Sample records for alligator river national

  1. Herpetofaunal diversity of Alligator River National Wildlife Refuge, North Carolina

    USGS Publications Warehouse

    Meyers, J.M.; Pike, D.A.


    In the past century, habitat alteration and fragmentation have increased dramatically, which increases the need for improving our understanding of how species and biological communities react to these modifications. A national strategy on biological diversity has focused attention on how these habitat modifications affect species, especially herpetofauna (i.e., changes in species richness, community evenness and similarity, and dominant/rare species). As part of this strategy, we surveyed Alligator River National Wildlife Refuge, a coastal, mixed second-growth forested swamp (MFS) and pocosin wetland (PW), in North Carolina for amphibians and reptiles from September 2000 to August 2001. We randomly selected three sites (3 x 3 km) in two major habitat types (MFS, PW) and completed random surveys and trapping using transects, quadrats, nighttime aural road surveys, drift fences, canal transects, coverboards, incidental captures, and evening road surveys. We also collected herpetofauna opportunistically throughout the refuge to establish an updated species list. For analysis, we used Shannon-Weiner species diversity (H'), evenness (1'), species richness and species detectability (COMDYN4), and community percent similarity index to determine herpetofaunal community differences. We estimated 39 species in MFS and 32 species in PW (P < 0.10). Species detectability was similar between habitats (0.84 to 0.86). More reptilian species (+ 31 %) inhabited MFS than PW, but estimated amphibian species richness was identical (17 spp.). H' was higher (P < 0.000 I) for PW (2.6680) than for MFS (2.1535) because of lower J' in the latter (0.6214 vs. 0.8010). Dominance of three Rana species caused lower J' and H' in MFS. Similarity between the communities was 56.6%; we estimated 22-24 species in common for each habitat (95% CI = 18 to 31 spp.). We verified 49 of the 52 herpetofaunal species on the refuge that were known to exist in the area. Restoration of natural water flows may

  2. 75 FR 34365 - Safety Zone, Alligator River, NC

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone, Alligator River, NC AGENCY: Coast Guard... the waters of the Alligator River at East Lake, North Carolina. The safety zone is intended to... on the Alligator River makes safety zone regulations necessary to provide for the safety...

  3. Gender differences in haemogregarine infections in American alligators (Alligator mississippiensis) at Savannah River, South Carolina, USA.


    Davis, Andrew K; Horan, Robert V; Grosse, Andrew M; Harris, Bess B; Metts, Brian S; Scott, David E; Tuberville, Tracey D


    We report a host gender bias in haemogregarine infection characteristics in the American alligator (Alligator mississippiensis) at the Savannah River Site, South Carolina, USA. Prevalence and severity in female alligators was higher than it was in males. The reason for this pattern is not clear.

  4. International Alligator Rivers Analog Project

    SciTech Connect

    Bichard, G.F.


    The Australian Nuclear Science and Technology Organization (ANSTO), the Japan Atomic Energy Research Institute, the Swedish Nuclear Power Inspectorate, the U.K. Department of the Environment, the US Nuclear Regulatory Commission (NRC), and the Power Reactor and Nuclear Fuel Development Corporation of Japan are participating under the aegis of the Nuclear Energy Agency in the International Alligator Rivers Analog Project. The project has a duration of 3 yr, starting in 1988. The project has grown out of a research program on uranium ore bodies as analogs of high-level waste (HLW) repositories undertaken by ANSTO supported by the NRC. A primary objective of the project is to develop an approach to radionuclide transport model validation that may be used by the participants to support assessments of the safety of radioactive waste repositories. The approach involves integrating mathematical and physical modeling with hydrological and geochemical field and laboratory investigations of the analog site. The Koongarra uranium ore body has been chosen as the analog site because it has a secondary ore body that has formed over the past million years as a result of leaching by groundwater flowing through fractures in the primary ore body.

  5. Ecological studies on the American alligator (Alligator mississippiensis) on the Savannah River Plant

    SciTech Connect

    Seigel, R.A.; Brandt, L.A.; Knight, J.L.; Novak, S.S.


    The American alligator (Alligator mississippiensis) is the largest vertebrate of the Savannah River Plant (SRP), reaching a maximum length of 3.7 meters (12 feet) and weighing up to 175 kg (385 pounds). Currently, populations in coastal South Carolina are considered Threatened, whereas populations in inland areas (such as the SRP) are still Endangered. Because of their legal status and economic and ecological importance, it is important to determine the environmental impacts of SRP operations on the local alligator population. The major objectives under the Endangered Species Program of the Comprehensive Cooling Water Study (CCWS) were as follows: (1) document and compare the present status and distribution of alligators on the SRP to previous surveys, in order to determine long-term changes in population abundance; (2) establish baseline population and ecological parameters of the Steel Creek population so that the ecological effects of L-Reactor operations can be determined, and (3) conduct ecological research on the immediate impacts of thermal effluents on American alligators. Gladden et al., (1985) summarized data on previous population surveys, temporal changes in the Par Pond population, preliminary results of the Steel Creek surveys and Savannah River Ecology Laboratory (SREL) research on the effects of thermal effluents. This report summarizes the current status of the SRP population, presents data on the abundance, movement patterns and activity cycles of the Steel Creek population, and presents additional data on the effect of cooling water releases on alligator ecology and behavior.

  6. Population status of the American alligator on the Savannah River Plant, South Carolina

    SciTech Connect

    Murphy, T.M.


    Estimates are presented of alligator numbers, size distribution, sex ratios, reproductive effort, and population trends for all major components of the entire Savannah River Plant (SRP) alligator population. Savannah River Plant operations have impacted the alligator population in many different ways. The formation of man-made reservoirs has dramatically increased the amount of aquatic habitat available to alligators and has therefore increased the carrying capacity of the SRP site for this species. The thermal alteration of aquatic habitats on the SRP has also impacted the resident alligator population. Temperature elevations of aquatic habitat to greater than 38/sup 0/C result in the loss of this habitat to alligators. Moderate thermal increases on the other hand are responded to by alligator movement. The current information available on the alligators of the SRP suggests the following future trends: low density populations distant from thermally altered areas will continue at a low density with the exception of localized increases.

  7. Ecological studies on the American alligator (Alligator mississippiensis) on the Savannah River Plant. Comprehensive Cooling Water Study: Final report

    SciTech Connect

    Seigel, R.A.; Brandt, L.A.; Knight, J.L.; Novak, S.S.


    The American alligator (Alligator mississippiensis) is the largest vertebrate of the Savannah River Plant (SRP), reaching a maximum length of 3.7 meters (12 feet) and weighing up to 175 kg (385 pounds). Currently, populations in coastal South Carolina are considered Threatened, whereas populations in inland areas (such as the SRP) are still Endangered. Because of their legal status and economic and ecological importance, it is important to determine the environmental impacts of SRP operations on the local alligator population. The major objectives under the Endangered Species Program of the Comprehensive Cooling Water Study (CCWS) were as follows: (1) document and compare the present status and distribution of alligators on the SRP to previous surveys, in order to determine long-term changes in population abundance; (2) establish baseline population and ecological parameters of the Steel Creek population so that the ecological effects of L-Reactor operations can be determined, and (3) conduct ecological research on the immediate impacts of thermal effluents on American alligators. Gladden et al., (1985) summarized data on previous population surveys, temporal changes in the Par Pond population, preliminary results of the Steel Creek surveys and Savannah River Ecology Laboratory (SREL) research on the effects of thermal effluents. This report summarizes the current status of the SRP population, presents data on the abundance, movement patterns and activity cycles of the Steel Creek population, and presents additional data on the effect of cooling water releases on alligator ecology and behavior.

  8. 33 CFR 165.T05-0091 - Safety Zone; Alligator River, NC.

    Code of Federal Regulations, 2010 CFR


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Alligator River, NC... SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS... Safety Zone; Alligator River, NC. (a) Definitions. For the purposes of this section, Captain of the...

  9. Alligator rivers analogue project an OECD/NEA international project

    SciTech Connect

    Duerden, P.; Airey, P.; Pescatore, C.


    The Koongarra uranium deposit in the Alligator Rivers Region of the Northern Territory of Australia was studied as a natural analogue of the far field behaviour of high level waste repositories following groundwater ingress. A number of mathematical modelling approaches were developed for processes as diverse as groundwater transport, host rock weathering, radionuclide sorption, evolution of the uranium dispersion fan and the distribution of uranium series nuclides between mineral assemblages in weathered host rock. Some of these models are relevant to performance assessment at the level of individual processes and subsystem performance. Through the project, new insights into the application of the natural analogue approach to the assessment of potential waste repository sites were obtained.

  10. Seasonal Variation of Total Mercury Burden in the American Alligator (Alligator Mississippiensis) at Merritt Island National Wildlife Refuge (MINWR), Florida

    NASA Technical Reports Server (NTRS)

    Nilsen, Frances M.; Dorsey, Jonathan E.; Long, Stephen E.; Schock, Tracey B.; Bowden, John A.; Lowers, Russell H.; Guillette, Louis J., Jr.


    Seasonal variation of mercury (Hg) is not well studied in free-ranging wildlife. Atmospheric deposition patterns of Hg have been studied in detail and have been modeled for both global and specific locations with great accuracy and correlates to environment impact. However, monitoring these trends in wildlife is complicated due to local environmental parameters (e.g., rainfall, humidity, pH, bacterial composition) that can affect the transformation of atmospheric Hg to the biologically available forms. Here, we utilized an abundant and healthy population of American alligators (Alligator mississippiensis) at Merritt Island National Wildlife Refuge (MINWR), FL, and assessed Hg burden in whole blood samples over a span of 7 years (2007 2014; n 174) in an effort to assess seasonal variation of total [Hg]. While the majority of this population is assumed healthy, 18 individuals with low body mass indices (BMI, defined in this study) were captured throughout the 7 year sampling period. These individual alligators exhibited [Hg] that were not consistent with the observed overall seasonal [Hg] variation, and were statistically different from the healthy population of alligators. The alligators with low BMI had elevated concentrations of Hg compared to their age/sex/season matched counterparts with normal BMI. Statistically significant differences were found between the winter and spring seasons for animals with normal BMI. The data in this report supports the conclusion that organismal total [Hg] do fluctuate directly with seasonal deposition rates as well as other seasonal environmental parameters, such as average rainfall and prevailing wind direction. This study highlights the unique environment of MINWR to permit annual assessment of apex predators, such as the American alligator, to determine detailed environmental impact of contaminants of concern.

  11. Mercury in alligators (Alligator mississippiensis) in the southeastern United States

    USGS Publications Warehouse

    Jagoe, C.H.; Arnold-Hill, B.; Yanochko, G.M.; Winger, P.V.; Brisbin, I.L.


    Mercury methylation may be enhanced in wetlands and humic-rich, blackwater systems that crocodiles and alligators typically inhabit. Given their high trophic level and long life-spans, crocodilians could accumulate significant burdens of Hg. Our objectives were to survey Hg concentrations in alligators from several areas in the southeastern United States to test their utility as sentinels of Hg contamination, to examine relationships among Hg concentrations in various tissues and to look for any differences in tissue Hg concentrations among locations. We measured total Hg concentrations in alligators collected in the Florida Everglades (n = 18), the Okefenokee National Wildlife Refuge, Georgia (n = 9), the Savannah River Site (SRS), South Carolina (n = 49) and various locations in central Florida ( n = 21), sampling tissues including blood, brain, liver, kidney, muscle, bone, fat, spleen, claws and dermal scutes. Alligators from the Everglades were mostly juvenile, but Hg concentrations in tissues were high (means: liver 41.0, kidney 36.4, muscle 5.6 mg Hg/kg dry wt.). Concentrations in alligators from other locations in Florida were lower (means: liver 14.6, kidney 12.6, muscle 1.8 mg Hg/kg dry wt.), although they tended to be larger adults. Alligators from the Okefenokee were smallest and had the lowest Hg concentrations (means: liver 4.3, kidney 4.8, muscle 0.8 mg Hg/kg dry wt.). At some locations, alligator length was correlated with Hg concentrations in some internal organs. However, at three of the four locations, muscle Hg was not related to length. Tissue Hg concentrations were correlated at most locations; however, claw or dermal scute Hg explained less than 74% of the variation of Hg in muscle or organs, suggesting readily-obtained tissues, such as scutes or claws, have limited value for nondestructive screening of Hg in alligator populations.

  12. Mining in the Alligator Rivers Region, northern Australia: assessing potential and actual effects on ecosystem and human health.


    van Dam, R A; Humphrey, C L; Martin, P


    This paper presents an overview of issues related to surface water contamination arising from uranium mining activities in the Alligator Rivers Region (ARR) of northern Australia, and a program of research and monitoring that must assess the potential and actual effects on ecosystem and human health. The program of assessing effects on aquatic ecosystems involves a four-tiered approach including the derivation of local water quality guideline trigger values, direct toxicity assessment of mine waters prior to their release, creekside or in situ monitoring for early warning of adverse effects during mine water release, and longer-term monitoring of macroinvertebrate and fish communities. Bioaccumulation in aquatic biota is also assessed, and is an issue of importance not only to ecosystem health, but also to the health of local Aboriginal people. The aquatic animals they consume represent potential sources of radiological dose, and as a result, a major component of the program to assess potential effects on human health is the prediction of doses to Aboriginal people living downstream of mining activities. Acknowledging the assumptions and uncertainties, the calculation of concentration factors for local aquatic (and other) food sources allows the prediction of potential radiological exposure to people following hypothetical mine water releases. The approaches described form the basis of best-practice protocols that are relevant at both regional and national levels.

  13. Spatial and temporal variability in estuary habitat use by American alligators

    USGS Publications Warehouse

    Fujisaki, Ikuko; Hart, Kristen M.; Cherkiss, Michael S.; Mazzotti, Frank J.; Beauchamp, Jeffrey S.; Jeffery, Brian M.; Brandt, Laura A.


    Estuarine habitat occupied by Alligator mississippiensis, a primarily freshwater species, is spatially and temporally heterogeneous largely due to a salinity gradient that fluctuates. Using long-term night light survey data, we examined seasonal patterns in alligators’ habitat use by size classes in midstream and downstream estuary zones of Shark River, Everglades National Park, in southern Florida. We observed predominantly large-sized alligators (total length ≥ 1.75 m); observations of alligators in the small size classes (0.5 m ≤ total length < 1.25 m) were rare especially in the higher-salinity downstream zone. The density of alligators in the downstream zone was lower than that of the midstream zone during the dry season when salinity increases due to reduced precipitation. Conversely, the density of the large size alligators was higher in the downstream zone than in the midstream zone during the wet season, likely because of reduced salinity. We also found a significant declining trend over time in the number of alligators in the dry season, which coincides with the reported decline in alligator relative density in southern Florida freshwater wetlands. Our results indicated high adaptability of alligators to the fluctuating habitat conditions. Use of estuaries by alligators is likely driven in part by physiology and possibly by reproductive cycle, and our results supported their opportunistic use of estuary habitat and ontogenetic niche shifts.

  14. Thermoluminescence and excess 226Ra decay dating of late Quaternary fluvial sands, East Alligator River, Australia

    NASA Astrophysics Data System (ADS)

    Murray, Andrew; Wohl, Ellen; East, Jon


    Thermoluminescence (TL) dating was applied to seven samples of siliceous fluvial sands from the East Alligator River of Northern Australia, giving ages ranging from modern to 6000 yr B.P. Two methods of estimating the equivalent dose (ED), total bleach and regenerative, were applied to the 90- to 125-μm quartz fraction of the samples in order to determine the reliability and internal consistency of the technique. High-resolution γ and α spectroscopy were used to measure radionuclide contents; these measurements revealed an excess 226Ra activity compared with 230Th. This excess decreased with depth, and was used directly to derive mean sedimentation rates, and thus sediment ages. Both this method and one 14C date confirmed the validity of the TL values, which increased systematically with depth and were consistent with site stratigraphy. TL was of limited use in the dating of these late Holocene deposits because of age uncertainties of 500 to 1600 yr, resulting from a significant residual ED. This residual probably resulted from incomplete bleaching during reworking upstream of the sampling site. For Pleistocene deposits, the residual ED will be less significant because of higher total EDs, and TL dates will be correspondingly more accurate.

  15. A big alligator snacks on a smaller alligator

    NASA Technical Reports Server (NTRS)


    A large alligator attacks and eats a smaller one in a natural display of cannibalism. Although this event has been observed infrequently by Kennedy Space Center's staff photographers, it is common feeding behavior among the wild alligator population on the space center. Alligators are carnivorous and will eat any living thing that crosses their paths and is small enough for them to kill. For this reason, it is dangerous to feed wild alligators, and in Florida, it is also illegal. Kennedy Space Center is located on the Merritt Island National Wildlife Refuge which is operated by the U.S. Fish and Wildlife Service.

  16. A thermal history of the Proterozoic East Alligator River Terrain, N.T., Australia: a fission track study

    NASA Astrophysics Data System (ADS)

    Koul, Sohan L.; Wilde, A. R.; Tickoo, Awtar K.


    Radiometric data indicate a major thermal event in Proterozoic rocks of the East Alligator River Terrain, at 1870 Ma. These data, together with metamorphic mineral assemblages, demonstrate peak temperatures in excess of 600 ° C, close to the melting temperature of more deeply buried rocks. A cooling rate following peak metamorphism of 3°C/Ma is suggested. Fission-track dates of peak metamorphic phases, however, reveal a thermal event (or events), after 1650 Ma, rather than the peak metamorphic event. This rise in temperature was the result of thermal blanketing of the metamorphic basement by Carpentarian sediments and anomalous radiogenic heat flow from underlying granitoid gneiss. The temperatures so generated (≥ 175 ° C) were insufficient to reset Rb-Sr and K-Ar systems, but are clearly in excess of F.T. annealing temperatures for all the phases investigated. A cooling history, extending over 1000 m.y. and reflecting gradual erosion of the sedimentary cover, is revealed. This history is consistent with the extraordinary tectonic stability of the region. The importance of F.T. studies in establishing a thermal history is underscored, particularly when maximum temperatures experienced were less than those required to reset Rb-Sr and K-Ar systems.

  17. 36 CFR 7.89 - New River Gorge National River.

    Code of Federal Regulations, 2011 CFR


    ... 36 Parks, Forests, and Public Property 1 2011-07-01 2011-07-01 false New River Gorge National River. 7.89 Section 7.89 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.89 New River Gorge National River....

  18. Nonpineal melatonin in the alligator (Alligator mississippiensis).


    Roth, J J; Gern, W A; Roth, E C; Ralph, C L; Jacobson, E


    All living and most fossil representatives of the reptilian subclass Archosauria lack pineal bodies. Arrhythmic, low-level, nonpineal melatonin is present, however, in the blood of Alligator mississippiensis. Although pineal bodies have been implicated in circadian phenomena, these results suggest that arrhytmic melatonin in alligators may not be involved incircadian events and indicate that the pineal is not the only source of the hormone melatonin. The evolutionary loss of the pineal in Archosauria occurred during the Mesozoic, and era noted for its seasonal stability. Arrhythmic melatonin titers inalligators and pineal loss in alligators and other archosaurs may be related to Mesozoic seasonal stability.

  19. The Nation's Rivers

    ERIC Educational Resources Information Center

    Wolman, M. Gordon


    Illustrates difficulties in measuring long term changes in water temperature and content of dissolved oxygen, inorganic ions, radiation, pesticides, and trash and debris by reference to selected U. S. river systems. Concludes that observations to detect polluters may not provide data for assessing trends and trend reversals. (AL)


    EPA Science Inventory

    We examined variation in plasma thyroxine (T4) in juvenile American alligators (Alligator mississippiensis) collected from three sites within the Kissimmee River drainage basin (FL, USA). Based on historical sediment data, Moonshine Bay served as the low contaminant exposure site...

  1. 36 CFR 7.89 - New River Gorge National River.

    Code of Federal Regulations, 2014 CFR


    ... River Gorge National River? (i) In addition to the applicable provisions in 36 CFR part 4, all... Bicycle Use—North to South Hawks Nest Connector Trail Fayetteville Trail Park Loop Trail Timber...

  2. A mother alligator protects her young

    NASA Technical Reports Server (NTRS)


    In the water near Kennedy Space Center, a mother alligator gathers her six offspring. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  3. An algae-covered alligator rests warily

    NASA Technical Reports Server (NTRS)


    An algae-covered alligator keeps a wary eye open as it rests in one of the ponds at Kennedy Space Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  4. 109. Doughton Park Recreation Area. View of alligator back and ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    109. Doughton Park Recreation Area. View of alligator back and the parkway seen from bluff mountain. Looking west. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  5. American Alligator Research on the Kennedy Space Center

    NASA Technical Reports Server (NTRS)

    Lowers, Russell H.


    This slide presentation reviews the research conducted at the Kennedy Space Center on the American Alligator. The objectives of the research were to establish life history baseline at the Kennedy Space Center and at the Merit Island National Wildlife Reserve (MINWR). Some of the factors that were examined are: nesting success, movement patterns, and population structure. Another objective was to determine the overall health of the alligator population, by analyzing blood and tissue chemistry, and urine analysis. A third objective was to compare alligators at KSC/MINWR to the statewide population. Some of the results are shown in charts and graphs.

  6. Levels of mercury in alligators (Alligator mississippiensis) collected along a transect through the Florida Everglades

    USGS Publications Warehouse

    Rumbold, D.G.; Fink, L.E.; Laine, K.A.; Niemczyk, S.L.; Chandrasekhar, T.; Wankel, Scott D.; Kendall, C.


    As part of a multi-agency study of alligator health, 28 American alligators (Alligator mississippiensis) were captured along a transect through the Florida Everglades in 1999. Liver and tail muscle tissues were sampled and analyzed on a wet weight basis for total mercury (THg) using cold-vapor atomic absorption spectrophotometry. All tissues had detectable concentrations of THg that ranged from 0.6 to 17 mg/kg in liver and from 0.1 to 1.8 mg/kg in tail muscle. THg was more concentrated in liver tissue than tail muscle, but levels were highly correlated between tissues. THg concentrations in tissue differed significantly among locations, with animals from Everglades National Park (ENP) having mean concentrations of THg in liver (10.4 mg/kg) and tail muscle (1.2 mg/kg) that were two-fold higher than basin-wide averages (4.9 and 0.64 mg/kg, respectively). The reasons for higher contamination of ENP alligators were unclear and could not be explained by differences in sex, length, weight or animal age. While ??15N values were positively correlated with THg concentrations in tail muscle, spatial patterns in isotopic composition did not explain the elevated THg levels in ENP alligators. Therefore, it appears that ENP alligators were more highly exposed to mercury in their environment than individuals in other areas. Comparisons to a previous survey by Yanochko et al. [Arch Environ Contam Toxicol 32 (1997) 323] suggest that mercury levels have declined in some Everglades alligators since 1994. ?? 2002 Elsevier Science B.V. All rights reserved.

  7. National River and Stream Assessment Monitoring Design

    EPA Science Inventory

    The USEPA designed the National River and Stream Assessment (NRSA) in 2007 and field sampling was completed in 2008-9. The objective of the assessment is to estimate the ecological condition of river and streams nationally. This paper describes the national survey design and re...

  8. Analysis of the landsat remote sensing images of the types of habitats of Yangtze alligators

    NASA Astrophysics Data System (ADS)

    Huang, Zhujian; Lin, Hengzhang; Zhang, Shengkai


    The Chinese “Yangtze” alligator is a rare reptile that has been listed as an “endangered species” by the United Nations, so its preservation has become an urgent task. A study of its habitats through analysis of their Landsat images will provide a scientific basis for the government departments concerned to select the best locations for its breeding. The Chinese alligator is a subtropical reptile of freshwater rivers, lakes and ponds. Found only in China, it is now distributed only in the border region between the three provinces of Anhui, Zhejiang and Jiangsu. On the basis of previous investigations by Chinese scientists, and from an analysis and interpretation of their Landsat images, we made a special study, review, and classification of the natural environment of the alligator’s present habitats (and the modern changes in the natural background of these hatitats) so that the government departments concerned with the preservation of the reptiles may have a scientific basis for determining the best locations for the breeding and propagation of the alligator.

  9. An alligator basks in the sun at KSC.

    NASA Technical Reports Server (NTRS)


    On the bank of a levee near Schwartz Rd. at Kennedy Space Center, an alligator suns itself with a wary eye out for trespassers. Nearly 5,000 alligators can be found in canals, ponds, and waterways throughout the Center and the Merritt Island National Wildlife Refuge, which shares a boundary with the Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Wildlife Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  10. Hydrologic data from Nation, Kandik, and Yukon rivers, Yukon-Charley Rivers National Preserve, Alaska

    USGS Publications Warehouse

    Brabets, Timothy P.


    Flow data were collected from two adjacent rivers in Yukon?Charley Rivers National Preserve, Alaska?the Nation River (during 1991?2000) and the Kandik River (1994?2000)?and from the Yukon River (1950?2000) at Eagle, Alaska, upstream from the boundary of the preserve. These flow records indicate that most of the runoff from these rivers occurs from May through September and that the average monthly discharge during this period ranges from 1,172 to 2,210 cubic feet per second for the Nation River, from 1,203 to 2,633 cubic feet per second for the Kandik River, and from 112,000 to 224,000 cubic feet per second for the Yukon River. Water-quality data were collected for the Nation River and several of its tributaries from 1991 to 1992 and for the Yukon River at Eagle from 1950 to 1994. Three tributaries to the Nation River (Waterfall Creek, Cathedral Creek, and Hard Luck Creek) have relatively high concentrations of calcium, magnesium, and sulfate. These three watersheds are underlain predominantly by Paleozoic and Precambrian rocks. The Yukon River transports 33,000,000 tons of suspended sediment past Eagle each year. Reflecting the inputs from its major tributaries, the water of the Yukon River at Eagle is dominated by calcium?magnesium bicarbonate.


    NASA Technical Reports Server (NTRS)


    A 12-foot alligator worked his way up from the turn basin at Press Site 39 to the grandstand seats. The toothy reptile was later wrangled by wildlife trappers who relocated him to a less populated area on KSC. The alligator is one of approximately 4,000 on KSC/Merritt Island National Wildlife Refuge.

  12. Fibrous trabeculae in the liver of alligator (alligator mississippiensis).


    Beresford, W A


    In the mature alligator, fibrous trabeculae run from the portal areas and capsule through the hepatic parenchyma. The extent of these trabeculae becomes clear only after staining for collagen with, for example, Fast green or Picrosirius red. The trabeculae are less well developed in young caiman. The alligator's liver might use the trabeculae to withstand thrashing of the body.

  13. The 'Angry Alligator'

    NASA Technical Reports Server (NTRS)


    The Augmented Target Docking Adapter (ATDA) as seen from the Gemini 9 spacecraft during one of their three rendezvous in space. The ATDA and Gemini 9 spacecraft are 66.5 ft. apart. Failure of the docking adapter protective cover to fully separate on the ATDA prevented the docking of the two spacecraft. The ATDA was described by the Gemini 9 crew as an 'angry alligator.'

  14. Perfluorinated Alkyl Acids in Plasma of American Alligators (Alligator Mississippiensis) from Florida and South Carolina

    NASA Technical Reports Server (NTRS)

    Bangma, Jacqueline T.; Bowden, John A.; Brunell, Arnold M.; Christie, Ian; Finnell, Brendan; Guillette, Matthew P.; Jones, Martin; Lowers, Russell H.; Rainwater, Thomas R.; Reiner, Jessica L.; Wilkinson, Philip M.; Guillette, Louis J., Jr.


    This study aimed to quantitate fourteen perfluoroalkyl acids (PFAAs) in 125 adult American alligators at twelve sites across the southeastern US. Of those fourteen PFAAs, nine were detected in 65% - 100% of the samples: PFOA, PFNA, PFDA, PFUnA, PFDoA, PFTriA, PFTA, PFHxS, and PFOS. Males (across all sites) showed significantly higher concentrations of four PFAAs: PFOS (p = 0.01), PFDA (p = 0.0003), PFUnA (p = 0.021), and PFTriA (p = 0.021). Concentrations of PFOS, PFHxS, and PFDA in plasma were significantly different among the sites in each sex. Alligators at Merritt Island National Wildlife Refuge and Kiawah Nature Conservancy both exhibited some of the highest PFOS concentrations (medians 99.5 ng/g and 55.8 ng/g respectively) in plasma measured to date in a crocodilian species. A number of positive correlations between PFAAs and snout-vent length (SVL) were observed in both sexes suggesting PFAA body burdens increase with increasing size. In addition, several significant correlations among PFAAs in alligator plasma may suggest conserved sources of PFAAs at each site throughout the greater study area. This study is the first to report PFAAs in American alligators, reveals potential PFAA hot spots in Florida and South Carolina, and provides and additional contaminant of concern when assessing anthropogenic impacts on ecosystem health.

  15. A mother alligator protects her young

    NASA Technical Reports Server (NTRS)


    American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  16. Variations in hepatic biomarkers in American alligators (Alligator mississippiensis) from three sites in Florida, USA.


