolutionary processes, including endosymbiotic events and lateral gene transfer, speciation and adaptation at all phylogenetic levels. But progress in this field might also in the future provide valid tools for the manipulation of aquaculture and environmental processes.

  20. Laser-fluorescence measurement of marine algae

    NASA Technical Reports Server (NTRS)

    Browell, E. V.


    Progress in remote sensing of algae by laser-induced fluorescence is subject of comprehensive report. Existing single-wavelength and four-wavelength systems are reviewed, and new expression for power received by airborne sensor is derived. Result differs by as much as factor of 10 from those previously reported. Detailed error analysis evluates factors affecting accuracy of laser-fluorosensor systems.

  1. Peroxisomal targeting signals in green algae.


    Shinozaki, Akiko; Sato, Nagisa; Hayashi, Yasuko


    Peroxisomal enzymatic proteins contain targeting signals (PTS) to enable their import into peroxisomes. These targeting signals have been identified as PTS1 and PTS2 in mammalian, yeast, and higher plant cells; however, no PTS2-like amino acid sequences have been observed in enzymes from the genome database of Cyanidiochyzon merolae (Bangiophyceae), a primitive red algae. In studies on the evolution of PTS, it is important to know when their sequences came to be the peroxisomal targeting signals for all living organisms. To this end, we identified a number of genes in the genome database of the green algae Chlamydomonas reinhardtii, which contains amino acid sequences similar to those found in plant PTS. In order to determine whether these sequences function as PTS in green algae, we expressed modified green fluorescent proteins (GFP) fused to these putative PTS peptides under the cauliflower mosaic virus 35S promoter. To confirm whether granular structures containing GFP-PTS fusion proteins accumulated in the peroxisomes of Closterium ehrenbergii, we observed these cells after the peroxisomes were stained with 3, 3'-diaminobenzidine. Our results confirm that the GFP-PTS fusion proteins indeed accumulated in the peroxisomes of these green algae. These findings suggest that the peroxisomal transport system for PTS1 and PTS2 is conserved in green algal cells and that our fusion proteins can be used to visualize peroxisomes in live cells.

  2. XET Activity is Found Near Sites of Growth and Cell Elongation in Bryophytes and Some Green Algae: New Insights into the Evolution of Primary Cell Wall Elongation

    PubMed Central

    Van Sandt, Vicky S. T.; Stieperaere, Herman; Guisez, Yves; Verbelen, Jean-Pierre; Vissenberg, Kris


    Background and Aims In angiosperms xyloglucan endotransglucosylase (XET)/hydrolase (XTH) is involved in reorganization of the cell wall during growth and development. The location of oligo-xyloglucan transglucosylation activity and the presence of XTH expressed sequence tags (ESTs) in the earliest diverging extant plants, i.e. in bryophytes and algae, down to the Phaeophyta was examined. The results provide information on the presence of an XET growth mechanism in bryophytes and algae and contribute to the understanding of the evolution of cell wall elongation in general. Methods Representatives of the different plant lineages were pressed onto an XET test paper and assayed. XET or XET-related activity was visualized as the incorporation of fluorescent signal. The Physcomitrella genome database was screened for the presence of XTHs. In addition, using the 3′ RACE technique searches were made for the presence of possible XTH ESTs in the Charophyta. Key Results XET activity was found in the three major divisions of bryophytes at sites corresponding to growing regions. In the Physcomitrella genome two putative XTH-encoding cDNA sequences were identified that contain all domains crucial for XET activity. Furthermore, XET activity was located at the sites of growth in Chara (Charophyta) and Ulva (Chlorophyta) and a putative XTH ancestral enzyme in Chara was identified. No XET activity was identified in the Rhodophyta or Phaeophyta. Conclusions XET activity was shown to be present in all major groups of green plants. These data suggest that an XET-related growth mechanism originated before the evolutionary divergence of the Chlorobionta and open new insights in the evolution of the mechanisms of primary cell wall expansion. PMID:17098750

  3. Widespread occurrence of norspermidine and norspermine in eukaryotic algae.


    Hamana, K; Matsuzaki, S


    Seven phyla of eukaryotic algae were analyzed to determine their contents of diamines and polyamines. The algae examined included Rhodophyta, Pyrrophyta, Chrysophyta, Phaeophyta, Euglenophyta, Chlorophyta, and Charophyta. Both putrescine and spermidine were detected in all the algae studied, while appreciable amounts of spermine were detected only in a few species of algae. 1,3-Diaminopropane, norspermidine, and norspermine, which are chemical analogs of putrescine, spermidine, and spermine, respectively, were widely distributed in various species of algae. There was no parallelism between the distribution patterns of putrescine derivatives and those of 1,3-diaminopropane derivatives. Cadaverine and agmatine were detected in multicellular marine algae. Homospermidine was detected sporadically in some algae. The biological and phylogenetical significance of polyamines in these lower eukaryotes is discussed.

  4. Sulfated polysaccharides as bioactive agents from marine algae.


    Ngo, Dai-Hung; Kim, Se-Kwon


    Recently, much attention has been paid by consumers toward natural bioactive compounds as functional ingredients in nutraceuticals. Marine algae are considered as valuable sources of structurally diverse bioactive compounds. Marine algae are rich in sulfated polysaccharides (SPs) such as carrageenans in red algae, fucoidans in brown algae and ulvans in green algae. These SPs exhibit many health beneficial nutraceutical effects such as antioxidant, anti-allergic, anti-human immunodeficiency virus, anticancer and anticoagulant activities. Therefore, marine algae derived SPs have great potential to be further developed as medicinal food products or nutraceuticals in the food industry. This contribution presents an overview of nutraceutical effects and potential health benefits of SPs derived from marine algae.

  5. Comparative studies on utilizing nitrogen capacity between two macroalgae Gracilaria tenuistipitata var. liui (rhodophyta) and Ulva pertusa (chlorophyta). II. Feedback controls of intracellular nitrogen pools on nitrogen uptake.


    Liu, J W; Dong, S L


    The potential feedback by intracellular nitrogen pools on maximum N uptake (NH4+) rate were determined for Gracilaria tenuistipitata var. liui and Ulva pertusa. The results of correlation matrix analyzing showed that the surge uptake of ammonium seemed related to rapid changes in small intracellular pools of inorganic nitrogen or small peptide and amino acids rather than to changes in TN content of the macroalgae. The assimilation rates of nitrogen of U. pertusa and G. tenuistipitata increased slowly during N starvation and were mainly regulated by amino acids and some incorporation of amino acids into macromolecules. From ecological point of view, the fast-growing and uptaking nutrient U. pertusa is more suitable to improve water quality in integrated shrimp culture ponds in which external nutrient supplies are usually high and constant during the culture period, while G. tenuistipitata var. liui is more suitable to be polycultured in a waters with intermittence supply of nutrients.

  6. Photooxidative Death in Blue-Green Algae

    PubMed Central

    Abeliovich, A.; Shilo, M.


    When incubated in the light under 100% oxygen, wild-type blue-green algae (Anacystis nidulans, Synechococcus cedrorum) die out rapidly at temperatures of 4 to 15 C, and at 35 C (or at 26 C in the case of S. cedrorum) in the absence of CO2. Photosynthesis is impaired in these cells long before they die. Blocking of photosystem II at high temperatures in the presence of CO2 sensitizes the algae to photooxidative death. Photooxidative death and bleaching of photosynthetic pigments are separable phenomena. Photooxidative conditions were demonstrated in Israeli fish ponds using A. nidulans as the test organism during dense summer blooms, when dissolved CO2 is low, and in winter, when water temperatures generally drop below 15 C. This finding suggests that photooxidative death may be responsible for the sudden decomposition of blue-green blooms in summer, and may be a factor in the absence of blue-green blooms in winter. PMID:4626540

  7. Phycobilisomes in Blue-Green Algae

    PubMed Central

    Wildman, Ruth B.; Bowen, C. C.


    Fifteen species of freshwater blue-green algae, including unicellular, filamentous, and colonial forms, were subjected to a variety of fixatives, fixation conditions, and stains for comparison of the preservation of phycobilisomes. Absorption spectra of the corresponding in vivo and released photosynthetic pigments, in 10 of the species that were maintained in culture, demonstrated the presence of phycocyanin in all 10 species and phycoerythrin in only 2 of them. Spectroscope and electron microscope evidence was obtained for localization of phycobiliproteins in phycobilisomes of Nostoc muscorum. Phycobilisomes were observed in all species examined in situ, strenghening the hypothesis that phycobilisomes are common to all phycobiliprotein-containing photosynthetic blue-green algae. Images PMID:4204443

  8. Toxicity of chlorinated benzenes to marine algae

    NASA Astrophysics Data System (ADS)

    Ma, Yan-Jun; Wang, Xiu-Lin; Yu, Wei-Jun; Zhang, Li-Jun; Sun, Han-Zhang


    Growth of Chlorella marine, Nannochloropsis oculata, Pyramidomonas sp., Platymonas subcordiformis and Phaeodactylum tricornutum exposed to monochlorobenzene (MCB), 1,2-dichlorobenzene (1,2-DCB), 1, 2, 3, 4-tetrachlorobenzene (1, 2, 3, 4-TeCB) and pentachlorobenzene (PeCB) was tested. Tests of 72 h- EC 50 values showed that the toxicity ranged in the order: MCB<1,2-DCB<1,2,3,4-TeCBalgae was almost in the order: Pyramidomonas sp. < Platymonas subcordiformis < Nannochloropsis oculata < Chlorella marine < Phaeodactylum tricomutum. Study of the QSAR (Quantitative Structure-Activity Relationship) between K OW and toxicity of CBs to marine algae showed good relationships between -log EC 50 and log K OW.

  9. Bioconcentration of tetrachlorobenzene in marine algae

    NASA Astrophysics Data System (ADS)

    Wang, Xiu-Lin; Ma, Yan-Jun; Cheng, Gang; Yu, Wei-Jun; Zhang, Li-Jun


    Bioconcentration of tetrachlorobenzene (TeCB) in Chlorella marine, Nannochloropsis oculata, Pyramidomonas sp., Platymonas subcordiformis, and Phaeodactylum tricornutum; and toxicity of TeCB to the marine algae were tested. Values of bioconcentration potential parameters, including uptake rate constant k 1, elimination rate constant k 2 and bioconcentration factor BCF, were obtained not only from the time course of TeCB uptake by the marine algae by using a bioconcentration model, but also from the acute toxicity test data for percent inhibition PI(%)˜exposure concentration of TeCB-time by using a combined bioconcentration and probability model. The results showed good relationship between k 1(TOXIC) and k 1(UPTAKE) and k 2(TOXIC), k 2(UPTAKE), and BCF D(IOXIC) and BCF D(UPTAKE). Especially, the values of BCF D(TOXIC) were well consistent with those of BCF D(UPTAKE).

  10. Biofuels from algae: challenges and potential

    PubMed Central

    Hannon, Michael; Gimpel, Javier; Tran, Miller; Rasala, Beth; Mayfield, Stephen


    Algae biofuels may provide a viable alternative to fossil fuels; however, this technology must overcome a number of hurdles before it can compete in the fuel market and be broadly deployed. These challenges include strain identification and improvement, both in terms of oil productivity and crop protection, nutrient and resource allocation and use, and the production of co-products to improve the economics of the entire system. Although there is much excitement about the potential of algae biofuels, much work is still required in the field. In this article, we attempt to elucidate the major challenges to economic algal biofuels at scale, and improve the focus of the scientific community to address these challenges and move algal biofuels from promise to reality. PMID:21833344

  11. Nitrogenous wastewater treatment by activated algae

    SciTech Connect

    Gupta, S.K.


    A biological treatability study by activated algae process was performed with synthetic wastewater containing a high concentration of nitrogen. It was found that the wastewater could be processed at all nitrogen removal rates. The yield coefficient and decay coefficient for heterotrophic bacteria were 0.06 (COD basis) and 0.019 day/sup -1/ (COD bases) respectively. The yield coefficient and decay coefficient for nitrifiers were 0.06 and 0.02 day/sup -1/ respectively. NH/sup +//sub 4/-N seemed to inhibit bacteriological growth as the yield coefficients values were significantly lower. Nitrification was observed at all the nitrogen loadings. Diffusion of NH/sub 3/ into the atmosphere was the dominant mechanism of nitrogen removal. The results demonstrated a symbiotic relationship between algae and bacteria.

  12. Fermentation metabolism and its evolution in algae

    PubMed Central

    Catalanotti, Claudia; Yang, Wenqiang; Posewitz, Matthew C.; Grossman, Arthur R.


    Fermentation or anoxic metabolism allows unicellular organisms to colonize environments that become anoxic. Free-living unicellular algae capable of a photoautotrophic lifestyle can also use a range of metabolic circuitry associated with different branches of fermentation metabolism. While algae that perform mixed-acid fermentation are widespread, the use of anaerobic respiration is more typical of eukaryotic heterotrophs. The occurrence of a core set of fermentation pathways among the algae provides insights into the evolutionary origins of these pathways, which were likely derived from a common ancestral eukaryote. Based on genomic, transcriptomic, and biochemical studies, anaerobic energy metabolism has been examined in more detail in Chlamydomonas reinhardtii (Chlamydomonas) than in any other photosynthetic protist. This green alga is metabolically flexible and can sustain energy generation and maintain cellular redox balance under a variety of different environmental conditions. Fermentation metabolism in Chlamydomonas appears to be highly controlled, and the flexible use of the different branches of fermentation metabolism has been demonstrated in studies of various metabolic mutants. Additionally, when Chlamydomonas ferments polysaccharides, it has the ability to eliminate part of the reductant (to sustain glycolysis) through the production of H2, a molecule that can be developed as a source of renewable energy. To date, little is known about the specific role(s) of the different branches of fermentation metabolism, how photosynthetic eukaryotes sense changes in environmental O2 levels, and the mechanisms involved in controlling these responses, at both the transcriptional and post-transcriptional levels. In this review, we focus on fermentation metabolism in Chlamydomonas and other protists, with only a brief discussion of plant fermentation when relevant, since it is thoroughly discussed in other articles in this volume. PMID:23734158

  13. Selenium Uptake and Volatilization by Marine Algae

    NASA Astrophysics Data System (ADS)

    Luxem, Katja E.; Vriens, Bas; Wagner, Bettina; Behra, Renata; Winkel, Lenny H. E.


    Selenium (Se) is an essential trace nutrient for humans. An estimated one half to one billion people worldwide suffer from Se deficiency, which is due to low concentrations and bioavailability of Se in soils where crops are grown. It has been hypothesized that more than half of the atmospheric Se deposition to soils is derived from the marine system, where microorganisms methylate and volatilize Se. Based on model results from the late 1980s, the atmospheric flux of these biogenic volatile Se compounds is around 9 Gt/year, with two thirds coming from the marine biosphere. Algae, fungi, and bacteria are known to methylate Se. Although algal Se uptake, metabolism, and methylation influence the speciation and bioavailability of Se in the oceans, these processes have not been quantified under environmentally relevant conditions and are likely to differ among organisms. Therefore, we are investigating the uptake and methylation of the two main inorganic Se species (selenate and selenite) by three globally relevant microalgae: Phaeocystis globosa, the coccolithophorid Emiliania huxleyi, and the diatom Thalassiosira oceanica. Selenium uptake and methylation were quantified in a batch experiment, where parallel gas-tight microcosms in a climate chamber were coupled to a gas-trapping system. For E. huxleyi, selenite uptake was strongly dependent on aqueous phosphate concentrations, which agrees with prior evidence that selenite uptake by phosphate transporters is a significant Se source for marine algae. Selenate uptake was much lower than selenite uptake. The most important volatile Se compounds produced were dimethyl selenide, dimethyl diselenide, and dimethyl selenyl sulfide. Production rates of volatile Se species were larger with increasing intracellular Se concentration and in the decline phase of the alga. Similar experiments are being carried out with P. globosa and T. oceanica. Our results indicate that marine algae are important for the global cycling of Se

  14. Fermentation metabolism and its evolution in algae.


    Catalanotti, Claudia; Yang, Wenqiang; Posewitz, Matthew C; Grossman, Arthur R


    Fermentation or anoxic metabolism allows unicellular organisms to colonize environments that become anoxic. Free-living unicellular algae capable of a photoautotrophic lifestyle can also use a range of metabolic circuitry associated with different branches of fermentation metabolism. While algae that perform mixed-acid fermentation are widespread, the use of anaerobic respiration is more typical of eukaryotic heterotrophs. The occurrence of a core set of fermentation pathways among the algae provides insights into the evolutionary origins of these pathways, which were likely derived from a common ancestral eukaryote. Based on genomic, transcriptomic, and biochemical studies, anaerobic energy metabolism has been examined in more detail in Chlamydomonas reinhardtii (Chlamydomonas) than in any other photosynthetic protist. This green alga is metabolically flexible and can sustain energy generation and maintain cellular redox balance under a variety of different environmental conditions. Fermentation metabolism in Chlamydomonas appears to be highly controlled, and the flexible use of the different branches of fermentation metabolism has been demonstrated in studies of various metabolic mutants. Additionally, when Chlamydomonas ferments polysaccharides, it has the ability to eliminate part of the reductant (to sustain glycolysis) through the production of H2, a molecule that can be developed as a source of renewable energy. To date, little is known about the specific role(s) of the different branches of fermentation metabolism, how photosynthetic eukaryotes sense changes in environmental O2 levels, and the mechanisms involved in controlling these responses, at both the transcriptional and post-transcriptional levels. In this review, we focus on fermentation metabolism in Chlamydomonas and other protists, with only a brief discussion of plant fermentation when relevant, since it is thoroughly discussed in other articles in this volume.

  15. Algae-Derived Dietary Ingredients Nourish Animals

    NASA Technical Reports Server (NTRS)


    In the 1980s, Columbia, Maryland-based Martek Biosciences Corporation worked with Ames Research Center to pioneer the use of microalgae as a source of essential omega-3 fatty acids, work that led the company to develop its highly successful Formulaid product. Now the Nutritional Products Division of Royal DSM, the company also manufactures DHAgold, a nutritional supplement for pets, livestock and farm-raised fish that uses algae to deliver docosahexaenoic acid (DHA).

  16. Antibody Production in Plants and Green Algae.


    Yusibov, Vidadi; Kushnir, Natasha; Streatfield, Stephen J


    Monoclonal antibodies (mAbs) have a wide range of modern applications, including research, diagnostic, therapeutic, and industrial uses. Market demand for mAbs is high and continues to grow. Although mammalian systems, which currently dominate the biomanufacturing industry, produce effective and safe recombinant mAbs, they have a limited manufacturing capacity and high costs. Bacteria, yeast, and insect cell systems are highly scalable and cost effective but vary in their ability to produce appropriate posttranslationally modified mAbs. Plants and green algae are emerging as promising production platforms because of their time and cost efficiencies, scalability, lack of mammalian pathogens, and eukaryotic posttranslational protein modification machinery. So far, plant- and algae-derived mAbs have been produced predominantly as candidate therapeutics for infectious diseases and cancer. These candidates have been extensively evaluated in animal models, and some have shown efficacy in clinical trials. Here, we review ongoing efforts to advance the production of mAbs in plants and algae. PMID:26905655

  17. Antibody Production in Plants and Green Algae.


    Yusibov, Vidadi; Kushnir, Natasha; Streatfield, Stephen J


    Monoclonal antibodies (mAbs) have a wide range of modern applications, including research, diagnostic, therapeutic, and industrial uses. Market demand for mAbs is high and continues to grow. Although mammalian systems, which currently dominate the biomanufacturing industry, produce effective and safe recombinant mAbs, they have a limited manufacturing capacity and high costs. Bacteria, yeast, and insect cell systems are highly scalable and cost effective but vary in their ability to produce appropriate posttranslationally modified mAbs. Plants and green algae are emerging as promising production platforms because of their time and cost efficiencies, scalability, lack of mammalian pathogens, and eukaryotic posttranslational protein modification machinery. So far, plant- and algae-derived mAbs have been produced predominantly as candidate therapeutics for infectious diseases and cancer. These candidates have been extensively evaluated in animal models, and some have shown efficacy in clinical trials. Here, we review ongoing efforts to advance the production of mAbs in plants and algae.

  18. New records of marine algae in Vietnam

    NASA Astrophysics Data System (ADS)

    Le Hau, Nhu; Ly, Bui Minh; Van Huynh, Tran; Trung, Vo Thanh


    In May, 2013, a scientific expedition was organized by the Vietnam Academy of Science and Technology (VAST) and the Far Eastern Branch of the Russian Academy of Sciences (FEBRAS) through the frame of the VAST-FEBRAS International Collaboration Program. The expedition went along the coast of Vietnam from Quang Ninh to Kien Giang. The objective was to collect natural resources to investigate the biological and biochemical diversity of the territorial waters of Vietnam. Among the collected algae, six taxa are new records for the Vietnam algal flora. They are the red algae Titanophora pikeana (Dickie) Feldmann from Cu Lao Xanh Island, Laurencia natalensis Kylin from Tho Chu Island, Coelothrix irregularis (Harvey) Børgesen from Con Dao Island, the green algae Caulerpa oligophylla Montagne, Caulerpa andamanensis (W.R. Taylor) Draisma, Prudhomme et Sauvage from Phu Quy Island, and Caulerpa falcifolia Harvey & Bailey from Ly Son Island. The seaweed flora of Vietnam now counts 833 marine algal taxa, including 415 Rhodophyta, 147 Phaeophyceae, 183 Chlorophyta, and 88 Cyanobacteria.

  19. Environmental life cycle comparison of algae to other bioenergy feedstocks.


    Clarens, Andres F; Resurreccion, Eleazer P; White, Mark A; Colosi, Lisa M


    Algae are an attractive source of biomass energy since they do not compete with food crops and have higher energy yields per area than terrestrial crops. In spite of these advantages, algae cultivation has not yet been compared with conventional crops from a life cycle perspective. In this work, the impacts associated with algae production were determined using a stochastic life cycle model and compared with switchgrass, canola, and corn farming. The results indicate that these conventional crops have lower environmental impacts than algae in energy use, greenhouse gas emissions, and water regardless of cultivation location. Only in total land use and eutrophication potential do algae perform favorably. The large environmental footprint of algae cultivation is driven predominantly by upstream impacts, such as the demand for CO(2) and fertilizer. To reduce these impacts, flue gas and, to a greater extent, wastewater could be used to offset most of the environmental burdens associated with algae. To demonstrate the benefits of algae production coupled with wastewater treatment, the model was expanded to include three different municipal wastewater effluents as sources of nitrogen and phosphorus. Each provided a significant reduction in the burdens of algae cultivation, and the use of source-separated urine was found to make algae more environmentally beneficial than the terrestrial crops. PMID:20085253

  20. Electro-coagulation-flotation process for algae removal.


    Gao, Shanshan; Yang, Jixian; Tian, Jiayu; Ma, Fang; Tu, Gang; Du, Maoan


    Algae in surface water have been a long-term issue all over the world, due to their adverse influence on drinking water treatment process as well as drinking water quality. The algae removal by electro-coagulation-flotation (ECF) technology was investigated in this paper. The results indicated that aluminum was an excellent electrode material for algae removal as compared with iron. The optimal parameters determined were: current density=1 mA/cm(2), pH=4-7, water temperature=18-36 degrees C, algae density=0.55 x 10(9)-1.55 x 10(9) cells/L. Under the optimal conditions, 100% of algae removal was achieved with the energy consumption as low as 0.4 kWh/m(3). The ECF performed well in acid and neutral conditions. At low initial pH of 4-7, the cell density of algae was effectively removed in the ECF, mainly through the charge neutralization mechanism; while the algae removal worsened when the pH increased (7-10), and the main mechanism shifted to sweeping flocculation and enmeshment. The mechanisms for algae removal at different pH were also confirmed by atomic force microscopy (AFM) analysis. Furthermore, initial cell density and water temperature could also influence the algae removal. Overall, the results indicated that the ECF technology was effective for algae removal, from both the technical and economical points of view. PMID:20042280

  1. Electro-coagulation-flotation process for algae removal.


    Gao, Shanshan; Yang, Jixian; Tian, Jiayu; Ma, Fang; Tu, Gang; Du, Maoan


    Algae in surface water have been a long-term issue all over the world, due to their adverse influence on drinking water treatment process as well as drinking water quality. The algae removal by electro-coagulation-flotation (ECF) technology was investigated in this paper. The results indicated that aluminum was an excellent electrode material for algae removal as compared with iron. The optimal parameters determined were: current density=1 mA/cm(2), pH=4-7, water temperature=18-36 degrees C, algae density=0.55 x 10(9)-1.55 x 10(9) cells/L. Under the optimal conditions, 100% of algae removal was achieved with the energy consumption as low as 0.4 kWh/m(3). The ECF performed well in acid and neutral conditions. At low initial pH of 4-7, the cell density of algae was effectively removed in the ECF, mainly through the charge neutralization mechanism; while the algae removal worsened when the pH increased (7-10), and the main mechanism shifted to sweeping flocculation and enmeshment. The mechanisms for algae removal at different pH were also confirmed by atomic force microscopy (AFM) analysis. Furthermore, initial cell density and water temperature could also influence the algae removal. Overall, the results indicated that the ECF technology was effective for algae removal, from both the technical and economical points of view.