    Gunderson, Mark P; Pickett, Melissa A; Martin, Justin T; Hulse, Elizabeth J; Smith, Spenser S; Smith, Levi A; Campbell, Rachel M; Lowers, Russell H; Boggs, Ashley S P; Guillette, Louis J


    Sub-individual biomarkers are sub-lethal biological responses commonly used in the assessment of wildlife exposure to environmental contaminants. In this study, we examined the activity of glutathione-s-transferase (GST) and lactate dehydrogenase (LDH), and metallothionein (MT) concentrations among captive-raised alligator hatchlings, wild-caught juveniles, and wild-caught adults. Juveniles and adults were collected from three locations in Florida (USA) with varying degrees of contamination (i.e. Lake Apopka (organochlorine polluted site), Merritt Island National Wildlife Refuge (NWR) (metal polluted site), and Lake Woodruff NWR (reference site)). We examined whether changes in the response of these three biomarkers were age and sex dependent or reflected site-specific variations of environmental contaminants. Juvenile alligators from Merritt Island NWR had higher MT concentrations and lower GST activity compared to those from the other two sites. This outcome was consistent with higher metal pollution at this location. Sexually dimorphic patterns of MT and GST (F > M) were observed in juvenile alligators from all sites, although this pattern was not observed in adults. GST activity was lower in captive-raised alligators from Lake Apopka and Merritt Island NWR as compared to animals from Lake Woodruff NWR, suggesting a possible developmental modulator at these sites. No clear patterns were observed in LDH activity. We concluded that GST and MT demonstrate age and sex specific patterns in the alligators inhabiting these study sites and that the observed variation among sites could be due to differences in contaminant exposure. PMID:27111470


    EPA Science Inventory

    Although folliculogenesis and oogenesis have been observed in numerous reptiles, these phenomena have not been described in detail in a crocodilian. Oogenesis and histological features of the adult ovary of Alligator mississippiensis are described. Using a complex process, the ov...

  18. Evaluating recent taxonomic changes for alligator snapping turtles (Testudines: Chelydridae).


    Folt, Brian; Guyer, Craig


    The Alligator Snapping Turtle (Macrochelys temminckii Troost in Harlan 1835, sensu lato) has been historically treated as a single, wide-ranging species, until a recently published paper by Thomas et al. (2014; hereafter Thomas et al.) analyzed variation in morphology and mitochondrial DNA sequence data to describe two new species of Macrochelys: the Apalachicola Alligator Snapping Turtle (Macrochelys apalachicolae Thomas, Granatosky, Bourque, Krysko, Moler, Gamble, Suarez, Leone & Roman 2014) and the Suwannee Alligator Snapping Turtle (Macrochelys suwanniensis Thomas, Granatosky, Bourque, Krysko, Moler, Gamble, Suarez, Leone & Roman 2014). The specific epithet temminckii was retained for populations in drainages from the Yellow River in Alabama and Florida west to the San Antonio River, Texas. Because populations of Macrochelys have been historically exploited by humans (Pritchard 1989) and the life-history strategies of large, long-lived turtles make them susceptible to declines from harvest (Congdon et al. 1994), a sound understanding of species delimitation and richness is critical for the conservation of alligator snapping turtles, especially if the acceptance of a widely distributed species disguises the presence of multiple, smaller-ranged species. PMID:25947748

  19. Essential fatty acid nutrition of the American alligator (Alligator mississippiensis).


    Staton, M A; Edwards, H M; Brisbin, I L; Joanen, T; McNease, L


    The essential fatty acid (EFA) nutrition of young American alligators (Alligator mississippiensis) was examined by feeding a variety of fats/oils with potential EFA activity. Over a 12-wk period, alligators fed diets containing 2.5 or 5.0% chicken liver oil grew longer and heavier and converted feed to body mass more efficiently than alligators fed other fat/oil combinations that lacked or contained only trace amounts of arachidonic acid [20:4(n-6)]. Alligators fed an EFA-deficient diet (containing only coconut fat as the dietary fat) were the slowest-growing animals and converted feed to body mass least efficiently. However, over a 41-wk feeding period, alligators fed this diet showed no obvious external signs of deficiency other than being reduced in size and unthrifty. Fatty acid composition of heart, liver, muscle, skin and adipose tissue lipids was influenced markedly by dietary fat composition. Tissues varied significantly in response to dietary fat composition. Heart lipids contained the lowest levels of short- and medium-chain fatty acids and the highest levels of arachidonic acid. Arachidonic acid levels were less influenced by diet than were levels of other 20- and 22-carbon polyunsaturated fatty acids. Radiotracer studies indicated that linoleic acid was converted to arachidonic acid in the liver. Nevertheless, tissue arachidonic acid levels also appeared to be maintained by concentration from dietary sources and selective conservation. It appears that a dietary source of arachidonic acid may be required for a maximum rate of growth.

  20. River Raisin National Battlefield Act

    THOMAS, 111th Congress

    Rep. Dingell, John D. [D-MI-15


    02/04/2009 Referred to the Subcommittee on National Parks, Forests and Public Lands. (All Actions) Notes: For further action, see H.R.146, which became Public Law 111-11 on 3/30/2009. Tracker: This bill has the status IntroducedHere are the steps for Status of Legislation:

  1. Mortality of American alligators attributed to cannibalism

    USGS Publications Warehouse

    Delany, Michael F.; Woodward, Allan R.; Kiltie, Richard A.; Moore, Clinton T.


    Mortality of juvenile (Alligator mississippiensis) attributed to cannibalism on Orange Lake, Florida was examined. Alligator web tags used in mark–recapture studies were found in 12% of 267 stomachs sampled from alligators ≥168 cm TL. Captive alligators retained 76% of force-fed tags during a 588-d tag-retention trial. Models relating the probability of tag recovery to the annual probabilities of juvenile survival, cannibalism, tag retention, adult survival, and adult harvest suggested that cannibalism may on average remove 6–7% of the juvenile alligator population annually. Vulnerability continued to 140 cm TL (age 6–8 yr). Cannibalism of juveniles may serve to regulate the alligator population on Orange Lake. Alligator cannibalism may vary widely among populations, depending on demography and environmental conditions. The role and importance of cannibalism in alligator population dynamics should be more fully assessed and environmental and population factors that influence cannibalism identified to better evaluate management programs.


    NASA Technical Reports Server (NTRS)


    Harold O'Connor, manager of the Merritt Island Wildlife Refuge, watches a 10-foot-long alligator inch its way toward a busy highway at the Kennedy Space Center. O'Connor, aided by assistant Jerome Carroll, not shown, guided the large gator to safety in a nearby pond, several miles south of the Vehicle Assembly Building, in background. The Apollo 12 astronauts will be launched no earlier than November 14, 1969, from the Kennedy Space Center on the Nation's second manned lunar landing mission.

  3. Glutamine synthetase in liver of the American alligator, Alligator mississippiensis.


    Smith, D D; Campbell, J W


    Glutamine synthetase was shown to be localized in liver mitochondria of the American alligator, Alligator mississippiensis, by immunofluorescent staining of frozen liver sections and by the detection of enzymatic activity and immunoreactive protein in the mitochondrial fraction following subcellular fractionation of liver tissue by differential centrifugation. The primary translation product of alligator liver glutamine synthetase mRNA was shown to have an Mr = 45,000 which is similar if not identical in size to that of the mature subunit. This mRNA was found to be heterogeneous in size with a major form corresponding to 2.8-3.0 kb and a lesser form corresponding to around 2 kb. Both are in excess of the size required to code for the glutamine synthetase subunit. The synthesis and presumably the mitochondrial import of glutamine synthetase in alligator liver are thus very similar to the same processes in avian liver. Despite the excretion of a high percentage of nitrogen as ammonia, the demonstration of a mitochondrial glutamine synthetase indicates the alligator has the typical avian-type uricotelic ammonia-detoxification system in liver. This suggests that the transition to uricotelism occurred in the sauropsid line of evolution and has persisted through both the lepidosaurian (snakes, lizards) and archosaurian (dinosaurs, crocodilians, birds) lines.

  4. Growth rates of Chinese and American alligators.


    Herbert, J D; Coulson, T D; Coulson, R A


    Growth rates in two closely related species, Alligator mississippiensis (American alligator) and Alligator sinensis (Chinese alligator), were compared under identical conditions for at least 1 year after hatching. When hatched, Chinese alligators were approximately 2/3 the length and approximately 1/2 the weight of American alligator hatchlings. At the end of 1 year of growth in captivity in heated chambers, the Chinese alligators were approximately 1/2 as long and weighed approximately 1/10 as much as American alligator yearlings. When the animals were maintained at 31 degrees C, Chinese alligator food consumption and length gain rates dropped to near zero during autumn and winter and body weights decreased slightly, apparently in response to the change in day length. At constant temperature (31 degrees C), food consumption by American alligators remained high throughout the year. Length gain rates in American alligators decreased slowly as size increased, but were not affected by photoperiod. Daily weight gains in American alligators increased steadily throughout the year. In autumn, provision of artificial light for 18 h a day initially stimulated both length and weight gain in Chinese alligators, but did not affect growth in American alligators. Continuation of the artificial light regimen seemed to cause deleterious effects in the Chinese alligators after several months, however, so that animals exposed to the normal light cycle caught up to and then surpassed the extra-light group in size. Even after removal of the artificial light, it was several months before these extra-light animals reverted to a normal growth pattern. These findings may be of interest to those institutions engaged in captive growth programs intended to provide animals for reintroduction to the wild or to protected habitat. PMID:11897202

  5. Dry years decrease abundance of American alligators in the Florida Everglades

    USGS Publications Warehouse

    Waddle, J. Hardin; Brandt, Laura A.; Jeffery, Brian M.; Mazzotti, Frank J.


    The Everglades has been greatly reduced and is threatened by land use change and altered hydrology. The Comprehensive Everglades Restoration Plan calls for monitoring and assessment of key ecosystem attributes, one of which is abundance of American alligators. We examined 10 years of alligator night spotlight counts from Arthur R. Marshall Loxahatchee National Wildlife Refuge along two canals and in the interior marsh to determine trends and how dry years affect alligator abundance. Alligators showed population response to hydrologic conditions. In particular, there were declines in abundance after dry years followed by an apparent recovery in abundance in subsequent years. Increases in abundance were lower in the marsh than L-40 Canal. In addition, there was evidence that intensity of dry events affected population dynamics with greater declines observed in years with drier conditions. Results revealed that overall population of alligators increased from 2004 to 2013, but that increases varied by survey route. These results demonstrate that dry years cause a decline in alligator abundance proportional to the intensity of the dry event, and that it is important to make a distinction between canals and marsh when measuring alligator response to hydrology.

  6. Alligator diet in relation to alligator mortality on Lake Griffin, FL

    USGS Publications Warehouse

    Rice, A.N.; Ross, J.P.; Woodward, A.R.; Carbonneau, D.A.; Percival, H.F.


    Alligator mississippiensis (American Alligators) demonstrated low hatch-rate success and increased adult mortality on Lake Griffin, FL, between 1998 and 2003. Dying Lake Griffin alligators with symptoms of poor motor coordination were reported to show specific neurological impairment and brain lesions. Similar lesions were documented in salmonines that consumed clupeids with high thiaminase levels. Therefore, we investigated the diet of Lake Griffin alligators and compared it with alligator diets from two lakes that exhibited relatively low levels of unexplained alligator mortality to see if consumption of Dorosoma cepedianum (gizzard shad) could be correlated with patterns of mortality. Shad in both lakes Griffin and Apopka had high levels of thiaminase and Lake Apopka alligators were consuming greater amounts of shad relative to Lake Griffin without showing mortality rates similar to Lake Griffin alligators. Therefore, a relationship between shad consumption alone and alligator mortality is not supported.


    EPA Science Inventory

    Top predators, like the American alligator (Alligator mississippiensis) bioaccumulate and biomagnify persistent pollutants, such as organochlorine pesticides. In a recently published study, several pesticides and pesticide metabolites not previously reported in alligator eggs wer...

  8. Scale-Dependent Habitat Selection and Size-Based Dominance in Adult Male American Alligators.


    Strickland, Bradley A; Vilella, Francisco J; Belant, Jerrold L


    Habitat selection is an active behavioral process that may vary across spatial and temporal scales. Animals choose an area of primary utilization (i.e., home range) then make decisions focused on resource needs within patches. Dominance may affect the spatial distribution of conspecifics and concomitant habitat selection. Size-dependent social dominance hierarchies have been documented in captive alligators, but evidence is lacking from wild populations. We studied habitat selection for adult male American alligators (Alligator mississippiensis; n = 17) on the Pearl River in central Mississippi, USA, to test whether habitat selection was scale-dependent and individual resource selectivity was a function of conspecific body size. We used K-select analysis to quantify selection at the home range scale and patches within the home range to determine selection congruency and important habitat variables. In addition, we used linear models to determine if body size was related to selection patterns and strengths. Our results indicated habitat selection of adult male alligators was a scale-dependent process. Alligators demonstrated greater overall selection for habitat variables at the patch level and less at the home range level, suggesting resources may not be limited when selecting a home range for animals in our study area. Further, diurnal habitat selection patterns may depend on thermoregulatory needs. There was no relationship between resource selection or home range size and body size, suggesting size-dependent dominance hierarchies may not have influenced alligator resource selection or space use in our sample. Though apparent habitat suitability and low alligator density did not manifest in an observed dominance hierarchy, we hypothesize that a change in either could increase intraspecific interactions, facilitating a dominance hierarchy. Due to the broad and diverse ecological roles of alligators, understanding the factors that influence their social dominance

  9. Scale-Dependent Habitat Selection and Size-Based Dominance in Adult Male American Alligators

    PubMed Central

    Strickland, Bradley A.; Vilella, Francisco J.; Belant, Jerrold L.


    Habitat selection is an active behavioral process that may vary across spatial and temporal scales. Animals choose an area of primary utilization (i.e., home range) then make decisions focused on resource needs within patches. Dominance may affect the spatial distribution of conspecifics and concomitant habitat selection. Size-dependent social dominance hierarchies have been documented in captive alligators, but evidence is lacking from wild populations. We studied habitat selection for adult male American alligators (Alligator mississippiensis; n = 17) on the Pearl River in central Mississippi, USA, to test whether habitat selection was scale-dependent and individual resource selectivity was a function of conspecific body size. We used K-select analysis to quantify selection at the home range scale and patches within the home range to determine selection congruency and important habitat variables. In addition, we used linear models to determine if body size was related to selection patterns and strengths. Our results indicated habitat selection of adult male alligators was a scale-dependent process. Alligators demonstrated greater overall selection for habitat variables at the patch level and less at the home range level, suggesting resources may not be limited when selecting a home range for animals in our study area. Further, diurnal habitat selection patterns may depend on thermoregulatory needs. There was no relationship between resource selection or home range size and body size, suggesting size-dependent dominance hierarchies may not have influenced alligator resource selection or space use in our sample. Though apparent habitat suitability and low alligator density did not manifest in an observed dominance hierarchy, we hypothesize that a change in either could increase intraspecific interactions, facilitating a dominance hierarchy. Due to the broad and diverse ecological roles of alligators, understanding the factors that influence their social dominance

  10. Morphology and histochemistry of juvenile American alligator (Alligator mississippiensis) nephrons.


    Moore, Brandon C; Hyndman, Kelly A; Cox, Ashley; Lawler, Ashley; Mathavan, Ketan; Guillette, Louis J


    Here we present a detailed morphological description of the alligator (Alligator mississippiensis) kidney and nephron. We present a series of histological, histochemical, and immunohistochemical markers that clearly define the seven regions of the alligator nephron. The alligator kidney is composed of many paired (mirrored) lobules on each kidney (lobe). Single nephrons span the width of lobules three times. The fine structure of glomeruli, lying in rows spanning the height of the lobule, is resolved by periodic acid methionine silver (PAMS) and periodic acid Schiff's (PAS) histochemistry. Glomeruli are connected to the proximal tubule (PT) via a neck segment. The PT is alcian blue-negative, making it distinct from the distal tubule (DT), connecting segment (CS), and collecting duct (CD). The PT is clearly identifiable by a PAS-positive brush border membrane. The PT is connected to the DT via an intermediate segment (IS) that makes a 180 degrees turn to connect these tubules. PAMS-positive material is found in the lumens of the PT, IS, and DT. Also, PAMS-positive granules are found in the DT, CS, and CD. Immunolocalization of the Na(+), K(+)-ATPase to the basolateral membrane of the DT, CS, and CD suggests a role of this enzyme in driving primary and secondary transport processes in these segments, including bicarbonate transport into the lumen of the DT (leading to an alkaline urine). Through the techniques described here, we have identified a series of distinct markers to be used by pathologists, veterinarians, and researchers to easily identify alligator nephron segments. Anat Rec, 2009. (c) 2009 Wiley-Liss, Inc.

  11. Alligators in the Sewers? Really?

    ERIC Educational Resources Information Center

    Egbert, Joy


    A large number of alligators, flushed down toilets as babies, have grown up and proliferated in the bowels of New York City. Over the years, they have grown in number and size and frequently terrorize those foolish enough to visit the subways. This tale has been making its way around the Internet ever since there's been an Internet. It's wild…

  12. 77 FR 23658 - Six Rivers National Forest, Gasquet Ranger District, California, The Smith River National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Smith River National Recreation Area Restoration and Motorized Travel Management Project AGENCY: Forest.... This project responds to the Travel Management Rule, Subpart B (36 CFR 212.52), which requires the.... Changes to the NFTS resulting from this project will be reflected in an updated Motor Vehicle Use...

  13. 75 FR 50745 - Boundary Establishment for the Black National Wild and Scenic River; Ottawa National Forest...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Boundary Establishment for the Black National Wild and Scenic River; Ottawa National..., is transmitting the final boundary of the Black National Wild and Scenic River to Congress. ] FOR... INFORMATION: The Black Wild and Scenic River boundary is available for review at the following offices:...

  14. The reproductive hormone cycle of adult female American alligators from a barrier island population.


    Hamlin, Heather J; Lowers, Russell H; Kohno, Satomi; Mitsui-Watanabe, Naoko; Amano, Haruna; Hara, Akihiko; Ohta, Yasuhiko; Miyagawa, Shinichi; Iguchi, Taisen; Guillette, Louis J


    Comparatively, little data are available detailing the geographic variation that exists in the reproductive endocrinology of adult alligators, especially those living in barrier islands. The Merritt Island National Wildlife Refuge (MI) is a unique barrier island environment and home to the Kennedy Space Center (FL, USA). Seasonal patterns of sex steroids were assessed in adult female American alligators from MI monthly from 2008 to 2009, with additional samples collected at more random intervals in 2006, 2007, and 2010. Plasma 17β-estradiol and vitellogenin concentrations peaked in April, coincident with courtship and mating, and showed patterns similar to those observed in adult female alligators in other regions. Plasma concentrations of progesterone, however, showed patterns distinctly different than those reported for alligator populations in other regions and remained relatively constant throughout the year. Plasma DHEA peaked in July around the time of oviposition, decreased in August, and then remained constant for the remaining months, except for a moderate increase in October. Circulating concentrations of DHEA have not been previously assessed in a female crocodilian, and plasma concentrations coincident with reproductive activity suggest a reproductive and/or behavioral role. Interestingly, plasma testosterone concentrations peaked in May of 2008, as has been shown in female alligator populations in other regions, but showed no peak in 2009, demonstrating dramatic variability from year to year. Surveys showed 2009 to be particularly depauperate of alligator nests in MI, and it is possible that testosterone could serve as a strong indicator of breeding success.

  15. Occurrence of decabromodiphenyl ethane in captive Chinese alligators (Alligator sinensis) from China.


    Hong, Bing; Wu, Ting; Zhao, Guangchao; Sun, Yuxin; Wang, Xinming; Zhao, Juan; Yi, Zhigang; Wu, Xiaobing; Mai, Bixian


    Decabromodiphenyl ethane (DBDPE), a replacement for decabromodiphenyl ether (deca-BDE), was investigated in captive Chinese alligators from China. DBDPE was detected in adult tissues, neonates and eggs of Chinese alligators with concentrations ranging from 4.74-192, 0.24-1.94, and 0.01-0.51 ng g(-1) lipid weight, respectively. Compared to PBDEs and PCBs, DBDPE contamination was limited in Chinese alligators. Additionally, DBDPE concentrations in adult muscles were one to three orders of magnitude higher than those in neonates and eggs, suggesting the limited maternal transfer potential of DBDPE in Chinese alligators. This is the first study to report the occurrence of DBDPE in Chinese alligators.

  16. Knife River Indian Villages National Historic Site: Teacher's Guide.

    ERIC Educational Resources Information Center

    National Park Service (Dept. of Interior), Washington, DC. National Register of Historic Places.

    This guide provides history and social studies teachers, at all grade levels, with information and activities about the American Indians of the Northern Plains who lived in the area of the Knife River where it enters the Missouri River. Located in what is now North Dakota, this area is the Knife River Indian Villages National Historic Site. The…

  17. Distribution of ventilation in American alligator Alligator mississippiensis

    SciTech Connect

    Bickler, P.E.; Spragg, R.G.; Hartman, M.T.; White, F.N.


    The regional distribution of ventilation in the multicameral lung of spontaneously ventilating alligators (Alligator mississippiensis) was studied with TTXe scintigraphy. Frequent gamma camera images of TTXe washin and washout were obtained and processed to allow evaluation of regional ventilation. Washin of TTXe to equilibrium occurred in three to four breaths in anterior, central, and posterior compartments. Washin was most rapid in the posterior compartment and slowest in the anterior. The structure of the lungs and distribution of ventilation of inspired gas is consistent with the rapid radial spread of gas through a parallel arrangement of lung units surrounding the central intrapulmonary bronchus. Washout to equilibrium of TTXe from all compartments occurred within three to four breaths. This rapid washin and washout of gas to all parts of the lung stands in contrast to the lungs of turtles and snakes, in which the caudal air sacs are relatively poorly ventilated.

  18. Bioprospecting the American Alligator (Alligator mississippiensis) Host Defense Peptidome

    PubMed Central

    Bishop, Barney M.; Juba, Melanie L.; Devine, Megan C.; Barksdale, Stephanie M.; Rodriguez, Carlos Alberto; Chung, Myung C.; Russo, Paul S.; Vliet, Kent A.; Schnur, Joel M.; van Hoek, Monique L.


    Cationic antimicrobial peptides and their therapeutic potential have garnered growing interest because of the proliferation of bacterial resistance. However, the discovery of new antimicrobial peptides from animals has proven challenging due to the limitations associated with conventional biochemical purification and difficulties in predicting active peptides from genomic sequences, if known. As an example, no antimicrobial peptides have been identified from the American alligator, Alligator mississippiensis, although their serum is antimicrobial. We have developed a novel approach for the discovery of new antimicrobial peptides from these animals, one that capitalizes on their fundamental and conserved physico-chemical properties. This sample-agnostic process employs custom-made functionalized hydrogel microparticles to harvest cationic peptides from biological samples, followed by de novo sequencing of captured peptides, eliminating the need to isolate individual peptides. After evaluation of the peptide sequences using a combination of rational and web-based bioinformatic analyses, forty-five potential antimicrobial peptides were identified, and eight of these peptides were selected to be chemically synthesized and evaluated. The successful identification of multiple novel peptides, exhibiting antibacterial properties, from Alligator mississippiensis plasma demonstrates the potential of this innovative discovery process in identifying potential new host defense peptides. PMID:25671663

  19. Biophysics of directional hearing in the American alligator (Alligator mississippiensis)

    PubMed Central

    Bierman, Hilary S.; Thornton, Jennifer L.; Jones, Heath G.; Koka, Kanthaiah; Young, Bruce A.; Brandt, Christian; Christensen-Dalsgaard, Jakob; Carr, Catherine E.; Tollin, Daniel J.


    Physiological and anatomical studies have suggested that alligators have unique adaptations for spatial hearing. Sound localization cues are primarily generated by the filtering of sound waves by the head. Different vertebrate lineages have evolved external and/or internal anatomical adaptations to enhance these cues, such as pinnae and interaural canals. It has been hypothesized that in alligators, directionality may be enhanced via the acoustic coupling of middle ear cavities, resulting in a pressure difference receiver (PDR) mechanism. The experiments reported here support a role for a PDR mechanism in alligator sound localization by demonstrating that (1) acoustic space cues generated by the external morphology of the animal are not sufficient to generate location cues that match physiological sensitivity, (2) continuous pathways between the middle ears are present to provide an anatomical basis for coupling, (3) the auditory brainstem response shows some directionality, and (4) eardrum movement is directionally sensitive. Together, these data support the role of a PDR mechanism in crocodilians and further suggest this mechanism is a shared archosaur trait, most likely found also in the extinct dinosaurs. PMID:24671963

  20. National wild and scenic rivers system, January 2000

    USGS Publications Warehouse

    ,; ,; ,; ,; ,


    The National Wild and Scenic Rivers System was created by Congress in 1968 (Public Law 90-542; 16 U.S.C 1271 et seq.) to preserve certain rivers with outstanding natural cultural, or recreational features in a free flowing condition for enjoyment of present and future generations. As of January 2000, the National System has grown from its initial eight components to a 156-river system with representation in 37 states.

  1. National rivers and streams assessment: fish tissue contaminants

    EPA Science Inventory

    Overview of the National Rivers and Streams Assessment (NRSA), a statistical survey of flowing waters in the U.S. Survey is designed to: assess the condition of the nation's rivers and streams; help build state and tribal capacity for monitoring and assessment; promote collabor...

  2. 77 FR 8801 - Boundary Establishment for Sturgeon National Wild and Scenic River; Hiawatha National Forest...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...; ] DEPARTMENT OF AGRICULTURE Forest Service Boundary Establishment for Sturgeon National Wild and Scenic River..., Washington Office, is transmitting the final boundary of the Sturgeon National Wild and Scenic River to... 157. SUPPLEMENTARY INFORMATION: The Sturgeon Wild and Scenic River boundary is available for review...

  3. Jumping the Alligators in the Ditch.

    ERIC Educational Resources Information Center

    Barber, Rims

    Poor black young people in rural Mississippi contemplate their schooling with the same feelings as their friends who dare to jump the local ditches filled with alligators: the odds are against escaping the alligators, and the advantages of getting to the far side are not very apparent. Living in conditions of extreme poverty, these young people…


    SciTech Connect

    Danko, E


    The Savannah River National Laboratory (SRNL) is a U.S. Department of Energy research and development laboratory located at the Savannah River Site (SRS) near Aiken, South Carolina. SRNL has over 50 years of experience in developing and applying hydrogen technology, both through its national defense activities as well as through its recent activities with the DOE Hydrogen Programs. The hydrogen technical staff at SRNL comprises over 90 scientists, engineers and technologists, and it is believed to be the largest such staff in the U.S. SRNL has ongoing R&D initiatives in a variety of hydrogen storage areas, including metal hydrides, complex hydrides, chemical hydrides and carbon nanotubes. SRNL has over 25 years of experience in metal hydrides and solid-state hydrogen storage research, development and demonstration. As part of its defense mission at SRS, SRNL developed, designed, demonstrated and provides ongoing technical support for the largest hydrogen processing facility in the world based on the integrated use of metal hydrides for hydrogen storage, separation, and compression. The SRNL has been active in teaming with academic and industrial partners to advance hydrogen technology. A primary focus of SRNL's R&D has been hydrogen storage using metal and complex hydrides. SRNL and its Hydrogen Technology Research Laboratory have been very successful in leveraging their defense infrastructure, capabilities and investments to help solve this country's energy problems. SRNL has participated in projects to convert public transit and utility vehicles for operation using hydrogen fuel. Two major projects include the H2Fuel Bus and an Industrial Fuel Cell Vehicle (IFCV) also known as the GATOR{trademark}. Both of these projects were funded by DOE and cost shared by industry. These are discussed further in Section 3.0, Demonstration Projects. In addition to metal hydrides technology, the SRNL Hydrogen group has done extensive R&D in other hydrogen technologies, including


    SciTech Connect

    Motyka, T


    A team comprised of governmental, academic and industrial partners led by the Savannah River National Laboratory developed and demonstrated a regenerative fuel cell system for backup power applications. Recent market assessments have identified emergency response and telecommunication applications as promising near-term markets for fuel cell backup power systems. The Regenerative Fuel Cell System (RFC) consisted of a 2 kg-per-day electrolyzer, metal-hydride based hydrogen storage units and a 5 kW fuel cell. Coupling these components together created a system that can produce and store its own energy from the power grid much like a rechargeable battery. A series of test were conducted to evaluate the performance of the RFC system under both steady-state and transit conditions that might be encountered in typical backup power applications. In almost all cases the RFC functioned effectively. Test results from the demonstration project will be used to support recommendations for future fuel cell and hydrogen component and system designs and support potential commercialization activities. In addition to the work presented in this report, further testing of the RFC system at the Center for Hydrogen Research in Aiken County, SC is planned including evaluating the system as a renewable system coupled with a 20kW-peak solar photovoltaic array.

  6. The fishes of Buffalo National River, Arkansas, 2001-2003

    USGS Publications Warehouse

    Petersen, James C.; Justus, B.G.