  2. Hydrogenases in green algae: do they save the algae's life and solve our energy problems?


    Happe, Thomas; Hemschemeier, Anja; Winkler, Martin; Kaminski, Annette


    Green algae are the only known eukaryotes with both oxygenic photosynthesis and a hydrogen metabolism. Recent physiological and genetic discoveries indicate a close connection between these metabolic pathways. The anaerobically inducible hydA genes of algae encode a special type of highly active [Fe]-hydrogenase. Electrons from reducing equivalents generated during fermentation enter the photosynthetic electron transport chain via the plastoquinone pool. They are transferred to the hydrogenase by photosystem I and ferredoxin. Thus, the [Fe]-hydrogenase is an electron 'valve' that enables the algae to survive under anaerobic conditions. During sulfur deprivation, illuminated algal cultures evolve large quantities of hydrogen gas, and this promises to be an alternative future energy source. PMID:12049920

  3. Microplate Technique for Determining Accumulation of Metals by Algae

    PubMed Central

    Hassett, James M.; Jennett, J. Charles; Smith, James E.


    A microplate technique was developed to determine the conditions under which pure cultures of algae removed heavy metals from aqueous solutions. Variables investigated included algal species and strain, culture age (11 and 44 days), metal (mercury, lead, cadmium, and zinc), pH, effects of different buffer solutions, and time of exposure. Plastic, U-bottomed microtiter plates were used in conjunction with heavy metal radionuclides to determine concentration factors for metal-alga combinations. The technique developed was rapid, statistically reliable, and economical of materials and cells. Results (expressed as concentration factors) were in reasonably good agreement with literature values. All species of algae studied removed mercury from solution. Green algae proved better at accumulating cadmium than did blue-green algae. No alga studied removed zinc, perhaps because cells were maintained in the dark during the labeling period. Chlamydomonas sp. proved superior in ability to remove lead from solution. PMID:16345764

  4. Exploring the potential of algae/bacteria interactions.


    Kouzuma, Atsushi; Watanabe, Kazuya


    Algae are primary producers in aquatic ecosystems, where heterotrophic bacteria grow on organics produced by algae and recycle nutrients. Ecological studies have identified the co-occurrence of particular species of algae and bacteria, suggesting the presence of their specific interactions. Algae/bacteria interactions are categorized into nutrient exchange, signal transduction and gene transfer. Studies have examined how these interactions shape aquatic communities and influence geochemical cycles in the natural environment. In parallel, efforts have been made to exploit algae for biotechnology processes, such as water treatment and bioenergy production, where bacteria influence algal activities in various ways. We suggest that better understanding of mechanisms underlying algae/bacteria interactions will facilitate the development of more efficient and/or as-yet-unexploited biotechnology processes.

  5. Method and apparatus for iterative lysis and extraction of algae

    SciTech Connect

    Chew, Geoffrey; Boggs, Tabitha; Dykes, Jr., H. Waite H.; Doherty, Stephen J.


    A method and system for processing algae involves the use of an ionic liquid-containing clarified cell lysate to lyse algae cells. The resulting crude cell lysate may be clarified and subsequently used to lyse algae cells. The process may be repeated a number of times before a clarified lysate is separated into lipid and aqueous phases for further processing and/or purification of desired products.

  6. Bromophenols from marine algae with potential anti-diabetic activities

    NASA Astrophysics Data System (ADS)

    Lin, Xiukun; Liu, Ming


    Marine algae contain various bromophenols with a variety of biological activities, including antimicrobial, anticancer, and anti-diabetic effects. Here, we briefly review the recent progress in researches on the biomaterials from marine algae, emphasizing the relationship between the structure and the potential anti-diabetic applications. Bromophenols from marine algae display their hyperglycemic effects by inhibiting the activities of protein tyrosine phosphatase 1B, α-glucosidase, as well as other mechanisms.

  7. Algae to Bio-Crude in Less Than 60 Minutes


    Elliott, Doug


    Engineers have created a chemical process that produces useful crude oil just minutes after engineers pour in harvested algae -- a verdant green paste with the consistency of pea soup. The PNNL team combined several chemical steps into one continuous process that starts with an algae slurry that contains as much as 80 to 90 percent water. Most current processes require the algae to be dried -- an expensive process that takes a lot of energy. The research has been licensed by Genifuel Corp.

  8. Method for producing hydrogen and oxygen by use of algae


    Greenbaum, Elias


    Efficiency of process for producing H.sub.2 by subjecting algae in an aqueous phase to light irradiation is increased by culturing algae which has been bleached during a first period of irradiation in a culture medium in an aerobic atmosphere until it has regained color and then subjecting this algae to a second period of irradiation wherein hydrogen is produced at an enhanced rate.

  9. Algae to Bio-Crude in Less Than 60 Minutes

    SciTech Connect

    Elliott, Doug


    Engineers have created a chemical process that produces useful crude oil just minutes after engineers pour in harvested algae -- a verdant green paste with the consistency of pea soup. The PNNL team combined several chemical steps into one continuous process that starts with an algae slurry that contains as much as 80 to 90 percent water. Most current processes require the algae to be dried -- an expensive process that takes a lot of energy. The research has been licensed by Genifuel Corp.

  10. Method for producing hydrogen and oxygen by use of algae


    Greenbaum, E.


    Efficiency of process for producing H/sub 2/ by subjecting algae in an aqueous phase to light irradiation is increased by culturing algae which has been bleached during a first period of irradiation in a culture medium in an aerobic atmosphere until it has regained color and then subjecting this algae to a second period of irradiation wherein hydrogen is produced at an enhanced rate.

  11. Overall Energy Considerations for Algae Species Comparison and Selection in Algae-to-Fuels Processes

    SciTech Connect

    Link, D.; Kail, B.; Curtis, W.; Tuerk,A.


    The controlled growth of microalgae as a feedstock for alternative transportation fuel continues to receive much attention. Microalgae have the characteristics of rapid growth rate, high oil (lipid) content, and ability to be grown in unconventional scenarios. Algae have also been touted as beneficial for CO{sub 2} reuse, as algae can be grown using CO{sub 2} emissions from fossil-based energy generation. Moreover, algae does not compete in the food chain, lessening the 'food versus fuel' debate. Most often, it is assumed that either rapid production rate or high oii content should be the primary factor in algae selection for algae-to-fuels production systems. However, many important characteristics of algae growth and lipid production must be considered for species selection, growth condition, and scale-up. Under light limited, high density, photoautotrophic conditions, the inherent growth rate of an organism does not affect biomass productivity, carbon fixation rate, and energy fixation rate. However, the oil productivity is organism dependent, due to physiological differences in how the organisms allocate captured photons for growth and oil production and due to the differing conditions under which organisms accumulate oils. Therefore, many different factors must be considered when assessing the overall energy efficiency of fuel production for a given algae species. Two species, Chlorella vulgaris and Botryococcus braunii, are popular choices when discussing algae-to-fuels systems. Chlorella is a very robust species, often outcompeting other species in mixed-culture systems, and produces a lipid that is composed primarily of free fatty acids and glycerides. Botryococcus is regarded as a slower growing species, and the lipid that it produces is characterized by high hydrocarbon content, primarily C28-C34 botryococcenes. The difference in growth rates is often considered to be an advantage oiChlorella. However, the total energy captured by each algal species in

  12. Algae Bioreactor Using Submerged Enclosures with Semi-Permeable Membranes

    NASA Technical Reports Server (NTRS)

    Trent, Jonathan D (Inventor); Gormly, Sherwin J (Inventor); Embaye, Tsegereda N (Inventor); Delzeit, Lance D (Inventor); Flynn, Michael T (Inventor); Liggett, Travis A (Inventor); Buckwalter, Patrick W (Inventor); Baertsch, Robert (Inventor)


    Methods for producing hydrocarbons, including oil, by processing algae and/or other micro-organisms in an aquatic environment. Flexible bags (e.g., plastic) with CO.sub.2/O.sub.2 exchange membranes, suspended at a controllable depth in a first liquid (e.g., seawater), receive a second liquid (e.g., liquid effluent from a "dead zone") containing seeds for algae growth. The algae are cultivated and harvested in the bags, after most of the second liquid is removed by forward osmosis through liquid exchange membranes. The algae are removed and processed, and the bags are cleaned and reused.

  13. Method and apparatus for lysing and processing algae


    Chew, Geoffrey; Reich, Alton J.; Dykes, Jr., H. Waite H.; Di Salvo, Roberto


    Methods and apparatus for processing algae are described in which a hydrophilic ionic liquid is used to lyse algae cells at lower temperatures than existing algae processing methods. A salt or salt solution is used as a separation agent and to remove water from the ionic liquid, allowing the ionic liquid to be reused. The used salt may be dried or concentrated and reused. The relatively low lysis temperatures and recycling of the ionic liquid and salt reduce the environmental impact of the algae processing while providing biofuels and other useful products.

  14. Exploring the potential of using algae in cosmetics.


    Wang, Hui-Min David; Chen, Ching-Chun; Huynh, Pauline; Chang, Jo-Shu


    The applications of microalgae in cosmetic products have recently received more attention in the treatment of skin problems, such as aging, tanning and pigment disorders. There are also potential uses in the areas of anti-aging, skin-whitening, and pigmentation reduction products. While algae species have already been used in some cosmetic formulations, such as moisturizing and thickening agents, algae remain largely untapped as an asset in this industry due to an apparent lack of utility as a primary active ingredient. This review article focuses on integrating studies on algae pertinent to skin health and beauty, with the purpose of identifying serviceable algae functions in practical cosmetic uses.

  15. A technical evaluation of biodiesel from vegetable oils vs. algae. Will algae-derived biodiesel perform?

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biodiesel, one of the most prominent renewable alternative fuels, can be derived from a variety of sources including vegetable oils, animal fats and used cooking oils as well as alternative sources such as algae. While issues such as land-use change, food vs. fuel, feedstock availability, and produc...



    Roman, Manuel Casal


    Some microscopic algae can cause different infectious diseases in humans, including skin, bone, and disseminated. These little-known emerging disease are more severe in immunocompromised patients. The confirmatory microbiological diagnosis must be done differential with yeast-like fungi that can be confused. Anti-fungal drugs and surgery, being quite frequent treatment failure have been used in the treatment. Given the increase of immunosuppression in the current medicine and new possibilities of microbiological diagnostics, it is logical that these diseases tend to increase, by which all physician should know them. PMID:27386675

  17. Factors affecting spore germination in algae - review.


    Agrawal, S C


    This review surveys whatever little is known on the influence of different environmental factors like light, temperature, nutrients, chemicals (such as plant hormones, vitamins, etc.), pH of the medium, biotic factors (such as algal extracellular substances, algal concentration, bacterial extracellular products, animal grazing and animal extracellular products), water movement, water stress, antibiotics, UV light, X-rays, gamma-rays, and pollution on the spore germination in algae. The work done on the dormancy of algal spores and on the role of vegetative cells in tolerating environmental stress is also incorporated. PMID:19826917



    Roman, Manuel Casal


    Some microscopic algae can cause different infectious diseases in humans, including skin, bone, and disseminated. These little-known emerging disease are more severe in immunocompromised patients. The confirmatory microbiological diagnosis must be done differential with yeast-like fungi that can be confused. Anti-fungal drugs and surgery, being quite frequent treatment failure have been used in the treatment. Given the increase of immunosuppression in the current medicine and new possibilities of microbiological diagnostics, it is logical that these diseases tend to increase, by which all physician should know them.

  19. Effect of petroleum hydrocarbons on algae

    SciTech Connect

    Bhadauria, S. ); Sengar, R.M.S. ); Mittal, S.; Bhattacharjee, S. )


    Algal species (65) were isolated from oil refinery effluent. Twenty-five of these species were cultured in Benecke's medium in a growth chamber, along with controls. Retardation in algal growth, inhibition in algal photosynthesis, and discoloration was observed in petroleum enriched medium. Few forms, viz. Cyclotella sp., Cosmarium sp., and Merismopedia sp. could not survive. The lag phase lengthened by several days and slope of exponential phase was also depressed. Chlamydomonas sp., Scenedesmus sp., Ankistrodesmus sp., Nitzschia sp. and Navicula sp. were comparatively susceptible to petroleum. Depression in carbon fixation, cell numbers, and total dry algal mass was noticeable, showing toxicity to both diatoms and green algae.

  20. Pheromones in marine algae: A technical approach

    NASA Astrophysics Data System (ADS)

    Gassmann, G.; Müller, D. G.; Fritz, P.


    It is now well known that many marine organisms use low-molecular volatile substances as signals, in order to coordinate activities between different individuals. The study of such pheromones requires the isolation and enrichment of the secretions from undisturbed living cells or organisms over extended periods of time. The Grob-Hersch extraction device, which we describe here, avoids adverse factors for the biological materials such as strong water currents, rising gas bubbles or chemical solvents. Furthermore, the formation of sea-water spray is greatly reduced. The application of this technique for the isolation of pheromones of marine algae and animals is described.

  1. Algae-based oral recombinant vaccines.


    Specht, Elizabeth A; Mayfield, Stephen P


    Recombinant subunit vaccines are some of the safest and most effective vaccines available, but their high cost and the requirement of advanced medical infrastructure for administration make them impractical for many developing world diseases. Plant-based vaccines have shifted that paradigm by paving the way for recombinant vaccine production at agricultural scale using an edible host. However, enthusiasm for "molecular pharming" in food crops has waned in the last decade due to difficulty in developing transgenic crop plants and concerns of contaminating the food supply. Microalgae could be poised to become the next candidate in recombinant subunit vaccine production, as they present several advantages over terrestrial crop plant-based platforms including scalable and contained growth, rapid transformation, easily obtained stable cell lines, and consistent transgene expression levels. Algae have been shown to accumulate and properly fold several vaccine antigens, and efforts are underway to create recombinant algal fusion proteins that can enhance antigenicity for effective orally delivered vaccines. These approaches have the potential to revolutionize the way subunit vaccines are made and delivered - from costly parenteral administration of purified protein, to an inexpensive oral algae tablet with effective mucosal and systemic immune reactivity.

  2. Viruses and viruslike particles of eukaryotic algae.

    PubMed Central

    Van Etten, J L; Lane, L C; Meints, R H


    Until recently there was little interest or information on viruses and viruslike particles of eukaryotic algae. However, this situation is changing. In the past decade many large double-stranded DNA-containing viruses that infect two culturable, unicellular, eukaryotic green algae have been discovered. These viruses can be produced in large quantities, assayed by plaque formation, and analyzed by standard bacteriophage techniques. The viruses are structurally similar to animal iridoviruses, their genomes are similar to but larger (greater than 300 kbp) than that of poxviruses, and their infection process resembles that of bacteriophages. Some of the viruses have DNAs with low levels of methylated bases, whereas others have DNAs with high concentrations of 5-methylcytosine and N6-methyladenine. Virus-encoded DNA methyltransferases are associated with the methylation and are accompanied by virus-encoded DNA site-specific (restriction) endonucleases. Some of these enzymes have sequence specificities identical to those of known bacterial enzymes, and others have previously unrecognized specificities. A separate rod-shaped RNA-containing algal virus has structural and nucleotide sequence affinities to higher plant viruses. Quite recently, viruses have been associated with rapid changes in marine algal populations. In the next decade we envision the discovery of new algal viruses, clarification of their role in various ecosystems, discovery of commercially useful genes in these viruses, and exploitation of algal virus genetic elements in plant and algal biotechnology. Images PMID:1779928

  3. Effects of nitrogen dioxide on algae

    SciTech Connect

    Wodzinski, R.S.; Alexander, M.


    Photosynthetic activity of Anabaena flos-aquae in a soil suspension at an initial pH of 4.9 was almost totally eliminated after 3 days of exposure to 5.0 ppm ( NO/sub 2/, at which time the pH had fallen to 3.9. In contrast, A. flos-aquae in soil suspensions at an initial pH of 6.0 was not inhibited after 3 days by 5.0 ppm NO/sub 2/, but the activity was reduced by half in the presence of 15.0 ppm NO/sub 2/; the pH was 6.5 and 5.8, respectively, in the NO/sub 2/-treated samples on day 3. Photosynthesis by the green algae Chlamydomonas reinhardtii and Ankistrodesmus falcatus in soil suspensions at an initial pH of approx 4.2 was not appreciably affected by 15.0 ppm of NO/sub 2/ after 3 days, at which time the pH had fallen below 4.0. The high levels of NO/sub 2/ and low pH values required for toxicity suggest that blue-green and green algae probably will not be affected directly by NO/sub 2/ in polluted air.

  4. Effects of nitrogen dioxide on algae

    SciTech Connect

    Wodzinski, R.S.; Alexander, M.


    Photosynthetic activity of Anabaena flos-aquae in a soil suspension at an initial pH of 4.9 was almost totally eliminated after 3 days of exposure to 5.0 ppM ( NO/sub 2/, at which time the pH had fallen to 3.9. In contrast, A. flos-aquae in soil suspensions at an initial pH of 6.0 was not inhibited after 3 days by 5.0 ppM NO/sub 2/, but the activity was reduced by half in the presence of 15.0 ppM NO/sub 2/; the pH was 6.5 and 5.8, respectively, in the NO/sub 2/-treated samples on day 3. Photosynthesis by the green algae Chlamydomonas reinhardtii and Ankistrodesmus falcatus in soil suspensions at an initial pH of approx. 4.2 was not appreciably affected by 15.0 ppM of NO/sub 2/ after 3 days, at which time the pH had fallen below 4.0. The high levels of NO/sub 2/ and low pH values required for toxicity suggest that blue-green and green algae probably will not be affected directly by NO/sub 2/ in polluted air.

  5. Algae-based oral recombinant vaccines.


    Specht, Elizabeth A; Mayfield, Stephen P


    Recombinant subunit vaccines are some of the safest and most effective vaccines available, but their high cost and the requirement of advanced medical infrastructure for administration make them impractical for many developing world diseases. Plant-based vaccines have shifted that paradigm by paving the way for recombinant vaccine production at agricultural scale using an edible host. However, enthusiasm for "molecular pharming" in food crops has waned in the last decade due to difficulty in developing transgenic crop plants and concerns of contaminating the food supply. Microalgae could be poised to become the next candidate in recombinant subunit vaccine production, as they present several advantages over terrestrial crop plant-based platforms including scalable and contained growth, rapid transformation, easily obtained stable cell lines, and consistent transgene expression levels. Algae have been shown to accumulate and properly fold several vaccine antigens, and efforts are underway to create recombinant algal fusion proteins that can enhance antigenicity for effective orally delivered vaccines. These approaches have the potential to revolutionize the way subunit vaccines are made and delivered - from costly parenteral administration of purified protein, to an inexpensive oral algae tablet with effective mucosal and systemic immune reactivity. PMID:24596570

  6. Respiratory Chain of Colorless Algae II. Cyanophyta

    PubMed Central

    Webster, D. A.; Hackett, D. P.


    Whole cell difference spectra of the blue-green algae, Saprospira grandis, Leucothrix mucor, and Vitreoscilla sp. have one, or at the most 2, broad α-bands near 560 mμ. At −190° these bands split to give 4 peaks in the α-region for b and c-type cytochromes, but no α-band for a-type cytochromes is visible. The NADH oxidase activity of these organisms was shown to be associated with particulate fractions of cell homogenates. The response of this activity to inhibitors differed from the responses of the NADH oxidase activities of particulate preparations from the green algae and higher plants to the same inhibitors, but is more typical of certain bacteria. No cytochrome oxidase activity was present in these preparations. The respiration of Saprospira and Vitreoscilla can be light-reversibly inhibited by CO, and all 3 organisms have a CO-binding pigment whose CO complex absorbs near 570, 535, and 417 mμ. The action spectrum for the light reversal of CO-inhibited Vitreoscilla respiration shows maxima at 568, 534, and 416 mμ. The results suggest that the terminal oxidase in these blue-greens is an o-type cytochrome. Images PMID:5932404

  7. Algae Biofuels Co-Location Assessment Tool


    ABCLAT was built to help any model user with spatially explicit Nitrogen, Phosphorous, and Carbon Dioxide nutrient flux information, and solar resource information evaluate algal cultivation potential. Initial applications of this modeling framework include Algae Biofuels Co-Location Assessment Tool Canada and Australia. The Canadian application was copyrighted November 29th 2011 as the Algae Biofuels Co-Location Assessment Tool for Canada. This copyright assertion is for the general framework from which any country or region with themore » requisite data could create a regionally specific application. The ABCLAT model framework developed by SNL looks at the growth potential in a given region as a function of available nutrients from wastewater and other sources, carbon dioxide from power plants, available solar potential, and if available, land cover and use information. The model framework evaluates the biomass potential, fixed carbon dioxide, potential algal biocrude and required land area for nutrient sources. ABCLAT is built with an object-oriented software program that can provide an easy to use interface for exploring questions related to aigal biomass production.« less

  8. Algae Biofuels Co-Location Assessment Tool

    SciTech Connect


    ABCLAT was built to help any model user with spatially explicit Nitrogen, Phosphorous, and Carbon Dioxide nutrient flux information, and solar resource information evaluate algal cultivation potential. Initial applications of this modeling framework include Algae Biofuels Co-Location Assessment Tool Canada and Australia. The Canadian application was copyrighted November 29th 2011 as the Algae Biofuels Co-Location Assessment Tool for Canada. This copyright assertion is for the general framework from which any country or region with the requisite data could create a regionally specific application. The ABCLAT model framework developed by SNL looks at the growth potential in a given region as a function of available nutrients from wastewater and other sources, carbon dioxide from power plants, available solar potential, and if available, land cover and use information. The model framework evaluates the biomass potential, fixed carbon dioxide, potential algal biocrude and required land area for nutrient sources. ABCLAT is built with an object-oriented software program that can provide an easy to use interface for exploring questions related to aigal biomass production.

  9. Variations of morphology and photosynthetic performances of Ulva prolifera during the whole green tide blooming process in the Yellow Sea.


    Zhang, Jian Heng; Huo, Yuan Zi; Zhang, Zheng Long; Yu, Ke Feng; He, Qing; Zhang, Lin Hui; Yang, Li Li; Xu, Ren; He, Pei Min


    Since 2007, the world's largest macroalgal blooms have occurred along the coastal area of the Yellow Sea for 6 consecutive years. In 2012, shipboard surveying and satellite remote sensing were used to monitor the whole blooming process. The blooms originated in Rudong sea area of the South Yellow Sea where bloom patches were of dark green and filamentous thalli were the dominant morphology. The scale of the blooms reached its peak size in Rizhao sea area of the North Yellow Sea, and decreased promptly and became insignificant in Qingdao coast where the blooms turned yellow, mostly with air sac blades. Meanwhile, vegetative cells of the green tide algae changed into cytocysts gradually from which germ cells were released as the blooms drifted northward. Additionally, chlorophyll contents and fluorescence activity of free-floating thalli in the North Yellow Sea were both significantly lower than that in the South Yellow Sea. Those studies presented here contributed to increasing our understanding about how the green tide declined gradually in the North Yellow Sea.

  10. Shewanella algae Peritonitis in Patients on Peritoneal Dialysis.


    Shanmuganathan, Malini; Goh, Bak Leong; Lim, Christopher; NorFadhlina, Zakaria; Fairol, Ibrahim

    Patients with peritonitis present with abdominal pain, diarrhea, fever, and turbid peritoneal dialysis (PD) fluid. Shewanella algae peritonitis has not yet been reported in PD patients in the literature. We present the first 2 cases of Shewanella algae peritonitis in PD patients. Mupirocin cream is applied on the exit site as prophylactic antibiotic therapy. PMID:27659933

  11. Cryoalgotox: Use of cryopreserved alga in a semistatic microplate test

    SciTech Connect

    Benhra, A.; Radetski, C.M.; Ferard, J.F.


    Use of cryopreserved alga Selenastrum capricornutum has been evaluated as a simple and cost-efficient procedure in a new semistatic algal ecotoxicity test. Experiments have been conducted to compare performance criteria of this method, named Cryoalgotox, versus the classic microplate test using fresh algae. Cryoalgotox 72-h 50% effective concentrations (EC50s) determined with Cd{sup 2+}, Cu{sup 2+}, Cr{sup 6+}, and atrazine were more sensitive, repeatable (low coefficients of variation), and reproducible (low time effect) than the results obtained with the classical microplate tests. The effect of storage time at {minus}80 C on the sensitivity of the algae was assessed using cadmium as a toxic reference; it was shown that algae stored at {minus}80 C over a 3-month period gave comparable toxicity results to those found with fresh algae.

  12. Algae Farming in Low Earth Orbit: Past Present and Future

    NASA Astrophysics Data System (ADS)

    Morrison, N.

    Algal strains used as a production engine represent a novel example of living mechanical systems with tremendous potential for applications in space. Algae use photosynthesis to create lipids, glycerin, and biomass, with different strains of algae producing different oils. Algae can be grown to produce many types of oils, with low, medium or long hydrocarbon chain lengths. This article examines the history of algae research, as well as its value to astronauts as both a food supplement and as an oxygen production and carbon sequester engine. Consideration is given to ways algae is currently being used and tested in space, followed by a look forward envisioning dynamic living technological systems that can help to sustain our race as we travel the void between stars.

  13. Mitigating ammonia nitrogen deficiency in dairy wastewaters for algae cultivation.


    Lu, Qian; Zhou, Wenguang; Min, Min; Ma, Xiaochen; Ma, Yiwei; Chen, Paul; Zheng, Hongli; Doan, Yen T T; Liu, Hui; Chen, Chi; Urriola, Pedro E; Shurson, Gerald C; Ruan, Roger


    This study demonstrated that the limiting factor to algae growth on dairy wastewater was the ammonia nitrogen deficiency. Dairy wastewaters were mixed with a slaughterhouse wastewater that has much higher ammonia nitrogen content. The results showed the mixing wastewaters improved the nutrient profiles and biomass yield at low cost. Algae grown on mixed wastewaters contained high protein (55.98-66.91%) and oil content (19.10-20.81%) and can be exploited to produce animal feed and biofuel. Furthermore, algae grown on mixed wastewater significantly reduced nutrient contents remained in the wastewater after treatment. By mitigating limiting factor to algae growth on dairy wastewaters, the key issue of low biomass yield of algae grown on dairy wastewaters was resolved and the wastewater nutrient removal efficiency was significantly improved by this study.

  14. Auxin and cytoskeletal organization in algae.


    Jin, Qiaojun; Scherp, Peter; Heimann, Kirsten; Hasenstein, Karl H


    Hormones affect growth and alter the cytoskeleton suggesting that hormones and the cytoskeleton interact with each other. The cytoskeleton of ancestral algae such as Chara showed similar sensitivity to auxin as higher plants, even in generative structures but the sensitivity differed between IAA and alpha-NAA and presumably other auxins. The ability of cells to elongate depends on microtubule organization during the transition from disorganized to perpendicular to longitudinal organization of the cytoskeleton. Because of the many functions of the cytoskeleton it is possible that its composition is influenced by selective gene expression and adaptation to growth regulators. Co-localization of microtubules and F-actin change at a high temporal and spatial scale. High resolution measurements of mRNA expression indicate rapid turnover that may affect the composition of the cytoskeleton.

  15. High-fidelity phototaxis in biflagellate algae

    NASA Astrophysics Data System (ADS)

    Leptos, Kyriacos; Chioccioli, Maurizio; Furlan, Silvano; Pesci, Adriana; Goldstein, Raymond


    The single-cell alga Chlamydomonas reinhardtii is a motile biflagellate that can swim towards light for its photosynthetic requirements, a behavior referred to as phototaxis. The cell responds upon light stimulation through its rudimentary eye - the eyespot - by changing the beating amplitude of its two flagella accordingly - a process called the photoresponse. All this occurs in a coordinated fashion as Chlamydomonas spins about its body axis while swimming, thus experiencing oscillating intensities of light. We use high-speed video microscopy to measure the flagellar dynamics of the photoresponse on immobilized cells and interpret the results with a mathematical model of adaptation similar to that used previously for Volvox. These results are incorporated into a model of phototactic steering to yield trajectories that are compared to those obtained by three-dimensional tracking. Implications of these results for the evolution of multicellularity in the Volvocales are discussed.

  16. Autophagy in the model alga Chlamydomonas reinhardtii.


    Pérez-Pérez, María Esther; Crespo, José L


    Degradation and recycling of intracellular components via autophagy is conserved among eukaryotes. This catabolic process is mediated by autophagy-related (ATG) proteins, which have been identified in different systems including yeasts, mammals and plants. The genome of the model alga Chlamydomonas reinhardtii contains homologues to yeast and plant ATG genes although autophagy has not been previously described in this organism. In our study, we report the molecular characterization of autophagy in Chlamydomonas. Using the ATG8 protein from Chlamydomonas as a molecular autophagy marker, we demonstrate that this degradative process is induced in stationary cells or under different stresses such as nutrient limitation, oxidative stress or the accumulation of misfolded proteins in the endoplasmic reticulum. Our results also indicate that TOR, a major regulator of autophagy, inhibits this process in Chlamydomonas.

  17. Swimming like algae: biomimetic soft artificial cilia

    PubMed Central

    Sareh, Sina; Rossiter, Jonathan; Conn, Andrew; Drescher, Knut; Goldstein, Raymond E.


    Cilia are used effectively in a wide variety of biological systems from fluid transport to thrust generation. Here, we present the design and implementation of artificial cilia, based on a biomimetic planar actuator using soft-smart materials. This actuator is modelled on the cilia movement of the alga Volvox, and represents the cilium as a piecewise constant-curvature robotic actuator that enables the subsequent direct translation of natural articulation into a multi-segment ionic polymer metal composite actuator. It is demonstrated how the combination of optimal segmentation pattern and biologically derived per-segment driving signals reproduce natural ciliary motion. The amenability of the artificial cilia to scaling is also demonstrated through the comparison of the Reynolds number achieved with that of natural cilia. PMID:23097503

  18. Swimming like algae: biomimetic soft artificial cilia.


    Sareh, Sina; Rossiter, Jonathan; Conn, Andrew; Drescher, Knut; Goldstein, Raymond


    Cilia are used effectively in a wide variety of biological systems from fluid transport to thrust generation. Here, we present the design and implementation of artificial cilia, based on a biomimetic planar actuator using soft-smart materials. This actuator is modelled on the cilia movement of the alga Volvox, and represents the cilium as a piecewise constant-curvature robotic actuator that enables the subsequent direct translation of natural articulation into a multi-segment ionic polymer metal composite actuator. It is demonstrated how the combination of optimal segmentation pattern and biologically derived per-segment driving signals reproduce natural ciliary motion. The amenability of the artificial cilia to scaling is also demonstrated through the comparison of the Reynolds number achieved with that of natural cilia. PMID:23097503

  19. Random flow induced by swimming algae

    NASA Astrophysics Data System (ADS)

    Kantsler, Vasily; Rushkin, Ilia; Goldstein, Raymond


    In this work we studied the random flow induced in a fluid by the motion of a dilute suspension of the swimming algae Volvox carteri. The fluid velocity in the suspension is a superposition of the flow fields set up by the individual organisms, which in turn have multipole contributions that decay as inverse powers of distance from the organism. Here we show that the conditions under which the central limit theorem guarantees a Gaussian probability distribution function of velocity fluctuations are satisfied when the leading force singularity is a Stokeslet. Deviations from Gaussianity are shown to arise from near-field effects. Comparison is made with the statistical properties of abiotic sedimenting suspensions. The experimental results are supplemented by extensive numerical studies.

  20. Chloroplast Phylogenomic Inference of Green Algae Relationships

    PubMed Central

    Sun, Linhua; Fang, Ling; Zhang, Zhenhua; Chang, Xin; Penny, David; Zhong, Bojian


    The green algal phylum Chlorophyta has six diverse classes, but the phylogenetic relationship of the classes within Chlorophyta remains uncertain. In order to better understand the ancient Chlorophyta evolution, we have applied a site pattern sorting method to study compositional heterogeneity and the model fit in the green algal chloroplast genomic data. We show that the fastest-evolving sites are significantly correlated with among-site compositional heterogeneity, and these sites have a much poorer fit to the evolutionary model. Our phylogenomic analyses suggest that the class Chlorophyceae is a monophyletic group, and the classes Ulvophyceae, Trebouxiophyceae and Prasinophyceae are non-monophyletic groups. Our proposed phylogenetic tree of Chlorophyta will offer new insights to investigate ancient green algae evolution, and our analytical framework will provide a useful approach for evaluating and mitigating the potential errors of phylogenomic inferences. PMID:26846729

  1. An algae-covered alligator rests warily

    NASA Technical Reports Server (NTRS)


    An algae-covered alligator keeps a wary eye open as it rests in one of the ponds at Kennedy Space Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  2. Copper-Induced Membrane Depolarizations Involve the Induction of Mosaic TRP Channels, Which Activate VDCC Leading to Calcium Increases in Ulva compressa

    PubMed Central

    Gómez, Melissa; González, Alberto; Sáez, Claudio A.; Moenne, Alejandra


    The marine macroalga Ulva compressa (Chlorophyceae) is a cosmopolitan species, tolerant to heavy metals, in particular to copper. U. compressa was cultivated with 10 μM copper for 12 h and membrane depolarization events were detected. First, seven depolarization events occurred at 4, 8, 12–13, 80, and 86 min, and at 5 and 9 h of copper exposure. Second, bathocuproine sulphonate, a specific copper-chelating compound, was added before incorporating copper to the culture medium. Copper-induced depolarizations were inhibited by bathocuproine at 4, 8, 12–13, 80, and 86 min, but not at 5 and 9 h, indicating that initial events are due to copper ions entry. Third, specific inhibitors of human TRPA1, C4, C5, M8, and V1corresponding to HC030031, ML204, SKF96363, M8B, and capsazepin, respectively, were used to analyze whether copper-induced depolarizations were due to activation of transient receptor potentials (TRPs). Inhibitor effects indicate that the seven depolarizations involved the activation of functional mosaic TRPs that displayed properties similar to human TRPA, C, M, and/or V. Finally, inhibition of copper-induced depolarizations using specific TRP inhibitors suppressed calcium increases at 2, 3, and 12 h due to activation of voltage-dependent calcium channels (VDCCs). Thus, copper induces seven depolarization events that involve activation of mosaic TRPs which, in turn, activates VDCC leading to calcium increases at 2, 3, and 12 h in U. compressa. PMID:27379106

  3. Investigation of the ionic strength dependence of Ulva lactuca acid functional group pK(a)s by manual alkalimetric titrations.


    Schijf, Johan; Ebling, Alina M


    We performed a series of manual alkalimetric titrations in NaCl solutions (0.01-5.0 M) at T = 25 degrees C on both fresh and dehydrated samples of the marine chlorophyte Ulva lactuca (sea lettuce), a strong metal accumulator holding considerable promise in biosorbent and biomonitor applications. Functional groups were characterized in terms of their number, site densities, and acid dissociation constants (pK(a)s). FITEQL4.0 modeling shows that, at any ionic strength, titration curves for dehydrated biomass in the pH range 2-10 are adequately described by three functional groups with remarkably uniform site densities of about 5 x 10(-4) mol/g. Lower site densities for fresh U. lactuca are consistent with approximately 87% water content. The pK(a)s display pronounced ionic strength dependent behavior obeying an extended Debye-Huckel relation. Extrapolation to I = 0 yields values of 4.26 +/- 0.04, 6.44 +/- 0.02, and 9.56 +/- 0.04. This information by itself is insufficient to unambiguously identify the groups. Similar site densities suggest that all three are linked to major molecular building blocks of the cell material, pointing to carboxylic acids, phosphate esters, and amines as likely candidates. Highly acidic sulfate esters, not detected in our titrations, may also play a role in trace metal adsorption on U. lactuca.

  4. The Hydrobia ulvae-Maritrema subdolum association: influence of temperature, salinity, light, water-pressure and secondary host exudates on cercarial emergence and longevity.


    Mouritsen, K N


    The effects of environmental factors and exudates from the amphipod Corophium volutator on the emergence of Maritrema subdolum cercariae (Digenea: Microphallidae) from the snail Hydrobia ulvae were investigated in the laboratory. Increasing the temperature (15 to 25 degrees C) caused an overall 11-fold increase in emergence rate under varying salinities (24 to 36 per thousand). The effect of salinity depended on the experimental temperature. Emergence increased with increasing salinity at higher temperatures, but decreased with increasing salinity at 15 degrees C. Whereas the different levels of salinity had no effect, increasing the temperature significantly reduced the life span of cercariae. In comparison with complete darkness, light caused a two-fold increase in emergence, whereas an increment of the water pressure from 1.0 to 1.3 ATM (corresponding to 0 and 3 m of depth) left the shedding rate unaffected. Unidentified exudates from the second intermediate host, C. volutator, significantly depressed the cercarial emergence rate. The main transmission window of M. subdolum seems to occur during low water in tidal pools where light levels are high and solar radiation rapidly elevates the water temperature, as well as salinity through evaporation. The consequence of such a transmission strategy is discussed in relation to the impact of M. subdolum on the population dynamics of the second intermediate host. PMID:12498640

  5. Preparation of novel alginate based anion exchanger from Ulva japonica and its application for the removal of trace concentrations of fluoride from water.


    Paudyal, Hari; Pangeni, Bimala; Inoue, Katsutoshi; Kawakita, Hidetaka; Ohto, Keisuke; Ghimire, Kedar Nath; Alam, Shafiq


    A green seaweed, Ulva japonica, was modified by loading multivalent metal ions such as Zr(IV) and La(III) after CaCl2 cross-linking to produce metal loaded cross-linked seaweed (M-CSW) adsorbents, which were characterized by elemental analysis, functional groups identification, and metal content determination. Maximum sorption potential for fluoride was drastically increased after La(III) and Zr(IV) loading, which were evaluated as 0.58 and 0.95 mmol/g, respectively. Loaded fluoride was quantitatively desorbed by using dilute alkaline solution for its regeneration. Mechanism of fluoride adsorption was inferred in terms of ligand exchange reaction between hydroxyl ion on co-ordination sphere of the loaded metal ions of M-CSW and fluoride ion in aqueous solution. Application of M-CSW for the treatment of actual waste plating solution exhibited successful removal of fluoride to clear the effluent and environmental standards in Japan, suggesting high possibility of its application for the treatment of fluoride rich waste water.

  6. Sulphated Polysaccharides from Ulva clathrata and Cladosiphon okamuranus Seaweeds both Inhibit Viral Attachment/Entry and Cell-Cell Fusion, in NDV Infection

    PubMed Central

    Aguilar-Briseño, José Alberto; Cruz-Suarez, Lucia Elizabeth; Sassi, Jean-François; Ricque-Marie, Denis; Zapata-Benavides, Pablo; Mendoza-Gamboa, Edgar; Rodríguez-Padilla, Cristina; Trejo-Avila, Laura María


    Sulphated polysaccharides (SP) extracted from seaweeds have antiviral properties and are much less cytotoxic than conventional drugs, but little is known about their mode of action. Combination antiviral chemotherapy may offer advantages over single agent therapy, increasing efficiency, potency and delaying the emergence of resistant virus. The paramyxoviridae family includes pathogens causing morbidity and mortality worldwide in humans and animals, such as the Newcastle Disease Virus (NDV) in poultry. This study aims at determining the antiviral activity and mechanism of action in vitro of an ulvan (SP from the green seaweed Ulva clathrata), and of its mixture with a fucoidan (SP from Cladosiphon okamuranus), against La Sota NDV strain. The ulvan antiviral activity was tested using syncytia formation, exhibiting an IC50 of 0.1 μg/mL; ulvan had a better anti cell-cell spread effect than that previously shown for fucoidan, and inhibited cell-cell fusion via a direct effect on the F0 protein, but did not show any virucidal effect. The mixture of ulvan and fucoidan showed a greater anti-spread effect than SPs alone, but ulvan antagonizes the effect of fucoidan on the viral attachment/entry. Both SPs may be promising antivirals against paramyxovirus infection but their mixture has no clear synergistic advantage. PMID:25629385

  7. Effects of three macroalgae, Ulva linza (Chlorophyta), Corallina pilulifera (Rhodophyta) and Sargassum thunbergii (Phaeophyta) on the growth of the red tide microalga Prorocentrum donghaiense under laboratory conditions

    NASA Astrophysics Data System (ADS)

    Wang, Renjun; Xiao, Hui; Wang, You; Zhou, Wenli; Tang, Xuexi


    Allelopathic effects of several concentrations of fresh tissue and dry powder of three macroalgae, Ulva linza, Corallina pilulifera and Sargassum thunbergii, on the red tide microalga Prorocentrum donghaiense were evaluated in microcosms. Preliminary studies on the algicidal effects of one aqueous and four organic solvent extracts from the macroalgae on the microalga were carried out to confirm the existence of allelochemicals in the tissues of the macroalgae. The effects of macroalgal culture medium filtrate on P. donghaiense were investigated using initial or semi-continuous filtrate addition. Furthermore, the potential effects of the microalga on these three macroalgae were also tested. The results of the microcosm assay showed that the growth of P. donghaiense was strongly inhibited by using fresh tissues and dry powder of the three macroalgae. Both aqueous and methanol extracts of the macroalgae had strong growth inhibitory effects on P. donghaiense, while the other three organic solvent extracts (acetone, ether and chloroform) had no apparent effect on its growth; this suggested that the allelochemicals from these three macroalga had relatively high polarities. The three macroalgal culture medium filtrates exhibited apparent growth inhibitory effect on the microalgae under initial or semi-continuous addition, which suggested that the cells of P. donghaiense are sensitive to the allelochemicals. In contrast, P. donghaiense had no apparent effect on the growth of the macroalgae in coexistence experiment.

  8. Granular activated algae for wastewater treatment.


    Tiron, O; Bumbac, C; Patroescu, I V; Badescu, V R; Postolache, C


    The study used activated algae granules for low-strength wastewater treatment in sequential batch mode. Each treatment cycle was conducted within 24 h in a bioreactor exposed to 235 μmol/m²/s light intensity. Wastewater treatment was performed mostly in aerobic conditions, oxygen being provided by microalgae. High removal efficiency of chemical oxygen demand (COD) was achieved (86-98%) in the first hours of the reaction phase, during which the indicator's removal rate was 17.4 ± 3.9 mg O₂/g h; NH(4)(+) was removed during organic matter degradation processes with a rate of 1.8 ± 0.6 mg/g h. After almost complete COD removal, the (O⁺) remaining in the liquor was removed through nitrification processes promoted by the increase of the liquor's oxygen saturation (O₂%), the transformation rate of NH4(+) into NO(3)(-) increasing from 0.14 ± 0.05 to 1.5 ± 0.4 mg NH4(+)/g h, along with an O₂% increase. A wide removal efficiency was achieved in the case of PO(4)(3)(-) (11-85%), with the indicator's removal rate being 1.3 ± 0.7 mg/g h. In the provided optimum conditions, the occurrence of the denitrifying activity was also noticed. A large pH variation was registered (5-8.5) during treatment cycles. The granular activated algae system proved to be a promising alternative for wastewater treatment as it also sustains cost-efficient microalgae harvesting, with microalgae recovery efficiency ranging between 99.85 and 99.99% after granules settling with a velocity of 19 ± 3.6 m/h.

  9. The origin of red algae and the evolution of chloroplasts.


    Moreira, D; Le Guyader, H; Philippe, H


    Chloroplast structure and genome analyses support the hypothesis that three groups of organisms originated from the primary photosynthetic endosymbiosis between a cyanobacterium and a eukaryotic host: green plants (green algae + land plants), red algae and glaucophytes (for example, Cyanophora). Although phylogenies based on several mitochondrial genes support a specific green plants/red algae relationship, the phylogenetic analysis of nucleus-encoded genes yields inconclusive, sometimes contradictory results. To address this problem, we have analysed an alternative nuclear marker, elongation factor 2, and included new red algae and protist sequences. Here we provide significant support for a sisterhood of green plants and red algae. This sisterhood is also significantly supported by a multi-gene analysis of a fusion of 13 nuclear markers (5,171 amino acids). In addition, the analysis of an alternative fusion of 6 nuclear markers (1,938 amino acids) indicates that glaucophytes may be the closest relatives to the green plants/red algae group. Thus, our study provides evidence from nuclear markers for a single primary endosymbiosis at the origin of these groups, and supports a kingdom Plantae comprising green plants, red algae and glaucophytes.

  10. Isoprenoid biosynthesis in eukaryotic phototrophs: A spotlight on algae

    SciTech Connect

    Lohr M.; Schwender J.; Polle, J. E. W.


    Isoprenoids are one of the largest groups of natural compounds and have a variety of important functions in the primary metabolism of land plants and algae. In recent years, our understanding of the numerous facets of isoprenoid metabolism in land plants has been rapidly increasing, while knowledge on the metabolic network of isoprenoids in algae still lags behind. Here, current views on the biochemistry and genetics of the core isoprenoid metabolism in land plants and in the major algal phyla are compared and some of the most pressing open questions are highlighted. Based on the different evolutionary histories of the various groups of eukaryotic phototrophs, we discuss the distribution and regulation of the mevalonate (MVA) and the methylerythritol phosphate (MEP) pathways in land plants and algae and the potential consequences of the loss of the MVA pathway in groups such as the green algae. For the prenyltransferases, serving as gatekeepers to the various branches of terpenoid biosynthesis in land plants and algae, we explore the minimal inventory necessary for the formation of primary isoprenoids and present a preliminary analysis of their occurrence and phylogeny in algae with primary and secondary plastids. The review concludes with some perspectives on genetic engineering of the isoprenoid metabolism in algae.