    During June through September 2001 and 2002, extensive fish community sampling was conducted at 29 sites within the boundaries of Buffalo National River. Samples were collected using backpack, tote barge, and boat electrofishing equipment. Kick seining also was used at all sites. To supplement these results, samples were collected in 2003 from less typical habitats and during other seasons of the year. Ten supplemental samples were collected from the Buffalo River and five samples were collected from tributaries of the Buffalo River. During the 3 years of sampling, 66 species of fish were collected or observed from the 42 sampling sites. Stonerollers, duskystripe shiners, longear sunfish, and rainbow darters were among the more abundant fish species at most sites. Each of these species is common and abundant throughout much of the Ozark Plateaus in creeks and small rivers. Other species (for example, banded sculpin, southern redbelly dace, orangethroat darter, and Ozark minnow) were among the more abundant species at other sites. These species prefer small- to medium-sized, springfed streams or small creeks. A preliminary list of species expected to occur at Buffalo National River provided by the National Park Service incorrectly listed 47 species because of incorrect species range or habitat requirements. Upon revising this list, the inventory yielded 66 of the 78 species (85 percent). Twelve additional species not collected in 2001-2003 may occur at Buffalo National River for two primary reasons--because the species had been collected previously at the park, or because the park occurs within the known species range and habitats found at the park are suitable for the species. Although no fish species collected from Buffalo National River are federally-listed threatened or endangered species, several species collected at Buffalo National River may be of special interest to National Park Service managers and others. Ten species are endemic to the Ozark Plateaus area

  7. South Fork Clearwater River Habitat Enhancement, Nez Perce National Forest.

    SciTech Connect

    Siddall, Phoebe


    In 1984, the Nez Perce National forest and the Bonneville Power Administration entered into a contractual agreement which provided for improvement of spring chinook salmon and summer steelhead trout habitat in south Fork Clearwater River tributaries. Project work was completed in seven main locations: Crooked River, Red River, Meadow Creek Haysfork Gloryhole, Cal-Idaho Gloryhole, Fisher Placer and Leggett Placer. This report describes restoration activities at each of these sites.


    EPA Science Inventory

    The U.S. EPA is engaging states, tribes and other parties in designing a national survey to assess the condition of non-wadeable rivers and streams. The river survey is one of a series of surveys beng implemented as a partnership among states, tribes and U.S. EPA, with the colla...

  9. 36 CFR 7.90 - Chattahoochee River National Recreation Area.

    Code of Federal Regulations, 2014 CFR


    ... Recreation Area. 7.90 Section 7.90 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF... National Recreation Area. (a) Bicycling. (1) Where may I ride a bicycle within Chattahoochee River National Recreation Area? The following routes are designated for bicycle use: (i) The approximately...

  10. 36 CFR 7.90 - Chattahoochee River National Recreation Area.

    Code of Federal Regulations, 2013 CFR


    ... Recreation Area. 7.90 Section 7.90 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF... National Recreation Area. (a) Bicycling. (1) Where may I ride a bicycle within Chattahoochee River National Recreation Area? The following routes are designated for bicycle use: (i) The approximately...

  11. Methyltestosterone alters sex determination in the American alligator (Alligator mississippiensis).


    Murray, Christopher M; Easter, Michael; Merchant, Mark; Rheubert, Justin L; Wilson, Kelly A; Cooper, Amos; Mendonça, Mary; Wibbels, Thane; Marin, Mahmood Sasa; Guyer, Craig


    Effects of xenobiotics can be organizational, permanently affecting anatomy during embryonic development, and/or activational, influencing transitory actions during adulthood. The organizational influence of endocrine-disrupting contaminants (EDC's) produces a wide variety of reproductive abnormalities among vertebrates that exhibit temperature-dependent sex determination (TSD). Typically, such influences result in subsequent activational malfunction, some of which are beneficial in aquaculture. For example, 17-αmethyltestosterone (MT), a synthetic androgen, is utilized in tilapia farming to bias sex ratio towards males because they are more profitable. A heavily male-biased hatchling sex ratio is reported from a crocodile population near one such tilapia operation in Guanacaste, Costa Rica. In this study we test the effects of MT on sexual differentiation in American alligators, which we used as a surrogate for all crocodilians. Experimentally, alligators were exposed to MT in ovo at standard ecotoxicological concentrations. Sexual differentiation was determined by examination of primary and secondary sex organs post hatching. We find that MT is capable of producing male embryos at temperatures known to produce females and demonstrate a dose-dependent gradient of masculinization. Embryonic exposure to MT results in hermaphroditic primary sex organs, delayed renal development and masculinization of the clitero-penis (CTP). PMID:27401264

  12. Coronary blood flow in the anesthetized American alligator (Alligator mississippiensis).


    Jensen, Bjarke; Elfwing, Magnus; Elsey, Ruth M; Wang, Tobias; Crossley, Dane A


    Coronary circulation of the heart evolved early within ectothermic vertebrates and became of vital importance to cardiac performance in some teleost fish, mammals and birds. In contrast, the role and function of the coronary circulation in ectothermic reptiles remains largely unknown. Here, we investigated the systemic and coronary arterial responses of five anesthetized juvenile American alligators (Alligator mississippiensis) to hypoxia, acetylcholine, adenosine, sodium nitroprusside, isoproterenol, and phenylephrine. We recorded electrocardiograms, monitored systemic blood pressure, blood flows in both aortae, and blood flow in a major coronary artery supplying most of the right ventricle. Coronary arterial blood flow was generally forward, but there was a brief retrograde flow during a ventricular contraction. Blood pressure was significantly changed in all conditions. Acetylcholine decreased coronary forward flow, but this response was confounded by the concomitant lowered work of the ventricles due to decreased heart rate and blood pressure. Coronary forward flow was poorly correlated with heart rate and mean arterial pressure across treatments. Overall changes in coronary forward flow, significant and not significant, were generally in the same direction as mean arterial pressure and ventricular power, approximated as the product of systemic cardiac output and mean arterial pressure. PMID:26436857

  13. Coronary blood flow in the anesthetized American alligator (Alligator mississippiensis).


    Jensen, Bjarke; Elfwing, Magnus; Elsey, Ruth M; Wang, Tobias; Crossley, Dane A


    Coronary circulation of the heart evolved early within ectothermic vertebrates and became of vital importance to cardiac performance in some teleost fish, mammals and birds. In contrast, the role and function of the coronary circulation in ectothermic reptiles remains largely unknown. Here, we investigated the systemic and coronary arterial responses of five anesthetized juvenile American alligators (Alligator mississippiensis) to hypoxia, acetylcholine, adenosine, sodium nitroprusside, isoproterenol, and phenylephrine. We recorded electrocardiograms, monitored systemic blood pressure, blood flows in both aortae, and blood flow in a major coronary artery supplying most of the right ventricle. Coronary arterial blood flow was generally forward, but there was a brief retrograde flow during a ventricular contraction. Blood pressure was significantly changed in all conditions. Acetylcholine decreased coronary forward flow, but this response was confounded by the concomitant lowered work of the ventricles due to decreased heart rate and blood pressure. Coronary forward flow was poorly correlated with heart rate and mean arterial pressure across treatments. Overall changes in coronary forward flow, significant and not significant, were generally in the same direction as mean arterial pressure and ventricular power, approximated as the product of systemic cardiac output and mean arterial pressure.

  14. Methyltestosterone alters sex determination in the American alligator (Alligator mississippiensis).


    Murray, Christopher M; Easter, Michael; Merchant, Mark; Rheubert, Justin L; Wilson, Kelly A; Cooper, Amos; Mendonça, Mary; Wibbels, Thane; Marin, Mahmood Sasa; Guyer, Craig


    Effects of xenobiotics can be organizational, permanently affecting anatomy during embryonic development, and/or activational, influencing transitory actions during adulthood. The organizational influence of endocrine-disrupting contaminants (EDC's) produces a wide variety of reproductive abnormalities among vertebrates that exhibit temperature-dependent sex determination (TSD). Typically, such influences result in subsequent activational malfunction, some of which are beneficial in aquaculture. For example, 17-αmethyltestosterone (MT), a synthetic androgen, is utilized in tilapia farming to bias sex ratio towards males because they are more profitable. A heavily male-biased hatchling sex ratio is reported from a crocodile population near one such tilapia operation in Guanacaste, Costa Rica. In this study we test the effects of MT on sexual differentiation in American alligators, which we used as a surrogate for all crocodilians. Experimentally, alligators were exposed to MT in ovo at standard ecotoxicological concentrations. Sexual differentiation was determined by examination of primary and secondary sex organs post hatching. We find that MT is capable of producing male embryos at temperatures known to produce females and demonstrate a dose-dependent gradient of masculinization. Embryonic exposure to MT results in hermaphroditic primary sex organs, delayed renal development and masculinization of the clitero-penis (CTP).

  15. On the variability of alligator sex ratios

    USGS Publications Warehouse

    Nichols, J.D.; Chabreck, R.H.


    Samples of alligators from wild and 'farm' populations exhibited disproportionate sex ratios. Males predominated among young alligators from wild populations, whereas females were much more abundant than males in the farm population, where resources were superabundant. These results and other considerations lead us to hypothesize that environmental factors influence sex determination in alligators. During favorable environmental conditions natural selection is expected to favor a preponderance of the sex whose individuals exhibit the greater environmentally associated variation in relative fitness. We hypothesize that environmentally associated variation in age at sexual maturity of females produces sufficient variation in relative fitness of females to result in selection for low sex ratios during periods of resource abundance.

  16. 77 FR 67660 - Cahaba River National Wildlife Refuge, Alabama

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Cahaba River National Wildlife Refuge (NWR) in Bibb County, Alabama. We provide this notice in compliance... boundary. The refuge currently contains 3,608 acres in Bibb County. The refuge was established to:...

  17. An Allocation of Undiscovered Oil and Gas Resources to Gauley River National Recreation Area and New River Gorge National River, West Virginia

    USGS Publications Warehouse

    Schenk, Christopher J.; Klett, Timothy R.; Charpentier, Ronald R.; Cook, Troy A.; Crovelli, Robert A.; Pollastro, Richard M.; Milici, Robert C.


    The U.S. Geological Survey estimated volumes of undiscovered oil and gas resources that may underlie Gauley River National Recreation Area and New River Gorge National River in West Virginia. Using the results of an assessment of undiscovered resources from ten assessment units in the Appalachian Basin Province that include these land parcels, the USGS allocated 2.9 billion cubic feet of gas, 1.6 thousand barrels of oil, and 45 thousand barrels of natural gas liquids to part of Gauley River National Recreation Area, and 39 billion cubic feet of gas, 24 thousand barrels of oil, and 644 thousand barrels of natural gas liquids to New River Gorge National River. These allocated volumes of undiscovered resources represent potential volumes in undiscovered fields.

  18. The influence of regional hydrology on nesting behavior and nest fate of the American alligator

    USGS Publications Warehouse

    Ugarte, Cristina A.; Bass, Oron L.; Nuttle, William; Mazzotti, Frank J.; Rice, Kenneth G.; Fujisaki, Ikuko; Whelan, Kevin R.T.


    Hydrologic conditions are critical to the nesting behavior and reproductive success of crocodilians. In South Florida, USA, growing human settlement has led to extensive surface water management and modification of historical water flows in the wetlands, which have affected regional nesting of the American alligator (Alligator mississippiensis). Although both natural and anthropogenic factors are considered to determine hydrologic conditions, the aspects of hydrological patterns that affect alligator nest effort, flooding (partial and complete), and failure (no hatchling) are unclear. We deconstructed annual hydrological patterns using harmonic models that estimated hydrological matrices including mean, amplitude, timing of peak, and periodicity of surface water depth and discharge and examined their effects on alligator nesting using survey data from Shark Slough, Everglades National Park, from 1985 to 2005. Nest effort increased in years with higher mean and lesser periodicity of water depth. A greater proportion of nests were flooded and failed when peak discharge occurred earlier in the year. Also, nest flooding rates were greater in years with greater periodicity of water depth, and nest failure rate was greater when mean discharge was higher. This study guides future water management decisions to mitigate negative impacts on reproduction of alligators and provides wildlife managers with a tool for assessing and modifying annual water management plans to conserve crocodilians and other wetland species.

  19. Flood characteristics for the New River in the New River Gorge National River, West Virginia

    USGS Publications Warehouse

    Wiley, J.B.; Cunningham, M.K.


    The frequency and magnitude of flooding of the New River in the New River Gorge National River was studied. A steady-state, one-dimensional flow model was applied to the study reach. Rating curves, cross sections, and Manning's roughness coefficients that were used are presented in this report. Manning's roughness coefficients were evaluated by comparing computed elevations (from application of the steady-state, one-dimensional flow model) to rated elevations at U.S. Geological Survey (USGS) streamflow-gaging stations and miscellaneous-rating sites. Manning's roughness coefficients ranged from 0.030 to 0.075 and varied with hydraulic depth. The 2-, 25-, and 100-year flood discharges were esti- mated on the basis of information from flood- insurance studies of Summers County, Fayette County, and the city of Hinton, and flood-frequency analysis of discharge records for the USGS streamflow-gaging stations at Hinton and Thurmond. The 100-year discharge ranged from 107,000 cubic feet per second at Hinton to 150,000 cubic feet per second at Fayette.

  20. 76 FR 62038 - Boundary Establishment for North Fork Crooked National Wild and Scenic River, Ochoco National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Boundary Establishment for North Fork Crooked National Wild and Scenic River, Ochoco..., Washington Office, is transmitting the final boundary of the North Fork Crooked National Wild and Scenic.... SUPPLEMENTARY INFORMATION: The North Fork Crooked Wild and Scenic River boundary is available for review at...

  1. Concentrations of trace elements in American alligators (Alligator mississippiensis) from Florida, USA.


    Horai, Sawako; Itai, Takaaki; Noguchi, Takako; Yasuda, Yusuke; Adachi, Haruki; Hyobu, Yuika; Riyadi, Adi S; Boggs, Ashley S P; Lowers, Russell; Guillette, Louis J; Tanabe, Shinsuke


    Concentrations of 28 trace elements (Li, Mg, Al, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, Mo, Ag, Cd, In, Sn, Sb, Cs, Tl, Hg, Pb, and Bi) in the livers of juvenile and adult American alligators inhabiting two central Florida lakes, Lake Apopka (LA), and Lake Woodruff National Wildlife Refuge (LW) and one lagoon population located in Merritt Island National Wildlife Refuge (MINWR; NASA), were determined. In juveniles from MINWR, concentrations of nine elements (Li, Fe, Ni, Sr, In, Sb, Hg, Pb and Bi) were significantly higher, whereas six elements (V, Fe, As, Sr, Hg and Bi) were elevated in adults (p<0.05) obtained from MINWR. Significant enrichment of some trace elements in adults, relative to juveniles, was observed at all three sampling areas. Specifically, Fe, Pb and Hg were significantly elevated in adults when compared to juveniles, suggesting age-dependent accumulation of these elements. Further, As, Se and Sn showed the same trend but only in animals collected from MINWR. Mean Fe concentrations in the livers of adults from LA, LW and MINWR were 1770 μg g(-1) DW, 3690 μg g(-1) DW and 5250 μg g(-1) DW, respectively. More than half of the adult specimens from LW and MINWR exhibited elevated hepatic Fe concentrations that exceed the threshold value for toxic effects in donkey, red deer and human. These results prompted us to express our concern on possible exposure and health effects in American alligators by some trace elements derived from NASA activities. PMID:24698170

  2. Concentrations of trace elements in American alligators (Alligator mississippiensis) from Florida, USA.


    Horai, Sawako; Itai, Takaaki; Noguchi, Takako; Yasuda, Yusuke; Adachi, Haruki; Hyobu, Yuika; Riyadi, Adi S; Boggs, Ashley S P; Lowers, Russell; Guillette, Louis J; Tanabe, Shinsuke


    Concentrations of 28 trace elements (Li, Mg, Al, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, Mo, Ag, Cd, In, Sn, Sb, Cs, Tl, Hg, Pb, and Bi) in the livers of juvenile and adult American alligators inhabiting two central Florida lakes, Lake Apopka (LA), and Lake Woodruff National Wildlife Refuge (LW) and one lagoon population located in Merritt Island National Wildlife Refuge (MINWR; NASA), were determined. In juveniles from MINWR, concentrations of nine elements (Li, Fe, Ni, Sr, In, Sb, Hg, Pb and Bi) were significantly higher, whereas six elements (V, Fe, As, Sr, Hg and Bi) were elevated in adults (p<0.05) obtained from MINWR. Significant enrichment of some trace elements in adults, relative to juveniles, was observed at all three sampling areas. Specifically, Fe, Pb and Hg were significantly elevated in adults when compared to juveniles, suggesting age-dependent accumulation of these elements. Further, As, Se and Sn showed the same trend but only in animals collected from MINWR. Mean Fe concentrations in the livers of adults from LA, LW and MINWR were 1770 μg g(-1) DW, 3690 μg g(-1) DW and 5250 μg g(-1) DW, respectively. More than half of the adult specimens from LW and MINWR exhibited elevated hepatic Fe concentrations that exceed the threshold value for toxic effects in donkey, red deer and human. These results prompted us to express our concern on possible exposure and health effects in American alligators by some trace elements derived from NASA activities.

  3. Chronic incidental lead ingestion in a group of captive-reared alligators (Alligator mississippiensis): possible contribution to reproductive failure.


    Lance, Valentine A; Horn, Thomas R; Elsey, Ruth M; de Peyster, Ann


    An American alligator (Alligator mississippiensis) breeding facility using male and female alligators raised from artificially incubated eggs was established in 1975. These alligators first reproduced at 6 years of age as compared to 10-12 years in wild alligators, but the eggs produced showed a lower hatching rate than those collected from the wild. By age 21 reproduction had failed almost completely. The alligators were sacrificed and tissues collected at necropsy from 44 captive and 15 wild animals and assayed for metals. Results showed that captive alligators had significantly higher tissue levels of lead than wild alligators. Cadmium did not differ between wild and captive and selenium was 50% higher in wild than captive alligator kidneys. Bone lead in captive alligators was 252,443 +/- 20,462 ng/g. High yolk lead was suggested as a probable cause for early embryonic death in alligator eggs. The high tissue lead levels in captive alligators was attributed to long-term consumption of nutria (Myocastor coypus) meat contaminated with lead shot. Liver, ovary, and testis were assayed for lipid peroxidation using the thiobarbituric acid (TBA) test. Captive alligators had 3.6 fold increased TBA-reactive materials in the liver tissue compared to wild. Lipid peroxidation was strongly suspected as having been enhanced by consumption of rancid nutria meat containing lead.


    EPA Science Inventory

    Seasonal variation in plasma sex steroid concentrations is common in mature vertebrates, and is occasionally seen in juvenile animals. In this study, we examine the seasonal pattern of sex hormone concentration in juvenile American alligators (Alligator mississippiensis) and make...


    EPA Science Inventory

    Reproductive disorders in American alligators (Alligator mississippiensis) inhabiting Lake Apopka, Florida, have been observed for several years. Such disorders are hypothesized to be caused by endocrine disrupting contaminants occurring in the Lake due to pesticide spills and ...


    EPA Science Inventory

    Exposure to environmental contaminants has been shown to alter normal thyroid function in various wildlife species, including the American alligator (Alligator mississippiensis). Abnormalities in circulating levels of the thyroid hormone thyroxine (T4) have been reported in juven...

  7. An urban Northeastern United States alligator bite.


    Shepherd, Suzanne Moore; Shoff, William H


    Individuals who live and work in the Southeastern coastal range of the 3 US crocodilian carnivores, American alligators, American crocodiles, and caiman, understand the risks of reptile-human encounters. Individuals who live in other parts of the country maybe exposed through contact with exotic pets at private homes, small menageries, or petting zoos or from escaped or abandoned animals. During these encounters, individuals may be severely injured.Emergency medical services, law enforcement, and animal welfare workers in nonhabitat areas are usually not trained in the handling and safe removal of injured individuals from the scene when the reptile is present. The emergency management of large crocodilian injuries is similar to that of other major trauma; however, providers also must take into consideration the significant crush component potentially inflicted by the tremendous bite power and shaking inflicting during attacks by these large reptiles, appropriate antibiotic coverage for less common organisms that inhabit their mouths, and management of possible psychological distress, including posttraumatic stress disorder produced by such an unusual attack. Emergency physicians should support the development of a readily available national database of scientifically collect information on attacks to inform appropriate care and support efforts to explore responsible measures that the USDA Animal and Plant Health Inspection Service and other appropriate local, state, and federal agencies can take to ensure ethical and biologically sustainable management of our large reptiles, which also helps to ensure the safety of the public. PMID:24332253

  8. Hydrologic Connectivity Estimated throughout the Nation's River Corridors

    NASA Astrophysics Data System (ADS)

    Hunt, R.; Borchardt, M. A.; Bradbury, K. R.


    Hydrologic connectivity is a key concept that integrates longitudinal transport in rivers with vertical and lateral exchanges between rivers and hyporheic zones, riparian wetlands, floodplains, and ponded aquatic ecosystems. Desirable levels of connectivity are thought to be associated with rivers that are well-connected longitudinally while also being well connected vertically and laterally with marginal waters where carbon and nutrients are efficiently transformed, and where aquatic organisms feed, or are reared, or take refuge during floods. But what is the proper balance between longitudinal and vertical and lateral connectivity? We took a step towards quantifying hydrologic connectivity using the model NEXSS (Gomez-Velez and Harvey, 2014, GRL) applied throughout the nation's rivers. NEXSS simulates vertical and lateral connectivity and compares it with longitudinal transport along the river's main axis. It uses as inputs measured network topology for first to eighth order channels, river hydraulic geometry, sediment grain size, bedform types and sizes, estimated hydraulic conductivity of sediments, and estimates of reaction rates such as denitrification. Results indicate that hyporheic flow is large enough to exchange a river's entire volume many times within a river network, which increases biogeochemical opportunities for nutrient processing and attenuation of contaminants. Also, the analysis demonstrated why and where (i.e., in which physiographic regions of the nation) are hyporheic flow and solute reactions the greatest. The cumulative influence of hydrologic connectivity on water quality is expressed by a dimensionless index of reaction significance. Our quantification of hydrologic connectivity adds a physical basis that supports water quality modeling, and also supports scientifically based prioritization of management actions (e.g. stream restoration) and may support other types of actions (e.g. legislative actions) to help conserve healthy functional

  9. Hydrologic Connectivity Estimated throughout the Nation's River Corridors

    NASA Astrophysics Data System (ADS)

    Harvey, J. W.; Gomez-Velez, J. D.


    Hydrologic connectivity is a key concept that integrates longitudinal transport in rivers with vertical and lateral exchanges between rivers and hyporheic zones, riparian wetlands, floodplains, and ponded aquatic ecosystems. Desirable levels of connectivity are thought to be associated with rivers that are well-connected longitudinally while also being well connected vertically and laterally with marginal waters where carbon and nutrients are efficiently transformed, and where aquatic organisms feed, or are reared, or take refuge during floods. But what is the proper balance between longitudinal and vertical and lateral connectivity? We took a step towards quantifying hydrologic connectivity using the model NEXSS (Gomez-Velez and Harvey, 2014, GRL) applied throughout the nation's rivers. NEXSS simulates vertical and lateral connectivity and compares it with longitudinal transport along the river's main axis. It uses as inputs measured network topology for first to eighth order channels, river hydraulic geometry, sediment grain size, bedform types and sizes, estimated hydraulic conductivity of sediments, and estimates of reaction rates such as denitrification. Results indicate that hyporheic flow is large enough to exchange a river's entire volume many times within a river network, which increases biogeochemical opportunities for nutrient processing and attenuation of contaminants. Also, the analysis demonstrated why and where (i.e., in which physiographic regions of the nation) are hyporheic flow and solute reactions the greatest. The cumulative influence of hydrologic connectivity on water quality is expressed by a dimensionless index of reaction significance. Our quantification of hydrologic connectivity adds a physical basis that supports water quality modeling, and also supports scientifically based prioritization of management actions (e.g. stream restoration) and may support other types of actions (e.g. legislative actions) to help conserve healthy functional

  10. Alterations in steroidogenesis in alligators (Alligator mississippiensis) exposed naturally and experimentally to environmental contaminants.

    PubMed Central

    Crain, D A; Guillette, L J; Rooney, A A; Pickford, D B


    Many environmental contaminants alter the reproduction of animals by altering the development and function of the endocrine system. The ability of environmental contaminants to alter the endocrine system of alligators was studied both in a descriptive study in which juvenile alligators from a historically contaminated lake were compared to animals from a control lake and in an experimental study in which hatchling control alligators were exposed in ovo to several endocrine-disrupting standards and two modern-use herbicides. Endocrine status was assessed by examining plasma hormone concentrations, gonadal-adrenal mesonephros (GAM) aromatase activity, and gonadal histopathology. In the descriptive study, juvenile alligators from the contaminated lake had significantly lower plasma testosterone concentrations (29.2 pg/ml compared to 51.3 pg/ml), whereas plasma 17 beta-estradiol concentrations did not vary when compared to controls. GAM aromatase activity was significantly decreased n the alligators from the contaminated lake (7.6 pmol/g/hr compared to 11.4 pmol/g/hr). In the experimental study, the endocrine-disrupting standards had the expected effects. 17 beta-Estradiol and tamoxifen caused sex reversal from male to female, with a corresponding increase in aromatase activity. Vinclozolin had no apparent effect on male or female alligators. Among the herbicides tested, atrazine induced GAM aromatase activity in male hatchling alligators that was neither characteristic of males nor females, although testicular differentiation was not altered. Exposure to 2,4-dichlorophenoxyacetic acid had no effect on the endocrine parameters that were measured. Together, these studies show that exposure to some environmental chemicals (such as atrazine) can alter steroidogenesis in alligators, but the endocrine alterations previously noted for Lake Apopka, Florida, alligators can not be fully explained by this mechanism. Images Figure 1. PMID:9222139

  11. 77 FR 18997 - Boundary Establishment for the Presque Isle National Wild and Scenic River, Ottawa National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... River, Ottawa National Forest; Gogebic County, MI AGENCY: Forest Service, USDA. ACTION: Notice of availability. SUMMARY: In accordance with Section 3(b) of the Wild and Scenic Rivers Act, the USDA Forest... for review at the following offices: USDA Forest Service, Office of the Chief, 1400...

  12. Endogenous and exogenous estrogens during embryonic development affect timing of hatch and growth in the American alligator (Alligator mississippiensis).


    Cruze, Lori; Roark, Alison M; Rolland, Gabrielle; Younas, Mona; Stacy, Nicole; Guillette, Louis J


    Prenatal exposure to estrogenic endocrine disrupting chemicals (EDCs) can affect length of gestation and body mass and size of offspring. However, the dose, timing, and duration of exposure as well as sex and strain of the experimental animals determine the direction and magnitude of these effects. In this study, we examined the effects of a one-time embryonic exposure to either 17 β-estradiol (E2) or bisphenol A (BPA) on rate of development and growth in American alligators (Alligator mississippiensis). Our results indicate that BPA and E2-treated alligators hatched approximately 1.4 days earlier than vehicle-treated (control) alligators, suggesting that estrogenic chemicals hasten hatching in these animals. We assessed growth rates, growth allometry, and body condition for 21 weeks after hatching and found that BPA-treated alligators grew more quickly shortly after hatching but more slowly thereafter compared to control alligators. Conversely, E2-treated alligators grew more slowly shortly after hatching but more quickly thereafter compared to control alligators. As a result of differences in growth rate, BPA-treated alligators were heavier, longer, and fatter than control alligators at age 5 weeks but were similar in size and leaner than control alligators at age 21 weeks. Biochemical analytes were examined at the end of the 21-week study to assess overall metabolic condition. We found that E2-treated alligators had significantly higher circulating plasma concentrations of cholesterol and triglycerides than control alligators while BPA-treated alligators had blood profiles comparable to control alligators. Our results provide important insights into the effects of exogenous estrogens on morphology and metabolism in an oviparous, semi-aquatic reptile.

  13. 76 FR 14897 - Boundary Establishment for the Yellow Dog National Wild and Scenic River, Ottawa National Forest...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Boundary Establishment for the Yellow Dog National Wild and Scenic River, Ottawa National..., Washington Office, is transmitting the final boundary of the Yellow Dog National Wild and Scenic River to.... SUPPLEMENTARY INFORMATION: The Yellow Dog Wild and Scenic River boundary is available for review at...

  14. 77 FR 38035 - Boundary Establishment for the Allegheny National Wild and Scenic River, Allegheny National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... River. This document was published before sufficient consultation with the Seneca Nation of Indians (SNI.... Correction: In the Federal Register of April 10, 2012, in FR Doc. 2012-8451, on page 21522, in the...

  15. Estimating spawning times of Alligator Gar (Atractosteus spatula) in Lake Texoma, Oklahoma

    USGS Publications Warehouse

    Snow, Richard A.; Long, James M.


    In 2013, juvenile Alligator Gar were sampled in the reservoir-river interface of the Red River arm of Lake Texoma. The Red River, which flows 860 km along Oklahoma’s border with Texas, is the primary in-flow source of Lake Texoma, and is impounded by Denison Dam. Minifyke nets were deployed using an adaptive random cluster sampling design, which has been used to effectively sample rare species. Lapilli otoliths (one of the three pair of ear stones found within the inner ear of fish) were removed from juvenile Alligator Gar collected in July of 2013. Daily ages were estimated by counting the number of rings present, and spawn dates were back-calculated from date of capture and subtracting 8 days (3 days from spawn to hatch and 5 days from hatch to swimup when the first ring forms). Alligator Gar daily age estimation ranged from 50 to 63 days old since swim-up. Spawn dates corresponded to rising pool elevations of Lake Texoma and water pulses of tributaries.

  16. Natural Gas Storage Research at Savannah River National Laboratory

    SciTech Connect

    Anton, Don; Sulic, Martin; Tamburello, David A.


    As an alternative to imported oil, scientists at the Department of Energy’s Savannah River National Laboratory are looking at abundant, domestically sourced natural gas, as an alternative transportation fuel. SRNL is investigating light, inexpensive, adsorbed natural gas storage systems that may fuel the next generation of automobiles.


    EPA Science Inventory

    The goal of this study was to determine whether hepatic biotransformation of testosterone is normally sexually dimorphic in juvenile alligators and whether living in a contaminated environment affects hepatic dimorphism. Lake Woodruff served as our reference site. Moonshine Bay, ...


    EPA Science Inventory

    Morphological variation of 508 hatchling alligators from three lakes in north central Florida (Lakes Woodruff, Apopka, and Orange) was analyzed using multivariate statistics. Morphological variation was found among clutches as well as among lakes. Principal components analysis wa...

  19. Alligators, contaminants and steroid hormones.


    Guillette, Louis J; Edwards, Thea M; Moore, Brandon C


    Steroids are essential for successful reproduction in all vertebrate species. Over the last several decades, extensive research has indicated that exposure to various environmental pollutants can disrupt steroidogenesis and steroid signaling. Although steroidogenesis is regulated by the hypothalamic-pituitary axis, it is also modified by various paracrine and autocrine factors. Furthermore, the classical two-cell model of steroidogenesis in the developing ovarian follicle, involving the granulosa and theca cells in mammals, may not be universal. Instead, birds and probably reptiles use the two thecal compartments (theca interna and theca externa) as sites of steroid production. We have documented that embryonic or juvenile exposure to a complex mixture of contaminants from agricultural and storm water runoff leads to altered steroid hormone profiles in American alligators. Our observations suggest that alterations in plasma steroid hormone concentrations are due in part to altered gene expression, modified hepatic biotransformation and altered gonadal steroidogenesis. Future studies must examine the interplay between endocrine and paracrine regulation in the development and expression of gonadal steroidogenesis in individuals exposed to endocrine disrupting contaminants at various life stages if we are to fully understand potential detrimental outcomes.


    EPA Science Inventory

    Concentrations of metals and selenium were examined in tissues of American alligators (Alligator mississippiensis) from three lakes in central Florida, in one of which alligators have exhibited reproductive or developmental defects. Our overall objective was to determine whether ...

  1. Home range and movements of American alligators (Alligator mississippiensis) in an estuary habitat

    USGS Publications Warehouse

    Fujisaki, Ikuko; Hart, Kristen M.; Mazzotti, Frank J.; Cherkiss, Michael S.; Sartain-Iverson, Autumn R.; Jeffery, Brian M.; Beauchamp, Jeffrey S.; Denton, Mathew J.


    This study reveals consistent use of estuary habitat by American alligators. The alligators showed variations in their movement pattern and seasonal habitat, with movement attributable to environmental factors. Although satellite-derived locations were more dispersed compared to locations collected using VHF radio-tags, data collected from VHF tracking omitted some habitat used for a short period of time, indicating the effectiveness of satellite telemetry to continuously track animals for ecosystem-scale studies.

  2. A group of alligators basks in the sun and rest in the water at KSC.

    NASA Technical Reports Server (NTRS)


    This pond near Schwartz Rd. at Kennedy Space Center is host to a least the nine alligators shown on the banks and in the water. Nearly 5,000 alligators can be found in canals, ponds, and waterways throughout the Center and the Merritt Island National Wildlife Refuge, which shares a boundary with the Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Wildlife Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  3. The isolation of parvalbumin isoforms from the tail muscle of the American alligator (Alligator mississipiensis).


    Laney, E L; Shabanowitz, J; King, G; Hunt, D F; Nelson, D J


    Multiple parvalbumin isoforms have been detected in the tail (skeletal) muscle of the American alligator (Alligator mississipiensis). One of these isoforms (APV-1) has been highly purified and partially characterized. Protein purification involved mainly gel filtration and anion exchange chromatography, and characterization included gel electrophoresis, amino acid composition analysis, metal ion analysis, MALDI-TOF and ESI mass spectrometry, ultraviolet and fluorescence spectroscopy, and one- and two-dimensional 500 MHz proton NMR spectroscopy. The alligator isoforms are rich in phenylalanine and deficient in the other aromatic residues as is typical for parvalbumins. In fact, the one highly purified isoform that forms the basis of this study has only phenyl-alanine as an aromatic residue. Ion exchange chromatography further indicates that this isoform has a relatively high isoelectric point (pl approximately 5.0), indicating that it is an alpha-lineage parvalbumin. This alligator parvalbumin isoform is unusual in that it has an atypically high Ca2+ content (almost 3.0 mole of Ca2+ per mole of protein) following purification, a fact supported by terbium fluorescence titration experiments. Preliminary comparative analysis of the highly purified alligator parvalbumin isoform (in the Ca2-loaded state) by two-dimensional 1H-NMR (2D 1H TOCSY and 2D 1H NOESY) indicates that there is considerable similarity in structure between the alligator protein and a homologous protein obtained from the silver hake (a saltwater fish species). PMID:9076974

  4. Urinary Phthalate Metabolites in American Alligators (Alligator mississippiensis) from Selected Florida Wetlands.


    Brock, John W; Bell, Jane Margaret; Guillette, Louis J


    Phthalates have been shown to cause endocrine disruption in laboratory animals and are associated with altered development of the reproductive system in humans. Further, human have significant exposure to phthalates. However, little is known concerning the exposure of wildlife to phthalates. We report urinary phthalate metabolite concentrations from fifty juvenile alligators from three Florida lakes and a site in the Everglades. Urinary phthalate monoester concentrations varied widely among alligators from the different sites but also among alligators from the same site. Mono-2-ethylhexy phthalate and monobutyl phthalate were found in most samples of alligator urine with maximums of 35,700 ng/mL and 193 ng/mL, respectively. Monobenzyl phthalate was found in 5 alligators with a maximum of 66.7 ng/mL. Other monoesters were found in only one or two alligator urine samples. The wide variation within and among sites, in addition to the high levels of mEHP, mBP and mBzP, is consistent with exposure arising from the intermittent spraying of herbicide formulations to control invasive aquatic plants in Florida freshwater sites. Phthalate diesters are used as adjuvants in many of these formulations. PMID:26743198

  5. Survival and growth of American alligator (Alligator mississippiensis) hatchlings after artificial incubation and repatriation

    USGS Publications Warehouse

    Temsiripong, Y.; Woodward, A.R.; Ross, J.P.; Kubilis, P.S.; Percival, H.F.


    Hatchling American Alligators (Alligator mississippiensis) produced from artificially incubated wild eggs were returned to their natal areas (repatriated). We compared artificially incubated and repatriated hatchlings released within and outside the maternal alligator's home range with naturally incubated hatchlings captured and released within the maternal alligator's home range on Lake Apopka, Lake Griffin, and Orange Lake in Florida. We used probability of recapture and total length at approximately nine months after hatching as indices of survival and growth rates. Artificially incubated hatchlings released outside of the maternal alligator's home range had lower recapture probabilities than either naturally incubated hatchlings or artificially incubated hatchlings released near the original nest site. Recapture probabilities of other treatments did not differ significantly. Artificially incubated hatchlings were approximately 6% shorter than naturally incubated hatchlings at approximately nine months after hatching. We concluded that repatriation of hatchlings probably would not have long-term effects on populations because of the resiliency of alligator populations to alterations of early age-class survival and growth rates of the magnitude that we observed. Repatriation of hatchlings may be an economical alternative to repatriation of older juveniles for population restoration. However, the location of release may affect subsequent survival and growth. Copyright 2006 Society for the Study of Amphibians and Reptiles.

  6. River Chemistry and Solute Flux in Yellowstone National Park

    USGS Publications Warehouse

    Hurwitz, Shaul; Eagan, Sean; Heasler, Henry; Mahony, Dan; Huebner, Mark A.; Lowenstern, Jacob B.


    Introduction The Yellowstone Volcano Observatory (YVO) was established to 'To strengthen the long-term monitoring of volcanic and earthquake unrest in the Yellowstone National Park region'. Yellowstone National Park is underlain by a voluminous magmatic system overlain by the most active hydrothermal system on Earth. Tracking changes in water and gas chemistry is of great importance because anomalous fluxes might signal one of the earliest warnings of volcanic unrest. Because of the tremendous number, chemical diversity, and large aerial coverage of Yellowstone's thermal features, it remains daunting to monitor individual features that might serve as proxies for anomalous activity in the hydrothermal system. Sampling rivers provides some advantages, because they integrate chemical fluxes over a very large area and therefore, river fluxes may reveal large-scale spatial patterns (Hurwitz et al., 2007). In addition, based on the application of the chloride-enthalpy method (Fournier, 1979), quantifying chloride flux in rivers provides an estimate of the total heat discharge from the Yellowstone volcanic system (Norton and Friedman 1985; Fournier, 1989; Friedman and Norton, in press). Intermittent sampling of the large rivers draining Yellowstone National Park began in the 1960's (Fournier et al., 1976) and continuous sampling has been carried out since water year (1 October - 30 September) 1983 excluding water years 1995 and 1996 (Norton and Friedman, 1985, 1991; Friedman and Norton, 1990, 2000, 2007). Between 1983 and 2001 only Cl concentrations and fluxes were determined. Starting in water year 2002, the concentrations and fluxes of other anions of possible magmatic origin (F-, Br-, HCO3- , and SO42-) were also determined, and several new sampling sites were established (Hurwitz et al., 2007). The ongoing sampling and analysis of river solute flux is a key component in the current monitoring program of YVO, and it is a collaboration between the U.S. Geological Survey

  7. 77 FR 21522 - Boundary Establishment for the Allegheny National Wild and Scenic River, Allegheny National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... River, Allegheny National Forest, Warren, Forest, and Venango Counties, PA AGENCY: Forest Service, USDA... contacting Operations Staff Officer Jim Seyler, Allegheny National Forest, 4 Farm Colony Drive, Warren, PA or..., Warren, PA 16365. A detailed legal description is available upon request. The Allegheny Wild and...

  8. Water hyacinths and alligator weeds for removal of lead and mercury from polluted waters

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.


    Removal of lead and mercury by water hyacinths (Eichhornia crassipes) (Mart.) Solms and alligator weeds (Alternanthera philoxeroides) (Mart.) Griesb. was investigated. Water hyacinths demonstrated the ability to remove 0.176 mg of lead and 0.150 mg of mercury per gram of dry plant material from distilled water and river water in a 24-hour period. One acre of water hyacinths is potentially capable of removing 105.6 grams of lead and 90.0 grams of mercury per day. Alligator weeds removed 0.101 mg of lead per gram of dry plant material in a 24-hour period. This same plant also demonstrated the ability to remove a minimum of 0.153 mg of mercury per gram of dry plant material in a six hour period.

  9. 75 FR 2885 - Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Office of the Secretary Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting... the John H. Chafee Blackstone River Valley National Heritage Corridor Commission will be held on...: Jan H. Reitsma, Executive Director, John H. Chafee Blackstone River Valley National Heritage...

  10. 75 FR 17756 - Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Office of the Secretary Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting... the John H. Chafee Blackstone River Valley National Heritage Corridor Commission will be held on..., Executive Director, John H. Chafee, Blackstone River Valley National Heritage Corridor Commission, One...

  11. Bio-gas production from alligator weeds

    NASA Technical Reports Server (NTRS)

    Latif, A.


    Laboratory experiments were conducted to study the effect of temperature, sample preparation, reducing agents, light intensity and pH of the media, on bio-gas and methane production from the microbial anaerobic decomposition of alligator weeds (Alternanthera philoxeroides. Efforts were also made for the isolation and characterization of the methanogenic bacteria.

  12. Crocodiles and Alligators. Young Discovery Library Series.

    ERIC Educational Resources Information Center

    Farre, Marie

    This book is written for children ages 5 through 10. Part of a series designed to develop their curiosity, fascinate them and educate them, this volume describes the physical characteristics, behavior, and peculiar habits of crocodiles, including how to distinguish them from close relatives such as alligators, cayman, and gharials. (YP)

  13. Alternathera philoxeroides (Martius) Grisebach - alligator weed

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biological control of Alternanthera philoxeroides, alligator weed, began when George Vogt, USDA, conducted several surveys by public transport in South America during the 1960s. Three agents were released in USA and two of them, the flea beetle Agasicles hygrophila and the moth Arcola malloi were re...

  14. 75 FR 38832 - Record of Decision for the General Management Plan for the Chattahoochee River National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... National Recreation Area, GA AGENCY: National Park Service, Department of the Interior. ACTION: Notice of... Chattahoochee River National Recreation Area. SUMMARY: Pursuant to the National Environmental Policy Act of 1969... Decision (ROD) for the General Management Plan, Chattahoochee River National Recreation Area, Georgia....

  15. 75 FR 69125 - River Raisin National Battlefield Park, MI ; Account Number: 6495

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... National Park Service River Raisin National Battlefield Park, MI ; Account Number: 6495 AGENCY: National Park Service, Department of the Interior. ACTION: Notification of a New National Park, River Raisin National Battlefield Park. SUMMARY: As authorized by Section 7003 of the Omnibus Public Land Management...

  16. Elemental Levels Analyzed by PIXE in Florida Alligators

    NASA Astrophysics Data System (ADS)

    Kuharik, J. C.; Kravchenko, I. I.; Dunnam, F. E.; Van Rinsvelt, H. A.; Ross, J. P.


    Unusual and alarming mortality of alligators (Alligator mississippiensis) has been reported from Lake Griffin, Florida, where almost 400 dead alligators have been observed since 1997. In addition, the hatch rate for alligator eggs around Lake Griffin fell below 10% and remains low (30-45%) while the normal hatch rate is typically 80%. Standard diagnostic methods have been ineffective in determining the cause of the phenomenon. Many possibilities have been considered including pollutants, nutrition, and toxic algae. Particle Induced X-ray Emission (PIXE) analysis is highly suitable for investigating concentrations of a wide range of elements in animal tissue. Liver, kidney and spinal cord tissues from healthy and sick alligators have been analyzed by PIXE for elemental content. Initial results showed positive correlation between certain elements and neural impairment and morbidity of alligators in Lake Griffin, but have failed to prove significant.

  17. Elemental Levels Analyzed by PIXE in Florida Alligators

    SciTech Connect

    Kuharik, J.C.; Kravchenko, I.I.; Dunnam, F.E.; Rinsvelt, H.A. van; Ross, J.P.


    Unusual and alarming mortality of alligators (Alligator mississippiensis) has been reported from Lake Griffin, Florida, where almost 400 dead alligators have been observed since 1997. In addition, the hatch rate for alligator eggs around Lake Griffin fell below 10% and remains low (30-45%) while the normal hatch rate is typically 80%. Standard diagnostic methods have been ineffective in determining the cause of the phenomenon. Many possibilities have been considered including pollutants, nutrition, and toxic algae. Particle Induced X-ray Emission (PIXE) analysis is highly suitable for investigating concentrations of a wide range of elements in animal tissue. Liver, kidney and spinal cord tissues from healthy and sick alligators have been analyzed by PIXE for elemental content. Initial results showed positive correlation between certain elements and neural impairment and morbidity of alligators in Lake Griffin, but have failed to prove significant.

  18. A study on biliary ductal system and bile fistula in the American alligator, Alligator mississippiensis.


    Xu, G; Elsey, R M; Lance, V A; Javors, B; Chen, T S; Salen, G; Tint, G S


    The anomalous arrangement of bile ducts in the Crocodylia has not been fully appreciated. A clear understanding of biliary anatomy is necessary in order to create complete bile drainage in these reptiles. The object of this study was to clarify the anatomy of the bile ductal system and to establish total bile fistulas in the American alligator, Alligator mississippiensis. Bile duct anatomy was studied in 104 juvenile alligators, and bile fistulas were constructed in seven alligators. In 93 out of 104 (89%) of the juveniles dissected there was an interconnection between the right and left hepatic duct before the right hepatic duct emptied into the gallbladder. The left hepatic duct then entered the duodenum independently of the cystic duct which drained the gallbladder directly into the duodenum. In 8% of the animals, the left hepatic duct did not enter the duodenum but joined with the right duct, forming a common hepatic duct that emptied into the gallbladder. In 3% of the cases, the right hepatic duct emptied into the gallbladder, while the left duct had no communication with the right hepatic duct and drained separately into the duodenum. This arrangement of bile ducts is similar to that seen in birds and reflects the common ancestry of crocodiles and birds. In other reptiles, the biliary system shows much more variability and is different from the alligator. In five of seven alligators in which total biliary diversion was attempted, the biliary catheter remained in place and stayed patent from 2-7 weeks. Bile flow was extremely low (1.5-2.5 ml/24 h) when compared to that of mammals (80-100 ml/24 h). This study demonstrates the variable nature of the biliary ductal system in Alligator mississippiensis and suggest a method for constructing an effective total bile fistula in these animals.

  19. A General Approach for Establishing National Priorities for River Restoration

    NASA Astrophysics Data System (ADS)

    Schmidt, J. C.


    The effort to restore the nation's rivers necessarily involves the interplay among physical and biological science, engineering design and implementation, and policy science. Policy science helps decision-makers prioritize where to undertake restoration and what the goal or objective of remediation should be. Some commentators have advocated that restoration be pursued on streams that constitute the "low hanging fruit," that is the streams where the greatest gain can be obtained for the least investment. There is a general need for a unifying concept with which to evaluate these policy tradeoffs. The restoration response function defines the relationship between the costs of flow and sediment alteration and the results of those actions in reversing undesired channel change. Development of these functional relations should be an essential element in stream restoration, especially where there are many environmental management programs in a basin and they all affect regional water delivery and hydroelectric power production. The nation's regulated streams - those that are extensively dammed or diverted - are typically proposed for restoration. These streams can be distinguished into three categories: (1) physically transformed, (2) essentially wild and in sediment deficit, and (3) essentially wild and in sediment surplus. Physically transformed streams are those that have been channelized or leveed. Streams in sediment deficit are those whose sediment delivery has been decreased much more than has the ability to transport the available supply. Those in surplus are those whose sediment delivery now exceeds the ability to transport the available supply. Major efforts at riverine ecosystem rehabilitation are underway in all types of streams. The Lower Colorado River Multi-Species Conservation Program and efforts on the lower Missouri River and the Columbia Rivers are focused on transformed rivers. The Grand Canyon Adaptive Management Program is focused on a river in

  20. National Water-Quality Assessment program: The Trinity River Basin

    USGS Publications Warehouse

    Land, Larry F.


    In 1991, the U.S. Geological Survey (USGS) began to implement a full-scale National Water-Quality Assessment (NAWQA) program. The long-term goals of the NAWQA program are to describe the status and trends in the quality of a large, representative part of the Nation's surface- and ground-water resources and to provide a sound, scientific understanding of the primary natural and human factors affecting the quality of these resources. In meeting these goals, the program will produce a wealth of water-quality information that will be useful to policy makers and managers at the national, State, and local levels. A major design feature of the NAWQA program will enable water-quality information at different areal scales to be integrated. A major component of the program is study-unit investigations, which comprise the principal building blocks of the program on which national-level assessment activities will be based. The 60 study-unit investigations that make up the program are hydrologic systems that include parts of most major river basins and aquifer systems. These study units cover areas of 1,200 to more than 65,000 square miles and incorporate about 60 to 70 percent of the Nation's water use and population served by public water supply. In 1991, the Trinity River basin study was among the first 20 NAWQA study units selected for study under the full-scale implementation plan.

  1. National Water-Quality Assessment Program: The Sacramento River Basin

    USGS Publications Warehouse

    Domagalski, Joseph L.; Brown, Larry R.


    In 1991, the U.S. Geological Survey (USGS) began to implement a full-scale National Water-Quality Assessment (NAWQA) program. The long-term goals of the NAWQA program are to describe the status of and trends in the quality of a large, representative part of the Nation's surface- and ground-water resources and to identify the major natural and human factors that affect the quality of those resources. In addressing these goals, the program will provide a wealth of water- quality information that will be useful to policy makers and managers at the national, State, and local levels. A major asset of the NAWQA program is that it will allow for the integration of water-quality information collected at several scales. A major component of the program is the study-unit investigation-the foundation of national- level assessment. The 60 study units of the NAWQA program are hydrologic systems that include parts of most major river basins and aquifer systems of the conterminous United States. These study units cover areas of 1,000 to more than 60,000 square miles and represent 60 to 70 percent of the Nation's water use and population served by public water supplies. Investigations of the first 20 study units began in 1991. In 1994, the Sacramento River Basin was among the second set of 20 NAWQA study units selected for investigation.

  2. Identification and Characterization of the Androgen Receptor From the American Alligator, Alligator mississippiensis

    PubMed Central

    Miyagawa, Shinichi; Yatsu, Ryohei; Kohno, Satomi; Doheny, Brenna M.; Ogino, Yukiko; Ishibashi, Hiroshi; Katsu, Yoshinao; Ohta, Yasuhiko; Guillette, Louis J.


    Androgens are essential for the development, reproduction, and health throughout the life span of vertebrates, particularly during the initiation and maintenance of male sexual characteristics. Androgen signaling is mediated by the androgen receptor (AR), a member of the steroid nuclear receptor superfamily. Mounting evidence suggests that environmental factors, such as exogenous hormones or contaminants that mimic hormones, can disrupt endocrine signaling and function. The American alligator (Alligator mississippiensis), a unique model for ecological research in that it exhibits environment-dependent sex determination, is oviparous and long lived. Alligators from a contaminated environment exhibit low reproductive success and morphological disorders of the testis and phallus in neonates and juveniles, both associated with androgen signaling; thus, the alterations are hypothesized to be related to disrupted androgen signaling. However, this line of research has been limited because of a lack of information on the alligator AR gene. Here, we isolated A mississippiensis AR homologs (AmAR) and evaluated receptor-hormone/chemical interactions using a transactivation assay. We showed that AmAR responded to all natural androgens and their effects were inhibited by cotreatment with antiandrogens, such as flutamide, p,p′-dichlorodiphenyldichloroethylene, and vinclozolin. Intriguingly, we found a spliced form of the AR from alligator cDNA, which lacks seven amino acids within the ligand-binding domain that shows no response to androgens. Finally, we have initial data on a possible dominant-negative function of the spliced form of the AR against androgen-induced AmAR. PMID:25974402

  3. Blood and Plasma Biochemistry Reference Intervals for Wild Juvenile American Alligators ( Alligator mississippiensis ).


    Hamilton, Matthew T; Kupar, Caitlin A; Kelley, Meghan D; Finger, John W; Tuberville, Tracey D


    : American alligators ( Alligator mississippiensis ) are one of the most studied crocodilian species in the world, yet blood and plasma biochemistry information is limited for juvenile alligators in their northern range, where individuals may be exposed to extreme abiotic and biotic stressors. We collected blood samples over a 2-yr period from 37 juvenile alligators in May, June, and July to establish reference intervals for 22 blood and plasma analytes. We observed no effect of either sex or blood collection time on any analyte investigated. However, our results indicate a significant correlation between a calculated body condition index and aspartate aminotransferase and creatine kinase. Glucose, total protein, and potassium varied significantly between sampling sessions. In addition, glucose and potassium were highly correlated between the two point-of-care devices used, although they were significantly lower with the i-STAT 1 CG8+ cartridge than with the Vetscan VS2 Avian/Reptile Rotor. The reference intervals presented herein should provide baseline data for evaluating wild juvenile alligators in the northern portion of their range. PMID:27224213

  4. Identification and Characterization of the Androgen Receptor From the American Alligator, Alligator mississippiensis.


    Miyagawa, Shinichi; Yatsu, Ryohei; Kohno, Satomi; Doheny, Brenna M; Ogino, Yukiko; Ishibashi, Hiroshi; Katsu, Yoshinao; Ohta, Yasuhiko; Guillette, Louis J; Iguchi, Taisen


    Androgens are essential for the development, reproduction, and health throughout the life span of vertebrates, particularly during the initiation and maintenance of male sexual characteristics. Androgen signaling is mediated by the androgen receptor (AR), a member of the steroid nuclear receptor superfamily. Mounting evidence suggests that environmental factors, such as exogenous hormones or contaminants that mimic hormones, can disrupt endocrine signaling and function. The American alligator (Alligator mississippiensis), a unique model for ecological research in that it exhibits environment-dependent sex determination, is oviparous and long lived. Alligators from a contaminated environment exhibit low reproductive success and morphological disorders of the testis and phallus in neonates and juveniles, both associated with androgen signaling; thus, the alterations are hypothesized to be related to disrupted androgen signaling. However, this line of research has been limited because of a lack of information on the alligator AR gene. Here, we isolated A mississippiensis AR homologs (AmAR) and evaluated receptor-hormone/chemical interactions using a transactivation assay. We showed that AmAR responded to all natural androgens and their effects were inhibited by cotreatment with antiandrogens, such as flutamide, p,p'-dichlorodiphenyldichloroethylene, and vinclozolin. Intriguingly, we found a spliced form of the AR from alligator cDNA, which lacks seven amino acids within the ligand-binding domain that shows no response to androgens. Finally, we have initial data on a possible dominant-negative function of the spliced form of the AR against androgen-induced AmAR. PMID:25974402

  5. A walk through the hydroclimate network in Yosemite National Park: River chemistry

    USGS Publications Warehouse

    Peterson, Dave; Smith, Richard; Hager, Stephen


    Visitors to Yosemite National Park (YNP) are fully aware of the weather, snowmelt, waterfalls (Photo 1), and river discharge and river and lake water temperature. They are not, however, thinking about river chemistry because you can’t see, hear, or feel it. So a river chemistry article in Nature Notes needs a familiar background before we break out the instruments.

  6. Interactive Forecasting with the National Weather Service River Forecast System

    NASA Technical Reports Server (NTRS)

    Smith, George F.; Page, Donna


    The National Weather Service River Forecast System (NWSRFS) consists of several major hydrometeorologic subcomponents to model the physics of the flow of water through the hydrologic cycle. The entire NWSRFS currently runs in both mainframe and minicomputer environments, using command oriented text input to control the system computations. As computationally powerful and graphically sophisticated scientific workstations became available, the National Weather Service (NWS) recognized that a graphically based, interactive environment would enhance the accuracy and timeliness of NWS river and flood forecasts. Consequently, the operational forecasting portion of the NWSRFS has been ported to run under a UNIX operating system, with X windows as the display environment on a system of networked scientific workstations. In addition, the NWSRFS Interactive Forecast Program was developed to provide a graphical user interface to allow the forecaster to control NWSRFS program flow and to make adjustments to forecasts as necessary. The potential market for water resources forecasting is immense and largely untapped. Any private company able to market the river forecasting technologies currently developed by the NWS Office of Hydrology could provide benefits to many information users and profit from providing these services.

  7. EPA's National Reassessment of Contaminants in Fish from U.S. Rivers

    EPA Science Inventory

    Multiple EPA offices collaborated to conduct a reassessment of fish contamination in U.S. rivers as part of the Agency’s 2013-14 National Rivers and Streams Assessment (NRSA). This is the first national assessment of contamination in river fish that will generate probabili...

  8. Environmental risk assessment of compost prepared from salvinia, egeria densa, and alligator weed.


    Dorahy, C G; Pirie, A D; McMaster, I; Muirhead, L; Pengelly, P; Chan, K Y; Jackson, M; Barchia, I M


    Approximately 70,000 m(3) of salvinia (Salvinia molesta) was removed from the Hawkesbury-Nepean River, New South Wales (NSW), Australia, during 2004. This study assessed the risks associated with applying compost prepared from aquatic weeds (AWC) to land, namely, survival and spread of aquatic and terrestrial weeds, eutrophication of waterways, accumulation of heavy metals and phytotoxicity. The results demonstrate composting is an effective method of reducing the viability of aquatic and terrestrial weeds. However, mortality of alligator weed (Alternanthera philoxeroides), which was used as an indicator plant, was significantly (P < 0.001) correlated with the temperature within the windrows and the length of time the material was subjected to composting. Conditions within the central core of the windrow were sufficient to kill the alligator weed, although not all of the aquatic weed material was exposed to the windrows' central core. This resulted in alligator weed continuing to grow at the base of the windrow. To reduce the risk of weeds surviving and spreading in aquatic and terrestrial environments it is suggested compost windrows should be located on an appropriate hard pad to enable complete mixing of the material and ensure all material is exposed to temperatures >55 degrees C for greater than three consecutive days. The likelihood of other risks associated with the AWC was low. If composting is selected as the preferred method for managing organic material harvested from waterways, then ongoing monitoring and evaluation is required to validate the composting process and ensure consumer confidence in the final product.