  11. Algae biomass cultivation in nitrogen rich biogas digestate.


    Krustok, I; Diaz, J G; Odlare, M; Nehrenheim, E


    Because microalgae are known for quick biomass growth and nutrient uptake, there has been much interest in their use in research on wastewater treatment methods. While many studies have concentrated on the algal treatment of wastewaters with low to medium ammonium concentrations, there are several liquid waste streams with high ammonium concentrations that microalgae could potentially treat. The aim of this paper was to test ammonium tolerance of the indigenous algae community of Lake Mälaren and to use this mixed consortia of algae to remove nutrients from biogas digestate. Algae from Lake Mälaren were cultivated in Jaworski's Medium containing a range of ammonium concentrations and the resulting algal growth was determined. The algae were able to grow at NH4-N concentrations of up to 200 mg L(-1) after which there was significant inhibition. To test the effectiveness of the lake water algae on the treatment of biogas digestate, different pre-cultivation set-ups and biogas digestate concentrations were tested. It was determined that mixing pre-cultivated suspension algae with 25% of biogas digestate by volume, resulting in an ammonium concentration of around 300 mg L(-1), produced the highest algal growth. The algae were effective in removing 72.8±2.2% of NH4-N and 41.4±41.4% of PO4-P. PMID:26540532

  12. Biomass of algae growth on natural water medium.


    Ramaraj, Rameshprabu; Tsai, David Dah-Wei; Chen, Paris Honglay


    Algae are the dominant primary producers in aquatic ecosystems. Since algae are highly varied group organisms, which have important functions in ecosystem, and their biomass is an essential biological resource. Currently, algae have been applied increasingly to diverse range of biomass applications. Therefore, this study was aimed to investigate the ecological algae features of microalgal production by natural medium, ecological function by lab scale of the symbiotic reactor which is imitated nature ecosystem, and atmospheric CO2 absorption that was related the algal growth of biomass to understand algae in natural water body better. Consequently, this study took advantages of using the unsupplemented freshwater natural medium to produce microalgae. Algal biomass by direct measurement of total suspended solids (TSS) and volatile suspended solids (VSS) resulted as 0.14g/L and 0.08g/L respectively. The biomass measurements of TSS and VSS are the sensible biomass index for algae production. The laboratory results obtained in the present study proved the production of algae by the natural water medium is potentially feasible.

  13. Algae biomass cultivation in nitrogen rich biogas digestate.


    Krustok, I; Diaz, J G; Odlare, M; Nehrenheim, E


    Because microalgae are known for quick biomass growth and nutrient uptake, there has been much interest in their use in research on wastewater treatment methods. While many studies have concentrated on the algal treatment of wastewaters with low to medium ammonium concentrations, there are several liquid waste streams with high ammonium concentrations that microalgae could potentially treat. The aim of this paper was to test ammonium tolerance of the indigenous algae community of Lake Mälaren and to use this mixed consortia of algae to remove nutrients from biogas digestate. Algae from Lake Mälaren were cultivated in Jaworski's Medium containing a range of ammonium concentrations and the resulting algal growth was determined. The algae were able to grow at NH4-N concentrations of up to 200 mg L(-1) after which there was significant inhibition. To test the effectiveness of the lake water algae on the treatment of biogas digestate, different pre-cultivation set-ups and biogas digestate concentrations were tested. It was determined that mixing pre-cultivated suspension algae with 25% of biogas digestate by volume, resulting in an ammonium concentration of around 300 mg L(-1), produced the highest algal growth. The algae were effective in removing 72.8±2.2% of NH4-N and 41.4±41.4% of PO4-P.

  14. [Seasonal variation characteristics of algae biomass in Chaohu Lake].


    Jiang, Xia; Wang, Shu-Hang; Zhong, Li-Xiang; Jin, Xiang-Can; Sun, Shi-Qun


    The biomass and distribution of algae community in Chaohu Lake were investigated in 2008. At the same time, the seasonal variations of algae translocation between the sediment and overlying water were also quantitative studied by self-made "algae up/down trap". Chaohu Lake was dominated by Cyanobacteria all the year, and dominant Cyanobacteria species changed in different seasons. In spring, Anabaena was the dominant species, and Microcystis was the subdominant species; In the whole summer and autumn, the dominant species is Microcystis. Algae biomass increased significantly from May and the maximum appeared in August, was 146.37 mg x m(-3) with Chl-a. The value of algae biomass were 9.75-16.24 mg x kg(-1) in the surface sediments, and the minimum appeared in Summer, then the algae biomass increased gradually with the maximum value in winter. Translocation process between the sediment and the overlying water occurred throughout the study period. The recruitment rates increased at first with the maximum rates in early August, was 0.036 8 mg x (m2 x d) (-1), and then had a downward tendency. However the sedimentation rates increased slowly firstly with the maximum rate in early September, then it decreased sharply, was 0.032 1 mg x (m2 x d)(-1). Multiple stepwise regression showed that temperature was the most significant factor for the algae biomass in Chaohu Lake, Total nitrogen (TN) and Total phosphorus(TP) are sub-important factors.

  15. Photophysiology and cellular composition of sea ice algae

    SciTech Connect

    Lizotte, M.P.


    The productivity of sea ice algae depends on their physiological capabilities and the environmental conditions within various microhabitats. Pack ice is the dominant form of sea ice, but the photosynthetic activity of associated algae has rarely been studied. Biomass and photosynthetic rates of ice algae of the Weddell-Scotia Sea were investigated during autumn and winter, the period when ice cover grows from its minimum to maximum. Biomass-specific photosynthetic rates typically ranged from 0.3 to 3.0 {mu}g C {center dot} {mu}g chl{sup {minus}1} {center dot} h{sup {minus}1} higher than land-fast ice algae but similar to Antarctic phytoplankton. Primary production in the pack ice during winter may be minor compared to annual phytoplankton production, but could represent a vital seasonal contribution to the Antarctic ecosystem. Nutrient supply may limit the productivity of ice algae. In McMurdo Sound, congelation ice algae appeared to be more nutrient deficient than underlying platelet ice algae based on: lower nitrogen:carbon, chlorophyll:carbon, and protein:carbohydrate; and {sup 14}C-photosynthate distribution to proteins and phospholipids was lower, while distribution to polysaccharides and neutral lipids was higher. Depletion of nitrate led to decreased nitrogen:carbon, chlorophyll:carbon, protein:carbohydrate, and {sup 14}C-photosynthate to proteins. Studied were conducted during the spring bloom; therefore, nutrient limitation may only apply to dense ice algal communities. Growth limiting conditions may be alleviated when algae are released into seawater during the seasonal recession of the ice cover. To continue growth, algae must adapt to the variable light field encountered in a mixed water column. Photoadaptation was studied in surface ice communities and in bottom ice communities.

  16. Activated chemical defenses suppress herbivory on freshwater red algae.


    Goodman, Keri M; Hay, Mark E


    The rapid life cycles of freshwater algae are hypothesized to suppress selection for chemical defenses against herbivores, but this notion remains untested. Investigations of chemical defenses are rare for freshwater macrophytes and absent for freshwater red algae. We used crayfish to assess the palatability of five freshwater red algae relative to a palatable green alga and a chemically defended aquatic moss. We then assessed the roles of structural, nutritional, and chemical traits in reducing palatability. Both native and non-native crayfish preferred the green alga Cladophora glomerata to four of the five red algae. Batrachospermum helminthosum, Kumanoa holtonii, and Tuomeya americana employed activated chemical defenses that suppressed feeding by 30-60 % following damage to algal tissues. Paralemanea annulata was defended by its cartilaginous structure, while Boldia erythrosiphon was palatable. Activated defenses are thought to reduce ecological costs by expressing potent defenses only when actually needed; thus, activation might be favored in freshwater red algae whose short-lived gametophytes must grow and reproduce rapidly over a brief growing season. The frequency of activated chemical defenses found here (three of five species) is 3-20× higher than for surveys of marine algae or aquatic vascular plants. If typical for freshwater red algae, this suggests that (1) their chemical defenses may go undetected if chemical activation is not considered and (2) herbivory has been an important selective force in the evolution of freshwater Rhodophyta. Investigations of defenses in freshwater rhodophytes contribute to among-system comparisons and provide insights into the generality of plant-herbivore interactions and their evolution.

  17. Photobiological hydrogen production with switchable photosystem-II designer algae


    Lee, James Weifu


    A process for enhanced photobiological H.sub.2 production using transgenic alga. The process includes inducing exogenous genes in a transgenic alga by manipulating selected environmental factors. In one embodiment inducing production of an exogenous gene uncouples H.sub.2 production from existing mechanisms that would downregulate H.sub.2 production in the absence of the exogenous gene. In other embodiments inducing an exogenous gene triggers a cascade of metabolic changes that increase H.sub.2 production. In some embodiments the transgenic alga are rendered non-regenerative by inducing exogenous transgenes for proton channel polypeptides that are targeted to specific algal membranes.

  18. Application of synthetic biology in cyanobacteria and algae

    PubMed Central

    Wang, Bo; Wang, Jiangxin; Zhang, Weiwen; Meldrum, Deirdre R.


    Cyanobacteria and algae are becoming increasingly attractive cell factories for producing renewable biofuels and chemicals due to their ability to capture solar energy and CO2 and their relatively simple genetic background for genetic manipulation. Increasing research efforts from the synthetic biology approach have been made in recent years to modify cyanobacteria and algae for various biotechnological applications. In this article, we critically review recent progresses in developing genetic tools for characterizing or manipulating cyanobacteria and algae, the applications of genetically modified strains for synthesizing renewable products such as biofuels and chemicals. In addition, the emergent challenges in the development and application of synthetic biology for cyanobacteria and algae are also discussed. PMID:23049529

  19. Evaluation of filamentous green algae as feedstocks for biofuel production.


    Zhang, Wei; Zhao, Yonggang; Cui, Binjie; Wang, Hui; Liu, Tianzhong


    Compared with unicellular microalgae, filamentous algae have high resistance to grazer-predation and low-cost recovery in large-scale production. Green algae, as the most diverse group of algae, included numerous filamentous genera and species. In this study, records of filamentous genera and species in green algae were firstly censused and classified. Then, seven filamentous strains subordinated in different genera were cultivated in bubbled-column to investigate their growth rate and energy molecular (lipid and starch) capacity. Four strains including Stigeoclonium sp., Oedogonium nodulosum, Hormidium sp. and Zygnema extenue were screened out due to their robust growth. And they all could accumulate triacylglycerols and starch in their biomass, but with different capacity. After nitrogen starvation, Hormidium sp. and Oedogonium nodulosum respectively exhibited high capacity of lipid (45.38% in dry weight) and starch (46.19% in dry weight) accumulation, which could be of high potential as feedstocks for biodiesel and bioethanol production. PMID:27598569

  20. Colourful Cultures: Classroom Experiments with the Unicellular Alga Haematococcus pluvialis.

    ERIC Educational Resources Information Center

    Delpech, Roger


    Describes an investigation into the photosynthetic potential of the different developmental stages of the green unicellular alga Haematococcus pluvialis. Reviews the biotechnological applications of astaxanthin, the red pigment which can be extracted from Haematococcus pluvialis. (Author/MM)

  1. Bicarbonate produced from carbon capture for algae culture.


    Chi, Zhanyou; O'Fallon, James V; Chen, Shulin


    Using captured CO(2) to grow microalgae is limited by the high cost of CO(2) capture and transportation, as well as significant CO(2) loss during algae culture. Moreover, algae grow poorly at night, but CO(2) cannot be temporarily stored until sunrise. To address these challenges, we discuss a process where CO(2) is captured as bicarbonate and used as feedstock for algae culture, and the carbonate regenerated by the culture process is used as an absorbent to capture more CO(2). This process would significantly reduce carbon capture costs because it does not require additional energy for carbonate regeneration. Furthermore, not only would transport of the aqueous bicarbonate solution cost less than for that of compressed CO(2), but using bicarbonate would also provide a superior alternative for CO(2) delivery to an algae culture system.


    EPA Science Inventory

    Bio-Recovery Systems, Inc. conducted a project under the Emerging Technology portion of the United States Environmental Protection Agency (EPAs) Superfund Innovative Technology Evaluation (SITE) Program to evaluate the ability of immobilized algae to adsorb mercury from contamina...

  3. Harmful algae blooms removal from fresh water with modified vermiculite.


    Miao, Chunguang; Tang, Yi; Zhang, Hong; Wu, Zhengyan; Wang, Xiangqin


    Vermiculite and vermiculite modified with hydrochloric acid were investigated to evaluate their flocculation efficiencies in freshwater containing harmful algae blooms (HABs) (Microcystis aeruginosa). Scanning electron microscope, Fourier transform infrared spectroscopy, X-ray diffraction, converted fluorescence microscope, plasma-atomic emission spectrometry, and Zetasizer were used to study the flocculation mechanism of modified vermiculite. It was found that the vermiculite modified with hydrochloric acid could coagulate algae cells through charge neutralization, chemical bridging, and netting effect. The experimental results show that the efficiency of flocculation can be notably improved by modified vermiculite. Ninety-eight per cent of algae cells in algae solution could be removed within 10 min after the addition ofmodified vermiculite clay. The method that removal of HABs with modified vermiculite is economical with high efficiency, and more research is needed to assess their ecological impacts before using in practical application.

  4. Evaluation of filamentous green algae as feedstocks for biofuel production.


    Zhang, Wei; Zhao, Yonggang; Cui, Binjie; Wang, Hui; Liu, Tianzhong


    Compared with unicellular microalgae, filamentous algae have high resistance to grazer-predation and low-cost recovery in large-scale production. Green algae, as the most diverse group of algae, included numerous filamentous genera and species. In this study, records of filamentous genera and species in green algae were firstly censused and classified. Then, seven filamentous strains subordinated in different genera were cultivated in bubbled-column to investigate their growth rate and energy molecular (lipid and starch) capacity. Four strains including Stigeoclonium sp., Oedogonium nodulosum, Hormidium sp. and Zygnema extenue were screened out due to their robust growth. And they all could accumulate triacylglycerols and starch in their biomass, but with different capacity. After nitrogen starvation, Hormidium sp. and Oedogonium nodulosum respectively exhibited high capacity of lipid (45.38% in dry weight) and starch (46.19% in dry weight) accumulation, which could be of high potential as feedstocks for biodiesel and bioethanol production.

  5. Photobiological hydrogen production in green algae and photosynthetic bacteria

    SciTech Connect

    Greenbaum, E.


    We have shown that, under appropriate physiological conditions, certain freshwater and marine green algae are capable of splitting water to molecular hydrogen and oxygen in a sustained steady-state reaction. In these algae, the gaseous-fuel-producing reaction can be driven by light throughout the visible portion of the solar emission spectrum, including the long wavelength (red) 700-nm region. No external energy sources are required.

  6. Algae Reefs in Shark Bay, Western Australia, Australia

    NASA Technical Reports Server (NTRS)


    Numerous algae reefs are seen in Shark Bay, Western Australia, Australia (26.0S, 113.5E) especially in the southern portions of the bay. The south end is more saline because tidal flow in and out of the bay is restricted by sediment deposited at the north and central end of the bay opposite the mouth of the Wooramel River. This extremely arid region produces little sediment runoff so that the waters are very clear, saline and rich in algae.

  7. An overview of algae biofuel production and potential environmental impact.


    Menetrez, Marc Y


    Algae are among the most potentially significant sources of sustainable biofuels in the future of renewable energy. A feedstock with virtually unlimited applicability, algae can metabolize various waste streams (e.g., municipal wastewater, carbon dioxide from industrial flue gas) and produce products with a wide variety of compositions and uses. These products include lipids, which can be processed into biodiesel; carbohydrates, which can be processed into ethanol; and proteins, which can be used for human and animal consumption. Algae are commonly genetically engineered to allow for advantageous process modification or optimization. However, issues remain regarding human exposure to algae-derived toxins, allergens, and carcinogens from both existing and genetically modified organisms (GMOs), as well as the overall environmental impact of GMOs. A literature review was performed to highlight issues related to the growth and use of algal products for generating biofuels. Human exposure and environmental impact issues are identified and discussed, as well as current research and development activities of academic, commercial, and governmental groups. It is hoped that the ideas contained in this paper will increase environmental awareness of issues surrounding the production of algae and will help the algae industry develop to its full potential. PMID:22681590

  8. Development of Green Fuels From Algae - The University of Tulsa

    SciTech Connect

    Crunkleton, Daniel; Price, Geoffrey; Johannes, Tyler; Cremaschi, Selen


    The general public has become increasingly aware of the pitfalls encountered with the continued reliance on fossil fuels in the industrialized world. In response, the scientific community is in the process of developing non-fossil fuel technologies that can supply adequate energy while also being environmentally friendly. In this project, we concentrate on green fuels which we define as those capable of being produced from renewable and sustainable resources in a way that is compatible with the current transportation fuel infrastructure. One route to green fuels that has received relatively little attention begins with algae as a feedstock. Algae are a diverse group of aquatic, photosynthetic organisms, generally categorized as either macroalgae (i.e. seaweed) or microalgae. Microalgae constitute a spectacularly diverse group of prokaryotic and eukaryotic unicellular organisms and account for approximately 50% of global organic carbon fixation. The PI's have subdivided the proposed research program into three main research areas, all of which are essential to the development of commercially viable algae fuels compatible with current energy infrastructure. In the fuel development focus, catalytic cracking reactions of algae oils is optimized. In the species development project, genetic engineering is used to create microalgae strains that are capable of high-level hydrocarbon production. For the modeling effort, the construction of multi-scaled models of algae production was prioritized, including integrating small-scale hydrodynamic models of algae production and reactor design and large-scale design optimization models.

  9. Extraction of mercury from ground-water using immobilized algae

    SciTech Connect

    Barkley, N.P.


    Bio-recovery Systems Inc., conducted a project under the Emerging Technology portion of the United States Environmental Protection Agency's (EPAs) Superfund Innovative Technology Evaluation (SITE) Program to evaluate the ability of immobilized algae to absorb mercury from contaminated groundwater in laboratory studies and pilot-scale field tests. Algae biomass was incorporated in a permeable polymeric matrix. The product, AlgaSORB, packed into absorption columns, exhibited excellent flow characteristics, and functioned as a 'biological' ion exchange resin. A sequence of eleven laboratory tests demonstrated the ability of the product to absorb mercury from groundwater that contained high levels of total dissolved solids and hard water components. However, use of a single AlgaSORB preparation yielded non-repeatable results with samples collected at different times of the year. The strategy of extracting the groundwater through two columns containing different times of the year. The strategy of extracting the groundwater through two columns containing different preparations of AlgaSORB was developed and proved successful in laboratory and pilot-scale field tests. Field test results indicate that AlgaSORB could be economically competitive with ion exchange resins for removal of mercury, with the advantage that hardness and other dissolved solids do not appear to compete with heavy metals for binding capacity. (Copyright (c) 1991--Air and Waste Management Association.)

  10. Study on algae removal by immobilized biosystem on sponge

    NASA Astrophysics Data System (ADS)

    Pei, Haiyan; Hu, Wenrong


    In this study, sponges were used to immobilize domesticated sludge microbes in a limited space, forming an immobilized biosystem capable of algae and microcystins removal. The removal effects on algae, microcystins and UV260 of this biosystem and the mechanism of algae removal were studied. The results showed that active sludge from sewage treatment plants was able to remove algae from a eutrophic lake’s water after 7 d of domestication. The removal efficiency for algae, organic matter and microcystins increased when the domesticated sludge was immobilized on sponges. When the hydraulic retention time (HRT) was 5h, the removal rates of algae, microcystins and UV260 were 90%, 94.17% and 84%, respectively. The immobilized biosystem consisted mostly of bacteria, the Ciliata and Sarcodina protozoans and the Rotifer metazoans. Algal decomposition by zoogloea bacteria and preying by microcreatures were the two main modes of algal removal, which occurred in two steps: first, absorption by the zoogloea; second, decomposition by the zoogloea bacteria and the predacity of the microcreatures.

  11. Modelling the effect of fluctuating herbicide concentrations on algae growth.


    Copin, Pierre-Jean; Coutu, Sylvain; Chèvre, Nathalie


    Herbicide concentrations fluctuate widely in watercourses after crop applications and rain events. The level of concentrations in pulses can exceed the water chronic quality criteria. In the present study, we proposed modelling the effects of successive pulse exposure on algae. The deterministic model proposed is based on two parameters: (i) the typical growth rate of the algae, obtained by monitoring growth rates of several successive batch cultures in growth media, characterizing both the growth of the control and during the recovery periods; (ii) the growth rate of the algae exposed to pulses, determined from a dose-response curve obtained with a standard toxicity test. We focused on the herbicide isoproturon and on the freshwater alga Scenedesmus vacuolatus, and we validated the model prediction based on effect measured during five sequential pulse exposures in laboratory. The comparison between the laboratory and the modelled effects illustrated that the results yielded were consistent, making the model suitable for effect prediction of the herbicide photosystem II inhibitor isoproturon on the alga S. vacuolatus. More generally, modelling showed that both pulse duration and level of concentration play a crucial role. The application of the model to a real case demonstrated that both the highest peaks and the low peaks with a long duration affect principally the cell density inhibition of the alga S. vacuolatus. It is therefore essential to detect these characteristic pulses when monitoring of herbicide concentrations are conducted in rivers. PMID:25499055

  12. An overview of algae biofuel production and potential environmental impact.


    Menetrez, Marc Y


    Algae are among the most potentially significant sources of sustainable biofuels in the future of renewable energy. A feedstock with virtually unlimited applicability, algae can metabolize various waste streams (e.g., municipal wastewater, carbon dioxide from industrial flue gas) and produce products with a wide variety of compositions and uses. These products include lipids, which can be processed into biodiesel; carbohydrates, which can be processed into ethanol; and proteins, which can be used for human and animal consumption. Algae are commonly genetically engineered to allow for advantageous process modification or optimization. However, issues remain regarding human exposure to algae-derived toxins, allergens, and carcinogens from both existing and genetically modified organisms (GMOs), as well as the overall environmental impact of GMOs. A literature review was performed to highlight issues related to the growth and use of algal products for generating biofuels. Human exposure and environmental impact issues are identified and discussed, as well as current research and development activities of academic, commercial, and governmental groups. It is hoped that the ideas contained in this paper will increase environmental awareness of issues surrounding the production of algae and will help the algae industry develop to its full potential.

  13. Radionuclides and trace metals in eastern Mediterranean Sea algae.


    Al-Masri, M S; Mamish, S; Budier, Y


    Three types of sea alga distributed along the Syrian coast have been collected and analyzed for radioactivity and trace elements. Results have shown that (137)Cs concentrations in all the analyzed sample were relatively low (less than 1.2 Bq kg(-1) dry weight) while the levels of naturally occurring radionuclides, such as (210)Po and (210)Pb, were found to be high in most samples; the highest observed value (27.43 Bq kg(-1) dry weight) for (210)Po being in the red Jania longifurca alga. In addition, most brown alga species were also found to accumulate (210)Po, which indicates their selectivity to this isotope. On the other hand, brown alga (Cystoseira and Sargassum Vulgare) have shown a clear selectivity for some trace metals such as Cr, As, Cu and Co, this selectivity may encourage their use as biomonitor for pollution by trace metals. Moreover, the red alga species were found to contain the highest levels of Mg while the brown alga species were found to concentrate Fe, Mn, Na and K and nonmetals such as Cl, I and Br. PMID:12660047

  14. Phosphorus-limited growth of a green alga and a blue-green alga

    SciTech Connect

    Lang, D.S.; Brown, E.J.


    The phosphorus-limited growth kinetics of the chlorophyte Scenedesmus quadricauda and the cyanophyte Synechococcus Nageli were studied by using batch and continuous culturing techniques. The steady-state phosphate transport capability and the phosphorus storage capacity is higher in S. Nageli than in S. quadricauda. Synechococcus Nageli can also deplete phosphate to much lower levels than can S. quadricauda. These results, along with their morphological characteristics, were used to construct partial physiological profiles for each organism. The profiles indicate that this unicellular cyanophyte (cyanobacterium) is better suited for growth in phosphorus-limited oligotrophic niches than is this chlorophyte (green alga). (Refs. 44).