  9. Health assessment of free-ranging alligator snapping turtles (Macrochelys temminckii) in Georgia and Florida.


    Chaffin, Kristen; Norton, Terry M; Gilardi, Kirsten; Poppenga, Robert; Jensen, John B; Moler, Paul; Cray, Carolyn; Dierenfeld, Ellen S; Chen, Tai; Oliva, Marcie; Origgi, Francesco C; Gibbs, Samantha; Mazzaro, Lisa; Mazet, Jonna


    The Alligator Snapping Turtle (Macrochelys temminckii) is a large freshwater turtle endemic to river systems that drain into the Gulf of Mexico. Turtle populations were sharply reduced by commercial harvest in the 1970s and 1980s; however, the species has yet to be protected under the Endangered Species Act. While anthropogenic stressors such as habitat fragmentation and degradation and illegal capture continue to threaten populations, the degree to which disease may be contributing to any decline of the Alligator Snapping Turtle is unknown. Data were collected from 97 free-ranging Alligator Snapping Turtles in nine waterways in Florida and Georgia from 2001 to 2006. Eleven turtles were captured more than once, resulting in a total sample pool of 123. Reference ranges were established for complete blood count, plasma biochemistry values, trace metals (mercury, zinc, copper, lead, and arsenic), and nutrient parameters (vitamins A, E, D, and selenium). Variations by capture location, sex, and season were detected and likely resulted from external factors such as habitat and diet. Turtles sampled in one location were positive for tortoise herpesviral antibodies. Blood mercury values also differed among populations. This study provides justification for the use of these long-lived aquatic turtles as biologic monitors of the health of local freshwater ecosystems. PMID:18689653

  10. Respiratory bronchoscopy of subadult American alligators (Alligator mississippiensis) and tracheal wash evaluation.


    Lafortune, Maud; Göbel, Thomas; Jacobson, Elliot; Heard, Darryl; Brown, Dan; Alleman, Rick; Vliet, Kent; Harr, Kendal E; Hernandez, Jorge


    Twelve healthy approximately 3-yr-old captive-born 4.5-9 kg American alligators (Alligator mississipiensis) each had bronchoscopy and tracheal washes performed four times during a 10-mo period to evaluate seasonal respiratory microbiology and cytology. Cytologic evaluation of most samples showed a small amount of mucus and low numbers of ciliated columnar epithelium, cubodial epithelium, and keratinized squamous cells. No bacteria or parasites were observed, and there was no seasonal variation in the cytology. No significant bacterial or fungal growth was identified in any season. Hematology performed in the spring and fall evaluations showed seasonal variation in the red blood cell count, hemoglobin concentration, mean corpuscular volume, mean corpuscular hemoglobin concentration, eosinophil count, and thrombocyte count. The lower respiratory tract (at the tracheal level) of healthy subadult alligators appears to be sterile, and cytology is similar to that described in domestic mammals. PMID:17315452

  11. Low cost of pulmonary ventilation in American alligators (Alligator mississippiensis) stimulated with doxapram.


    Skovgaard, Nini; Crossley, Dane A; Wang, Tobias


    To determine the costs of pulmonary ventilation without imposing severe oxygen limitations or acidosis that normally accompany exposures to hypoxia or hypercapnia, we opted to pharmacologically stimulate ventilation with doxapram (5 and 10 mg kg(-1)) in alligators. Doxapram is used clinically to alleviate ventilatory depression in response to anaesthesia and acts primarily on the peripheral oxygen-sensitive chemoreceptors. Using this approach, we investigated the hypothesis that pulmonary ventilation is relatively modest in comparison to resting metabolic rate in crocodilians and equipped seven juvenile alligators with masks for concurrent determination of ventilation and oxygen uptake. Doxapram elicited a dose-dependent and up to fourfold rise in ventilation, primarily by increasing ventilatory frequency. The accompanying rise in oxygen uptake was very small; ventilation in resting animals constitutes no more than 5% of resting metabolic rate. The conclusion that pulmonary ventilation is energetically cheap is consistent with earlier studies on alligators where ventilation was stimulated by hypoxia or hypercapnia. PMID:26896538

  12. Cloning of the growth hormone cDNA of alligator gar Atractosteus spatula and its expression through larval development.


    Revol, Agnès; Garza Rodríguez, Maria de Lourdes; Hernández Montenegro, Víctor; Aguilera, Carlos; Barrera Saldaña, Hugo; Mendoza, Roberto


    The alligator gar (Atractosteus spatula) is the largest freshwater fish inhabiting rivers draining into the Gulf of Mexico. This primitive fish shows a fast growth rate since its early larval stages. This is attributed to the action of growth hormone (GH), an anterior pituitary gland hormone responsible for linear growth in vertebrates that can also be expressed in extrapituitary adult tissues and in fish embryos. The present research was aimed at obtaining the GH coding sequence of the alligator gar and studying its expression through larval development. A cDNA was obtained by RT-PCR, cloned and sequenced. The alligator gar GH cDNA sequence shares 98% nucleotide similarity with that reported for Lepisosteus osseus, indicating a very slow evolution of the GH within the primitive fish, in contrast with the burst of changes observed in euteleosts. Using RT-PCR and RNA nuclease protection assays, GH transcripts were detected at very high levels in eggs, embryos and in several larval stages. These data suggest that the GH may play an important role during embryogenesis in fish. The better understanding of alligator gar larval physiology will facilitate the culture of larvae and juvenile gar and consequently may allow the restoration of their natural populations. PMID:15936701

  13. Cloning of the growth hormone cDNA of alligator gar Atractosteus spatula and its expression through larval development.


    Revol, Agnès; Garza Rodríguez, Maria de Lourdes; Hernández Montenegro, Víctor; Aguilera, Carlos; Barrera Saldaña, Hugo; Mendoza, Roberto


    The alligator gar (Atractosteus spatula) is the largest freshwater fish inhabiting rivers draining into the Gulf of Mexico. This primitive fish shows a fast growth rate since its early larval stages. This is attributed to the action of growth hormone (GH), an anterior pituitary gland hormone responsible for linear growth in vertebrates that can also be expressed in extrapituitary adult tissues and in fish embryos. The present research was aimed at obtaining the GH coding sequence of the alligator gar and studying its expression through larval development. A cDNA was obtained by RT-PCR, cloned and sequenced. The alligator gar GH cDNA sequence shares 98% nucleotide similarity with that reported for Lepisosteus osseus, indicating a very slow evolution of the GH within the primitive fish, in contrast with the burst of changes observed in euteleosts. Using RT-PCR and RNA nuclease protection assays, GH transcripts were detected at very high levels in eggs, embryos and in several larval stages. These data suggest that the GH may play an important role during embryogenesis in fish. The better understanding of alligator gar larval physiology will facilitate the culture of larvae and juvenile gar and consequently may allow the restoration of their natural populations.

  14. In ovo and in vitro susceptibility of American alligators (Alligator mississippiensis) to avian influenza virus infection.


    Temple, Bradley L; Finger, John W; Jones, Cheryl A; Gabbard, Jon D; Jelesijevic, Tomislav; Uhl, Elizabeth W; Hogan, Robert J; Glenn, Travis C; Tompkins, S Mark


    Avian influenza has emerged as one of the most ubiquitous viruses within our biosphere. Wild aquatic birds are believed to be the primary reservoir of all influenza viruses; however, the spillover of H5N1 highly pathogenic avian influenza (HPAI) and the recent swine-origin pandemic H1N1 viruses have sparked increased interest in identifying and understanding which and how many species can be infected. Moreover, novel influenza virus sequences were recently isolated from New World bats. Crocodilians have a slow rate of molecular evolution and are the sister group to birds; thus they are a logical reptilian group to explore susceptibility to influenza virus infection and they provide a link between birds and mammals. A primary American alligator (Alligator mississippiensis) cell line, and embryos, were infected with four, low pathogenic avian influenza (LPAI) strains to assess susceptibility to infection. Embryonated alligator eggs supported virus replication, as evidenced by the influenza virus M gene and infectious virus detected in allantoic fluid and by virus antigen staining in embryo tissues. Primary alligator cells were also inoculated with the LPAI viruses and showed susceptibility based upon antigen staining; however, the requirement for trypsin to support replication in cell culture limited replication. To assess influenza virus replication in culture, primary alligator cells were inoculated with H1N1 human influenza or H5N1 HPAI viruses that replicate independent of trypsin. Both viruses replicated efficiently in culture, even at the 30 C temperature preferred by the alligator cells. This research demonstrates the ability of wild-type influenza viruses to infect and replicate within two crocodilian substrates and suggests the need for further research to assess crocodilians as a species potentially susceptible to influenza virus infection.



    Zhao, Jinhong; Wang, Shaosheng; Tu, Genjun; Zhou, Yongkang; Wu, Xiaobing; Li, Chaopin


    Crocodiles are susceptible to infection with a wide array of external and internal gastrointestinal helminths, yet little is known on the histopathology following infection or the effects of these parasites. The present study was aimed at evaluating the impact of infection by Ortleppascaris sinensis (Nematoda: Ascaridoidea) on the stomach of captive Alligator sinensis. The histological examination of the stomach revealed presence of superficial ulcer in mucous layer and granulomatous inflammation in submucous layer at entire gastric walls of the Alligator sinensis. Our findings also confirm that development of Ortleppascaris sinensis is in close association with the wall of the stomach. PMID:26319836


    SciTech Connect

    Richard Metcalf; Saleem Salaymeh; Michael Ehinger


    Abstract was already submitted. Could not find the previous number. Would be fine with attaching/update of old number. Abstract Below: Modern nuclear facilities will have significant process monitoring capability for their operators. These systems will also be used for domestic safeguards applications, which has led to research over new diversion-detection algorithms. Curiously missing from these efforts are verification and validation data sets. A tri-laboratory project to locate the existing data sets and recover their data has yielded three major potential sources of data. The first is recovery of the process monitoring data of the Idaho Chemical Processing Plant, which now has a distributable package for algorithm developers. The second data set is extensive sampling and process data from Savannah River National Laboratory’s F- and H-canyon sites. Finally, high fidelity data from the start-up tests at the Barnwell Reprocessing Facility is in recovery. This paper details the data sets and compares their relative attributes.

  17. Hexavalent chromium is cytotoxic and genotoxic to American alligator cells.


    Wise, Sandra S; Wise, Catherine; Xie, Hong; Guillette, Louis J; Zhu, Cairong; Wise, John Pierce; Wise, John Pierce


    Metals are a common pollutant in the aquatic ecosystem. With global climate change, these levels are anticipated to rise as lower pH levels allow sediment bound metals to be released. The American alligator (Alligator mississippiensis) is an apex predator in the aquatic ecosystem and is considered a keystone species; as such it serves as a suitable monitor for localized pollution. One metal of increasing concern is hexavalent chromium (Cr(VI)). It is present in the aquatic environment and is a known human carcinogen and reproductive toxicant. We measured the cytotoxicity and genotoxicity of Cr(VI) in American alligator cells derived from scute tissue. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to alligator cells in a concentration-dependent manner. These data suggest that alligators may be used as a model for assessing the effects of environmental Cr(VI) contamination as well as for other metals of concern. PMID:26730726

  18. Hexavalent chromium is cytotoxic and genotoxic to American alligator cells.


    Wise, Sandra S; Wise, Catherine; Xie, Hong; Guillette, Louis J; Zhu, Cairong; Wise, John Pierce; Wise, John Pierce


    Metals are a common pollutant in the aquatic ecosystem. With global climate change, these levels are anticipated to rise as lower pH levels allow sediment bound metals to be released. The American alligator (Alligator mississippiensis) is an apex predator in the aquatic ecosystem and is considered a keystone species; as such it serves as a suitable monitor for localized pollution. One metal of increasing concern is hexavalent chromium (Cr(VI)). It is present in the aquatic environment and is a known human carcinogen and reproductive toxicant. We measured the cytotoxicity and genotoxicity of Cr(VI) in American alligator cells derived from scute tissue. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to alligator cells in a concentration-dependent manner. These data suggest that alligators may be used as a model for assessing the effects of environmental Cr(VI) contamination as well as for other metals of concern.

  19. Pathology, physiologic parameters, tissue contaminants, and tissue thiamine in morbid and healthy central Florida adult American alligators (Alligator mississippiensis)

    USGS Publications Warehouse

    Honeyfield, D.C.; Ross, J.P.; Carbonneau, D.A.; Terrell, S.P.; Woodward, A.R.; Schoeb, T.R.; Perceval, H.F.; Hinterkopf, J.P.


    An investigation of adult alligator (Alligator mississippiensis) mortalities in Lake Griffin, central Florida, was conducted from 1998-2004. Alligator mortality was highest in the months of April and May and annual death count peaked in 2000. Bacterial pathogens, heavy metals, and pesticides were not linked with the mortalities. Blood chemistry did not point to any clinical diagnosis, although differences between impaired and normal animals were noted. Captured alligators with signs of neurologic impairment displayed unresponsive and uncoordinated behavior. Three of 21 impaired Lake Griffin alligators were found to have neural lesions characteristic of thiamine deficiency in the telencephalon, particularly the dorsal ventricular ridge. In some cases, lesions were found in the thalamus, and parts of the midbrain. Liver and muscle tissue concentrations of thiamine (vitamin B"1) were lowest in impaired Lake Griffin alligators when compared to unimpaired alligators or to alligators from Lake Woodruff. The consumption of thiaminase-positive gizzard shad (Dorosoma cepedianum) is thought to have been the cause of the low tissue thiamine and resulting mortalities. ?? Wildlife Disease Association 2008.

  20. 75 FR 48359 - Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Office of the Secretary Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting... the John H. Chafee Blackstone River Valley National Heritage Corridor Commission will be held on... Valley National Heritage Corridor Commission, One Depot Square, Woonsocket, RI 02895, Tel.: (401)...

  1. 75 FR 20979 - Six Rivers National Forest, Mad River Ranger District, Ruth, CA, Beaverslide Timber Sale and Fuel...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Six Rivers National Forest, Mad River Ranger District, Ruth, CA, Beaverslide Timber Sale... supplemental environmental impact statement. SUMMARY: The Forest Service is proposing the Beaverslide Timber Sale and Fuel Treatment Project to provide timber products to local economies and to reduce...

  2. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis).


    Nilsen, Frances M; Parrott, Benjamin B; Bowden, John A; Kassim, Brittany L; Somerville, Stephen E; Bryan, Teresa A; Bryan, Colleen E; Lange, Ted R; Delaney, J Patrick; Brunell, Arnold M; Long, Stephen E; Guillette, Louis J


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida's north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different "treatments" of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics.

  3. Periods of cardiovascular susceptibility to hypoxia in embryonic american alligators (Alligator mississippiensis).


    Tate, Kevin B; Rhen, Turk; Eme, John; Kohl, Zachary F; Crossley, Janna; Elsey, Ruth M; Crossley, Dane A


    During embryonic development, environmental perturbations can affect organisms' developing phenotype, a process known as developmental plasticity. Resulting phenotypic changes can occur during discrete, critical windows of development. Critical windows are periods when developing embryos are most susceptible to these perturbations. We have previously documented that hypoxia reduces embryo size and increases relative heart mass in American alligator, and this study identified critical windows when hypoxia altered morphological, cardiovascular function and cardiac gene expression of alligator embryos. We hypothesized that incubation in hypoxia (10% O2) would increase relative cardiac size due to cardiac enlargement rather than suppression of somatic growth. We exposed alligator embryos to hypoxia during discrete incubation periods to target windows where the embryonic phenotype is altered. Hypoxia affected heart growth between 20 and 40% of embryonic incubation, whereas somatic growth was affected between 70 and 90% of incubation. Arterial pressure was depressed by hypoxic exposure during 50-70% of incubation, whereas heart rate was depressed in embryos exposed to hypoxia during a period spanning 70-90% of incubation. Expression of Vegf and PdgfB was increased in certain hypoxia-exposed embryo treatment groups, and hypoxia toward the end of incubation altered β-adrenergic tone for arterial pressure and heart rate. It is well known that hypoxia exposure can alter embryonic development, and in the present study, we have identified brief, discrete windows that alter the morphology, cardiovascular physiology, and gene expression in embryonic American alligator. PMID:27101296

  4. Persistent halogenated compounds in captive Chinese alligators (Alligator sinensis) from China.


    Wu, Ting; Hong, Bing; Wu, Xiaobing; Wu, Jiangping; Wang, Xinming; Yi, Zhigang; Zhao, Juan; Zhan, Miao; Mai, Bixian


    While a number of studies have reported residual levels of persistent halogenated compounds (PHCs) in crocodilia, there is still a dearth of information on the Chinese alligator, a critically endangered crocodilian species. In the present study, several PHCs, including polybrominated diphenyl ethers (PBDEs), polychlorinated biphenyls (PCBs), and dichlorodiphenyltrichloroethane and its metabolites (DDTs), were detected in the adult tissues, neonates, and eggs of captive Chinese alligators from China. The concentrations of ΣPBDEs, ΣPCBs, and ΣDDTs in Chinese alligators ranged from 0.11 to 16.1, 1.12 to 22.2, and 6.03 to 1020ngg(-1) wet weight, respectively, with higher levels of ΣPCBs and ΣDDTs in the neonates and eggs than in muscle tissues. The ΣDDT residues in the studied Chinese alligators were at the high end of reported ranges from crocodilia around the world, and some results exceeded levels known to cause a female-biased sex ratio in crocodilians.

  5. Periods of cardiovascular susceptibility to hypoxia in embryonic american alligators (Alligator mississippiensis).


    Tate, Kevin B; Rhen, Turk; Eme, John; Kohl, Zachary F; Crossley, Janna; Elsey, Ruth M; Crossley, Dane A


    During embryonic development, environmental perturbations can affect organisms' developing phenotype, a process known as developmental plasticity. Resulting phenotypic changes can occur during discrete, critical windows of development. Critical windows are periods when developing embryos are most susceptible to these perturbations. We have previously documented that hypoxia reduces embryo size and increases relative heart mass in American alligator, and this study identified critical windows when hypoxia altered morphological, cardiovascular function and cardiac gene expression of alligator embryos. We hypothesized that incubation in hypoxia (10% O2) would increase relative cardiac size due to cardiac enlargement rather than suppression of somatic growth. We exposed alligator embryos to hypoxia during discrete incubation periods to target windows where the embryonic phenotype is altered. Hypoxia affected heart growth between 20 and 40% of embryonic incubation, whereas somatic growth was affected between 70 and 90% of incubation. Arterial pressure was depressed by hypoxic exposure during 50-70% of incubation, whereas heart rate was depressed in embryos exposed to hypoxia during a period spanning 70-90% of incubation. Expression of Vegf and PdgfB was increased in certain hypoxia-exposed embryo treatment groups, and hypoxia toward the end of incubation altered β-adrenergic tone for arterial pressure and heart rate. It is well known that hypoxia exposure can alter embryonic development, and in the present study, we have identified brief, discrete windows that alter the morphology, cardiovascular physiology, and gene expression in embryonic American alligator.

  6. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis).


    Nilsen, Frances M; Parrott, Benjamin B; Bowden, John A; Kassim, Brittany L; Somerville, Stephen E; Bryan, Teresa A; Bryan, Colleen E; Lange, Ted R; Delaney, J Patrick; Brunell, Arnold M; Long, Stephen E; Guillette, Louis J


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida's north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different "treatments" of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics. PMID:26748003

  7. Molecular and functional characterization of BAFF from the Yangtze alligator (Alligator sinensis, Alligatoridae).


    Zhang, Jia-Xin; Song, Ren; Sang, Ming; Sun, Si-Qing; Ma, Lei; Zhang, Jie; Zhang, Shuang-Quan


    B-cell activating factor (BAFF) from the TNF family is critical for B-cell survival and maturation. In this study, we identified a Yangtze alligator (Alligator sinensis, Alligatoridae) BAFF cDNA, designated as asBAFF, using reverse transcription polymerase chain reaction (RT-PCR) and rapid amplification of cDNA ends (RACE). The open reading frame of this cDNA encodes a 287-amino acid protein containing a predicted transmembrane domain and a furin protease cleavage site, similar to mammalian and avian BAFF. The amino acid identity between biologically soluble asBAFF (assBAFF) and csBAFF, hsBAFF, and msBAFF is 94, 76, and 71%, respectively. Real-time quantitative PCR analysis showed that the asBAFF gene is strongly expressed in the spleen. Since BAFF is always expressed as inclusion bodies in bacteria, it is difficult to purify. To enhance the soluble expression of assBAFF in Escherichia coli, we fused the extracellular region of the asBAFF gene to a small ubiquitin-related modifier gene (SUMO). Purified assBAFF was able to promote the survival of splenic lymphocytes and co-stimulate the proliferation of mouse B cells with anti-mouse IgM. These findings suggest that asBAFF plays an important role in the survival and proliferation of Yangtze alligator B cells, and because it is evolutionarily highly conserved, functional cross-reactivity exists between mammalian and Yangtze alligator BAFF. PMID:26116474

  8. Polychlorinated biphenyls in eggs and chlorioallantoic membranes of American alligators (Alligator mississippiensis) from coastal South Carolina

    SciTech Connect

    Cobb, G.P.; Wood, P.D.; O`Quinn, M.


    Assessing chemical exposure in threatened or endangered wildlife species presents unique analytical problems. Chorioallantoic membranes (CAMs) have been proposed as surrogate tissues for evaluation of polychlorinated biphenyl (PCB) exposure in oviparous species. Research was undertaken to determine the extent of PCB accumulation in alligators (Alligator mississippiensis) at sites along the coast of South Carolina and to evaluate the utility of CAMs as surrogate tissues for determining PCB concentrations in whole alligator eggs. Polychlorinated biphenyls were found in eggs and CAMs of alligators from both sites examined. Concentrations of PCBs were higher in CAMs (p = 0.02) and eggs (p = 0.001) from sites known to contain chlorinated hydrocarbons than from more pristine sites. Total PCBs partitioned predictably (r{sup 2} > 0.59; p < 0.02) between egg and CAM tissues indicating the utility of CAMs to serve as surrogate tissues when comparing total PCB concentrations in whole eggs. Tetrachloro through octachloro biphenyl homologues and total PCBs in CAMs from reference areas were correlated with concentrations of these homologues in eggs. At contaminated sites, total PCB concentrations in CAMs were correlated with total PCB concentrations in eggs.

  9. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis)

    PubMed Central

    Nilsen, Frances M.; Parrott, Benjamin B.; Bowden, John A.; Kassim, Brittany L.; Somerville, Stephen E.; Bryan, Teresa A.; Bryan, Colleen E.; Lange, Ted R.; Delaney, J. Patrick; Brunell, Arnold M.; Long, Stephen E.; Guillette, Louis J.


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida’s north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different “treatments” of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics. PMID:26748003

  10. Characterization of microsatellite DNA markers for the alligator snapping turtle, Macrochelys temminckii: Primer note

    USGS Publications Warehouse

    Hackler, J.C.; Van Den Bussche, Ronald A.; Leslie, David M.


    Two trinucleotide and seven tetranucleotide microsatellite loci were isolated from an alligator snapping turtle Macrochelys temminckii. To assess the degree of variability in these nine microsatellite loci, we genotyped 174 individuals collected from eight river drainage basins in the southeastern USA. These markers revealed a moderate degree of allelic diversity (six to 16 alleles per locus) and observed heterozygosity (0.166-0.686). These polymorphic microsatellite loci provide powerful tools for population genetic studies for a species that is afforded some level of conservation protection in every state in which it occurs. ?? 2006 The Authors.

  11. Fluctuating water depths affect American alligator (Alligator mississippiensis) body condition in the Everglades, Florida, USA

    USGS Publications Warehouse

    Brandt, Laura A.; Beauchamp, Jeffrey S.; Jeffery, Brian M.; Cherkiss, Michael S.; Mazzotti, Frank J.


    Successful restoration of wetland ecosystems requires knowledge of wetland hydrologic patterns and an understanding of how those patterns affect wetland plant and animal populations.Within the Everglades, Florida, USA restoration, an applied science strategy including conceptual ecological models linking drivers to indicators is being used to organize current scientific understanding to support restoration efforts. A key driver of the ecosystem affecting the distribution and abundance of organisms is the timing, distribution, and volume of water flows that result in water depth patterns across the landscape. American alligators (Alligator mississippiensis) are one of the ecological indicators being used to assess Everglades restoration because they are a keystone species and integrate biological impacts of hydrological operations through all life stages. Alligator body condition (the relative fatness of an animal) is one of the metrics being used and targets have been set to allow us to track progress. We examined trends in alligator body condition using Fulton’s K over a 15 year period (2000–2014) at seven different wetland areas within the Everglades ecosystem, assessed patterns and trends relative to restoration targets, and related those trends to hydrologic variables. We developed a series of 17 a priori hypotheses that we tested with an information theoretic approach to identify which hydrologic factors affect alligator body condition. Alligator body condition was highest throughout the Everglades during the early 2000s and is approximately 5–10% lower now (2014). Values have varied by year, area, and hydrology. Body condition was positively correlated with range in water depth and fall water depth. Our top model was the “Current” model and included variables that describe current year hydrology (spring depth, fall depth, hydroperiod, range, interaction of range and fall depth, interaction of range and hydroperiod). Across all models, interaction

  12. 78 FR 20883 - Tonto National Forest; Arizona; Salt River Allotments Vegetative Management EIS

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Availability of the Draft EIS (78 FR 12310) for more detailed information related to the Salt River Allotments...; ] DEPARTMENT OF AGRICULTURE Forest Service Tonto National Forest; Arizona; Salt River Allotments Vegetative... that it is extending the public comment period for the Salt River Allotments Vegetative...

  13. Umbilical scarring in hatchling American alligators

    USGS Publications Warehouse

    Wiebe, J.J.; Sepulveda, M.S.; Buckland, J.E.; Anderson, S.R.; Gross, T.S.


    Umbilical scarring is the presence of excess scar tissue deposited between abdominal dermal layers at the site of yolk sac absorption in hatchling American alligators (Alligator mississippiensis). The presence of this dermal condition plays a key evaluatory role in the overall quality and subsequent value for various commercial leather products. Despite the prevalent nature of this condition, currently the industry has no standardized protocols for its quantification. The objectives of this study were to examine the relationship between hatchling weight and age and incidence of umbilical scarring and to develop a quantifiable and reproducible technique to measure this dermal condition in hatchling American alligators. Thirty eggs from each of nine clutches were incubated in two separate incubators at different facilities and hatchling umbilical scarring was measured at 2 and 10 days of age using digital calipers. Umbilical area was calculated by multiplying umbilical length times umbilical width. There was a significant effect of both age and clutch on umbilical area (overall decline of 64%) by 10 days post-hatch. However, only five of the nine clutches utilized expressed a noticeable decline in the size of this dermal condition (range 67-74%). We had hypothesized that larger hatchlings would have larger umbilical areas and a slower rate of improvement in this condition during the first few days post-hatch. The differences in umbilical area and percent decline with age across clutches, however, were not associated with differences in initial hatchling weights. Within clutches and time periods, hatchling weight had no significant effect on the size and/or rate of decline of this condition. ?? 2004 Published by Elsevier B.V.


    SciTech Connect

    Farfan, E.; Foley, T.


    The United Kingdom's National Nuclear Laboratory (NNL) has developed a remote, nonelectrical, radiation-mapping device known as RadBall (patent pending), which offers a means to locate and quantify radiation hazards and sources within contaminated areas of the nuclear industry. Positive results from initial deployment trials in nuclear waste reprocessing plants at Sellafield in the United Kingdom and the anticipated future potential use of RadBall throughout the U.S. Department of Energy Complex have led to the NNL partnering with the Savannah River National Laboratory (SRNL) to further test, underpin, and strengthen the technical performance of the technology. The study completed at SRNL addresses key aspects of the testing of the RadBall technology. The first set of tests was performed at Savannah River Nuclear Solutions Health Physics Instrument Calibration Laboratory (HPICL) using various gamma-ray sources and an x-ray machine with known radiological characteristics. The objective of these preliminary tests was to identify the optimal dose and collimator thickness. The second set of tests involved a highly contaminated hot cell. The objective of this testing was to characterize a hot cell with unknown radiation sources. The RadBall calibration experiments and hot cell deployment were successful in that for each trial radiation tracks were visible. The deployment of RadBall can be accomplished in different ways depending on the size and characteristics of the contaminated area (e.g., a hot cell that already has a crane/manipulator available or highly contaminated room that requires the use of a remote control device with sensor and video equipment to position RadBall). This report also presents SRNL-designed RadBall accessories for future RadBall deployment (a harness, PODS, and robot).

  15. 75 FR 64741 - Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Office of the Secretary Blackstone River Valley National Heritage Corridor Commission: Notice of Meeting... the John H. Chafee Blackstone River Valley National Heritage Corridor Commission will be held on... Heritage Corridor Commission, One Depot Square, Woonsocket, RI 02895, Tel.: (401) 762-0250....

  16. 75 FR 70126 - Safety Zone; Fireworks Displays, Potomac River, National Harbor, MD

    Federal Register 2010, 2011, 2012, 2013, 2014


    ..., Potomac River, National Harbor, MD'' in the Federal Register (75 FR 169). We received one comment on the... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Fireworks Displays, Potomac River, National... the safety of life on navigable waters during fireworks displays launched from a discharge...

  17. 46 CFR 11.459 - Requirements for national endorsement as master or mate on rivers.

    Code of Federal Regulations, 2014 CFR


    ... 46 Shipping 1 2014-10-01 2014-10-01 false Requirements for national endorsement as master or mate... Deck Officer Endorsements § 11.459 Requirements for national endorsement as master or mate on rivers.... (b) An applicant for an endorsement as master or mate of river self-propelled vessels, with...

  18. 77 FR 62257 - Draft Environmental Impact Statement for the Herring River Restoration Project, Cape Cod National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... National Park Service Draft Environmental Impact Statement for the Herring River Restoration Project, Cape... Impact Statement (DEIS) for the Herring River Restoration Project in Cape Cod National Seashore... Restoration Project will be available for public review online at the NPS's PEPC Web site (...

  19. National Rivers and Streams Assessment 2008-2009: A Collaborative Survey

    EPA Science Inventory

    The National Rivers and Streams Assessment 2008–2009: A Collaborative Survey (NRSA) presents the results of an unprecedented assessment of the nation’s rivers and streams. This report is part of the National Aquatic Resource Surveys, a series of statistically based surveys design...

  20. 75 FR 55539 - Crooked Creek Reservoir Repair; White River National Forest, Eagle County, CO

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...; ] DEPARTMENT OF AGRICULTURE Forest Service Crooked Creek Reservoir Repair; White River National Forest, Eagle... Repair project on the Sopris Ranger District of the White River National Forest was published in the Federal Register (86 FR 24215). The Forest Service has decided to cancel the preparation of this EIS....