  15. Comparative Transcriptome Analysis of Four Prymnesiophyte Algae

    PubMed Central

    Koid, Amy E.; Liu, Zhenfeng; Terrado, Ramon; Jones, Adriane C.; Caron, David A.; Heidelberg, Karla B.


    Genomic studies of bacteria, archaea and viruses have provided insights into the microbial world by unveiling potential functional capabilities and molecular pathways. However, the rate of discovery has been slower among microbial eukaryotes, whose genomes are larger and more complex. Transcriptomic approaches provide a cost-effective alternative for examining genetic potential and physiological responses of microbial eukaryotes to environmental stimuli. In this study, we generated and compared the transcriptomes of four globally-distributed, bloom-forming prymnesiophyte algae: Prymnesium parvum, Chrysochromulina brevifilum, Chrysochromulina ericina and Phaeocystis antarctica. Our results revealed that the four transcriptomes possess a set of core genes that are similar in number and shared across all four organisms. The functional classifications of these core genes using the euKaryotic Orthologous Genes (KOG) database were also similar among the four study organisms. More broadly, when the frequencies of different cellular and physiological functions were compared with other protists, the species clustered by both phylogeny and nutritional modes. Thus, these clustering patterns provide insight into genomic factors relating to both evolutionary relationships as well as trophic ecology. This paper provides a novel comparative analysis of the transcriptomes of ecologically important and closely related prymnesiophyte protists and advances an emerging field of study that uses transcriptomics to reveal ecology and function in protists. PMID:24926657

  16. Microfluidic one-way streets for algae

    NASA Astrophysics Data System (ADS)

    Dunkel, Jorn; Kantsler, Vasily; Polin, Marco; Goldstein, Raymond E.


    Controlling locomotion and transport of microorganisms is a key challenge in the development of future biotechnological applications. Here, we demonstrate the use of optimized microfluidic ratchets to rectify the mean swimming direction in suspensions of the unicellular green alga Chlamydomonas reinhardtii, which is a promising candidate for the photosynthetic production of hydrogen. To assess the potential of microfluidic barriers for the manipulation of algal swimming, we studied first the scattering of individual C. reinhardtii from solid boundaries. High-speed imaging reveals the surprising result that these quasi-spherical ``puller''-type microswimmers primarily interact with surfaces via direct flagellar contact, whereas hydrodynamic effects play a subordinate role. A minimal theoretical model, based on run-and-turn motion and the experimentally measured surface-scattering law, predicts the existence of optimal wedge-shaped ratchets that maximize rectification of initially uniform suspensions. We confirm this prediction in experimental measurements with different geometries. Since the mechano-elastic properties of eukaryotic flagella are conserved across many genera, we expect that our results and methods are applicable to a broad class of biflagellate microorganisms.

  17. Mixotrophy in red tide algae raphidophytes.


    Jeong, Hae Jin


    Marine raphidophytes are common red tide organisms that are distributed worldwide. They are known to be harmful to other plankton and fish and have often caused large-scale fish mortality in many countries. Thus, the population dynamics of raphidophytes is a critical concern for scientists, the aquaculture industry, and government officers from many countries. Raphidophyte growth and mortality should be investigated to understand bloom dynamics. Raphidophytes were thought to be exclusively autotrophic organisms. However, several recent studies have revealed that raphidophytes are able to feed on heterotrophic and autotrophic bacteria, i.e. raphidophytes are mixotrophic algae. Further, high-resolution video microscopy has revealed the mechanism by which raphidophytes feed on bacteria, which involves capturing prey cells in the mucus excreted by mucocysts and engulfing the cells through mucocysts. These discoveries may influence the conventional view on both raphidophyte bloom dynamics and plankton energy flow and carbon cycling. In the present study, I review prey, feeding mechanisms, and ingestion rates of mixotrophic marine raphidophytes. In addition, I examine the ecological significance of raphidophyte mixotrophy.

  18. Comparative transcriptome analysis of four prymnesiophyte algae.


    Koid, Amy E; Liu, Zhenfeng; Terrado, Ramon; Jones, Adriane C; Caron, David A; Heidelberg, Karla B


    Genomic studies of bacteria, archaea and viruses have provided insights into the microbial world by unveiling potential functional capabilities and molecular pathways. However, the rate of discovery has been slower among microbial eukaryotes, whose genomes are larger and more complex. Transcriptomic approaches provide a cost-effective alternative for examining genetic potential and physiological responses of microbial eukaryotes to environmental stimuli. In this study, we generated and compared the transcriptomes of four globally-distributed, bloom-forming prymnesiophyte algae: Prymnesium parvum, Chrysochromulina brevifilum, Chrysochromulina ericina and Phaeocystis antarctica. Our results revealed that the four transcriptomes possess a set of core genes that are similar in number and shared across all four organisms. The functional classifications of these core genes using the euKaryotic Orthologous Genes (KOG) database were also similar among the four study organisms. More broadly, when the frequencies of different cellular and physiological functions were compared with other protists, the species clustered by both phylogeny and nutritional modes. Thus, these clustering patterns provide insight into genomic factors relating to both evolutionary relationships as well as trophic ecology. This paper provides a novel comparative analysis of the transcriptomes of ecologically important and closely related prymnesiophyte protists and advances an emerging field of study that uses transcriptomics to reveal ecology and function in protists.

  19. Is the Future Really in Algae?

    NASA Technical Reports Server (NTRS)

    Trent, Jonathan


    Having just emerged from the warmest decade on record and watching as the oceans acidify, global resources peak, the world's population continues to climb, and nearly half of all known species face extinction by the end of the century. We stand on the threshold of one of the most important transition in human history-the transition from hunting-and-gathering our energy to cultivating sustainable, carbon-neutral, environmentally-friendly energy supplies. Can we "cultivate" enerm without competing with agriculture for land, freshwater, or fertilizer? Can we develop an "ecology of technology" that optimizes our use of limited resources? Is human activity compatible with improved conditions in the world's oceans? Will our ingenuity prevail in time to make a difference for our children and the children of all species? With support from NASA ARMD and the California Energy Commission, a group of dedicated scientists and engineers are working on a project called OMEGA (Offshore Membrane Enclosures for Growing Algae), to provide practical answers to these critical questions and to leave a legacy of hope for the oceans and for the future.

  20. Potential use of green macroalgae Ulva lactuca as a feed supplement in diets on growth performance, feed utilization and body composition of the African catfish, Clarias gariepinus

    PubMed Central

    Abdel-Warith, Abdel-Wahab A.; Younis, El-Sayed M.I.; Al-Asgah, Nasser A.


    This study aimed to evaluate the effects of diet containing the green macroalgae, Ulva lactuca, on the growth performance, feed utilization and body composition of African catfish Clarias gariepinus. Four experimental diets were formulated: D1 as a control group and D2, D3 and D4 which included 10%, 20% and 30% U. lactuca meal, respectively. 180 African catfish, weighing 9.59 ± 0.43 g, and with an average length of 11.26 ± 0.21, (mean ± SE) were divided into four groups corresponding to the different feeding regimes. The final body weight of the fish showed insignificant differences (P > 0.05) between the control and fish fed D2, whereas, there was a significant difference (P < 0.05) between these two diets compared with D3 and D4, with weights of 70.52, 60.92, 40.57 and 35.66 g recorded for D1, D2, D3 and D4, respectively. In the same trend significant differences were also evident in weight gain, specific growth rate and feed utilization. Fish fed with a diet containing 20% or 30% U. lactuca meal had poorer growth performance and feed utilization. Protein productive value, protein efficiency ratio, daily dry feed intake and total feed intake were also significantly lower in fish fed with D3 and D4 than in the control D1 and D2. Overall, the results of the experiment revealed that African catfish fed a diet with U. lactuca included at 20% and 30% levels showed poorer growth and feed utilization than the control group and fish fed diets containing 10% of U. lactuca. PMID:27081367

  1. Two-step evolution of endosymbiosis between hydra and algae.


    Ishikawa, Masakazu; Shimizu, Hiroshi; Nozawa, Masafumi; Ikeo, Kazuho; Gojobori, Takashi


    In the Hydra vulgaris group, only 2 of the 25 strains in the collection of the National Institute of Genetics in Japan currently show endosymbiosis with green algae. However, whether the other non-symbiotic strains also have the potential to harbor algae remains unknown. The endosymbiotic potential of non-symbiotic strains that can harbor algae may have been acquired before or during divergence of the strains. With the aim of understanding the evolutionary process of endosymbiosis in the H. vulgaris group, we examined the endosymbiotic potential of non-symbiotic strains of the H. vulgaris group by artificially introducing endosymbiotic algae. We found that 12 of the 23 non-symbiotic strains were able to harbor the algae until reaching the grand-offspring through the asexual reproduction by budding. Moreover, a phylogenetic analysis of mitochondrial genome sequences showed that all the strains with endosymbiotic potential grouped into a single cluster (cluster γ). This cluster contained two strains (J7 and J10) that currently harbor algae; however, these strains were not the closest relatives. These results suggest that evolution of endosymbiosis occurred in two steps; first, endosymbiotic potential was gained once in the ancestor of the cluster γ lineage; second, strains J7 and J10 obtained algae independently after the divergence of the strains. By demonstrating the evolution of the endosymbiotic potential in non-symbiotic H. vulgaris group strains, we have clearly distinguished two evolutionary steps. The step-by-step evolutionary process provides significant insight into the evolution of endosymbiosis in cnidarians. PMID:27404042

  2. Two-step evolution of endosymbiosis between hydra and algae.


    Ishikawa, Masakazu; Shimizu, Hiroshi; Nozawa, Masafumi; Ikeo, Kazuho; Gojobori, Takashi


    In the Hydra vulgaris group, only 2 of the 25 strains in the collection of the National Institute of Genetics in Japan currently show endosymbiosis with green algae. However, whether the other non-symbiotic strains also have the potential to harbor algae remains unknown. The endosymbiotic potential of non-symbiotic strains that can harbor algae may have been acquired before or during divergence of the strains. With the aim of understanding the evolutionary process of endosymbiosis in the H. vulgaris group, we examined the endosymbiotic potential of non-symbiotic strains of the H. vulgaris group by artificially introducing endosymbiotic algae. We found that 12 of the 23 non-symbiotic strains were able to harbor the algae until reaching the grand-offspring through the asexual reproduction by budding. Moreover, a phylogenetic analysis of mitochondrial genome sequences showed that all the strains with endosymbiotic potential grouped into a single cluster (cluster γ). This cluster contained two strains (J7 and J10) that currently harbor algae; however, these strains were not the closest relatives. These results suggest that evolution of endosymbiosis occurred in two steps; first, endosymbiotic potential was gained once in the ancestor of the cluster γ lineage; second, strains J7 and J10 obtained algae independently after the divergence of the strains. By demonstrating the evolution of the endosymbiotic potential in non-symbiotic H. vulgaris group strains, we have clearly distinguished two evolutionary steps. The step-by-step evolutionary process provides significant insight into the evolution of endosymbiosis in cnidarians.

  3. Plasticity predicts evolution in a marine alga.


    Schaum, C Elisa; Collins, Sinéad


    Under global change, populations have four possible responses: 'migrate, acclimate, adapt or die' (Gienapp et al. 2008 Climate change and evolution: disentangling environmental and genetic response. Mol. Ecol. 17, 167-178. (doi:10.1111/j.1365-294X.2007.03413.x)). The challenge is to predict how much migration, acclimatization or adaptation populations are capable of. We have previously shown that populations from more variable environments are more plastic (Schaum et al. 2013 Variation in plastic responses of a globally distributed picoplankton species to ocean acidification. Nature 3, 298-230. (doi:10.1038/nclimate1774)), and here we use experimental evolution with a marine microbe to learn that plastic responses predict the extent of adaptation in the face of elevated partial pressure of CO2 (pCO2). Specifically, plastic populations evolve more, and plastic responses in traits other than growth can predict changes in growth in a marine microbe. The relationship between plasticity and evolution is strongest when populations evolve in fluctuating environments, which favour the evolution and maintenance of plasticity. Strikingly, plasticity predicts the extent, but not direction of phenotypic evolution. The plastic response to elevated pCO2 in green algae is to increase cell division rates, but the evolutionary response here is to decrease cell division rates over 400 generations until cells are dividing at the same rate their ancestors did in ambient CO2. Slow-growing cells have higher mitochondrial potential and withstand further environmental change better than faster growing cells. Based on this, we hypothesize that slow growth is adaptive under CO2 enrichment when associated with the production of higher quality daughter cells.

  4. Electrophysiology of turgor regulation in marine siphonous green algae.


    Bisson, M A; Beilby, M J; Shepherd, V A


    We review electrophysiological measures of turgor regulation in some siphonous green algae, primarily the giant-celled marine algae, Valonia and Ventricaria, with particular comparison to the well studied charophyte algae Chara and Lamprothamnium. The siphonous green algae have a less negative plasma membrane potential, and are unlikely to have a proton-based chemiosmotic transport system, dominated by active electrogenic K(+) uptake. We also make note of the unusual cellular structure of the siphonous green algae. Hypertonic stress, due to increased external osmotic pressure, is accompanied by positive-going potential difference (PD), increase in conductance, and slow turgor regulation. The relationship between these is not yet resolved, but may involve changes in K(+ )conductance (G (K)) or active K(+) transport at both membranes. Hypotonic turgor regulation, in response to decreased external osmotic pressure, is approximately 3 times faster than hypertonic turgor regulation. It is accompanied by a negative-going PD, although conductance also increases. The conductance increase and the magnitude of the PD change are strongly correlated with the magnitude of hypotonic stress.

  5. Anti-Phytopathogenic Activities of Macro-Algae Extracts

    PubMed Central

    Jiménez, Edra; Dorta, Fernando; Medina, Cristian; Ramírez, Alberto; Ramírez, Ingrid; Peña-Cortés, Hugo


    Aqueous and ethanolic extracts obtained from nine Chilean marine macro-algae collected at different seasons were examined in vitro and in vivo for properties that reduce the growth of plant pathogens or decrease the injury severity of plant foliar tissues following pathogen infection. Particular crude aqueous or organic extracts showed effects on the growth of pathogenic bacteria whereas others displayed important effects against pathogenic fungi or viruses, either by inhibiting fungal mycelia growth or by reducing the disease symptoms in leaves caused by pathogen challenge. Organic extracts obtained from the brown-alga Lessonia trabeculata inhibited bacterial growth and reduced both the number and size of the necrotic lesion in tomato leaves following infection with Botrytis cinerea. Aqueous and ethanolic extracts from the red-alga Gracillaria chilensis prevent the growth of Phytophthora cinnamomi, showing a response which depends on doses and collecting-time. Similarly, aqueous and ethanolic extracts from the brown-alga Durvillaea antarctica were able to diminish the damage caused by tobacco mosaic virus (TMV) in tobacco leaves, and the aqueous procedure is, in addition, more effective and seasonally independent. These results suggest that macro-algae contain compounds with different chemical properties which could be considered for controlling specific plant pathogens. PMID:21673886

  6. Boron uptake, localization, and speciation in marine brown algae.


    Miller, Eric P; Wu, Youxian; Carrano, Carl J


    In contrast to the generally boron-poor terrestrial environment, the concentration of boron in the marine environment is relatively high (0.4 mM) and while there has been extensive interest in its use as a surrogate of pH in paleoclimate studies in the context of climate change-related questions, the relatively depth independent, and the generally non-nutrient-like concentration profile of this element have led to boron being neglected as a potentially biologically relevant element in the ocean. Among the marine plant-like organisms the brown algae (Phaeophyta) are one of only five lineages of photosynthetic eukaryotes to have evolved complex multicellularity. Many of unusual and often unique features of brown algae are attributable to this singular evolutionary history. These adaptations are a reflection of the marine coastal environment which brown algae dominate in terms of biomass. Consequently, brown algae are of fundamental importance to oceanic ecology, geochemistry, and coastal industry. Our results indicate that boron is taken up by a facilitated diffusion mechanism against a considerable concentration gradient. Furthermore, in both Ectocarpus and Macrocystis some boron is most likely bound to cell wall constituent alginate and the photoassimilate mannitol located in sieve cells. Herein, we describe boron uptake, speciation, localization and possible biological function in two species of brown algae, Macrocystis pyrifera and Ectocarpus siliculosus. PMID:26679972

  7. Visualization of oxygen distribution patterns caused by coral and algae.


    Haas, Andreas F; Gregg, Allison K; Smith, Jennifer E; Abieri, Maria L; Hatay, Mark; Rohwer, Forest


    Planar optodes were used to visualize oxygen distribution patterns associated with a coral reef associated green algae (Chaetomorpha sp.) and a hermatypic coral (Favia sp.) separately, as standalone organisms, and placed in close proximity mimicking coral-algal interactions. Oxygen patterns were assessed in light and dark conditions and under varying flow regimes. The images show discrete high oxygen concentration regions above the organisms during lighted periods and low oxygen in the dark. Size and orientation of these areas were dependent on flow regime. For corals and algae in close proximity the 2D optodes show areas of extremely low oxygen concentration at the interaction interfaces under both dark (18.4 ± 7.7 µmol O2 L(- 1)) and daylight (97.9 ± 27.5 µmol O2 L(- 1)) conditions. These images present the first two-dimensional visualization of oxygen gradients generated by benthic reef algae and corals under varying flow conditions and provide a 2D depiction of previously observed hypoxic zones at coral algae interfaces. This approach allows for visualization of locally confined, distinctive alterations of oxygen concentrations facilitated by benthic organisms and provides compelling evidence for hypoxic conditions at coral-algae interaction zones.

  8. Application of algae-biosensor for environmental monitoring.


    Umar, Lazuardi; Alexander, Frank A; Wiest, Joachim


    Environmental problems including water and air pollution, over fertilization, insufficient wastewater treatment and even ecological disaster are receiving greater attention in the technical and scientific area. In this paper, a method for water quality monitoring using living green algae (Chlorella Kessleri) with the help of the intelligent mobile lab (IMOLA) is presented. This measurement used two IMOLA systems for measurement and reference simultaneously to verify changes due to pollution inside the measurement system. The IMOLA includes light emitting diodes to stimulate photosynthesis of the living algae immobilized on a biochip containing a dissolved oxygen microsensor. A fluid system is used to transport algae culture medium in a stop and go mode; 600s ON, 300s OFF, while the oxygen concentration of the water probe is measured. When the pump stops, the increase in dissolved oxygen concentration due to photosynthesis is detected. In case of a pollutant being transported toward the algae, this can be detected by monitoring the photosynthetic activity. Monitoring pollution is shown by adding emulsion of 0,5mL of Indonesian crude palm oil and 10mL algae medium to the water probe in the biosensor.

  9. Extraction of mercury from groundwater using immobilized algae

    SciTech Connect

    Barkley, N.P. )


    Bio-Recovery Systems, Inc. conducted a project under the Emerging Technology portion of the United States Environmental Protection Agency's (EPAs) Superfund Innovative Technology Evaluation (SITE) Program to evaluate the ability of immobilized algae to adsorb mercury from contaminated groundwater in laboratory studies and pilot-scale field tests. Algal biomass was incorporated in a permeable polymeric matrix. The product, AlgaSORB, packed into adsorption columns, exhibited excellent flow characteristics, and functioned as a biological ion exchange resin. A sequence of eleven laboratory tests demonstrated the ability of this product to adsorb mercury from groundwater that contained high levels of total dissolved solids and hard water components. However, use of a single AlgaSORB preparation yielded nonrepeatable results with samples collected at different times of the year. The strategy of sequentially extracting the groundwater through two columns containing different preparations of AlgaSORB was developed and proved successful in laboratory and pilot-scale field tests. Field test results indicate that AlgaSORB could be economically competitive with ion exchange resins for removal of mercury, with the advantage that hardness and other dissolved solids do not appear to compete with heavy metals for binding capacity.

  10. Algae-bacteria interactions: Evolution, ecology and emerging applications.


    Ramanan, Rishiram; Kim, Byung-Hyuk; Cho, Dae-Hyun; Oh, Hee-Mock; Kim, Hee-Sik


    Algae and bacteria have coexisted ever since the early stages of evolution. This coevolution has revolutionized life on earth in many aspects. Algae and bacteria together influence ecosystems as varied as deep seas to lichens and represent all conceivable modes of interactions - from mutualism to parasitism. Several studies have shown that algae and bacteria synergistically affect each other's physiology and metabolism, a classic case being algae-roseobacter interaction. These interactions are ubiquitous and define the primary productivity in most ecosystems. In recent years, algae have received much attention for industrial exploitation but their interaction with bacteria is often considered a contamination during commercialization. A few recent studies have shown that bacteria not only enhance algal growth but also help in flocculation, both essential processes in algal biotechnology. Hence, there is a need to understand these interactions from an evolutionary and ecological standpoint, and integrate this understanding for industrial use. Here we reflect on the diversity of such relationships and their associated mechanisms, as well as the habitats that they mutually influence. This review also outlines the role of these interactions in key evolutionary events such as endosymbiosis, besides their ecological role in biogeochemical cycles. Finally, we focus on extending such studies on algal-bacterial interactions to various environmental and bio-technological applications. PMID:26657897

  11. Extraction of mercury from groundwater using immobilized algae.


    Barkley, N P


    Bio-Recovery Systems, Inc. conducted a project under the Emerging Technology portion of the United States Environmental Protection Agency's (EPAs) Superfund Innovative Technology Evaluation (SITE) Program to evaluate the ability of immobilized algae to adsorb mercury from contaminated groundwater in laboratory studies and pilot-scale field tests. Algal biomass was incorporated in a permeable polymeric matrix. The product, AlgaSORB, packed into adsorption columns, exhibited excellent flow characteristics, and functioned as a "biological" ion exchange resin. A sequence of eleven laboratory tests demonstrated the ability of this product to adsorb mercury from groundwater that contained high levels of total dissolved solids and hard water components. However, use of a single AlgaSORB preparation yielded nonrepeatable results with samples collected at different times of the year. The strategy of sequentially extracting the groundwater through two columns containing different preparations of AlgaSORB was developed and proved successful in laboratory and pilot-scale field tests. Field test results indicate that AlgaSORB could be economically competitive with ion exchange resins for removal of mercury, with the advantage that hardness and other dissolved solids do not appear to compete with heavy metals for binding capacity. PMID:1777231

  12. Actin gene family dynamics in cryptomonads and red algae.


    Tanifuji, Goro; Archibald, John M


    Here we present evidence for a complex evolutionary history of actin genes in red algae and cryptomonads, a group that acquired photosynthesis secondarily through the engulfment of a red algal endosymbiont. Four actin genes were found in the nuclear genome of the cryptomonad, Guillardia theta, and in the genome of the red alga, Galdieria sulphuraria, a member of the Cyanidiophytina. Phylogenetic analyses reveal that the both organisms possess two distinct sequence types, designated "type-1" and "type-2." A weak but consistent phylogenetic affinity between the cryptomonad type-2 sequences and the type-2 sequences of G. sulphuraria and red algae belonging to the Rhodophytina was observed. This is consistent with the possibility that the cryptomonad type-2 sequences are derived from the red algal endosymbiont that gave rise to the cryptomonad nucleomorph and plastid. Red algae as a whole possess two very different actin sequence types, with G. sulphuraria being the only organism thus far known to possess both. The common ancestor of Rhodophytina and Cyanidiophytina may have had two actin genes, with differential loss explaining the distribution of these genes in modern-day groups. Our study provides new insight into the evolution and divergence of actin genes in cryptomonads and red algae, and in doing so underscores the challenges associated with heterogeneity in actin sequence evolution and ortholog/paralog detection.