  1. 75 FR 1806 - Draft General Management Plan and Environmental Impact Statement, New River Gorge National River, WV

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... with National Park Service laws, regulations, and policies, and the purpose of the National River, the...; floodplains; water quality; vegetation; aquatic wildlife; terrestrial wildlife; rare, threatened, and... signed into law in 1978, including several boundary changes. The most recent legislation mandates...


    EPA Science Inventory

    Many xenobiotic compounds introduced into the environment by human activity adversely affect wildlife. A number of these contaminants have been hypothesized to induce non lethal, multigenerational effects by acting as endocrine disrupting agents. One case is that of the alligator...


    SciTech Connect

    Danko, E


    The Savannah River National Laboratory (SRNL) is a U.S. Department of Energy research and development laboratory located at the Savannah River Site (SRS) near Aiken, South Carolina. SRNL has over 50 years of experience in developing and applying hydrogen technology, both through its national defense activities as well as through its recent activities with the DOE Hydrogen Programs. The hydrogen technical staff at SRNL comprises over 90 scientists, engineers and technologists, and it is believed to be the largest such staff in the U.S. SRNL has ongoing R&D initiatives in a variety of hydrogen storage areas, including metal hydrides, complex hydrides, chemical hydrides and carbon nanotubes. SRNL has over 25 years of experience in metal hydrides and solid-state hydrogen storage research, development and demonstration. As part of its defense mission at SRS, SRNL developed, designed, demonstrated and provides ongoing technical support for the largest hydrogen processing facility in the world based on the integrated use of metal hydrides for hydrogen storage, separation, and compression. The SRNL has been active in teaming with academic and industrial partners to advance hydrogen technology. A primary focus of SRNL's R&D has been hydrogen storage using metal and complex hydrides. SRNL and its Hydrogen Technology Research Laboratory have been very successful in leveraging their defense infrastructure, capabilities and investments to help solve this country's energy problems. SRNL has participated in projects to convert public transit and utility vehicles for operation using hydrogen fuel. Two major projects include the H2Fuel Bus and an Industrial Fuel Cell Vehicle (IFCV) also known as the GATOR{trademark}. Both of these projects were funded by DOE and cost shared by industry. These are discussed further in Section 3.0, Demonstration Projects. In addition to metal hydrides technology, the SRNL Hydrogen group has done extensive R&D in other hydrogen technologies, including

  4. Persistent Organochlorine Pesticides and their Metabolites in Alligator Livers from Lakes Apopka and Woodruff, Florida, USA

    EPA Science Inventory

    Reproductive disorders in American alligators (Alligator mississippiensis) inhabiting Lake Apopka, Florida, have been observed for several years. Such disorders are hypothesized to be caused by endocrine disrupting contaminants occurring in the Lake due to pesticide spills and ...

  5. Unidirectional airflow in the lungs of alligators.


    Farmer, C G; Sanders, Kent


    The lungs of birds move air in only one direction during both inspiration and expiration through most of the tubular gas-exchanging bronchi (parabronchi), whereas in the lungs of mammals and presumably other vertebrates, air moves tidally into and out of terminal gas-exchange structures, which are cul-de-sacs. Unidirectional flow purportedly depends on bellowslike ventilation by air sacs and may have evolved to meet the high aerobic demands of sustained flight. Here, we show that air flows unidirectionally through parabronchi in the lungs of the American alligator, an amphibious ectotherm without air sacs, which suggests that this pattern dates back to the basal archosaurs of the Triassic and may have been present in their nondinosaur descendants (phytosaurs, aetosaurs, rauisuchians, crocodylomorphs, and pterosaurs) as well as in dinosaurs. PMID:20075253

  6. Ontogenetic development of otoliths in Alligator Gar

    USGS Publications Warehouse

    Long, James M.; Snow, Richard A.


    The Alligator Gar Atractosteus spatula is a species of conservation concern throughout its range, and better definition of otoliths during early development would aid understanding its life history and ecology. We conducted X-ray computed tomography scans, scanning electron microscopy, and light microscopy to examine the three pairs of otoliths and how they developed over time in relation to fish size and age. The sagittae are the largest, possessing distinct dorsal and ventral lobes covered with small otoconia concentrated in the sulcul region. The sagittae exhibited allometric growth, increasing more rapidly in the ventral lobe than in the dorsal. The asterisci were smaller and also exhibited small otoconia on their surface, but much less than the sagittae. The lapilli were oriented laterally, in contrast to the sagittae and asterisci, which were oriented vertically, with a hump on the dorsum and very large otoconia on the lateral surface that appeared to fuse into the main otolith as the fish grew. Based on size measurements and ring counts in all three pairs of otoliths from 101 known-age Alligator Gar sampled weekly through 91 d after hatch, we developed regression models to examine otolith growth and predict age. All relationships were significant and highly explanatory, but the strongest relationships were between otolith and fish size (for measurements from sagittae) and for age predictions from the lapillus. Age prediction models all resulted in a slope near unity, indicating that ring deposition occurred approximately daily. The first ring in sagittae and lapilli corresponded to swim-up, whereas the first ring formed in asterisci approximately 8 d after swim-up. These results fill a gap in knowledge and can aid understanding of evolutionary processes as well as provide useful information for management and conservation.

  7. 77 FR 39675 - Wallowa-Whitman National Forest, Baker County, OR; North Fork Burnt River Mining

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...; ] DEPARTMENT OF AGRICULTURE Forest Service Wallowa-Whitman National Forest, Baker County, OR; North Fork Burnt... changed to the Whitman District Ranger. This 2012 North Fork Burnt River Mining Record of Decision will replace and supercede the 2004 North Fork Burnt River Mining Record of Decision only where necessary...


    EPA Science Inventory

    The U.S. EPA is engaging states, tribes and other parties in designing a national survey to assess the condition of non-wadeable rivers and streams. The rivers survey is one of a series of surveys being implemented as a partnership among states, tribes and U.S. EPA, with the coll...

  9. Fire history of southeastern Glacier National Park: Missouri River Drainage

    USGS Publications Warehouse

    Barrett, Stephen W.


    In 1982, Glacier National Park (GNP) initiated long-term studies to document the fire history of all forested lands in the 410,000 ha. park. To date, studies have been conducted for GNP west of the Continental Divide (Barrett et al. 1991), roughly half of the total park area. These and other fire history studies in the Northern Rockies (Arno 1976, Sneck 1977, Arno 1980, Romme 1982, Romme and Despain 1989, Barrett and Arno 1991, Barrett 1993a, Barrett 1993b) have shown that fire history data can be an integral element of fire management planning, particularly wen natiral fire plans are being developed for parks and wilderness. The value of site specific fire history data is apparent when considering study results for lodgepole pin (Pinus contorta var. latifolia) forests. Lodgepole pine is a major subalpine type in the Northern Rockies and such stands experiences a wide range of presettlement fire patterns. On relatively warm-dry sites at lower elevations, such as in GNP's North Fork drainage (Barrett et al. 1991), short to moderately long interval (25-150 yr) fires occurred in a mixed severity pattern ranging from non-lethal underburns to total stand replacement (Arno 1976, Sneck 1977, Barrett and Arno 1991). Markedly different fire history occurred at high elevation lodgepole pine stands on highly unproductive sites, such as on Yellowstone National Park's (YNP) subalpine plateau. Romme (1982) found that, on some sites, stand replacing fires recurred after very long intervals (300-400 yr), and that non-lethal surface fires were rare. For somewhat more productive sites in the Absaroka Mountains in YNP, Barrett (1993a) estimated a 200 year mean replacement interval, in a pattern similar to that found in steep mountain terrain elsewhere, such as in the Middle Fork Flathead River drainage (Barrett et al. 1991, Sneck 1977). Aside from post-1900 written records (ayres 1900; fire atlas data on file, GNP Archives Div. and GNP Resources Mgt. Div.), little fire history

  10. Computing flow in mapped rivers of the United States using national datasets

    NASA Astrophysics Data System (ADS)

    David, C. H.; Yang, Z.


    The modeling of the horizontal movement of water from land to coasts has benefited from extensive research within the past two decades. Most of these studies use a coarse gridded representation of river networks. The recently-enhanced National Hydrography Dataset (NHDPlus) provides a "blue line" description of the river networks of the U.S. consisting of approximately 3 million interconnected river reaches which can be used as computing elements of a river model. Such computations benefit from best-available catchment delineation which accurately represents basin areas. More importantly, they may have higher societal meaning than flow estimates on traditional coarse grid cells. We estimate the inflow of surface and subsurface water into NDHPlus river reaches from runoff provided by a locally-calibrated land surface model or by results from the second phase of the North American Land Data Assimilation System (NLDAS2). The Routing Application for Parallel computatIon of Discharge (RAPID) is used to perform stream flow computations. River model parameters are calibrated and the quality of computations estimated using hundreds of gauges from the U.S. Geological Survey National Water Information System (NWIS). We present results from five years of research focusing on U.S. river basins ranging in area from 20,000 to 1,000,000 square kilometers. Our work investigates methods for coupling models of the atmosphere, land surface and subsurface to river models. We also study the influence of using high-resolution topographic data in river model parameters on river flow computations. Finally, we address issues related to parallel computing of flow in large river networks and present a novel numerical scheme allowing for gains in parallel speedup that exceeds previous theoretical expectations. Snapshot from an animation of river flow for the Upper Mississippi River Basin. The full animation is available at:

  11. Long-term change along the Colorado River in Grand Canyon National Park (1889-2011)

    USGS Publications Warehouse

    Webb, R.H.; Belnap, J.; Scott, M. L.; Friedman, J. M.; Esque, T. C.


    The Colorado River and its riverine resources have undergone profound changes since completion of Glen Canyon Dam in 1963, as every river runner with any history in Grand Canyon will attest. Long-term monitoring data are difficult to obtain for high-value resource areas (Webb et al. 2009), particularly in remote parts of national parks, yet these data are important to determining appropriate actions for restoration of resources and (or) potential modifications of flow releases on regulated rivers. The river corridor through the bottom of Grand Canyon creates a challenging environment for change-detection monitoring techniques (Belnap et al. 2008).

  12. Morphological characteristics regulating phallic glans engorgement in the American alligator.


    Moore, Brandon C; Spears, David; Mascari, Taylor; Kelly, Diane A


    The distal part of the crocodilian phallus consists of a bulbous glans containing well-developed vascular tissues that can inflate before or during sexual activity, enlarging and elaborating the glans into a complex, though still functionally undefined, copulatory structure. An enlarged glans putatively interacts with the female cloaca and may change the shape of her reproductive tract to facilitate insemination and increase the probability of fertilization. Here, we investigated the cellular-level properties of the glans and other inflatable phallic tissues associated with the sperm-conducting sulcus spermaticus in the American alligator (Alligator mississippiensis). Using histochemical staining, we visualized and defined collagen and elastin fiber densities and orientations in these tissues. Extracellular matrix architectures provided insights about phallic glans material properties and how they may affect tissue strength and flexibility during inflation and in response to copulatory forces. We also investigated the potential sources of fluids that induce inflation in alligator phalli. Combining serial sectioning and three-dimensional reconstruction, we identified a pair of supracrucal plexus vascular bodies at the proximal end of the alligator phallus that extend distally adjacent to ventro-medial sulcus tissues. Together, our gross and histological examination of the American alligator phallic glans suggests that its tissues are arranged in a manner that would allow vascular inflation to expand the glans to a specific and repeatable shape, and potentially release secretory products into the female reproductive tract. Both elements could play roles in postcopulatory sexual selection, by mechanically and/or chemically affecting female reproductive physiology.

  13. Plasma steroid concentrations and male phallus size in juvenile alligators from seven Florida lakes

    USGS Publications Warehouse

    Guillette, L.J.; Woodward, A.R.; Crain, D.A.; Pickford, D.B.; Rooney, A.A.; Percival, H.F.


    Neonatal and juvenile alligators from contaminated Lake Apopka in central Florida exhibit abnormal plasma sex steroid concentrations as well as morphological abnormalities of the gonad and phallus. This study addresses whether similar abnormalities occur in juvenile alligators inhabiting six other lakes in Florida. For analysis, animals were partitioned into two subsets, animals 40-79 cm total length (1-3 years old) and juveniles 80-130 cm total length (3-7 years old). Plasma testosterone (T) concentrations were lower in small males from lakes Apopka, Griffin, and Jessup than from Lake Woodruff National Wildlife Refuge (NWR). Similar differences were observed in the larger juveniles, with males from lakes Jessup, Apopka, and Okeechobee having lower plasma T concentrations than Lake Woodruff males. Plasma estradiol-17?? (E2) concentrations were significantly elevated in larger juvenile males from Lake Apopka compared to Lake Woodruff NWR. When compared to small juvenile females from Lake Woodruff NWR, females from lakes Griffin, Apopka, Orange, and Okeechobee had elevated plasma E2 concentrations. Phallus size was significantly smaller in males from lakes Griffin and Apopka when compared to males from Lake Woodruff NWR. An association existed between body size and phallus size on all lakes except Lake Apopka and between phallus size and plasma T concentration on all lakes except lakes Apopka and Orange. Multiple regression analysis, with body size and plasma T concentration as independent covariables, explained the majority of the variation in phallus size on all lakes. These data suggest that the differences in sex steroids and phallus size observed in alligators from Lake Apopka are not limited to that lake, nor to one with a history of a major pesticide spill. Further work examining the relationship of sex steroids and phallus size with specific biotic and abiotic factors, such as antiandrogenic or estrogenic contaminants, is needed.

  14. Estimating sighting proportions of American alligator nests during helicopter survey

    USGS Publications Warehouse

    Rice, Kenneth G.; Percival, H. Franklin; Woodward, Allan R.


    Proportions of American alligator (Alligator mississippiensis) nests sighted during aerial survey in Florida were estimated based upon multiple surveys by different observers. We compared sighting proportions across habitats, nesting seasons, and observer experience levels. The mean sighting proportion across all habitats and years was 0.736 (SE=0.024). Survey counts corrected by the mean sighting proportion reliably predicted total nest counts (7?2=0.933). Sighting proportions did not differ by habitat type (P=0.668) or year P=0.328). Experienced observers detected a greater proportion of nests (P<0.0001) than did either less experienced or inexperienced observers. Reliable estimates of nest abundance can be derived from aerial counts of alligator nests when corrected by the appropriate sighting proportion.

  15. The alligator gut microbiome and implications for archosaur symbioses

    PubMed Central

    Keenan, Sarah W.; Engel, Annette Summers; Elsey, Ruth M.


    Among vertebrate gastrointestinal microbiome studies, complete representation of taxa is limited, particularly among reptiles. Here, we provide evidence for previously unrecognized host-microbiome associations along the gastrointestinal tract from the American alligator, a crown archosaur with shared ancestry to extinct taxa, including dinosaurs. Microbiome compositional variations reveal that the digestive system consists of multiple, longitudinally heterogeneous microbiomes that strongly correlate to specific gastrointestinal tract organs, regardless of rearing histories or feeding status. A core alligator gut microbiome comprised of Fusobacteria, but depleted in Bacteroidetes and Proteobacteria common to mammalians, is compositionally unique from other vertebrate gut microbiomes, including other reptiles, fish, and herbivorous and carnivorous mammals. As such, modern alligator gut microbiomes advance our understanding of archosaur gut microbiome evolution, particularly if conserved host ecology has retained archosaur-specific symbioses over geologic time. PMID:24096888

  16. The alligator gut microbiome and implications for archosaur symbioses.


    Keenan, Sarah W; Engel, Annette Summers; Elsey, Ruth M


    Among vertebrate gastrointestinal microbiome studies, complete representation of taxa is limited, particularly among reptiles. Here, we provide evidence for previously unrecognized host-microbiome associations along the gastrointestinal tract from the American alligator, a crown archosaur with shared ancestry to extinct taxa, including dinosaurs. Microbiome compositional variations reveal that the digestive system consists of multiple, longitudinally heterogeneous microbiomes that strongly correlate to specific gastrointestinal tract organs, regardless of rearing histories or feeding status. A core alligator gut microbiome comprised of Fusobacteria, but depleted in Bacteroidetes and Proteobacteria common to mammalians, is compositionally unique from other vertebrate gut microbiomes, including other reptiles, fish, and herbivorous and carnivorous mammals. As such, modern alligator gut microbiomes advance our understanding of archosaur gut microbiome evolution, particularly if conserved host ecology has retained archosaur-specific symbioses over geologic time.

  17. River and riparian restoration in the southwest: Results of the National River Restoration Science Synthesis project

    USGS Publications Warehouse

    Follstad, Shah J.J.; Dahm, Clifford N.; Gloss, S.P.; Bernhardt, E.S.


    Restoration activity has exponentially increased across the Southwest since 1990. Over 37,000 records were compiled into the National River Restoration Science Synthesis (NRRSS) database to summarize restoration trends and assess project effectiveness. We analyzed data from 576 restoration projects in the Southwest (NRRSS-SW). More than 50% of projects were less than or equal to 3 km in length. The most common restoration project intent categories were riparian management, water quality management, in-stream habitat improvement, and flow modification. Common project activities were well matched to goals. Conservative estimates of total restoration costs exceeded $500 million. Most restoration dollars have been allocated to flow modification and water quality management. Monitoring was linked to 28% of projects across the Southwest, as opposed to just 10% nationwide. Mean costs were statistically similar whether or not projects were monitored. Results from 48 telephone interviews provided validation of NRRSS-SW database analyses but showed that project costs are often underreported within existing datasets. The majority of interviewees considered their projects to be successful, most often based upon observed improvements to biota or positive public reaction rather than evaluation of field data. The efficacy of restoration is difficult to ascertain given the dearth of information contained within most datasets. There is a great need for regional entities that not only track information on project implementation but also maintain and analyze monitoring data associated with restoration. Agencies that fund or regulate restoration should reward projects that emphasize monitoring and evaluation as much as project implementation. ?? 2007 Society for Ecological Restoration International.

  18. An examination of the sensory structures in the oral cavity of the American alligator (Alligator mississippiensis).


    Rehorek, Susan J; Duffy, Michael; Zacherl, Janelle R; Anand, Kusuma; Elsey, Ruth M; Smith, Timothy S


    The location and distribution of mucosal sensory structures of the crocodilian oral cavity are poorly understood. Although there are several descriptions of these structures in adults, nothing is known about their development. The purpose of this study was to document location, morphology, and relative abundance of these mucosal sensory structures in both hatchling and subadult alligators. Numerous mucosal sensory structures and pale staining dome-shaped papillae were observed only in the upper palate and tongue. In hatchlings, these papillae, which house either mechanoreceptive or chemosensory (taste buds) structures, were larger and more prevalent on the tongue than the upper palate. In the subadult, however, these papillae housed primarily mechanoreceptive structures and possibly degenerate taste buds. Although the presence of the mechanoreceptive structures in the palates of the suabadult alligator are to be expected, the loss of most taste buds is hitherto undocumented. Thus, there is morphological support for an ontogenetic shift in the role of the sensory palate, from a prey detection gustatory sensory system in hatchlings to a prey-manipulative mechanoreceptive system in subadults.

  19. Potential molecular wires and molecular alligator clips

    NASA Astrophysics Data System (ADS)

    Schumm, Jeffry S.; Pearson, Darren L.; Jones, LeRoy, II; Hara, Ryuichiro; Tour, James M.


    The synthesis of oligo(2-ethylphenylene-ethynylene)s, oligo(2-(0957-4484/7/4/023/img1-ethylheptyl)phenylene-ethynylene)s, and oligo(3-ethylthiophene-ethynylene)s is described via an iterative divergent convergent approach. Synthesized were the monomer, dimer, tetramer, octamer and 16-mer of the oligo(3-ethylthiophene-ethynylene)s and oligo(2-0957-4484/7/4/023/img1-ethylheptyl)phenylene-ethynylene)s. The 16-mers are 100 Å and 128 Å long, respectively. At each stage in the iteration, the length of the framework doubles. Only three sets of reaction conditions are needed for the entire iterative synthetic sequence; an iodination, a protodesilylation, and a Pd/Cu-catalyzed cross coupling. The oligomers were characterized spectroscopically and by mass spectrometry. The optical properties are presented which show the stage of optical absorbance saturation. The size exclusion chromatography values for the number average weights, relative to polystyrene, illustrate the tremendous differences in the hydrodynamic volume of these rigid rod oligomers versus the random coils of polystyrene. These differences become quite apparent at the octamer stage. The preparation of thiol-protected end groups is described. These may serve as molecular alligator clips for adhesion to gold surfaces. These oligomers may act as molecular wires in molecular electronic devices and they also serve as useful models for understanding related bulk polymers.

  20. A moss-covered alligator rests in the sun at KSC. copy form; photos beginning with 99PD are only ava

    NASA Technical Reports Server (NTRS)


    On top of what may be a nest on the edge of an algae-coated canal near Schwartz Rd. at Kennedy Space Center, a moss-covered alligator rests while keeping a wary eye open for trespassers. Nearly 5,000 alligators can be found in canals, ponds, and waterways throughout the Center and the Merritt Island National Wildlife Refuge, which shares a boundary with the Center. American alligators feed and rest in the water, and usually lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Wildlife Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  1. Atmospheric oxygen level affects growth trajectory, cardiopulmonary allometry and metabolic rate in the American alligator (Alligator mississippiensis)

    PubMed Central

    Owerkowicz, Tomasz; Elsey, Ruth M.; Hicks, James W.


    Summary Recent palaeoatmospheric models suggest large-scale fluctuations in ambient oxygen level over the past 550 million years. To better understand how global hypoxia and hyperoxia might have affected the growth and physiology of contemporary vertebrates, we incubated eggs and raised hatchlings of the American alligator. Crocodilians are one of few vertebrate taxa that survived these global changes with distinctly conservative morphology. We maintained animals at 30°C under chronic hypoxia (12% O2), normoxia (21% O2) or hyperoxia (30% O2). At hatching, hypoxic animals were significantly smaller than their normoxic and hyperoxic siblings. Over the course of 3 months, post-hatching growth was fastest under hyperoxia and slowest under hypoxia. Hypoxia, but not hyperoxia, caused distinct scaling of major visceral organs–reduction of liver mass, enlargement of the heart and accelerated growth of lungs. When absorptive and post-absorptive metabolic rates were measured in juvenile alligators, the increase in oxygen consumption rate due to digestion/absorption of food was greatest in hyperoxic alligators and smallest in hypoxic ones. Hyperoxic alligators exhibited the lowest breathing rate and highest oxygen consumption per breath. We suggest that, despite compensatory cardiopulmonary remodelling, growth of hypoxic alligators is constrained by low atmospheric oxygen supply, which may limit their food utilisation capacity. Conversely, the combination of elevated metabolism and low cost of breathing in hyperoxic alligators allows for a greater proportion of metabolised energy to be available for growth. This suggests that growth and metabolic patterns of extinct vertebrates would have been significantly affected by changes in the atmospheric oxygen level. PMID:19376944

  2. Braided River Response to Eight Decades of Human Disturbance, Toklat River, Denali National Park and Preserve, AK

    NASA Astrophysics Data System (ADS)

    Richards, M. E.; Rathburn, S. L.; Booth, D. B.; Capps, D.; Wohl, E.


    The spatially complex and stochastic nature of braided rivers complicates quantifying natural rates of sediment transport and limits our understanding of braided river response to human disturbance. The Toklat River in Denali National Park and Preserve, a 135-km-long braided tributary of the Kantishna River draining the north-facing slopes of the Alaska Range, exemplifies these challenges. Eight decades of localized channel confinement due to installation of a causeway in the 1930's and over three decades of gravel extraction since the 1980's have occurred on the Toklat River where it crosses the Denali Park Road. Research associated with these disturbances has developed a unique multi-scalar and temporally diverse dataset that records the responses of the river over a 10-km reach. We have evaluated trends in short-term sediment storage through lidar differencing and analyzed long-term planform change through morphologic metrics such as braiding index, active braidplain width, and percentage of occupied floodplain derived from aerial photographs. Two reference reaches along comparable adjacent braided rivers, with varying levels of confinement and no gravel extraction, illuminate the relative influence of confinement and gravel extraction on sediment flux and planform changes. Preliminary comparisons of lidar-derived DEMs show volumetric decrease in sediment within the active braidplain within the gravel extraction area and downstream of the causeway, suggesting enhanced degradation due to both extraction and confinement. Areas of braidplain degradation also show increasing variance in surface elevations and decreasing braidplain width and braiding index with time. These data support the usage of morphologic metrics to identify long-term degradation trends in large, braided systems where detailed elevation data are unavailable. Despite the pronounced local expression of sediment discontinuity, watershed topography and zones of long-term sediment storage in this


    SciTech Connect

    Farfan, E.


    The UK National Nuclear Laboratory (NNL) has developed a remote, non-electrical, radiation-mapping device known as RadBall (patent pending), which offers a means to locate and quantify radiation hazards and sources within contaminated areas of the nuclear industry. To date, the RadBall has been deployed in a number of technology trials in nuclear waste reprocessing plants at Sellafield in the UK. The trials have demonstrated the successful ability of the RadBall technology to be deployed and retrieved from active areas. The positive results from these initial deployment trials and the anticipated future potential of RadBall have led to the NNL partnering with the Savannah River National Laboratory (SRNL) to further underpin and strengthen the technical performance of the technology. RadBall consists of a colander-like outer shell that houses a radiation-sensitive polymer sphere. It has no power requirements and can be positioned in tight or hard-to reach places. The outer shell works to collimate radiation sources and those areas of the polymer sphere that are exposed react, becoming increasingly less transparent, in proportion to the absorbed dose. The polymer sphere is imaged in an optical-CT scanner which produces a high resolution 3D map of optical attenuation coefficients. Subsequent analysis of the optical attenuation maps provides information on the spatial distribution and strength of the sources in a given area forming a 3D characterization of the area of interest. This study completed at SRNL addresses key aspects of the testing of the RadBall technology. The first set of tests was performed at Savannah River Nuclear Solutions Health Physics Instrument Calibration Laboratory (HPICL) using various gamma-ray sources and an x-ray machine with known radiological characteristics. The objective of these preliminary tests was to identify the optimal dose and collimator thickness. The second set of tests involved a highly contaminated hot cell. The objective of

  4. National Uranium Resource Evaluation: Iron River Quadrangle, Michigan and Wisconsin

    SciTech Connect

    Frishman, D


    No area within the Iron River 1/sup 0/ x 2/sup 0/ Quadrangle, Michigan and Wisconsin, appears to be favorable for the existence of a minimum of 100 tons of U/sub 3/O/sub 8/ at a grade of 0.01 percent or better.

  5. 77 FR 66865 - Record of Decision for the Oil and Gas Management Plan, Big South Fork National River and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... National Park Service Record of Decision for the Oil and Gas Management Plan, Big South Fork National River... (ROD) for the Oil and Gas Management Plan (Plan) for Big South Fork National River and Recreation Area... impacts from oil and gas development. The plan will guide oil and gas management in Big South...

  6. Estimating trends in alligator populations from nightlight survey data

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, F.J.; Dorazio, R.M.; Rice, K.G.; Cherkiss, M.; Jeffery, B.


    Nightlight surveys are commonly used to evaluate status and trends of crocodilian populations, but imperfect detection caused by survey- and location-specific factors makes it difficult to draw population inferences accurately from uncorrected data. We used a two-stage hierarchical model comprising population abundance and detection probability to examine recent abundance trends of American alligators (Alligator mississippiensis) in subareas of Everglades wetlands in Florida using nightlight survey data. During 2001-2008, there were declining trends in abundance of small and/or medium sized animals in a majority of subareas, whereas abundance of large sized animals had either demonstrated an increased or unclear trend. For small and large sized class animals, estimated detection probability declined as water depth increased. Detection probability of small animals was much lower than for larger size classes. The declining trend of smaller alligators may reflect a natural population response to the fluctuating environment of Everglades wetlands under modified hydrology. It may have negative implications for the future of alligator populations in this region, particularly if habitat conditions do not favor recruitment of offspring in the near term. Our study provides a foundation to improve inferences made from nightlight surveys of other crocodilian populations. ?? 2011 US Government.

  7. Estimating trends in alligator populations from nightlight survey data

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, Frank J.; Dorazio, Robert M.; Rice, Kenneth G.; Cherkiss, Michael; Jeffery, Brian


    Nightlight surveys are commonly used to evaluate status and trends of crocodilian populations, but imperfect detection caused by survey- and location-specific factors makes it difficult to draw population inferences accurately from uncorrected data. We used a two-stage hierarchical model comprising population abundance and detection probability to examine recent abundance trends of American alligators (Alligator mississippiensis) in subareas of Everglades wetlands in Florida using nightlight survey data. During 2001–2008, there were declining trends in abundance of small and/or medium sized animals in a majority of subareas, whereas abundance of large sized animals had either demonstrated an increased or unclear trend. For small and large sized class animals, estimated detection probability declined as water depth increased. Detection probability of small animals was much lower than for larger size classes. The declining trend of smaller alligators may reflect a natural population response to the fluctuating environment of Everglades wetlands under modified hydrology. It may have negative implications for the future of alligator populations in this region, particularly if habitat conditions do not favor recruitment of offspring in the near term. Our study provides a foundation to improve inferences made from nightlight surveys of other crocodilian populations.