  13. Boron uptake, localization, and speciation in marine brown algae.


    Miller, Eric P; Wu, Youxian; Carrano, Carl J


    In contrast to the generally boron-poor terrestrial environment, the concentration of boron in the marine environment is relatively high (0.4 mM) and while there has been extensive interest in its use as a surrogate of pH in paleoclimate studies in the context of climate change-related questions, the relatively depth independent, and the generally non-nutrient-like concentration profile of this element have led to boron being neglected as a potentially biologically relevant element in the ocean. Among the marine plant-like organisms the brown algae (Phaeophyta) are one of only five lineages of photosynthetic eukaryotes to have evolved complex multicellularity. Many of unusual and often unique features of brown algae are attributable to this singular evolutionary history. These adaptations are a reflection of the marine coastal environment which brown algae dominate in terms of biomass. Consequently, brown algae are of fundamental importance to oceanic ecology, geochemistry, and coastal industry. Our results indicate that boron is taken up by a facilitated diffusion mechanism against a considerable concentration gradient. Furthermore, in both Ectocarpus and Macrocystis some boron is most likely bound to cell wall constituent alginate and the photoassimilate mannitol located in sieve cells. Herein, we describe boron uptake, speciation, localization and possible biological function in two species of brown algae, Macrocystis pyrifera and Ectocarpus siliculosus.

  14. Method to transform algae, materials therefor, and products produced thereby


    Dunahay, T.G.; Roessler, P.G.; Jarvis, E.E.


    Disclosed is a method to transform chlorophyll C-containing algae. The method includes introducing a recombinant molecule comprising a nucleic acid molecule encoding a dominant selectable marker operatively linked to an algal regulatory control sequence into a chlorophyll C-containing alga in such a manner that the marker is produced by the alga. In a preferred embodiment the algal regulatory control sequence is derived from a diatom and preferably Cyclotella cryptica. Also disclosed is a chimeric molecule having one or more regulatory control sequences derived from one or more chlorophyll C-containing algae operatively linked to a nucleic acid molecule encoding a selectable marker, an RNA molecule and/or a protein, wherein the nucleic acid molecule does not normally occur with one or more of the regulatory control sequences. Further, specifically disclosed are molecules pACCNPT10, pACCNPT4.8 and pACCNPT5.1. The methods and materials of the present invention provide the ability to accomplish stable genetic transformation of chlorophyll C-containing algae. 2 figs.

  15. Method to transform algae, materials therefor, and products produced thereby


    Dunahay, Terri Goodman; Roessler, Paul G.; Jarvis, Eric E.


    Disclosed is a method to transform chlorophyll C-containing algae which includes introducing a recombinant molecule comprising a nucleic acid molecule encoding a dominant selectable marker operatively linked to an algal regulatory control sequence into a chlorophyll C-containing alga in such a manner that the marker is produced by the alga. In a preferred embodiment the algal regulatory control sequence is derived from a diatom and preferably Cyclotella cryptica. Also disclosed is a chimeric molecule having one or more regulatory control sequences derived from one or more chlorophyll C-containing algae operatively linked to a nucleic acid molecule encoding a selectable marker, an RNA molecule and/or a protein, wherein the nucleic acid molecule does not normally occur with one or more of the regulatory control sequences. Further specifically disclosed are molecules pACCNPT10, pACCNPT4.8 and pACCNPT5.1. The methods and materials of the present invention provide the ability to accomplish stable genetic transformation of chlorophyll C-containing algae.

  16. Algae-bacteria interactions: Evolution, ecology and emerging applications.


    Ramanan, Rishiram; Kim, Byung-Hyuk; Cho, Dae-Hyun; Oh, Hee-Mock; Kim, Hee-Sik


    Algae and bacteria have coexisted ever since the early stages of evolution. This coevolution has revolutionized life on earth in many aspects. Algae and bacteria together influence ecosystems as varied as deep seas to lichens and represent all conceivable modes of interactions - from mutualism to parasitism. Several studies have shown that algae and bacteria synergistically affect each other's physiology and metabolism, a classic case being algae-roseobacter interaction. These interactions are ubiquitous and define the primary productivity in most ecosystems. In recent years, algae have received much attention for industrial exploitation but their interaction with bacteria is often considered a contamination during commercialization. A few recent studies have shown that bacteria not only enhance algal growth but also help in flocculation, both essential processes in algal biotechnology. Hence, there is a need to understand these interactions from an evolutionary and ecological standpoint, and integrate this understanding for industrial use. Here we reflect on the diversity of such relationships and their associated mechanisms, as well as the habitats that they mutually influence. This review also outlines the role of these interactions in key evolutionary events such as endosymbiosis, besides their ecological role in biogeochemical cycles. Finally, we focus on extending such studies on algal-bacterial interactions to various environmental and bio-technological applications.

  17. Application of algae-biosensor for environmental monitoring.


    Umar, Lazuardi; Alexander, Frank A; Wiest, Joachim


    Environmental problems including water and air pollution, over fertilization, insufficient wastewater treatment and even ecological disaster are receiving greater attention in the technical and scientific area. In this paper, a method for water quality monitoring using living green algae (Chlorella Kessleri) with the help of the intelligent mobile lab (IMOLA) is presented. This measurement used two IMOLA systems for measurement and reference simultaneously to verify changes due to pollution inside the measurement system. The IMOLA includes light emitting diodes to stimulate photosynthesis of the living algae immobilized on a biochip containing a dissolved oxygen microsensor. A fluid system is used to transport algae culture medium in a stop and go mode; 600s ON, 300s OFF, while the oxygen concentration of the water probe is measured. When the pump stops, the increase in dissolved oxygen concentration due to photosynthesis is detected. In case of a pollutant being transported toward the algae, this can be detected by monitoring the photosynthetic activity. Monitoring pollution is shown by adding emulsion of 0,5mL of Indonesian crude palm oil and 10mL algae medium to the water probe in the biosensor. PMID:26737928

  18. Method and apparatus using an active ionic liquid for algae biofuel harvest and extraction


    Salvo, Roberto Di; Reich, Alton; Dykes, Jr., H. Waite H.; Teixeira, Rodrigo


    The invention relates to use of an active ionic liquid to dissolve algae cell walls. The ionic liquid is used to, in an energy efficient manner, dissolve and/or lyse an algae cell walls, which releases algae constituents used in the creation of energy, fuel, and/or cosmetic components. The ionic liquids include ionic salts having multiple charge centers, low, very low, and ultra low melting point ionic liquids, and combinations of ionic liquids. An algae treatment system is described, which processes wet algae in a lysing reactor, separates out algae constituent products, and optionally recovers the ionic liquid in an energy efficient manner.

  19. An updated comprehensive techno-economic analysis of algae biodiesel.


    Nagarajan, Sanjay; Chou, Siaw Kiang; Cao, Shenyan; Wu, Chen; Zhou, Zhi


    Algae biodiesel is a promising but expensive alternative fuel to petro-diesel. To overcome cost barriers, detailed cost analyses are needed. A decade-old cost analysis by the U.S. National Renewable Energy Laboratory indicated that the costs of algae biodiesel were in the range of $0.53-0.85/L (2012 USD values). However, the cost of land and transesterification were just roughly estimated. In this study, an updated comprehensive techno-economic analysis was conducted with optimized processes and improved cost estimations. Latest process improvement, quotes from vendors, government databases, and other relevant data sources were used to calculate the updated algal biodiesel costs, and the final costs of biodiesel are in the range of $0.42-0.97/L. Additional improvements on cost-effective biodiesel production around the globe to cultivate algae was also recommended. Overall, the calculated costs seem promising, suggesting that a single step biodiesel production process is close to commercial reality.

  20. Importance of algae as a potential source of biofuel.


    Singh, A K; Singh, M P


    Algae have a great potential source of biofuels and also have unique importance to reduce gaseous emissions, greenhouse gases, climatic changes, global warming receding of glaciers, rising sea levels and loss of biodiversity. The microalgae, like Scenedesmus obliquus, Neochloris oleabundans, Nannochloropsis sp., Chlorella emersonii, and Dunaliella tertiolecta have high oil content. Among the known algae, Scenedesmus obliquus is one of the most potential sources for biodiesel as it has adequate fatty acid (linolenic acid) and other polyunsaturated fatty acids. Bio—ethanol is already in the market of United States of America and Europe as an additive in gasoline. Bio—hydrogen is the cleanest biofuel and extensive efforts are going on to bring it to market at economical price. This review highlights recent development and progress in the field of algae as a potential source of biofuel.

  1. Stable chloroplast transformation of the unicellular red alga Porphyridium species.


    Lapidot, Miri; Raveh, Dina; Sivan, Alex; Arad, Shoshana Malis; Shapira, Michal


    Red algae are extremely attractive for biotechnology because they synthesize accessory photosynthetic pigments (phycobilins and carotenoids), unsaturated fatty acids, and unique cell wall sulfated polysaccharides. We report a high-efficiency chloroplast transformation system for the unicellular red microalga Porphyridium sp. This is the first genetic transformation system for Rhodophytes and is based on use of a mutant form of the gene encoding acetohydroxyacid synthase [AHAS(W492S)] as a dominant selectable marker. AHAS is the target enzyme of the herbicide sulfometuron methyl, which effectively inhibits growth of bacteria, fungi, plants, and algae. Biolistic transformation of synchronized Porphyridium sp. cells with the mutant AHAS(W492S) gene that confers herbicide resistance gave a high frequency of sulfomethuron methyl-resistant colonies. The mutant AHAS gene integrated into the chloroplast genome by homologous recombination. This system paves the way for expression of foreign genes in red algae and has important biotechnological implications.

  2. [Immunostimulating activity of the lipopolysaccharides of blue-green algae].


    Besednova, N N; Smolina, T P; Mikheĭskaia, L V; Ovodova, R G


    The whole cells of blue-gree algae and lipopolysaccharides isolated from these cells were shown to stimulate the production of macro-(mainly) and microglobulin antibodies in rabbits. The macro- and microphage indices in rabbits increased significantly after the injection of LPS isolated from blue-green algae 24--48 hours before infecting the animals with a virulent Y. pseudotuberculosis strain. Besides, the inhibiting action of this strain on the migration of phagocytes to the site of infection was abolished immediately after the injection. The use of the indirect hemagglutination test allowed to prove the absence of close antigenic interrelations between blue-green algae and the following organisms: Spirulina platensis, Microcystis aeruginosa, Phormidium africanum and P. uncinatum. PMID:117655

  3. Algae from the arid southwestern United States: an annotated bibliography

    SciTech Connect

    Thomas, W.H.; Gaines, S.R.


    Desert algae are attractive biomass producers for capturing solar energy through photosynthesis of organic matter. They are probably capable of higher yields and efficiencies of light utilization than higher plants, and are already adapted to extremes of sunlight intensity, salinity and temperature such as are found in the desert. This report consists of an annotated bibliography of the literature on algae from the arid southwestern United States. It was prepared in anticipation of efforts to isolate desert algae and study their yields in the laboratory. These steps are necessary prior to setting up outdoor algal culture ponds. Desert areas are attractive for such applications because land, sunlight, and, to some extent, water resources are abundant there. References are sorted by state.

  4. Designer proton-channel transgenic algae for photobiological hydrogen production


    Lee, James Weifu


    A designer proton-channel transgenic alga for photobiological hydrogen production that is specifically designed for production of molecular hydrogen (H.sub.2) through photosynthetic water splitting. The designer transgenic alga includes proton-conductive channels that are expressed to produce such uncoupler proteins in an amount sufficient to increase the algal H.sub.2 productivity. In one embodiment the designer proton-channel transgene is a nucleic acid construct (300) including a PCR forward primer (302), an externally inducible promoter (304), a transit targeting sequence (306), a designer proton-channel encoding sequence (308), a transcription and translation terminator (310), and a PCR reverse primer (312). In various embodiments, the designer proton-channel transgenic algae are used with a gas-separation system (500) and a gas-products-separation and utilization system (600) for photobiological H.sub.2 production.

  5. A look at diacylglycerol acyltransferases (DGATs) in algae.


    Chen, Jit Ern; Smith, Alison G


    Triacylglycerols (TAGs) from algae are considered to be a potentially viable source of biodiesel and thereby renewable energy, but at the moment very little is known about the biosynthetic pathway in these organisms. Here we compare what is currently known in eukaryotic algal species, in particular the characteristics of algal diacylglycerol acyltransferase (DGAT), the last enzyme of de novo TAG biosynthesis. Several studies in plants and mammals have shown that there are two DGAT isoforms, DGAT1 and DGAT2, which catalyse the same reaction but have no clear sequence similarities. Instead, they have differences in functionality and spatial and temporal expression patterns. Bioinformatic searches of sequenced algal genomes reveal that most algae have multiple copies of putative DGAT2s, whereas other eukaryotes have single genes. Investigating whether these putative isoforms are indeed functional and whether they confer significantly different phenotypes to algal cells will be vital for future efforts to genetically modify algae for biofuel production.

  6. Synergistic cooperation between wastewater-born algae and activated sludge for wastewater treatment: influence of algae and sludge inoculation ratios.


    Su, Yanyan; Mennerich, Artur; Urban, Brigitte


    An algal-bacterial culture, composed of wastewater-born algae and activated sludge, was cultivated to treat domestic wastewater and accumulate biomass simultaneously. The influence of algae and sludge inoculation ratios on the treatment efficiency and the settleability of the accumulated biomass were investigated. There was no significant effect of the inoculation ratios on the chemical oxygen demand removal. Comparatively, the nutrients removal and related mechanism were varied with different inoculation ratios. The highest nitrogen and phosphorus removal efficiencies were observed with 5:1 (algae/sludge) culture (91.0±7.0% and 93.5±2.5%, respectively) within 10 days, which was 5-40% higher and 2-4 days faster than those with other inoculation ratios. The biomass settleability was improved with the assistance of sludge, and the 1:5 (algae/sludge) culture showed the best settleability. Furthermore, 16S rDNA gene analysis showed that the bacterial communities were varying with different algae and sludge inoculation ratios and some specific bacteria were enriched during operation.

  7. Copper-induced activation of TRP channels promotes extracellular calcium entry, activation of CaMs and CDPKs, copper entry and membrane depolarization in Ulva compressa

    PubMed Central

    Gómez, Melissa; González, Alberto; Sáez, Claudio A.; Morales, Bernardo; Moenne, Alejandra


    In order to identify channels involved in membrane depolarization, Ulva compressa was incubated with agonists of TRP channels C5, A1 and V1, and the level of intracellular calcium was detected. Agonists of TRPC5, A1 and V1 induced increases in intracellular calcium at 4, 9, and 11 min of exposure, respectively, and antagonists of TRPC5, A1, and V1 corresponding to SKF-96365 (SKF), HC-030031 (HC), and capsazepin (CPZ), respectively, inhibited calcium increases indicating that functional TRPs exist in U. compressa. In addition, copper excess induced increases in intracellular calcium at 4, 9, and 12 min which were inhibited by SKF, HC, and CPZ, respectively, indicating that copper activate TRPC5, A1, and V1 channels. Moreover, copper-induced calcium increases were inhibited by EGTA, a non-permeable calcium chelating agent, but not by thapsigargin, an inhibitor of endoplasmic reticulum (ER) calcium ATPase, indicating that activation of TRPs leads to extracellular calcium entry. Furthermore, copper-induced calcium increases were not inhibited by W-7, an inhibitor of CaMs, and staurosporine, an inhibitor of CDPKs, indicating that extracellular calcium entry did not require activation of CaMs and CDPKs. In addition, copper induced membrane depolarization events at 4, 8, and 11 min and these events were inhibited by SKF, HC, CPZ, and bathocuproine, a specific copper chelating agent, indicating that copper entry through TRP channels leads to membrane depolarization. Moreover, membrane depolarization events were inhibited by W-7 and staurosporine, indicating that activation of CaMs and CDPKs is required to allow copper entry through TRPs. Interestingly, copper-induced calcium increases and depolarization events were light-dependent and were inhibited by DCMU, an inhibitor of photosystem II, and ATP-γ-S, a non-hydrolizable analog of ATP, suggesting that ATP derived from photosynthesis is required to activate TRPs. Thus, light-dependent copper-induced activation TRPC5, A1

  8. A surface complexation model of YREE sorption on Ulva lactuca in 0.05-5.0 M NaCl solutions

    NASA Astrophysics Data System (ADS)

    Zoll, Alison M.; Schijf, Johan


    We present distribution coefficients, log iKS, for the sorption of yttrium and the rare earth elements (YREEs) on BCR-279, a dehydrated tissue homogenate of a marine macroalga, Ulva lactuca, resembling materials featured in chemical engineering studies aimed at designing renewable biosorbents. Sorption experiments were conducted in NaCl solutions of different ionic strength (0.05, 0.5, and 5.0 M) at T = 25 °C over the pH range 2.7-8.5. Distribution coefficients based on separation of the dissolved and particulate phase by conventional filtration (<0.22 μm) were corrected for the effect of colloid-bound YREEs (>3 kDa) using an existing pH-dependent model. Colloid-corrected values were renormalized to free-cation concentrations by accounting for YREE hydrolysis and chloride complexation. At each ionic strength, the pH dependence of the renormalized values is accurately described with a non-electrostatic surface complexation model (SCM) that incorporates YREE binding to three monoprotic functional groups, previously characterized by alkalimetric titration, as well as binding of YREE-hydroxide complexes (MOH2+) to the least acidic one (pKa ∼ 9.5). In non-linear regressions of the distribution coefficients as a function of pH, each pKa was fixed at its reported value, while stability constants of the four YREE surface complexes were used as adjustable parameters. Data for a single fresh U. lactuca specimen in 0.5 M NaCl show generally the same pH-dependent behavior but a lower degree of sorption and were excluded from the regressions. Good linear free-energy relations (LFERs) between stability constants of the YREE-acetate and YREE-hydroxide solution complex and surface complexes with the first and third functional group, respectively, support their prior tentative identifications as carboxyl and phenol. A similar confirmation for the second group is precluded by insufficient knowledge of the stability of YREE-phosphate complexes and a perceived lack of YREE binding

  9. Oleosin of subcellular lipid droplets evolved in green algae.


    Huang, Nan-Lan; Huang, Ming-Der; Chen, Tung-Ling L; Huang, Anthony H C


    In primitive and higher plants, intracellular storage lipid droplets (LDs) of triacylglycerols are stabilized with a surface layer of phospholipids and oleosin. In chlorophytes (green algae), a protein termed major lipid-droplet protein (MLDP) rather than oleosin on LDs was recently reported. We explored whether MLDP was present directly on algal LDs and whether algae had oleosin genes and oleosins. Immunofluorescence microscopy revealed that MLDP in the chlorophyte Chlamydomonas reinhardtii was associated with endoplasmic reticulum subdomains adjacent to but not directly on LDs. In C. reinhardtii, low levels of a transcript encoding an oleosin-like protein (oleolike) in zygotes-tetrads and a transcript encoding oleosin in vegetative cells transferred to an acetate-enriched medium were found in transcriptomes and by reverse transcription-polymerase chain reaction. The C. reinhardtii LD fraction contained minimal proteins with no detectable oleolike or oleosin. Several charophytes (advanced green algae) possessed low levels of transcripts encoding oleosin but not oleolike. In the charophyte Spirogyra grevilleana, levels of oleosin transcripts increased greatly in cells undergoing conjugation for zygote formation, and the LD fraction from these cells contained minimal proteins, two of which were oleosins identified via proteomics. Because the minimal oleolike and oleosins in algae were difficult to detect, we tested their subcellular locations in Physcomitrella patens transformed with the respective algal genes tagged with a Green Fluorescent Protein gene and localized the algal proteins on P. patens LDs. Overall, oleosin genes having weak and cell/development-specific expression were present in green algae. We present a hypothesis for the evolution of oleosins from algae to plants. PMID:23391579

  10. Aragonitic Pennsylvanian phylloid algae from New Mexico: The missing link

    SciTech Connect

    Kirkland, B.L.; Moore, C.H. Jr. ); Dickson, J.A.D. )


    Remarkably well-preserved codiacean algae (Eugonophyllum and Anchicodium) retaining original aragonite are present in the Virgilian Holder Formation, Sacramento Mountains, south-central New Mexico. The algae are preserved in a 20-cm-thick packstone between two thick (> 5m) shale beds. Aragonite is preserved as a felt-like mesh of needles in the algal skeletons, in the shell fragments of molluscs, in the walls of sponges, and in botryoidal and isopachous marine cements. The aragonite is confirmed by X-ray diffraction, by visual inspection of pristine aragonite needles with SEM, and by a high content of Sr as revealed by microprobe analysis. The average Sr content of the algae (9,091 ppm, n = 21) is comparable to modern codiaceans. Preservation of internal structure in Eugonophyllum was previously unknown. The medullary (interior) region of the Eugonophyllum thallus is composed of an aragonite felt punctuated by small (20 {mu}m diameter), parallel utricles. As in modern codiaceans, the utricles in the cortical (exterior) region of the thallus increase in diameter and their bulbous tips coalesce to form the outer cortex of the plant. This occurrence provides a key piece of evidence in support of hypotheses concerning the nature and origin of phylloid algal bioherms. Because the internal structure of most fossil phylloid algae is replaced by sparry mosaic calcite, taxonomic classification has been difficult even at the fundamental level of division (phylum). The authors discovery confirms that at least some ancient phylloid algae resembled the modern green algae Halimeda or Udotea, and lends credibility to the suggestion that ancient phylloid algal mounds are analogous to modern Halimeda mounds of the South Pacific.

  11. [Sedimentary Phosphorus Forms Under Disturbances and Algae in Taihu Lake].


    Chen, Jun; Li, Da-peng; Zhu, Pei-ying; Huang, Yong; Wang, Ren


    Sedimentary phosphorus forms were investigated to clarify the release of sedimentary phosphorus forms under the repeated disturbance with the addition of algae at different initial concentrations. The sediments and overlying water were taken from the Meiliang Bay in Taihu Lake. The results showed that the concentrations of NH₄ Cl-P and Res-P decreased, while the content of Fe/Al-P and Ca-P increased without disturbance. In addition, the Ca-P increased with the increase of the initial concentration of algae and the net increase of Ca-P increased by 48% (30 µg · L⁻¹), 66% (60 µg · L⁻¹), 74% (120 µg · L⁻¹), respectively. However, under the disturbance, the NH₄Cl-P and Res-P were significantly reduced, the Fe/Al-P increased significantly. The percentage of Fe/Al-P to Tot-P was up to 66. 2% (average of the 3 experiments with the addition of algae of 30 µg · L⁻¹, 60 µg · L⁻¹ and 120 µg L-¹), it was higher than the value (53.%, average of the 3 experiments) without the disturbance. Moreover, under the disturbance, the percentage of Ca-P to Tot-P was 24.1% (average of the 3 experiments with the addition of algae of 30 µg · L⁻¹, 60 µg⁻¹ and 120 µg · L⁻¹) and it was slightly lower than that (33.0%, average of the 3 experiments) without the disturbance. It is suggested that the coexistence of disturbance and algae facilitated the formation of Fe/Al-P, but the algae accelerated the formation of Ca-P without disturbance.

  12. Oleosin of subcellular lipid droplets evolved in green algae.


    Huang, Nan-Lan; Huang, Ming-Der; Chen, Tung-Ling L; Huang, Anthony H C


    In primitive and higher plants, intracellular storage lipid droplets (LDs) of triacylglycerols are stabilized with a surface layer of phospholipids and oleosin. In chlorophytes (green algae), a protein termed major lipid-droplet protein (MLDP) rather than oleosin on LDs was recently reported. We explored whether MLDP was present directly on algal LDs and whether algae had oleosin genes and oleosins. Immunofluorescence microscopy revealed that MLDP in the chlorophyte Chlamydomonas reinhardtii was associated with endoplasmic reticulum subdomains adjacent to but not directly on LDs. In C. reinhardtii, low levels of a transcript encoding an oleosin-like protein (oleolike) in zygotes-tetrads and a transcript encoding oleosin in vegetative cells transferred to an acetate-enriched medium were found in transcriptomes and by reverse transcription-polymerase chain reaction. The C. reinhardtii LD fraction contained minimal proteins with no detectable oleolike or oleosin. Several charophytes (advanced green algae) possessed low levels of transcripts encoding oleosin but not oleolike. In the charophyte Spirogyra grevilleana, levels of oleosin transcripts increased greatly in cells undergoing conjugation for zygote formation, and the LD fraction from these cells contained minimal proteins, two of which were oleosins identified via proteomics. Because the minimal oleolike and oleosins in algae were difficult to detect, we tested their subcellular locations in Physcomitrella patens transformed with the respective algal genes tagged with a Green Fluorescent Protein gene and localized the algal proteins on P. patens LDs. Overall, oleosin genes having weak and cell/development-specific expression were present in green algae. We present a hypothesis for the evolution of oleosins from algae to plants.

  13. Smallest algae thrive as the Arctic Ocean freshens.


    Li, William K W; McLaughlin, Fiona A; Lovejoy, Connie; Carmack, Eddy C


    As climate changes and the upper Arctic Ocean receives more heat and fresh water, it becomes more difficult for mixing processes to deliver nutrients from depth to the surface for phytoplankton growth. Competitive advantage will presumably accrue to small cells because they are more effective in acquiring nutrients and less susceptible to gravitational settling than large cells. Since 2004, we have discerned an increase in the smallest algae and bacteria along with a concomitant decrease in somewhat larger algae. If this trend toward a community of smaller cells is sustained, it may lead to reduced biological production at higher trophic levels. PMID:19900890

  14. Algae Biofuels Co-Location Assessment Tool for Canada


    The Algae Biofuels Co-Location Assessment Tool for Canada uses chemical stoichiometry to estimate Nitrogen, Phosphorous, and Carbon atom availability from waste water and carbon dioxide emissions streams, and requirements for those same elements to produce a unit of algae. This information is then combined to find limiting nutrient information and estimate potential productivity associated with waste water and carbon dioxide sources. Output is visualized in terms of distributions or spatial locations. Distances are calculated betweenmore » points of interest in the model using the great circle distance equation, and the smallest distances found by an exhaustive search and sort algorithm.« less

  15. Algae Biofuels Co-Location Assessment Tool for Canada

    SciTech Connect


    The Algae Biofuels Co-Location Assessment Tool for Canada uses chemical stoichiometry to estimate Nitrogen, Phosphorous, and Carbon atom availability from waste water and carbon dioxide emissions streams, and requirements for those same elements to produce a unit of algae. This information is then combined to find limiting nutrient information and estimate potential productivity associated with waste water and carbon dioxide sources. Output is visualized in terms of distributions or spatial locations. Distances are calculated between points of interest in the model using the great circle distance equation, and the smallest distances found by an exhaustive search and sort algorithm.

  16. ECOLOGY: California Algae May Be Feared European Species.


    Kaiser, J


    A volleyball-court-sized patch of bright green algae in a San Diego lagoon has set off alarm bells among ecologists and officials. Scientists strongly suspect that the algae, Caulerpa taxifolia, is the same fast-growing, non-native clone that has swept over the northwestern Mediterranean sea floor in the past decade with devastating ecological consequences. A consortium of agencies and private groups has cordoned off the lagoon and is laying plans to poison the seaweed, marking the first major U.S. attempt to stop an incipient marine species invasion. PMID:17750394

  17. Algae as promising organisms for environment and health

    PubMed Central


    Algae, like other plants, produce a variety of remarkable compounds collectively referred to as secondary metabolites. They are synthesized by these organisms at the end of the growth phase and/or due to metabolic alterations induced by environmental stress conditions. Carotenoids, phenolic compounds, phycobiliprotein pigments, polysaccharides and unsaturated fatty acids are same of the algal natural products, which were reported to have variable biological activities, including antioxidant activity, anticancer activity, antimicroabial activity against bacteria-virus-algae-fungi, organic fertilizer and bioremediation potentials. PMID:21862867

  18. Value of crops: Quantity, quality and cost price. [algae as a nutritional supplement

    NASA Technical Reports Server (NTRS)

    Meyer, C.


    Possibilities of using algae as a nutritional supplement are examined. The nutritional value and protein content of spirulines of blue algae are discussed. A cost analysis of growing them artificially is presented.

  19. Where Have All the Algae Gone, or, How Many Kingdoms Are There?

    ERIC Educational Resources Information Center

    Blackwell, Will H.; Powell, Martha J.


    Examined 10 introductory college-level, general biology survey textbooks for the coverage of algae to assess the efficacy of coverage. Describes a proposal of seven kingdoms and discusses the disposition of algae among five of these kingdoms. Contends that textbooks should highlight the concept of algae across the five kingdoms. Contains 59…


    EPA Science Inventory

    Algae are an important quality component in water bodies. They are photosynthesizing organisms and are the foundation of most aquatic food webs; however, some algae (e.g. blue-green algae) can produce algal toxins. The presence of algal toxins in water bodies has important ...

  1. Biodegradation of phenols by the alga Ochromonas danica.

    PubMed Central

    Semple, K T; Cain, R B


    The eukaryotic alga Ochromonas danica, a nutritionally versatile, mixotrophic chrysophyte, grew on phenol as the sole carbon source in axenic culture and removed the phenol carbon from the growth medium. Respirometric studies confirmed that the enzymes involved in phenol catabolism were inducible and that the alga oxidized phenol; the amount of oxygen consumed per mole of oxidized substrate was approximately 65% of the theoretical value. [U-14C]phenol was completely mineralized, with 65% of the 14C label appearing as 14CO2, approximately 15% remaining in the aqueous medium, and the rest accounted for in the biomass. Analysis of the biomass showed that 14C label had been incorporated into the protein, nucleic acid, and lipid fractions; phenol carbon is thus unequivocally assimilated by the alga. Phenol-grown cultures of O. danica converted phenols to the corresponding catechols, which were further metabolized by the meta-cleavage pathway. This surprising result was rigorously confirmed by taking the working stock culture through a variety of procedures to check that it was axenic and repeating the experiments with algal extracts. This is, as far as is known, the first definitive identification of the meta-cleavage pathway for aromatic ring degradation in a eukaryotic alga, though its incidence in other eukaryotes has been (infrequently) suggested. PMID:8919787

  2. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.


    Dembitsky, V M; Shkrob, I; Rozentsvet, O A


    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%).

  3. Optimization of light use efficiency for biofuel production in algae.


    Simionato, Diana; Basso, Stefania; Giacometti, Giorgio M; Morosinotto, Tomas


    A major challenge for next decades is development of competitive renewable energy sources, highly needed to compensate fossil fuels reserves and reduce greenhouse gas emissions. Among different possibilities, which are currently under investigation, there is the exploitation of unicellular algae for production of biofuels and biodiesel in particular. Some algae species have the ability of accumulating large amount of lipids within their cells which can be exploited as feedstock for the production of biodiesel. Strong research efforts are however still needed to fulfill this potential and optimize cultivation systems and biomass harvesting. Light provides the energy supporting algae growth and available radiation must be exploited with the highest possible efficiency to optimize productivity and make microalgae large scale cultivation energetically and economically sustainable. Investigation of the molecular bases influencing light use efficiency is thus seminal for the success of this biotechnology. In this work factors influencing light use efficiency in algal biomass production are reviewed, focusing on how algae genetic engineering and control of light environment within photobioreactors can improve the productivity of large scale cultivation systems.

  4. A simple classification of the volvocine algae by formal languages.


    Yoshida, Hiroshi; Yokomori, Takashi; Suyama, Akira


    There are several explanations of why certain primitive multicellular organisms aggregate in particular forms and why their constituent cells cooperate with one another to a particular degree. Utilizing the framework of formal language theory, we have derived one possible simple classification of the volvocine algae-one of the primitive multicells-for some forms of aggregation and some degrees of cooperation among cells. The volvocine algae range from the unicellular Chlamydomonas to the multicellular Volvox globator, which has thousands of cells. The classification we use in this paper is based on the complexity of Parikh sets of families on Chomsky hierarchy in formal language theory. We show that an alga with almost no space closed to the environment, e.g., Gonium pectorale, can be characterized by PsFIN, one with a closed space and no cooperation, e.g., Eudorina elegans, by PsCF, and one with a closed space and cooperation, e.g., Volvox globator, by PslambdauSC. This classification should provide new insights into the necessity for specific forms and degrees of cooperation in the volvocine algae. PMID:16005503

  5. [Phycobiliproteins of blue-green, red and cryptophytic algae].


    Stadnichuk, I N; Gusev, M V


    The present-day concepts on phycobiliproteins, the protein pigments of blue-green, red and cryptophyte algae are reviewed. The functions, distribution, localization, physico-chemical, spectral and immunochemical properties of phycobiliproteins are described. The properties of the polypeptide protein subunits and the composition and chemical structure of chromophores as well as their binding to the apoprotein molecules are discussed.

  6. Effect of sonication frequency on the disruption of algae.


    Kurokawa, Masaki; King, Patrick M; Wu, Xiaoge; Joyce, Eadaoin M; Mason, Timothy J; Yamamoto, Ken


    In this study, the efficiency of ultrasonic disruption of Chaetoceros gracilis, Chaetoceros calcitrans, and Nannochloropsis sp. was investigated by applying ultrasonic waves of 0.02, 0.4, 1.0, 2.2, 3.3, and 4.3 MHz to algal suspensions. The results showed that reduction in the number of algae was frequency dependent and that the highest efficiency was achieved at 2.2, 3.3, and 4.3MHz for C. gracilis, C. calcitrans, and Nannochloropsis sp., respectively. A review of the literature suggested that cavitation, rather than direct effects of ultrasonication, are required for ultrasonic algae disruption, and that chemical effects are likely not the main mechanism for algal cell disruption. The mechanical resonance frequencies estimated by a shell model, taking into account elastic properties, demonstrated that suitable disruption frequencies for each alga were associated with the cell's mechanical properties. Taken together, we consider here that physical effects of ultrasonication were responsible for algae disruption. PMID:26964936

  7. Settlement of marine periphytic algae in a tropical estuary

    NASA Astrophysics Data System (ADS)

    Nayar, S.; Goh, B. P. L.; Chou, L. M.


    This note describes settlement studies of marine periphytic algae on glass substrata in a tropical estuary in Singapore. The rates of production in terms of 14C radiotracer uptake, biomass in terms of chlorophyll a, community structure and cell abundance were measured from the settled periphytic algae at various depths in the water column and compared with the prevailing hydrographical conditions. Relatively higher periphytic algal settlement was observed at 1 m depth, even though it was not statistically different from other depths. Diatoms such as Skeletonema costatum and Thalassiosira rotula dominated the assemblage, together with the marine cyanobacteria Synechococcus sp. The three settlement parameters viz., periphytic algal production, chlorophyll a and cell counts showed significant differences between the days of settlement, with no significant differences observed for different depths. The periphytic algal community in this study comprised 30 microalgal species, dominated by diatoms (78%), followed by cyanobacteria (19% - primarily Synechococcus sp.), green flagellates (1%), dinoflagellates (1%) and other forms accounting for the remaining 1% of the total cell counts. Correlation studies and principal component analysis (PCA) revealed significant influence of silicate concentrations in the water column with the settlement of periphytic algae in this estuary. Though photoinhibited at the surface, photosynthetically available radiation did not seem to influence the overall settlement of periphytic algae. Diatoms and Synechococcus in the periphytic algal community were influenced by water temperature, PAR, pH and dissolved oxygen as seen in the PCA plots.

  8. Survey of Hydrogenase Activity in Algae: Final Report

    SciTech Connect

    Brand, J. J.


    The capacity for hydrogen gas production was examined in nearly 100 strains of Eukaryotic algae. Each strain was assessed for rate of H2 production in darkness, at compensating light intensity and at saturating Tight intensity. Maximum H2 yield on illumination and sensitivity to molecular oxygen were also measured.

  9. MicroRNAs in a multicellular green alga Volvox carteri.


    Li, Jingrui; Wu, Yang; Qi, Yijun


    microRNAs (miRNAs) have emerged as key components in the eukaryotic gene regulatory network. We and others have previously identified many miRNAs in a unicellular green alga, Chlamydomonas reinhardtii. To investigate whether miRNA-mediated gene regulation is a general mechanism in green algae and how miRNAs have been evolved in the green algal lineage, we examined small RNAs in Volvox carteri, a multicellular species in the same family with Chlamydomonas reinhardtii. We identified 174 miRNAs in Volvox, with many of them being highly enriched in gonidia or somatic cells. The targets of the miRNAs were predicted and many of them were subjected to miRNA-mediated cleavage in vivo, suggesting that miRNAs play regulatory roles in the biology of green algae. Our catalog of miRNAs and their targets provides a resource for further studies on the evolution, biological functions, and genomic properties of miRNAs in green algae. PMID:24369344

  10. Intracellular invasion of green algae in a salamander host

    PubMed Central

    Kerney, Ryan; Kim, Eunsoo; Hangarter, Roger P.; Heiss, Aaron A.; Bishop, Cory D.; Hall, Brian K.


    The association between embryos of the spotted salamander (Ambystoma maculatum) and green algae (“Oophila amblystomatis” Lamber ex Printz) has been considered an ectosymbiotic mutualism. We show here, however, that this symbiosis is more intimate than previously reported. A combination of imaging and algal 18S rDNA amplification reveals algal invasion of embryonic salamander tissues and cells during development. Algal cells are detectable from embryonic and larval Stages 26–44 through chlorophyll autofluorescence and algal 18S rDNA amplification. Algal cell ultrastructure indicates both degradation and putative encystment during the process of tissue and cellular invasion. Fewer algal cells were detected in later-stage larvae through FISH, suggesting that the decline in autofluorescent cells is primarily due to algal cell death within the host. However, early embryonic egg capsules also contained encysted algal cells on the inner capsule wall, and algal 18S rDNA was amplified from adult reproductive tracts, consistent with oviductal transmission of algae from one salamander generation to the next. The invasion of algae into salamander host tissues and cells represents a unique association between a vertebrate and a eukaryotic alga, with implications for research into cell–cell recognition, possible exchange of metabolites or DNA, and potential congruence between host and symbiont population structures. PMID:21464324

  11. Decreased abundance of crustose coralline algae due to ocean acidification

    USGS Publications Warehouse

    Kuffner, Ilsa B.; Andersson, Andreas J; Jokiel, Paul L.; Rodgers, Ku'ulei S.; Mackenzie, Fred T.


    Owing to anthropogenic emissions, atmospheric concentrations of carbon dioxide could almost double between 2006 and 2100 according to business-as-usual carbon dioxide emission scenarios1. Because the ocean absorbs carbon dioxide from the atmosphere2, 3, 4, increasing atmospheric carbon dioxide concentrations will lead to increasing dissolved inorganic carbon and carbon dioxide in surface ocean waters, and hence acidification and lower carbonate saturation states2, 5. As a consequence, it has been suggested that marine calcifying organisms, for example corals, coralline algae, molluscs and foraminifera, will have difficulties producing their skeletons and shells at current rates6, 7, with potentially severe implications for marine ecosystems, including coral reefs6, 8, 9, 10, 11. Here we report a seven-week experiment exploring the effects of ocean acidification on crustose coralline algae, a cosmopolitan group of calcifying algae that is ecologically important in most shallow-water habitats12, 13, 14. Six outdoor mesocosms were continuously supplied with sea water from the adjacent reef and manipulated to simulate conditions of either ambient or elevated seawater carbon dioxide concentrations. The recruitment rate and growth of crustose coralline algae were severely inhibited in the elevated carbon dioxide mesocosms. Our findings suggest that ocean acidification due to human activities could cause significant change to benthic community structure in shallow-warm-water carbonate ecosystems.

  12. NADPH oxidases in Eukaryotes: red algae provide new hints!


    Hervé, Cécile; Tonon, Thierry; Collén, Jonas; Corre, Erwan; Boyen, Catherine


    The red macro-alga Chondrus crispus is known to produce superoxide radicals in response to cell-free extracts of its green algal pathogenic endophyte Acrochaete operculata. So far, no enzymes involved in this metabolism have been isolated from red algae. We report here the isolation of a gene encoding a homologue of the respiratory burst oxidase gp91(phox) in C. crispus, named Ccrboh. This single copy gene encodes a polypeptide of 825 amino acids. Search performed in available genome and EST algal databases identified sequences showing common features of NADPH oxidases in other algae such as the red unicellular Cyanidioschyzon merolae, the economically valuable red macro-alga Porphyra yezoensis and the two diatoms Phaeodactylum tricornutum and Thalassiosira pseudonana. Domain organization and phylogenetic relationships with plant, animal, fungal and algal NADPH oxidase homologues were analyzed. Transcription analysis of the C. crispus gene revealed that it was over-transcribed during infection of C. crispus gametophyte by the endophyte A. operculata, and after incubation in presence of atrazine, methyl jasmonate and hydroxyperoxides derived from C20 polyunsaturated fatty acids (PUFAs). These results also illustrate the interest of exploring the red algal lineage for gaining insight into the deep evolution of NADPH oxidases in Eukaryotes.

  13. Controlled artificial upwelling in a fjord to combat toxic algae

    NASA Astrophysics Data System (ADS)

    McClimans, T. A.; Hansen, A. H.; Fredheim, A.; Lien, E.; Reitan, K. I.


    During the summer, primary production in the surface layers of some fjords depletes the nutrients to the degree that some arts of toxic algae dominate the flora. We describe an experiment employing a bubble curtain to lift significant amounts of nutrient-rich seawater to the light zone and provide an environment in which useful algae can survive. The motivation for the experiment is to provide a local region in which mussels can be cleansed from the effects of toxic algae. Three 100-m long, perforated pipes were suspended at 40 m depth in the Arnafjord, a side arm of the Sognefjord. Large amounts of compressed air were supplied during a period of three weeks. The deeper water mixed with the surface water and flowed from the mixing region at 5 to 15 m depth. Within a few days, the mixture of nutrient-rich water covered most of the inner portion of Arnafjord. Within 10 days, the plankton samples showed that the artificial upwelling produced the desired type of algae and excluded the toxic blooms that were occurring outside the manipulated fjord arm. The project (DETOX) is supported by the Norwegian ministries of Fisheries, Agriculture and Public Administration.

  14. Effect of sonication frequency on the disruption of algae.


    Kurokawa, Masaki; King, Patrick M; Wu, Xiaoge; Joyce, Eadaoin M; Mason, Timothy J; Yamamoto, Ken


    In this study, the efficiency of ultrasonic disruption of Chaetoceros gracilis, Chaetoceros calcitrans, and Nannochloropsis sp. was investigated by applying ultrasonic waves of 0.02, 0.4, 1.0, 2.2, 3.3, and 4.3 MHz to algal suspensions. The results showed that reduction in the number of algae was frequency dependent and that the highest efficiency was achieved at 2.2, 3.3, and 4.3MHz for C. gracilis, C. calcitrans, and Nannochloropsis sp., respectively. A review of the literature suggested that cavitation, rather than direct effects of ultrasonication, are required for ultrasonic algae disruption, and that chemical effects are likely not the main mechanism for algal cell disruption. The mechanical resonance frequencies estimated by a shell model, taking into account elastic properties, demonstrated that suitable disruption frequencies for each alga were associated with the cell's mechanical properties. Taken together, we consider here that physical effects of ultrasonication were responsible for algae disruption.

  15. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.


    Dembitsky, V M; Shkrob, I; Rozentsvet, O A


    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%). PMID:11014298

  16. Antibiotic activity of lectins from marine algae against marine vibrios.


    Liao, W-R; Lin, J-Y; Shieh, W-Y; Jeng, W-L; Huang, R


    Saline and aqueous ethanol extracts of marine algae and the lectins from two red algal species were assayed for their antibiotic activity against marine vibrios. Experimental studies were also carried out on the influence of environmental factors on such activity, using batch cultures. The results indicated that many of the saline extracts of the algal species were active and that the activity was selective against those vibrios assayed. The algal extracts were active against Vibrio pelagius and the fish pathogen V. vulnificus, but inactive against V. neresis. Algal lectins from Eucheuma serra (ESA) and Galaxaura marginata (GMA) strongly inhibited V. vulnificus but were inactive against the other two vibrios. The antibacterial activity of algal extracts was inhibited by pretreatment with various sugars and glycoprotein. Extracts of the two red algae, E. serra and Pterocladia capillacea, in saline and aqueous ethanol, inhibited markedly the growth rate of V. vulnificus at very low concentrations. Culture results indicated that metabolites active against V. vulnificus were invariably produced in P. capillacea over a wide range of temperature, light intensity, and nutritional conditions. Enhanced antibacterial activity occurred when P. capillacea was grown under higher irradiance, severe nutrient stress and moderate temperature (20 degrees C), reflecting the specific antibiotic characteristics of this alga. The strong antibiotic activity of lectins towards fish pathogenic bacteria reveals one of the important roles played by algal lectins, as well as the potential high economic value of those marine algae assayed for aquaculture and for biomedical purposes. PMID:12884128

  17. Ecological assessments with algae: a review and synthesis.


    Stevenson, Jan


    Algae have been used for a century in environmental assessments of water bodies and are now used in countries around the world. This review synthesizes recent advances in the field around a framework for environmental assessment and management that can guide design of assessments, applications of phycology in assessments, and refinements of those applications to better support management decisions. Algae are critical parts of aquatic ecosystems that power food webs and biogeochemical cycling. Algae are also major sources of problems that threaten many ecosystems goods and services when abundances of nuisance and toxic taxa are high. Thus, algae can be used to indicate ecosystem goods and services, which complements how algal indicators are also used to assess levels of contaminants and habitat alterations (stressors). Understanding environmental managers' use of algal ecology, taxonomy, and physiology can guide our research and improve its application. Environmental assessments involve characterizing ecological condition and diagnosing causes and threats to ecosystems goods and services. Recent advances in characterizing condition include site-specific models that account for natural variability among habitats to better estimate effects of humans. Relationships between algal assemblages and stressors caused by humans help diagnose stressors and establish targets for protection and restoration. Many algal responses to stressors have thresholds that are particularly important for developing stakeholder consensus for stressor management targets. Future research on the regional-scale resilience of algal assemblages, the ecosystem goods and services they provide, and methods for monitoring and forecasting change will improve water resource management.

  18. Switchable photosystem-II designer algae for photobiological hydrogen production


    Lee, James Weifu


    A switchable photosystem-II designer algae for photobiological hydrogen production. The designer transgenic algae includes at least two transgenes for enhanced photobiological H.sub.2 production wherein a first transgene serves as a genetic switch that can controls photosystem II (PSII) oxygen evolution and a second transgene encodes for creation of free proton channels in the algal photosynthetic membrane. In one embodiment, the algae includes a DNA construct having polymerase chain reaction forward primer (302), a inducible promoter (304), a PSII-iRNA sequence (306), a terminator (308), and a PCR reverse primer (310). In other embodiments, the PSII-iRNA sequence (306) is replaced with a CF.sub.1-iRNA sequence (312), a streptomycin-production gene (314), a targeting sequence (316) followed by a proton-channel producing gene (318), or a PSII-producing gene (320). In one embodiment, a photo-bioreactor and gas-product separation and utilization system produce photobiological H.sub.2 from the switchable PSII designer alga.

  19. Expression and assembly of a fully active antibody in algae

    NASA Astrophysics Data System (ADS)

    Mayfield, Stephen P.; Franklin, Scott E.; Lerner, Richard A.


    Although combinatorial antibody libraries have solved the problem of access to large immunological repertoires, efficient production of these complex molecules remains a problem. Here we demonstrate the efficient expression of a unique large single-chain (lsc) antibody in the chloroplast of the unicellular, green alga, Chlamydomonas reinhardtii. We achieved high levels of protein accumulation by synthesizing the lsc gene in chloroplast codon bias and by driving expression of the chimeric gene using either of two C. reinhardtii chloroplast promoters and 5' and 3' RNA elements. This lsc antibody, directed against glycoprotein D of the herpes simplex virus, is produced in a soluble form by the alga and assembles into higher order complexes in vivo. Aside from dimerization by disulfide bond formation, the antibody undergoes no detectable posttranslational modification. We further demonstrate that accumulation of the antibody can be modulated by the specific growth regime used to culture the alga, and by the choice of 5' and 3' elements used to drive expression of the antibody gene. These results demonstrate the utility of alga as an expression platform for recombinant proteins, and describe a new type of single chain antibody containing the entire heavy chain protein, including the Fc domain.