  8. Alligators and crocodiles as indicators for restoration of Everglades ecosystems

    USGS Publications Warehouse

    Mazzotti, Frank J.; Best, G. Ronnie; Brandt, Laura A.; Cherkiss, Michael S.; Jeffery, Brian M.; Rice, Kenneth G.


    Alligators and crocodiles integrate biological impacts of hydrological operations, affecting them at all life stages through three key aspects of Everglades ecology: (1) food webs, (2) diversity and productivity, and (3) freshwater flow. Responses of crocodilians are directly related to suitability of environmental conditions and hydrologic change. Correlations between biological responses and environmental conditions contribute to an understanding of species' status and trends over time. Positive or negative trends of crocodilian populations relative to hydrologic changes permit assessment of positive or negative trends in restoration. The crocodilian indicator uses monitoring parameters (performance measures) that have been shown to be both effective and efficient in tracking trends. The alligator component uses relative density (reported as an encounter rate), body condition, and occupancy rates of alligator holes; the crocodile component uses juvenile growth and hatchling survival. We hypothesize that these parameters are correlated with hydrologic conditions including depth, duration, timing, spatial extent and water quality. Salinity is a critical parameter in estuarine habitats. Assessments of parameters defined for crocodilian performance measures support these hypotheses. Alligators and crocodiles are the charismatic megafauna of the Everglades. They are both keystone and flagship species to which the public can relate. In addition, the parameters used to track trends are easy to understand. They provide answers to the following questions: How has the number of alligators or crocodiles changed? Are the animals fatter or thinner than they should be? Are the animals in the places (in terms of habitat and geography) where they should be? As surely as there is no other Everglades, no other single species defines the Everglades as does the American alligator. The Everglades is the only place in the world where both alligators and crocodiles exist. Crocodilians

  9. Ultrastructure of spermiogenesis in the American alligator, Alligator mississippiensis (Reptilia, Crocodylia, Alligatoridae).


    Gribbins, Kevin M; Siegel, Dustin S; Anzalone, Marla L; Jackson, Daniel P; Venable, Katherine J; Rheubert, Justin L; Elsey, Ruth M


    Testicular samples were collected to describe the ultrastructure of spermiogenisis in Alligator mississipiensis (American Alligator). Spermiogenesis commences with an acrosome vesicle forming from Golgi transport vesicles. An acrosome granule forms during vesicle contact with the nucleus, and remains posterior until mid to late elongation when it diffuses uniformly throughout the acrosomal lumen. The nucleus has uniform diffuse chromatin with small indices of heterochromatin, and the condensation of DNA is granular. The subacrosome space develops early, enlarges during elongation, and accumulates a thick layer of dark staining granules. Once the acrosome has completed its development, the nucleus of the early elongating spermatid becomes associated with the cell membrane flattening the acrosome vesicle on the apical surface of the nucleus, which aids in the migration of the acrosomal shoulders laterally. One endonuclear canal is present where the perforatorium resides. A prominent longitudinal manchette is associated with the nuclei of late elongating spermatids, and less numerous circular microtubules are observed close to the acrosome complex. The microtubule doublets of the midpiece axoneme are surrounded by a layer of dense staining granular material. The mitochondria of the midpiece abut the proximal centriole resulting in a very short neck region, and possess tubular cristae internally and concentric layers of cristae superficially. A fibrous sheath surrounds only the axoneme of the principal piece. Characters not previously described during spermiogenesis in any other amniote are observed and include (1) an endoplasmic reticulum cap during early acrosome development, (2) a concentric ring of endoplasmic reticulum around the nucleus of early to middle elongating spermatids, (3) a band of endoplasmic reticulum around the acrosome complex of late developing elongate spermatids, and (4) midpiece mitochondria that have both tubular and concentric layers of

  10. Cross-Sectional Data for Selected Reaches of the Chattahoochee River within the Chattahoochee River National Recreation Area, Georgia, 2004

    USGS Publications Warehouse

    Dalton, Melinda S.


    This report presents hydrologic data for selected reaches of the Chattahoochee River within the Chattahoochee River National Recreation Area (CRNRA). Data about transect location, width, depth, and velocity of flow for selected reaches of the river are presented in tabular form. The tables contain measurements collected from shoal and run habitats identified as critical sites for the CRNRA. In shoal habitats, measurements were collected while wading using a digital flowmeter and laser range finder. In run habitats, measurements were collected using acoustic Doppler current profiling. Fifty-three transects were established in six reaches throughout the CRNRA; 24 in shoal habitat, 26 in run habitat, and 3 in pool habitat. Illustrations in this report contain information about study area location, hydrology, transect locations, and cross-sectional information. A study area location figure is followed by figures identifying locations of transects within each individual reach. Cross-sectional information is presented for each transect, by reach, in a series of graphs. The data presented herein can be used to complete preliminary habitat assessments for the Chattahoochee River within the CRNRA. These preliminary assessments can be used to identify reaches of concern for future impacts associated with continual development in the Metropolitan Atlanta area and potential water allocation agreements between Georgia, Florida, and Alabama.

  11. Population viability of Arctic grayling in the Gibbon River, Yellowstone National Park

    USGS Publications Warehouse

    Steed, Amber C.; Zale, Alexander V.; Koel, Todd M.; Kalinowski, Steven T.


    The fluvial Arctic grayling Thymallus arcticus is restricted to less than 5% of its native range in the contiguous United States and was relisted as a category 3 candidate species under the U.S. Endangered Species Act in 2010. Although fluvial Arctic grayling of the lower Gibbon River, Yellowstone National Park, Wyoming, were considered to have been extirpated by 1935, anglers and biologists have continued to report catching low numbers of Arctic grayling in the river. Our goal was to determine whether a viable population of fluvial Arctic grayling persisted in the Gibbon River or whether the fish caught in the river were downstream emigrants from lacustrine populations in headwater lakes. We addressed this goal by determining relative abundances, sources, and evidence for successful spawning of Arctic grayling in the Gibbon River. During 2005 and 2006, Arctic grayling comprised between 0% and 3% of the salmonid catch in riverwide electrofishing (mean < 1%; SE < 1%) and snorkeling (mean = 1%; SE = 1%) surveys; Arctic grayling constituted 0–14% of the salmonid catch obtained by targeted angling (3 of 22 fish; mean = 4%; SE = 5%). Low values of the genetic differentiation index (F ST = 0.0021 ± 0.002 [mean ± 95% confidence interval]) between headwater lake and river Arctic grayling indicated that fish from throughout the Gibbon River system probably belonged to the same population. Back-calculated lengths at most ages were similar among all fish, and successful spawning within the Gibbon River below the headwater lakes was not documented. Few Arctic grayling adults and no fry were detected in the Gibbon River, implying that a reproducing fluvial population does not exist there. These findings have implications for future Endangered Species Act considerations and management of fluvial Arctic grayling within and outside of Yellowstone National Park. Our comprehensive approach is broadly applicable to the management of sparsely detected aquatic species worldwide.

  12. Sex-steroid and thyroid hormone concentrations in juvenile alligators (Alligator mississippiensis) from contaminated and reference lakes in Florida, USA

    USGS Publications Warehouse

    Grain, D.A.; Guillette, L.J.; Pickford, D.B.; Percival, H.F.; Woodward, A.R.


    Sex-steroid and thyroid hormones are critical regulators of growth and reproduction in all vertebrates, and several recent studies suggest that environmental chemicals can alter circulating concentrations of these hormones. This study examines plasma concentrations of estradiol-171?? (E2), testosterone (T), triiodothyronine (T3), and thyroxine (T4) in juvenile alligators (60-140 cm total length) from two contaminated lakes and one reference lake in Florida. First, the data were analyzed by comparing hormone concentrations among males and females from the different lakes. Whereas there were no differences in plasma E2 concentrations among animals of the three lakes, male alligators from the contaminated lakes (Lake Apopka and Lake Okeechobee) had significantly lower plasma T concentrations compared 10 males from the reference take (Lake Woodruff). Concentrations of thyroid hormones also differed in animals of the three lakes, with T4 concentrations being elevated in Lake Okeechobee males compared to Lake Woodruff males. Second, the relationship between body size and hormone concentration was examined using regression analysis. Most notably for steroid hormones, no clear relationship was detected between E2 and total length in Apopka females (r2 0.09, p = 0.54) or between T and total length in Apopka males (r2 = 0.007, p = 0.75). Females from Apopka (r2 = 0.318, p = 0.09) and Okeechobee (r2 = 0.222, p = 0.09) exhibited weak correlations between T3 and total length. Males from Apopka (r2 = 0.015, p = 0.66) and Okeechobee (r2 = 0.128, p = 0.19) showed no correlation between T4 and total length. These results indicate: some of the previously reported abnormalities in steroid hormones of hatchling alligators persist, at least, through the juvenile years; steroid and thyroid hormones are related to body size in juvenile alligators from the reference lake, whereas alligators living in lakes Apopka and Okeechobee experience alterations in circulating thyroid and steroid

  13. Subspecific affinity of black bears in the White River National Wildlife Refuge

    USGS Publications Warehouse

    Warrillow, J.; Culver, M.; Hallerman, E.; Vaughan, M.


    The black bear population of the White River National Wildlife Refuge (NWR) is adjacent to populations of black bear in Louisiana (Urusus americanus luteolus) which are listed as threatened under the U.S. Endangered Species Act. Wildlife management plans can pose restrictions on bear harvests and timber extraction; therefore the management plan for the White River NWR is sensitive to subspecific classification of its bear population. The objective of this study was to analyze genetic variation in the White River NWR and seven adjacent populations of black bears to assess the subspecific affinity of the White River NWR population. Here we report the variation at seven microsatellite DNA loci among eight black bear populations. The patterns of genetic variation gave strong support for distinguishing a southern group of black bears comprised of the White River, Arkansas; Tensas River, Louisiana; Upper Atchafalaya, Louisiana; Lower Atchafalaya, Louisiana; and Alabama/Mississippi populations. Phylogenetic analysis of individual variation suggested that historical black bear introductions into Arkansas and Louisiana affected gene pools of certain southern receiving populations, but did not significantly change interpopulation relatedness. Phylogenetic inferences at both the population and individual levels support the hypothesis that the White River NWR population of black bears belongs to the U. a. luteolus subspecies.

  14. Digital Mapping and Environmental Characterization of National Wild and Scenic River Systems

    SciTech Connect

    McManamay, Ryan A; Bosnall, Peter; Hetrick, Shelaine L; Smith, Brennan T


    Spatially accurate geospatial information is required to support decision-making regarding sustainable future hydropower development. Under a memorandum of understanding among several federal agencies, a pilot study was conducted to map a subset of National Wild and Scenic Rivers (WSRs) at a higher resolution and provide a consistent methodology for mapping WSRs across the United States and across agency jurisdictions. A subset of rivers (segments falling under the jurisdiction of the National Park Service) were mapped at a high resolution using the National Hydrography Dataset (NHD). The spatial extent and representation of river segments mapped at NHD scale were compared with the prevailing geospatial coverage mapped at a coarser scale. Accurately digitized river segments were linked to environmental attribution datasets housed within the Oak Ridge National Laboratory s National Hydropower Asset Assessment Program database to characterize the environmental context of WSR segments. The results suggest that both the spatial scale of hydrography datasets and the adherence to written policy descriptions are critical to accurately mapping WSRs. The environmental characterization provided information to deduce generalized trends in either the uniqueness or the commonness of environmental variables associated with WSRs. Although WSRs occur in a wide range of human-modified landscapes, environmental data layers suggest that they provide habitats important to terrestrial and aquatic organisms and recreation important to humans. Ultimately, the research findings herein suggest that there is a need for accurate, consistent, mapping of the National WSRs across the agencies responsible for administering each river. Geospatial applications examining potential landscape and energy development require accurate sources of information, such as data layers that portray realistic spatial representations.

  15. Red River Stream Improvement Final Design Nez Perce National Forest.

    SciTech Connect

    Watershed Consulting, LLC


    This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.

  16. 75 FR 53574 - Safety Zone; Fireworks Displays, Potomac River, National Harbor, MD

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Register (73 FR 3316). Public Meeting: We do not now plan to hold a public meeting. But you may submit a... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Fireworks Displays, Potomac River, National... is necessary to provide for the safety of life on navigable waters during five fireworks...

  17. 77 FR 64538 - Tualatin River National Wildlife Refuge, Washington and Yamhill Counties, OR, Draft Comprehensive...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... process through a notice in the Federal Register (75 FR 67763; November 3, 2010). Tualatin River National... and photography, and environmental education and interpretation. Background The CCP Process The... photography, and environmental education and interpretation. We will review and update the CCP at least...

  18. Regional patterns of total nitrogen concentrations in the National Rivers and Streams Assessment

    EPA Science Inventory

    Patterns of nitrogen concentrations in streams sampled by the National Rivers and Streams Assessment (NRSA) were examined semi-quantitatively to identify regional differences in stream nitrogen levels. The data were categorized and analyzed by watershed size classes to reveal pat...

  19. 75 FR 38768 - Ashley National Forest, UT, High Uintas Wilderness-Colorado River Cutthroat Trout Habitat...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Ashley National Forest, UT, High Uintas Wilderness--Colorado River Cutthroat Trout Habitat...) populations to suitable habitats within the High Uintas Wilderness. Implementation of this proposal would... nonnative fish is necessary to enhance habitat and restore genetically pure CRCT populations to...

  20. 75 FR 37749 - White River National Forest, Colorado, Oil and Gas Leasing Environmental Impact Statement

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service White River National Forest, Colorado, Oil and Gas Leasing Environmental Impact Statement... Oil and Gas Leasing and Final EIS and Record of Decision. The proposed revision includes the following: Changing what lands will be available for oil and gas leasing; changing or adding stipulations to...

  1. 75 FR 77826 - White River National Forest; Eagle County, CO; Beaver Creek Mountain Improvements

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service White River National Forest; Eagle County, CO; Beaver Creek Mountain Improvements AGENCY... Creek Mountain Improvements'' in the subject line. The scoping notice and map can be reviewed/downloaded...: --Update mountain facilities and infrastructure in order to provide the highest quality guest...

  2. 77 FR 73976 - Nez Perce-Clearwater National Forests; Idaho; Crooked River Valley Rehabilitation Project

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Nez Perce-Clearwater National Forests; Idaho; Crooked River Valley Rehabilitation Project AGENCY: Forest Service, USDA. ACTION: Notice of intent to prepare an environmental impact statement. SUMMARY: The forest gives notice of its intent to prepare an Environmental Impact Statement for...





    As a part of the waterquality surveillance activities of the National Water Quality Network at 101 sampling stations, insecticides were identified in 38 samples from ten rivers during the period May through December 1962. Both DDT and dieldrin were identified by infrared and gas chromatographic analysis of carbon adsorption extracts.

  4. 77 FR 39630 - Special Local Regulations for Marine Events; Potomac River, National Harbor Access Channel, MD

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Department of Homeland Security FR Federal Register NPRM Notice of Proposed Rulemaking A. Regulatory History... Federal Register (77 FR 82). We received no comments on the proposed rule. No public meeting was requested... Potomac River and National Harbor Access Channel during the event, the effect of this regulation will...

  5. 77 FR 20750 - Special Local Regulations for Marine Events; Potomac River, National Harbor Access Channel, MD

    Federal Register 2010, 2011, 2012, 2013, 2014


    ..., 2008, issue of the Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public... rulemaking. SUMMARY: The Coast Guard proposes to establish special local regulations during the swim segment... swim segment of the triathlon will occur on the Potomac River and in portions of the National...

  6. Survival of young American alligators on a Florida lake

    USGS Publications Warehouse

    Woodward, A.R.; Hines, T.C.; Abercrombie, C.L.; Nichols, J.D.


    A capture-recapture study was conducted on Orange Lake, Florida, from 1979 through 1984 to estimate survival rates of young in an American alligator (Alligator mississippiensis) populations. Hatchlings remained together in sibling groups (pods) for at least their 1st year and then began to disperse during their 2nd spring and summer. Mortality through mid-November of their 1st year was negligible. Jolly-Seber (JS) survival estimates of hatchlings for 6 and 12 months were 76 and 41%, respectively. The 2-year JS estimate for the 1980 cohort was 8%. Minimum-Known-Alive (MKA) survival values were 72 and 46% of JS estimates for 6 months and 1 year of age. Survival during the 2nd 6 months of life (spring-summer) tended to be lower than survival during the 1st 6 months (fall-winter).

  7. A new alligator-clip compound for molecular electronics

    NASA Astrophysics Data System (ADS)

    Jacob, Timo; Blanco, Mario; Goddard, William A.


    We used the B3LYP flavor of density functional calculations to study new alligator-clip compounds for molecular electronics with platinum electrodes. First, with commonly used S-based linkage molecule 3-methyl-1,2-dithiolane (MDTL) we find that after chemisorption on Pt(1 1 1) the most stable structure is ring-opened with a binding energy of 32.44 kcal/mol. Among several alternative alligator-clip compounds we find that P-based molecules lead to much higher binding energies. For the ring-closed structure of 3-methyl-1,2-diphospholane (MDPL) a binding energy of 47.72 kcal/mol was calculated and even 54.88 kcal/mol for the ring-opened molecule. Thus, MDPL provides a more stable link to the metal surface and might increase the conductance.

  8. A national survey of trace organic contaminants in Australian rivers.


    Scott, Philip D; Bartkow, Michael; Blockwell, Stephen J; Coleman, Heather M; Khan, Stuart J; Lim, Richard; McDonald, James A; Nice, Helen; Nugegoda, Dayanthi; Pettigrove, Vincent; Tremblay, Louis A; Warne, Michael St J; Leusch, Frederic D L


    Trace organic contaminant (TrOC) studies in Australia have, to date, focused on wastewater effluents, leaving a knowledge gap of their occurrence and risk in freshwater environments. This study measured 42 TrOCs including industrial compounds, pesticides, and pharmaceuticals and personal care products by liquid chromatography tandem mass spectrometry at 73 river sites across Australia quarterly for 1 yr. Trace organic contaminants were found in 92% of samples, with a median of three compounds detected per sample (maximum 18). The five most commonly detected TrOCs were the pharmaceuticals salicylic acid (82%, maximum = 1530 ng/L), paracetamol (also known as acetaminophen; 45%, maximum = 7150 ng/L), and carbamazepine (27%, maximum = 682 ng/L), caffeine (65%, maximum = 3770 ng/L), and the flame retardant (2-chloroethyl) phosphate (44%, maximum = 184 ng/L). Pesticides were detected in 28% of the samples. To determine the risk posed by the detected TrOCs to the aquatic environment, hazard quotients were calculated by dividing the maximum concentration detected for each compound by the predicted no-effect concentrations. Three of the 42 compounds monitored (the pharmaceuticals carbamazepine and sulfamethoxazole and the herbicide simazine) had a hazard quotient >1, suggesting that they may be causing adverse effects at the most polluted sites. A further 10 compounds had hazard quotients >0.1, indicating a potential risk; these included four pharmaceuticals, three personal care products, and three pesticides. Most compounds had hazard quotients significantly <0.1. The number of TrOCs measured in this study was limited and further investigations are required to fully assess the risk posed by complex mixtures of TrOCs on exposed biota. PMID:25603256

  9. 77 FR 51733 - Special Regulations; Areas of the National Park System, New River Gorge National River, Bicycle...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... tourism activities in southern West Virginia due to its nationally recognized status and has greatly..., and the Notice of Availability was published in the Federal Register (77 FR 12877, March 2, 2012). The... few cases equestrian use. Frontcountry trails, located in and near developed areas, have a...


    SciTech Connect

    Kriikku, E.; Tibrea, S.; Nance, T.


    The Research & Development Engineering (R&DE) section in the Savannah River National Laboratory (SRNL) engineers, integrates, tests, and supports deployment of custom robotics, systems, and tools for use in radioactive, hazardous, or inaccessible environments. Mechanical and electrical engineers, computer control professionals, specialists, machinists, welders, electricians, and mechanics adapt and integrate commercially available technology with in-house designs, to meet the needs of Savannah River Site (SRS), Department of Energy (DOE), and other governmental agency customers. This paper discusses five R&DE robotic and remote system projects.

  11. Water Hyacinths and Alligator Weeds for Final Filtration of Sewage

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.; Gordon, J.


    The potential of water hyacinths (Eichhornia crassipes) (Mart.) Solms and alligator weeds (Alternanthera philoxerides) (Mart.) Griesb. as secondary and tertiary filtration systems for domestic sewage was demonstrated. These two vascular aquatic plants reduced the suspended solids, total Kjeldahl nitrogen, total phosphorus, BOD sub 5, and total organic carbon levels in domestic sewage from 60 percent to 98 percent within a two week period. These plants grown in domestic sewage were also free of toxic levels of trace heavy metals.

  12. EAARL coastal topography--Alligator Point, Louisiana, 2010

    USGS Publications Warehouse

    Nayegandhi, Amar; Bonisteel-Cormier, J.M.; Wright, C.W.; Brock, J.C.; Nagle, D.B.; Vivekanandan, Saisudha; Fredericks, Xan; Barras, J.A.


    This project provides highly detailed and accurate datasets of a portion of Alligator Point, Louisiana, acquired on March 5 and 6, 2010. The datasets are made available for use as a management tool to research scientists and natural-resource managers. An innovative airborne lidar instrument originally developed at the National Aeronautics and Space Administration (NASA) Wallops Flight Facility, and known as the Experimental Advanced Airborne Research Lidar (EAARL), was used during data acquisition. The EAARL system is a raster-scanning, waveform-resolving, green-wavelength (532-nanometer) lidar designed to map near-shore bathymetry, topography, and vegetation structure simultaneously. The EAARL sensor suite includes the raster-scanning, water-penetrating full-waveform adaptive lidar, a down-looking red-green-blue (RGB) digital camera, a high-resolution multispectral color-infrared (CIR) camera, two precision dual-frequency kinematic carrier-phase GPS receivers, and an integrated miniature digital inertial measurement unit, which provide for sub-meter georeferencing of each laser sample. The nominal EAARL platform is a twin-engine aircraft, but the instrument was deployed on a Pilatus PC-6. A single pilot, a lidar operator, and a data analyst constitute the crew for most survey operations. This sensor has the potential to make significant contributions in measuring sub-aerial and submarine coastal topography within cross-environmental surveys. Elevation measurements were collected over the survey area using the EAARL system, and the resulting data were then processed using the Airborne Lidar Processing System (ALPS), a custom-built processing system developed in a NASA-USGS collaboration. ALPS supports the exploration and processing of lidar data in an interactive or batch mode. Modules for presurvey flight-line definition, flight-path plotting, lidar raster and waveform investigation, and digital camera image playback have been developed. Processing algorithms have

  13. Barrier cells in gills of the alligator gar.


    Henderson, V


    Studies of barrier cells in fishes are few and have been restricted primarily to salmonids. Moreover, these studies revealed the presence of barrier cells only in hematopoietic and lymphoid organs. The alligator gar, Lepisosteus spatula, possesses similar tissues within the gills which are readily accessible; therefore, they were the organs of choice. An electron microscopical analysis of the gills was undertaken to determine if barrier cells exist and if they possess an ultrastructural design comparable to their counterparts in the brain and lungs of higher vertebrates and hematopoietic/lymphoid tissues in fishes. The present study revealed that barrier cells were found only within non-hematopoietic/lymphoid areas. Barrier cells surrounded endocrine components, nerves, and sinusoids rather than capillary endothelium or hematopoietic/lymphoid tissues. Barrier cells in the alligator gar displayed a complex envelopment more similar to those found in the blood-cerebrospinal fluid, blood-brain, and blood-gas barriers in higher vertebrates than in salmonids. The barrier in the alligator gar consisted of: (1) an endothelium whose cells displayed tight junctions; (2) a basement membrane; and (3) an outer adventitia composed of fibrocytic cells in syncytium. PMID:18627869

  14. Barrier cells in gills of the alligator gar.


    Henderson, V


    Studies of barrier cells in fishes are few and have been restricted primarily to salmonids. Moreover, these studies revealed the presence of barrier cells only in hematopoietic and lymphoid organs. The alligator gar, Lepisosteus spatula, possesses similar tissues within the gills which are readily accessible; therefore, they were the organs of choice. An electron microscopical analysis of the gills was undertaken to determine if barrier cells exist and if they possess an ultrastructural design comparable to their counterparts in the brain and lungs of higher vertebrates and hematopoietic/lymphoid tissues in fishes. The present study revealed that barrier cells were found only within non-hematopoietic/lymphoid areas. Barrier cells surrounded endocrine components, nerves, and sinusoids rather than capillary endothelium or hematopoietic/lymphoid tissues. Barrier cells in the alligator gar displayed a complex envelopment more similar to those found in the blood-cerebrospinal fluid, blood-brain, and blood-gas barriers in higher vertebrates than in salmonids. The barrier in the alligator gar consisted of: (1) an endothelium whose cells displayed tight junctions; (2) a basement membrane; and (3) an outer adventitia composed of fibrocytic cells in syncytium.

  15. Mathematical models for growth in alligator (Alligator mississippiensis) embryos developing at different incubation temperatures.

    PubMed Central

    Bardsley, W G; Ackerman, R A; Bukhari, N A; Deeming, D C; Ferguson, M W


    A variety of model-based (growth models) and model-free (cubic splines, exponentials) equations were fitted using weighted-nonlinear least squares regression to embryonic growth data from Alligator mississippiensis eggs incubated at 30 and 33 degrees C. Goodness of fit was estimated using a chi 2 on the sum of squared, weighted residuals, and run and sign tests on the residuals. One of the growth models used (Preece & Baines, 1978) was found to be superior to the classical growth models (exponential, monomolecular, logistic, Gompertz, von Bertalanffy) and gave an adequate fit to all longitudinal measures taken from the embryonic body and embryonic mass. However, measurements taken from the head could not be fitted by growth models but were adequately fitted by weighted least squares cubic splines. Data for the stage of development were best fitted by a sum of 2 exponentials with a transition point. Comparison of the maximum growth rates and parameter values, indicated that the growth data at 30 degrees C could be scaled to 33 degrees C to multiplying the time by a scaling factor of 1.2. This is equivalent to a Q10 of about 1.86 or, after solving the Arrhenius equation, an E++ of 46.9 kJmol-1. This may be interpreted as indicating a common rate-limiting step in development at the 2 temperatures. PMID:7591979


    EPA Science Inventory

    Previous studies have reported a number of physiological differences among juvenile alligators from two well-studied populations (Lake Apopka and Lake Woodruff) in north central Florida. These studies obtained alligators of similar size from each lake under the assumption that th...

  17. Biomonitoring Heavy Metal Pollution Using an Aquatic Apex Predator, the American Alligator, and Its Parasites

    PubMed Central

    Tellez, Marisa; Merchant, Mark


    Monitoring the bioaccumulation of chemical elements within various organismal tissues has become a useful tool to survey current or chronic levels of heavy metal exposure within an environment. In this study, we compared the bioaccumulations of As, Cd, Cu, Fe, Pb, Se, and Zn between the American alligator, Alligator mississippiensis, and its parasites in order to establish their use as bioindicators of heavy metal pollution. Concomitant with these results, we were interested to determine if parasites were more sensitive bioindicators of heavy metals relative to alligators. We found parasites collectively accumulated higher levels of As, Cu, Se, and Zn in comparison to their alligator hosts, whereas Fe, Cd, and Pb concentrations were higher in alligators. Interestingly, Fe levels were significantly greater in intestinal trematodes than their alligator hosts when analyzed independently from other parasitic taxa. Further analyses showed alligator intestinal trematodes concentrated As, Cu, Fe, Se, and Zn at significantly higher levels than intestinal nematodes and parasites from other organs. However, pentastomids also employed the role as a good biomagnifier of As. Interestingly, parasitic abundance decreased as levels of As increased. Stomach and intestinal nematodes were the poorest bioaccumulators of metals, yet stomach nematodes showed their ability to concentrate Pb at orders of magnitude higher in comparison to other parasites. Conclusively, we suggest that parasites, particularly intestinal trematodes, are superior biomagnifiers of As, Cu, Se, and Zn, whereas alligators are likely good biological indicators of Fe, Cd, and Pb levels within the environment. PMID:26555363

  18. Biomonitoring Heavy Metal Pollution Using an Aquatic Apex Predator, the American Alligator, and Its Parasites.


    Tellez, Marisa; Merchant, Mark


    Monitoring the bioaccumulation of chemical elements within various organismal tissues has become a useful tool to survey current or chronic levels of heavy metal exposure within an environment. In this study, we compared the bioaccumulations of As, Cd, Cu, Fe, Pb, Se, and Zn between the American alligator, Alligator mississippiensis, and its parasites in order to establish their use as bioindicators of heavy metal pollution. Concomitant with these results, we were interested to determine if parasites were more sensitive bioindicators of heavy metals relative to alligators. We found parasites collectively accumulated higher levels of As, Cu, Se, and Zn in comparison to their alligator hosts, whereas Fe, Cd, and Pb concentrations were higher in alligators. Interestingly, Fe levels were significantly greater in intestinal trematodes than their alligator hosts when analyzed independently from other parasitic taxa. Further analyses showed alligator intestinal trematodes concentrated As, Cu, Fe, Se, and Zn at significantly higher levels than intestinal nematodes and parasites from other organs. However, pentastomids also employed the role as a good biomagnifier of As. Interestingly, parasitic abundance decreased as levels of As increased. Stomach and intestinal nematodes were the poorest bioaccumulators of metals, yet stomach nematodes showed their ability to concentrate Pb at orders of magnitude higher in comparison to other parasites. Conclusively, we suggest that parasites, particularly intestinal trematodes, are superior biomagnifiers of As, Cu, Se, and Zn, whereas alligators are likely good biological indicators of Fe, Cd, and Pb levels within the environment. PMID:26555363

  19. Hydrobiological characteristics of Shark River estuary, Everglades National Park, Florida

    USGS Publications Warehouse

    McPherson, B.F.