  20. Complete Chloroplast Genome Sequence of Phagomixotrophic Green Alga Cymbomonas tetramitiformis

    PubMed Central

    Paasch, Amber E.; Graham, Linda E.; Kim, Eunsoo


    We report here the complete chloroplast genome sequence of Cymbomonas tetramitiformis strain PLY262, which is a prasinophycean green alga that retains a phagomixotrophic mode of nutrition. The genome is 84,524 bp in length, with a G+C content of 37%, and contains 3 rRNAs, 26 tRNAs, and 76 protein-coding genes. PMID:27313295

  1. Ecological assessments with algae: a review and synthesis.


    Stevenson, Jan


    Algae have been used for a century in environmental assessments of water bodies and are now used in countries around the world. This review synthesizes recent advances in the field around a framework for environmental assessment and management that can guide design of assessments, applications of phycology in assessments, and refinements of those applications to better support management decisions. Algae are critical parts of aquatic ecosystems that power food webs and biogeochemical cycling. Algae are also major sources of problems that threaten many ecosystems goods and services when abundances of nuisance and toxic taxa are high. Thus, algae can be used to indicate ecosystem goods and services, which complements how algal indicators are also used to assess levels of contaminants and habitat alterations (stressors). Understanding environmental managers' use of algal ecology, taxonomy, and physiology can guide our research and improve its application. Environmental assessments involve characterizing ecological condition and diagnosing causes and threats to ecosystems goods and services. Recent advances in characterizing condition include site-specific models that account for natural variability among habitats to better estimate effects of humans. Relationships between algal assemblages and stressors caused by humans help diagnose stressors and establish targets for protection and restoration. Many algal responses to stressors have thresholds that are particularly important for developing stakeholder consensus for stressor management targets. Future research on the regional-scale resilience of algal assemblages, the ecosystem goods and services they provide, and methods for monitoring and forecasting change will improve water resource management. PMID:26988318

  2. A simple classification of the volvocine algae by formal languages.


    Yoshida, Hiroshi; Yokomori, Takashi; Suyama, Akira


    There are several explanations of why certain primitive multicellular organisms aggregate in particular forms and why their constituent cells cooperate with one another to a particular degree. Utilizing the framework of formal language theory, we have derived one possible simple classification of the volvocine algae-one of the primitive multicells-for some forms of aggregation and some degrees of cooperation among cells. The volvocine algae range from the unicellular Chlamydomonas to the multicellular Volvox globator, which has thousands of cells. The classification we use in this paper is based on the complexity of Parikh sets of families on Chomsky hierarchy in formal language theory. We show that an alga with almost no space closed to the environment, e.g., Gonium pectorale, can be characterized by PsFIN, one with a closed space and no cooperation, e.g., Eudorina elegans, by PsCF, and one with a closed space and cooperation, e.g., Volvox globator, by PslambdauSC. This classification should provide new insights into the necessity for specific forms and degrees of cooperation in the volvocine algae.

  3. Higher plant origins and the phylogeny of green algae.


    Devereux, R; Loeblich, A R; Fox, G E


    5S rRNA sequences from six additional green algae lend strong molecular support for the major outlines of higher plant and green algae phylogeny that have been proposed under varying naming conventions by several authors. In particular, the molecular evidence now available unequivocally supports the existence of at least two well-separated divisions of the Chlorobionta: the Chlorophyta and the Streptophyta (i.e., charophytes) (according to the nomenclature of Bremer). The chlamydomonad 5S rRNAs are, however, sufficiently distinct from both clusters that it may ultimately prove preferable to establish a third taxon for them. In support of these conclusions 5S rRNA sequence data now exist for members of four diverse classes of chlorophytes. These sequences all exhibit considerably more phylogenetic affinity to one another than any of them show toward members of the other cluster, the Streptophyta, or the two Chlamydomonas strains. Among the Charophyceae, new 5S rRNA sequences are provided herein for three genera, Spirogyra, Klebsormidium, and Coleochaete. All of these sequences and the previously published Nitella sequence show greater resemblance among themselves and to the higher plants than they do to any of the other green algae examined to date. These results demonstrate that an appropriately named taxon that includes these green algae and the higher plants is strongly justified. The 5S rRNA data lack the resolution needed, however, to unequivocally determine which of several subdivisions of the charophytes is the sister group of the land plants. The evolutionary diversity of Chlamydomonas relative to the other green algae was recognized in earlier 5S rRNA studies but was unanticipated by ultrastructural work.(ABSTRACT TRUNCATED AT 250 WORDS)


    PubMed Central

    Gaffron, Hans; Rubin, Jack


    1.. After 2 hours of fermentation in nitrogen the metabolism of those algae which were found capable of photoreduction with hydrogen changes in such a way that molecular hydrogen is released from the cell in addition to carbon dioxide. 2. The amount of hydrogen formed anaerobically in the dark depends on the amount of some unknown reserve substance in the cell. More hydrogen is formed in presence of added glucose, but no proportionality has been found between the amount of substrate added and that of hydrogen formed. This is probably due to the fact that two types of fermentation reactions exist, with little or no connection between them. Whereas mainly unknown organic acids are formed during the autofermentation, the addition of glucose causes a considerable increase in the production of lactic acid. 3. Algae which have been fermenting for several hours in the dark produce upon illumination free hydrogen at several times the rate observed in the dark, provided carbon dioxide is absent. 4. Certain concentrations of dinitrophenol strongly inhibit the evolution of hydrogen in the dark. Fermentation then continues mainly as a reaction leading to lactic acid. In such poisoned algae the photochemical liberation of hydrogen still continues. 5. If the algae are poisoned with dinitrophenol the presence of carbon dioxide will not interfere with the photochemical evolution of hydrogen. 6. The amount of hydrogen released in this new photochemical reaction depends on the presence of an unknown hydrogen donor in the cell; it can be increased by the addition of glucose but not in proportion to the amount added. 7. The results obtained allow for a more correct explanation of the anaerobic induction period previously described for Scenedesmus and similar algae. The possibility of a photochemical evolution of hydrogen had not been taken into account in the earlier experiments. 8. The origin of the hydrogen released under the influence of light is discussed. PMID:19873339

  5. Photosynthetic H2 metabolism in Chlamydomonas reinhardtii (unicellular green algae).


    Melis, Anastasios


    Unicellular green algae have the ability to operate in two distinctly different environments (aerobic and anaerobic), and to photosynthetically generate molecular hydrogen (H2). A recently developed metabolic protocol in the green alga Chlamydomonas reinhardtii permitted separation of photosynthetic O2-evolution and carbon accumulation from anaerobic consumption of cellular metabolites and concomitant photosynthetic H2-evolution. The H2 evolution process was induced upon sulfate nutrient deprivation of the cells, which reversibly inhibits photosystem-II and O2-evolution in their chloroplast. In the absence of O2, and in order to generate ATP, green algae resorted to anaerobic photosynthetic metabolism, evolved H2 in the light and consumed endogenous substrate. This study summarizes recent advances on green algal hydrogen metabolism and discusses avenues of research for the further development of this method. Included is the mechanism of a substantial tenfold starch accumulation in the cells, observed promptly upon S-deprivation, and the regulated starch and protein catabolism during the subsequent H2-evolution. Also discussed is the function of a chloroplast envelope-localized sulfate permease, and the photosynthesis-respiration relationship in green algae as potential tools by which to stabilize and enhance H2 metabolism. In addition to potential practical applications of H2, approaches discussed in this work are beginning to address the biochemistry of anaerobic H2 photoproduction, its genes, proteins, regulation, and communication with other metabolic pathways in microalgae. Photosynthetic H2 production by green algae may hold the promise of generating a renewable fuel from nature's most plentiful resources, sunlight and water. The process potentially concerns global warming and the question of energy supply and demand. PMID:17721788

  6. Inter- and intra-annual patterns of Ulva prolifera green tides in the Yellow Sea during 2007-2009, their origin and relationship to the expansion of coastal seaweed aquaculture in China.


    Keesing, John K; Liu, Dongyan; Fearns, Peter; Garcia, Rodrigo


    The large green-tide events that occurred in the Yellow Sea in 2008 (3489km(2)) and 2009 (4994km(2)) are shown to be novel events preceded only once by a much smaller event in 2007 (82km(2)). The blooms originated in the coastal area of Jiangsu province and spread north-east towards the Shandong Peninsula. The blooms grew at different rates and mesoscale variability in surface winds explained the differences in the spatial and temporal patterns of blooms in 2008 and 2009. The 2009 bloom was tracked to its origin immediately offshore of extensive intertidal flats between Yancheng and Nantong where recent rapid expansion of Porphyra aquaculture has occurred. We review published hypotheses which have been advanced to explain the occurrence of blooms and in light of our findings, we conclude that the accumulation and disposal of waste Ulva prolifera from Porphyra aquaculture rafts is the most likely cause of the blooms.

  7. Recovery of dilute metal ions by biosorption on river algae and its component

    SciTech Connect

    Fujita, Toyohisa; Kogita, Hiroki; Mamiya, Mitsuo; Yen, W.T.


    Green algae taken from an acidic mine drainage and blue-green algae take from an alkaline hot spring stream were collected and tested for their ability to recover or remove dilute metal ions. Experimental results demonstrated that unwashed blue-green algae and washed green algae effectively adsorbed base metals ions and eluted the at pH 1. It was also found that washed and dried algae adsorbed precious metal ions more effectively than unwashed algae. For example, the washed and dried blue-green algae was capable of adsorbing 0.31 kg of gold pre kg of algae. The gold from tetrachloroaurate solution which was adsorbed on washed blue-green algae was found to change to a metallic state following initial metal binding. In the case of a dilute gold complex solution leached with thiourea, only a small amount of gold could be captured by algae. Further experiments were conducted on components of the algae, such as alginic acid, agar, cellulose and chitin and mixtures of these components, in order to determine their contribution to metal adsorption characteristics. However, a mixture of these two components demonstrated both good adsorption and desorption characteristics indicating an interaction between the individual components.

  8. Green Algae as Model Organisms for Biological Fluid Dynamics*

    PubMed Central

    Goldstein, Raymond E.


    In the past decade the volvocine green algae, spanning from the unicellular Chlamydomonas to multicellular Volvox, have emerged as model organisms for a number of problems in biological fluid dynamics. These include flagellar propulsion, nutrient uptake by swimming organisms, hydrodynamic interactions mediated by walls, collective dynamics and transport within suspensions of microswimmers, the mechanism of phototaxis, and the stochastic dynamics of flagellar synchronization. Green algae are well suited to the study of such problems because of their range of sizes (from 10 μm to several millimetres), their geometric regularity, the ease with which they can be cultured and the availability of many mutants that allow for connections between molecular details and organism-level behavior. This review summarizes these recent developments and highlights promising future directions in the study of biological fluid dynamics, especially in the context of evolutionary biology, that can take advantage of these remarkable organisms. PMID:26594068

  9. Marine Polysaccharides from Algae with Potential Biomedical Applications

    PubMed Central

    de Jesus Raposo, Maria Filomena; de Morais, Alcina Maria Bernardo; de Morais, Rui Manuel Santos Costa


    There is a current tendency towards bioactive natural products with applications in various industries, such as pharmaceutical, biomedical, cosmetics and food. This has put some emphasis in research on marine organisms, including macroalgae and microalgae, among others. Polysaccharides with marine origin constitute one type of these biochemical compounds that have already proved to have several important properties, such as anticoagulant and/or antithrombotic, immunomodulatory ability, antitumor and cancer preventive, antilipidaemic and hypoglycaemic, antibiotics and anti-inflammatory and antioxidant, making them promising bioactive products and biomaterials with a wide range of applications. Their properties are mainly due to their structure and physicochemical characteristics, which depend on the organism they are produced by. In the biomedical field, the polysaccharides from algae can be used in controlled drug delivery, wound management, and regenerative medicine. This review will focus on the biomedical applications of marine polysaccharides from algae. PMID:25988519

  10. Green Algae as Model Organisms for Biological Fluid Dynamics

    NASA Astrophysics Data System (ADS)

    Goldstein, Raymond E.


    In the past decade, the volvocine green algae, spanning from the unicellular Chlamydomonas to multicellular Volvox, have emerged as model organisms for a number of problems in biological fluid dynamics. These include flagellar propulsion, nutrient uptake by swimming organisms, hydrodynamic interactions mediated by walls, collective dynamics and transport within suspensions of microswimmers, the mechanism of phototaxis, and the stochastic dynamics of flagellar synchronization. Green algae are well suited to the study of such problems because of their range of sizes (from 10 μm to several millimeters), their geometric regularity, the ease with which they can be cultured, and the availability of many mutants that allow for connections between molecular details and organism-level behavior. This review summarizes these recent developments and highlights promising future directions in the study of biological fluid dynamics, especially in the context of evolutionary biology, that can take advantage of these remarkable organisms.

  11. Determination of aliphatic hydrocarbons in the alga Himanthalia elongata.


    Punín Crespo, M O; Lage Yusty, M A


    The algae considered new foods according to Regulation CE 258/97 need a guarantee of their healthfulness before being in the European market. In this work ten samples of the brown alga Himanthalia elongata have been analyzed with the aim of verifying the absence of aliphatic hydrocarbons, due to the ability of the macroalgae to capture lipophilic organic compounds of the marine water coming from accidental or continuous leaks of raw oil and refined products, which happen each year with the growth of the industrialization and the demand of energy. The fat of the samples were Soxhlet extracted using hexane:dichloromethane (1:1) for 7h. The organic fractions were purified using silica microcolumns. The identification and quantification of the aliphatic hydrocarbons have been carried out using gas chromatography (GC) with flame ionization detector (FID). The total hydrocarbon content was between 14.8 and 40.2 microg g(-1) dry weight. PMID:14759670

  12. Sodium, potassium-atpases in algae and oomycetes.


    Barrero-Gil, Javier; Garciadeblás, Blanca; Benito, Begoña


    We have investigated the presence of K(+)-transporting ATPases that belong to the phylogenetic group of animal Na(+),K(+)-ATPases in the Pythium aphanidermatum Stramenopile oomycete, the Porphyra yezoensis red alga, and the Udotea petiolata green alga, by molecular cloning and expression in heterologous systems. PCR amplification and search in EST databases allowed one gene to be identified in each species that could encode ATPases of this type. Phylogenetic analysis of the sequences of these ATPases revealed that they cluster with ATPases of animal origin, and that the algal ATPases are closer to animal ATPases than the oomycete ATPase is. The P. yezoensis and P. aphanidermatum ATPases were functionally expressed in Saccharomyces cerevisiae and Escherichia coli alkali cation transport mutants. The aforementioned cloning and complementary searches in silicio for H(+)- and Na(+),K(+)-ATPases revealed a great diversity of strategies for plasma membrane energization in eukaryotic cells different from typical animal, plant, and fungal cells.

  13. A New Noncalcified Dasycladalean Alga from the Silurian of Wisconsin

    USGS Publications Warehouse

    LoDuca, S.T.; Kluessendorf, Joanne; Mikulic, Donald G.


    Noncalcified thalli, consisting of a narrow main axis with numerous branched hairlike laterals in whorls and a subapical array of undivided clavate laterals, from the Silurian (Llandovery) Brandon Bridge Formation of southeastern Wisconsin, constitute the basis for a new genus and species of dasycladalean alga, Heterocladus waukeshaensis. A relationship within the family Triploporellaceae is indicated by the whorled arrangement of the laterals and the absence of gametophores on mature specimens. A compilation of occurrence data suggests that noncalcified dasyclads, as a whole, were more abundant and diverse during the Ordovician and Silurian than at any other time in their history. The heterocladous thallus architecture of this alga adds to a wide range of morphological variation documented among Ordovician and Silurian dasyclads, the sum of which indicates that Dasycladales underwent a significant evolutionary radiation during the early Paleozoic.

  14. Recurring patterns in bacterioplankton dynamics during coastal spring algae blooms

    PubMed Central

    Teeling, Hanno; Fuchs, Bernhard M; Bennke, Christin M; Krüger, Karen; Chafee, Meghan; Kappelmann, Lennart; Reintjes, Greta; Waldmann, Jost; Quast, Christian; Glöckner, Frank Oliver; Lucas, Judith; Wichels, Antje; Gerdts, Gunnar; Wiltshire, Karen H; Amann, Rudolf I


    A process of global importance in carbon cycling is the remineralization of algae biomass by heterotrophic bacteria, most notably during massive marine algae blooms. Such blooms can trigger secondary blooms of planktonic bacteria that consist of swift successions of distinct bacterial clades, most prominently members of the Flavobacteriia, Gammaproteobacteria and the alphaproteobacterial Roseobacter clade. We investigated such successions during spring phytoplankton blooms in the southern North Sea (German Bight) for four consecutive years. Dense sampling and high-resolution taxonomic analyses allowed the detection of recurring patterns down to the genus level. Metagenome analyses also revealed recurrent patterns at the functional level, in particular with respect to algal polysaccharide degradation genes. We, therefore, hypothesize that even though there is substantial inter-annual variation between spring phytoplankton blooms, the accompanying succession of bacterial clades is largely governed by deterministic principles such as substrate-induced forcing. DOI: PMID:27054497

  15. Biosorption of lead and nickel by biomass of marine algae

    SciTech Connect

    Holan, Z.R.; Volesky, B. . Dept. of Chemical Engineering)


    Screening tests of different marine algae biomass types revealed a high passive biosorptive uptake of lead up to 270 mg Pb/g of biomass in some brown marine algae. Members of the order Fucales performed particularly well in this descending sequence: Fucus > Ascophyllum > Sargassum. Although decreasing the swelling of wetted biomass particles, their reinforcement by crosslinking may significantly affect the biosorption performance. Lead uptakes up to 370 mg Pb/g were observed in crosslinked Fucus vesiculosus and Ascophyllum nodosum. At low equilibrium residual concentrations of lead in solution, however, ion exchange resin Amberlite IR-120 had a higher lead uptake than the biosorbent materials. An order-of-magnitude lower uptake of nickel was observed in all of the sorbent materials examined.

  16. Recurring patterns in bacterioplankton dynamics during coastal spring algae blooms.


    Teeling, Hanno; Fuchs, Bernhard M; Bennke, Christin M; Krüger, Karen; Chafee, Meghan; Kappelmann, Lennart; Reintjes, Greta; Waldmann, Jost; Quast, Christian; Glöckner, Frank Oliver; Lucas, Judith; Wichels, Antje; Gerdts, Gunnar; Wiltshire, Karen H; Amann, Rudolf I


    A process of global importance in carbon cycling is the remineralization of algae biomass by heterotrophic bacteria, most notably during massive marine algae blooms. Such blooms can trigger secondary blooms of planktonic bacteria that consist of swift successions of distinct bacterial clades, most prominently members of the Flavobacteriia, Gammaproteobacteria and the alphaproteobacterial Roseobacter clade. We investigated such successions during spring phytoplankton blooms in the southern North Sea (German Bight) for four consecutive years. Dense sampling and high-resolution taxonomic analyses allowed the detection of recurring patterns down to the genus level. Metagenome analyses also revealed recurrent patterns at the functional level, in particular with respect to algal polysaccharide degradation genes. We, therefore, hypothesize that even though there is substantial inter-annual variation between spring phytoplankton blooms, the accompanying succession of bacterial clades is largely governed by deterministic principles such as substrate-induced forcing. PMID:27054497

  17. Recurring patterns in bacterioplankton dynamics during coastal spring algae blooms.


    Teeling, Hanno; Fuchs, Bernhard M; Bennke, Christin M; Krüger, Karen; Chafee, Meghan; Kappelmann, Lennart; Reintjes, Greta; Waldmann, Jost; Quast, Christian; Glöckner, Frank Oliver; Lucas, Judith; Wichels, Antje; Gerdts, Gunnar; Wiltshire, Karen H; Amann, Rudolf I


    A process of global importance in carbon cycling is the remineralization of algae biomass by heterotrophic bacteria, most notably during massive marine algae blooms. Such blooms can trigger secondary blooms of planktonic bacteria that consist of swift successions of distinct bacterial clades, most prominently members of the Flavobacteriia, Gammaproteobacteria and the alphaproteobacterial Roseobacter clade. We investigated such successions during spring phytoplankton blooms in the southern North Sea (German Bight) for four consecutive years. Dense sampling and high-resolution taxonomic analyses allowed the detection of recurring patterns down to the genus level. Metagenome analyses also revealed recurrent patterns at the functional level, in particular with respect to algal polysaccharide degradation genes. We, therefore, hypothesize that even though there is substantial inter-annual variation between spring phytoplankton blooms, the accompanying succession of bacterial clades is largely governed by deterministic principles such as substrate-induced forcing.

  18. Biosorption of lead and nickel by biomass of marine algae.


    Holan, Z R; Volesky, B


    Screening tests of different marine algae biomas types revealed a high passive biosorptive uptake of lead up to 270 mg Pb/g of biomass in some brown marine algae. Members of the order Fucales perfomed particularly well in this descending sequence: Fucus > Ascophyllum > Sargassum. Although decreasing the swelling of wetted biomass particles, their reinforcement by crosslinking may significantly affect the biosorption performance. Lead uptakes up to 370 mg Pb/g were observed in crosslinked Fucus vesiculosus and Ascophyllum nodosum. At low equilibrium residual concentrations of lead in solution, however, ion exchange resin Amberlite IR-120 had a higher lead uptake than the biosorbent materials. An order-of-magnitude lower uptake of nickel was observed in all of the sorbent materials examined. (c) 1994 John Wiley & Sons, Inc. PMID:18615510

  19. Hydrostatic factors affect the gravity responses of algae and roots

    NASA Technical Reports Server (NTRS)

    Staves, Mark P.; Wayne, Randy; Leopold, A. C.


    The hypothesis of Wayne et al. (1990) that plant cells perceive gravity by sensing a pressure differential between the top and the bottom of the cell was tested by subjecting rice roots and cells of Caracean algae to external solutions of various densities. It was found that increasing the density of the external medium had a profound effect on the polar ratio (PR, the ratio between velocities of the downwardly and upwardly streaming cytoplasm) of the Caracean algae cells. When these cells were placed in solutions of denser compound, the PR decreased to less than 1, as the density of the external medium became higher than that of the cell; thus, the normal gravity-induced polarity was reversed, indicating that the osmotic pressure of the medium affects the cell's ability to respond to gravity. In rice roots, an increase of the density of the solution inhibited the rate of gravitropism. These results agree with predictions of a hydrostatic model for graviperception.

  20. Bioremoval of toxic elements with aquatic plants and algae

    SciTech Connect

    Wang, T.C.; Ramesh, G.; Weissman, J.C.; Varadarajan, R.; Benemann, J.R.


    Aquatic plants were screened to evaluate their ability to adsorb dissolved metals. The plants screened included those that are naturally immobilized (attached algae and rooted plants) and those that could be easily separated from suspension (filamentous microalgae, macroalgae, and floating plants). Two plants were observed to have high adsorption capabilities for cadmium (Cd) and zinc (Zn) removal: one blue green filamentous alga of the genus Phormidium and one aquatic rooted plant, water milfoil (Myriophyllum spicatum). These plants could also reduce the residual metal concentration to 0.1 mg/L or less. Both plants also exhibited high specific adsorption for other metals (Pb, Ni, and Cu) both individually and in combination. Metal concentrations were analyzed with an atomic absorption spectrophotometer (AAS).