    Water quality in the Shark River estuary was strongly influenced by seasonal patterns of rainfall, water level and temperature. During the rainy season (summer and early fall) the salinity in the 20-mile long estuary ranged from that of fresh water to half that of sea water while concentrations of dissolved oxygen were low, 2-5 milligrams per liter (mg/l) presumably because, among other factors, microbial activity and respiration were accelerated by high temperatures (30-33 degrees C). During the dry season (late fall through spring) the salinity ranged from 18 grams per liter (g/l) in the headwaters to 36 g/l at the Gulf during a dry year such as 1967 and from 1 to 25 g/l during a wet year such as 1969. Concentrations of dissolved oxygen increased from 2-3 mg/l in the summer of 1967 to 4-7 mg/l in the winter of 1968, and temperature decreased from an average of about 30 degrees C in summer to 20 degrees C in winter. Water level declined 5 to 10 decimeters in the headwaters during the dry season, and salinity and tidal action increased. Large amounts of submerged vegetation died in some headwater creeks at the end of the dry season, presumably killed by salinities above 3 g/l. The decaying organic matter and the decrease in photosynthesis resulted in low dissolved oxygen (1-2 mg/l). Fish died at this time probably as a result of the low dissolved oxygen. Trace elements, heavy metals and insecticides occurred in the waters of the estuary in concentrations below those indicated as harmful for aquatic life by current standards established by the Federal Water Pollution Control Administration (1968). The insecticides detected were concentrated in sediment and in various organisms. The patterns of distribution of planktonic and small nektonic animals in the estuary were related to salinity. Copepods (Arcatia tonsa, Labidocera aestiva, Pseudodiaptomus coronatus), cumaceans (Cyclaspis sp.), chaetognaths (Sagitta hispida), bay anchovies (Anchoa mitchilli), and scaled

  20. Sex-biased expression of sex-differentiating genes FOXL2 and FGF9 in American alligators, Alligator mississippiensis

    PubMed Central

    Janes, Daniel E.; Elsey, Ruth M.; Langan, Esther M.; Valenzuela, Nicole; Edwards, Scott V.


    Across amniotes, sex-determining mechanisms exhibit great variation yet the genes that govern sexual differentiation are largely conserved. Studies of evolution of sex-determining and sex-differentiating genes require an exhaustive characterization of functions of those genes such as FOXL2 and FGF9. FOXL2 is associated with ovarian development and FGF9 is known to play a role in testicular organogenesis in mammals and other amniotes. As a step toward characterization of the evolutionary history of sexual development, we measured expression of FOXL2 and FGF9 across three developmental stages and eight juvenile tissue types in male and female American alligators, Alligator mississippiensis. We report surprisingly high expression of FOXL2 before the stage of embryonic development when sex is determined in response to temperature and sustained and variable expression of FGF9 in juvenile male but not female tissue types. Novel characterization of gene expression in reptiles with temperature-dependent sex determination such as American alligators may inform the evolution of sex-determining and sex-differentiating gene networks as they suggest alternative functions from which the genes may have been exapted. Future functional profiling of sex-differentiating genes should similarly follow other genes and other species to enable a broad comparison across sex-determining mechanisms. PMID:23689672

  1. Fate of geothermal mercury from Yellowstone National Park in the Madison and Missouri Rivers, USA.


    Nimick, David A; Caldwell, Rodney R; Skaar, Donald R; Selch, Trevor M


    Mercury is a worldwide contaminant derived from natural and anthropogenic sources. River systems play a key role in the transport and fate of Hg because they drain widespread areas affected by aerial Hg deposition, transport Hg away from point sources, and are sites of Hg biogeochemical cycling and bioaccumulation. The Madison and Missouri Rivers provide a natural laboratory for studying the fate and transport of Hg contributed by geothermal discharge in Yellowstone National Park and from the atmosphere for a large drainage basin in Montana and Wyoming, United States of America (USA). Assessing Hg in these rivers also is important because they support fishery-based recreation and irrigated agriculture. During 2002 to 2006, Hg concentrations were measured in water, sediment, and fish from the main stem, 7 tributaries, and 6 lakes. Using these data, the geothermal Hg load to the Madison River and overall fate of Hg along 378 km of the Missouri River system were assessed. Geothermal Hg was the primary source of elevated total Hg concentrations in unfiltered water (6.2-31.2 ng/L), sediment (148-1100 ng/g), and brown and rainbow trout (0.12-1.23 μg total Hg/g wet weight skinless filet) upstream from Hebgen Lake (the uppermost impoundment). Approximately 7.0 kg/y of geothermal Hg was discharged from the park via the Madison River, and an estimated 87% of that load was lost to sedimentation in and volatilization from Hebgen Lake. Consequently, Hg concentrations in water, sediment, and fish from main-stem sites downstream from Hebgen Lake were not elevated and were comparable to concentrations reported for other areas affected solely by atmospheric Hg deposition. Some Hg was sequestered in sediment in the downstream lakes. Bioaccumulation of Hg in fish along the river system was strongly correlated (r(2)=0.76-0.86) with unfiltered total and methyl Hg concentrations in water and total Hg in sediment.

  2. Yakima River Spring Chinook Enhancement Study, Fisheries Resource Management, Yakima Indian Nation1983 Annual Report.

    SciTech Connect

    Wasserman, Larry


    The purpose was to evaluate enhancement methodologies that can be used to rebuild runs of spring chinook to the Yakima River system. In January, 1983, 100,000 fish raised at Leavenworth National Fish Hatchery were transported to Nile Springs Rearing Ponds on the Naches River. These fish were allowed a volitional release as smolts in April. An additional 100,000 smolts were transported from Leavenworth Hatchery in April and immediately released to the Upper Yakima River. Relative survival of smolts from their points of release to a trap at Prosser (RM48) was 1.69:1 for fish from Nile Springs, versus the trucked smolts. The fish from Nile Springs arrived at Prosser and McNary Dam approximately 1 week earlier than the transported fish. To better determine the magnitude and location of releases, distribution and abundance studies were undertaken. There is a decrease in abundance from upstream areas over time, indicating a general downstream movement. In the Naches System, the lower Naches River is heavily utilized by juvenile spring chinook during the early summer. A preliminary study evaluated physical limitations of production. On a single evening 67 fish were killed on diversion screens at Chandler Canal. This constituted 5.7% of the wild spring chinook entering the canal and 8.2% of the fall chinook. The larger hatchery spring chinook sustained a 2.3% loss. Adult returns resulted in 443 redds in the Yakima System, with 360 in the Yakima River and 83 in the Naches System.

  3. Salinity tolerances of selected macroinvertebrates of the Sabie River, Kruger National Park, South Africa.


    Goetsch, P; Palmer, C G


    Salinization has been identified as the most important problem facing the managers of South African freshwaters. Laboratory-based toxicity tests were conducted to assess the tolerance of selected macroinvertebrates to elevated salt concentrations. Since the Kruger National Park is the focus of river research in South Africa, and the Sabie River is the least mineralized river in the park, 96-h acute toxicity tests were conducted using Sabie River water and an ephemeropteran mayfly Tricorythus sp. found in the river. Experiments were conducted inflowing water systems known as raceways. The tolerance of the mayfly to two sodium salts, sodium chloride and sodium sulphate, was assessed at a range of selected conductivity levels/concentrations. The results indicated that mortality cannot be linked only to conductivity or total dissolved solid(TDS) concentrations, but also to the nature of the salt. Sodium sulphate was considerably more toxic to Tricorythus sp. than sodium chloride. Causes of mortality and implications for the development of water quality guidelines for the natural aquatic environment are discussed. PMID:9002432

  4. A hierarchical spatial framework and database for the national river fish habitat condition assessment

    USGS Publications Warehouse

    Wang, L.; Infante, D.; Esselman, P.; Cooper, A.; Wu, D.; Taylor, W.; Beard, D.; Whelan, G.; Ostroff, A.


    Fisheries management programs, such as the National Fish Habitat Action Plan (NFHAP), urgently need a nationwide spatial framework and database for health assessment and policy development to protect and improve riverine systems. To meet this need, we developed a spatial framework and database using National Hydrography Dataset Plus (I-.100,000-scale); This framework uses interconfluence river reaches and their local and network catchments as fundamental spatial river units and a series of ecological and political spatial descriptors as hierarchy structures to allow users to extract or analyze information at spatial scales that they define. This database consists of variables describing channel characteristics, network position/connectivity, climate, elevation, gradient, and size. It contains a series of catchment-natural and human-induced factors that are known to influence river characteristics. Our framework and database assembles all river reaches and their descriptors in one place for the first time for the conterminous United States. This framework and database provides users with the capability of adding data, conducting analyses, developing management scenarios and regulation, and tracking management progresses at a variety of spatial scales. This database provides the essential data needs for achieving the objectives of NFHAP and other management programs. The downloadable beta version database is available at

  5. Debris flows from tributaries of the Colorado River, Grand Canyon National Park, Arizona

    USGS Publications Warehouse

    Webb, R.H.; Pringle, P.T.; Rink, G.R.


    A reconnaissance of 36 tributaries of the Colorado River indicates that debris flows are a major process by which sediment is transported to the Colorado River in Grand Canyon National Park. Debris flows are slurries of sediment and water that have a water content < 40% by volume. Debris flows occur frequently in arid and semiarid regions. Slope failures commonly trigger debris flows, which can originate from any rock formation in the Grand Canyon. The largest and most frequent flows originate from the Permian Hermit Shale, the underlying Esplanade Sandstone of the Supai Group, and other formations of the Permian and Pennsylvanian Supai Group. Debris flows have reached the Colorado River on an average of once every 20 to 30 yr in the Lava-Chuar Creek drainage since about 1916. Two debris flows have reached the Colorado River in the last 25 yr in Monument Creek. The Crystal Creek drainage has had an average of one debris flow reaching the Colorado River every 50 yr, although the debris flow of 1966 has been the only flow that reached the Colorado River since 1900. Debris flows may actually reach the Colorado River more frequently in these drainages because evidence for all debris flows may not have been preserved in the channel-margin stratigraphy. Discharges were estimated for the peak flow of three debris flows that reached the Colorado River. The debris flow of 1966 in the Lava-Chuar Creek drainage had an estimated discharge of 4,000 cu ft/sec. The debris flow of 1984 in the Monument Creek drainage had a discharge estimated between 3,600 and 4,200 cu ft/sec. The debris flow of 1966 in the Crystal Creek drainage had a discharge estimated between 9,200 and 14,000 cu ft/sec. Debris flows in the Grand Canyon generally are composed of 10 to 40% sand by weight and may represent a significant source of beach-building sand along the Colorado River. The particle size distributions are very poorly sorted and the largest transported boulders were in the Crystal Creek

  6. Flow Velocity and Sediment Data Collected During 1990 and 1991 at National Canyon, Colorado River, Arizona

    USGS Publications Warehouse

    Hornewer, Nancy J.; Wiele, Stephen M.


    During 1990 and 1991, a series of research flows were released from Glen Canyon Dam. Data collected at the streamflow-gaging station on the Colorado River above National Canyon near Supai from that period have been compiled and entered into the U.S. Geological Survey database. The data consist of measurements of suspended-sediment concentration and sand sizes in suspension, sand sizes of streambed sediment, and velocity of the Colorado River above National Canyon near Supai streamflow-gaging site. Velocity and sediment data are available upon request from the Arizona Water Science Center and from the U.S. Geological Survey water-quality database (

  7. Sediment capture in flood plains of the Mississippi River: A case study in Cat Island National Wildlife Refuge, Louisiana

    NASA Astrophysics Data System (ADS)

    Smith, M.; Bentley, S. J., Sr.


    To plan restoration of the Mississippi River Delta, it is imperative to know how much sediment the Mississippi River currently provides. Recent research has demonstrated that between Tarbert Landing and St Francisville on the Mississippi, as much as 67 million metric tons (Mt) per year is lost from river transport, of which ~16 Mt is muddy suspended sediment. So where does this sediment go? Two pathways for loss have been proposed: riverbed storage, and overbank deposition in regions that lack manmade levées. Cat Island National Wildlife Refuge, on the unleveed Mississippi River east bank near St Francisville, Louisiana, consists of undisturbed bottomland forest that is inundated most years by river flooding. To determine fluvial sediment accumulation rates (SAR) from flooding, pushcores 40-50 cm long were collected then dated by Pb-210 and Cs-137 geochronology. Preliminary data suggests that muddy sediment accumulation is 10-13% of muddy suspended sediment lost from river transport along this river reach.

  8. Gastric nematode diversity between estuarine and inland freshwater populations of the American alligator (Alligator mississippiensis, daudin 1802), and the prediction of intermediate hosts.


    Tellez, Marisa; Nifong, James


    We examined the variation of stomach nematode intensity and species richness of Alligator mississippiensis from coastal estuarine and inland freshwater habitats in Florida and Georgia, and integrated prey content data to predict possible intermediate hosts. Nematode parasitism within inland freshwater inhabiting populations was found to have a higher intensity and species richness than those inhabiting coastal estuarine systems. This pattern potentially correlates with the difference and diversity of prey available between inland freshwater and coastal estuarine habitats. Increased consumption of a diverse array of prey was also correlated with increased nematode intensity in larger alligators. Parasitic nematodes Dujardinascaris waltoni, Brevimulticaecum tenuicolle, Ortleppascaris antipini, Goezia sp., and Contracaecum sp. were present in alligators from both habitat types. Dujardinascaris waltoni, B. tenuicolle, and O. antipini had a significantly higher abundance among inland inhabiting alligators than hosts from estuarine populations. Our findings also suggest that host specific nematode parasites of alligators may have evolved to infect multiple intermediate hosts, particularly fishes, crabs, and turtles, perhaps in response to the opportunistic predatory behaviors of alligators. PMID:25426417

  9. Gastric nematode diversity between estuarine and inland freshwater populations of the American alligator (Alligator mississippiensis, daudin 1802), and the prediction of intermediate hosts

    PubMed Central

    Tellez, Marisa; Nifong, James


    We examined the variation of stomach nematode intensity and species richness of Alligator mississippiensis from coastal estuarine and inland freshwater habitats in Florida and Georgia, and integrated prey content data to predict possible intermediate hosts. Nematode parasitism within inland freshwater inhabiting populations was found to have a higher intensity and species richness than those inhabiting coastal estuarine systems. This pattern potentially correlates with the difference and diversity of prey available between inland freshwater and coastal estuarine habitats. Increased consumption of a diverse array of prey was also correlated with increased nematode intensity in larger alligators. Parasitic nematodes Dujardinascaris waltoni, Brevimulticaecum tenuicolle, Ortleppascaris antipini, Goezia sp., and Contracaecum sp. were present in alligators from both habitat types. Dujardinascaris waltoni, B. tenuicolle, and O. antipini had a significantly higher abundance among inland inhabiting alligators than hosts from estuarine populations. Our findings also suggest that host specific nematode parasites of alligators may have evolved to infect multiple intermediate hosts, particularly fishes, crabs, and turtles, perhaps in response to the opportunistic predatory behaviors of alligators. PMID:25426417

  10. 76 FR 29721 - Lost River and Challis-Yankee Fork Ranger Districts, Salmon-Challis National Forest; ID; Lost...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Forest Service Lost River and Challis-Yankee Fork Ranger Districts, Salmon- Challis National Forest; ID; Lost River/Lemhi Grazing Allotments Environmental Impact Statement AGENCY: Forest Service, USDA....

  11. "Nehiyawewin Askihk": Cree Language on the Land--Language Planning through Consultation in the Loon River Cree First Nation

    ERIC Educational Resources Information Center

    Schreyer, Christine


    This article examines the parallel development of language planning and land planning within the Loon River Cree First Nation. Loon River Cree territory, located in north-central Alberta, Canada, is an area where major oil and gas industry, as well as logging and mining are constantly encroaching. The community, who still use Cree in their daily…

  12. 78 FR 56650 - Boundary Description and Final Map for Roaring Wild and Scenic River, Mount Hood National Forest...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Boundary Description and Final Map for Roaring Wild and Scenic River, Mount Hood National...'s Office of the Mount Hood National Forest, 16400 Champion Way, Sandy, Oregon 97055. FOR FURTHER INFORMATION CONTACT: Information may be obtained by contacting the following office: Mount Hood...

  13. Water-quality data for the Talkeetna River and four streams in National Parks, Cook Inlet basin, Alaska, 1998

    USGS Publications Warehouse

    Frenzel, Steven A.; Dorava, Joseph M.


    Five streams in the Cook Inlet Basin, Alaska, were sampled in 1998 to provide the National Park Service with baseline information on water quality. Four of these streams drain National Park Service land: Costello and Colorado Creeks in Denali National Park and Preserve, Johnson River in Lake Clark National Park and Preserve, and Kamishak River in Katmai National Park and Preserve. The fifth site was on the Talkeetna River, outside of national park boundaries. Samples of stream water, streambed sediments, and fish tissues were collected for chemical analyses. Biological and geomorphic information was also collected at each site. Nutrient concentrations in stream water were low and commonly were less than analytical detection limits. Analyses of fish tissues for 28 organochlorine compounds at Talkeetna River and Costello Creek produced just one detection. Hexachlorobenzene was detected at a concentration of 5.70 micrograms per kilogram in slimy sculpin from the Talkeetna River. Streambed sediment samples from the Talkeetna River had three organochlorine compounds at detectable levels; hexachlorobenzene was measured at 13 micrograms per kilogram and two other compounds were below the minimum reporting levels. At Colorado Creek, Johnson River, and Kamishak River, where fish samples were not collected, no organochlorine compounds were detected in streambed sediment samples. Several semivolatile organic compounds were detected at Colorado Creek and Costello Creek. Only one compound, dibenzothiophene, detected at Costello Creek at a concentration of 85 micrograms per kilogram was above the minimum reporting limit. No semivolatile organic compounds were detected at the Talkeetna, Kamishak, or Johnson Rivers. Trace elements were detected in both fish tissues and streambed sediments. Macroinvertebrate and fish samples contained few taxa at all sites. Total numbers of macroinvertebrate taxa ranged from 19 at the Johnson River to 38 at the Talkeetna River. Diptera were the

  14. Debris flows from tributaries of the Colorado River, Grand Canyon National Park, Arizona

    USGS Publications Warehouse

    Webb, Robert H.; Pringle, Patrick T.; Rink, Glenn R.


    A reconnaissance of 36 tributaries of the Colorado River indicates that debris flows are a major process by which sediment is transported to the Colorado River in Grand Canyon National Park. Debris flows are slurries of sediment and water that have a water content of less than about 40 percent by volume. Debris flows occur frequently in arid and semiarid regions. Slope failures commonly trigger debris flows, which can originate from any rock formation in the Grand Canyon. The largest and most frequent flows originate from the Permian Hermit Shale, the underlying Esplanade Sandstone of the Supai Group, and other formations of the Permian and Pennsylvanian Supai Group. Debris flows also occur in the Cambrian Muav Limestone and underlying Bright Angel Shale and the Quaternary basalts in the western Grand Canyon. Debris-flow frequency and magnitude were studied in detail in the Lava-Chuar Creek drainage at Colorado River mile 65.5; in the Monument Creek drainage at mile 93.5; and in the Crystal Creek drainage at mile 98.2. Debris flows have reached the Colorado River on an average of once every 20 to 30 years in the Lava-Chuar Creek drainage since about 1916. Two debris flows have reached the Colorado River in the last 25 years in Monument Creek. The Crystal Creek drainage has had an average of one debris flow reaching the Colorado River every 50 years, although the debris flow of 1966 has been the only flow that reached the Colorado River since 1900. Debris flows may actually reach the Colorado River more frequently in these drainages because evidence for all debris flows may not have been preserved in the channel-margin stratigraphy. Discharges were estimated for the peak flow of three debris flows that reached the Colorado River. The debris flow of 1966 in the Lava-Chuar Creek drainage had an estimated discharge of 4,000 cubic feet per second. The debris flow of 1984 in the Monument Creek drainage had a discharge estimated between 3,600 and 4,200 cubic feet per

  15. Hydrologic data and a proposed water-quality monitoring network for Kobuk River basin, gates of the Arctic National Park and Preserve, and Kobuk Valley National Park, Alaska

    USGS Publications Warehouse

    Brabets, Timothy P.


    Located in northwestern Alaska, the Kobuk River drains a watershed of approximately 12,300 square miles. Two national parks are located in the basin: the entire Kobuk Valley National Park and and a portion of Gates of the Arctic National Park and Preserve. Reconnaissance-type water-quality data collected on the Kobuk River and some of its tributaries indicate that the water is of a calcium to calcium-magnesium-bicarbonate type. To design a representative water-quality monitoring network, a geographical information system (GIS) of the Kobuk River Basin was created. The GIS was used with a statistical technique, cluster analysis, to stratify the Kobuk River Basin into different regions. Potential water-quality monitoring sites were then selected from these regions.

  16. Geochemistry of the Johnson River, Lake Clark National Park and Preserve, Alaska

    USGS Publications Warehouse

    Brabets, Timothy P.; Riehle, James R.


    The Johnson River Basin, located in Lake Clark National Park and Preserve, drains an area of 96 square miles. A private inholding in the upper part of the basin contains a gold deposit that may be developed in the future. To establish a natural baseline to compare potential effects on water quality if development were to occur, the upper part of the Johnson River Basin was studied from 1999 to 2001 as part of a cooperative study with the National Park Service. Two basic rock types occur within the drainage basin of the study: the Jurassic Talkeetna Formation of interbedded volcanic and volcaniclastic rocks, and the slightly younger plutonic rocks of the Aleutian-Alaska Ranges batholith. The Johnson River gold prospect reflects widespread, secondary mineralization and alteration of the Talkeetna Formation. Metals found at the prospect proper are: arsenic, cadmium, copper, gold, iron, lead, mercury, molybdenum, selenium, silver, and zinc. The Johnson River prospect is located in the East Fork Ore Creek Basin, a 0.5 square mile watershed that is a tributary to the Johnson River. Water quality data from this stream reflect the mineralization of the basin and the highest concentrations of several trace elements and major ions of the water column were found in this stream. Presently, pH in this stream is normal, indicating that there is sufficient buffering capacity. At the Johnson River streamgage, which drains approximately 25 mi2 including the East Fork Ore Creek, concentrations of these constituents are significantly lower, reflecting the runoff from Johnson Glacier and Double Glacier, which account for approximately 75 percent of the total discharge. Streambed concentrations of cadmium, lead, and zinc from East Fork Ore Creek and its receiving stream, Ore Creek, typically exceed concentrations where sediment dwelling organisms would be affected. Similar to the water column chemistry, concentrations of these elements are lower at the Johnson River streamgage

  17. Growth plate formation and development in alligator and mouse metapodials: evolutionary and functional implications.


    Reno, Philip L; Horton, Walter E; Elsey, Ruth M; Lovejoy, C Owen


    Mammalian metapodials (metacarpals and metatarsals), unlike most long bones, form a single growth plate, and undergo longitudinal growth at only one end. The growth dynamics of non-mammalian tetrapod metapodials have not been systematically examined in order to determine if unidirectional growth is unique to mammals. Here we compare murine metapodial ossification in growth stages that parallel those of embryonic, juvenile and subadult American alligators (Alligator mississippiensis). Safranin O staining was used for qualitative histology, and chondrocyte differentiation and proliferation were assessed via immunohistochemistry for type X collagen and proliferative cell nuclear antigen (PCNA). We establish that growth plates form at both ends of alligator metapodials and are maintained in the subadult. PCNA results show that alligators and mice share common patterns of chondrocyte proliferation during growth plate formation. In addition, while alligators and mice differ initially in the degree of organization and pace of chondrocyte differentiation, these parameters are largely similar in established growth plates. However, the replacement of cartilage by bone is highly irregular throughout growth in the alligator, in contrast to the more uniform process in the mouse. These results indicate that while alligators and mammals share common mechanisms of chondrocyte regulation, they differ substantially in their processes of ossification. Phylogenetic analysis indicates that the direct ossification of one epiphysis and reliance on a single growth plate is a derived character (synapomorphy) in therian mammals and likely indicates an adaptation for erect quadrupedal gait. PMID:17285637

  18. Water quality and pollution status of Chambal river in National Chambal Sanctuary, Madhya Pradesh.


    Saksena, D N; Garg, R K; Rao, R J


    The physico-chemical characteristics of Chambal river water in National Chambal sanctuary (Madhya Pradesh) have been studied. The stretch of Chambal river contained in the National Chambal sanctuary (located at 25 degrees 23'-26 degrees 52'N, 76 degrees 28'-79 degrees 15'E) is extending up to 600 km downstream from Kota (Rajasthan) to the confluence of the Chambal with Yamuna river (Etawah). The river flow in Madhya Pradesh spans up to approximately 400 km. Three sampling stations viz., Station A--near Palighat, district Sheopurkalan, Station B--near Rajghat, district Morena and Station C--near Baraighat, district Bhind were established for the collection of water samples during April, 2003 to March, 2004. The water quality parameters namely transparency (12.12-110 cm), colour (transparent-very turbid), turbidity (1-178 TNU), electrical conductivity (145.60-884 microS cm(-1)), total dissolved solids (260-500 mgl(-1)), pH (7.60-9.33), dissolved oxygen (4.86-14.59 mgl(-1)), free carbon dioxide (0-16.5 mgl(-1)), total alkalinity (70-290 mgl(-1)), total hardness (42-140 mgl(-1)), chloride (15.62-80.94 mgl(-1)), nitrate (0.008-0.025 mgl(-1)), nitrite (0.002-0.022 mgl(-1)), sulphate (3.50-45 mgl(-1)), phosphate (0.004-0.050 mgl(-1)), silicate (2.80-13.80 mgl(-1)), biochemical oxygen demand (0.60-5.67 mgl(-1)), chemical oxygen demand (2.40-26.80 mgl(-1)), ammonia (nil-0.56 mgl(-1)), sodium (14.30-54.40 mgl(-1)) and potassium (2.10 mgl(-1)-6.30 mgl(-1)) reflects on the pristine nature of the river in National Chambal sanctuary. On the basis of various parameters studied, Chambal river in this stretch can be placed under the category of oligosaprobic. The water quality analysis, indicated that the riverwater in the sanctuary area is pollution free and can serve as a good habitat for many aquatic animals including endangered species. PMID:19295068

  19. Water quality and pollution status of Chambal river in National Chambal Sanctuary, Madhya Pradesh.


    Saksena, D N; Garg, R K; Rao, R J


    The physico-chemical characteristics of Chambal river water in National Chambal sanctuary (Madhya Pradesh) have been studied. The stretch of Chambal river contained in the National Chambal sanctuary (located at 25 degrees 23'-26 degrees 52'N, 76 degrees 28'-79 degrees 15'E) is extending up to 600 km downstream from Kota (Rajasthan) to the confluence of the Chambal with Yamuna river (Etawah). The river flow in Madhya Pradesh spans up to approximately 400 km. Three sampling stations viz., Station A--near Palighat, district Sheopurkalan, Station B--near Rajghat, district Morena and Station C--near Baraighat, district Bhind were established for the collection of water samples during April, 2003 to March, 2004. The water quality parameters namely transparency (12.12-110 cm), colour (transparent-very turbid), turbidity (1-178 TNU), electrical conductivity (145.60-884 microS cm(-1)), total dissolved solids (260-500 mgl(-1)), pH (7.60-9.33), dissolved oxygen (4.86-14.59 mgl(-1)), free carbon dioxide (0-16.5 mgl(-1)), total alkalinity (70-290 mgl(-1)), total hardness (42-140 mgl(-1)), chloride (15.62-80.94 mgl(-1)), nitrate (0.008-0.025 mgl(-1)), nitrite (0.002-0.022 mgl(-1)), sulphate (3.50-45 mgl(-1)), phosphate (0.004-0.050 mgl(-1)), silicate (2.80-13.80 mgl(-1)), biochemical oxygen demand (0.60-5.67 mgl(-1)), chemical oxygen demand (2.40-26.80 mgl(-1)), ammonia (nil-0.56 mgl(-1)), sodium (14.30-54.40 mgl(-1)) and potassium (2.10 mgl(-1)-6.30 mgl(-1)) reflects on the pristine nature of the river in National Chambal sanctuary. On the basis of various parameters studied, Chambal river in this stretch can be placed under the category of oligosaprobic. The water quality analysis, indicated that the riverwater in the sanctuary area is pollution free and can serve as a good habitat for many aquatic animals including endangered species.

  20. Comparison of metabolic substrates in alligators and several birds of prey.


    Sweazea, Karen L; McMurtry, John P; Elsey, Ruth M; Redig, Patrick; Braun, Eldon J


    On average, avian blood glucose concentrations are 1.5-2 times those of mammals of similar mass and high concentrations of insulin are required to lower blood glucose. Whereas considerable data exist for granivorous species, few data are available for plasma metabolic substrate and glucoregulatory hormone concentrations for carnivorous birds and alligators. Birds and mammals with carnivorous diets have higher metabolic rates than animals consuming diets with less protein whereas alligators have low metabolic rates. Therefore, the present study was designed to compare substrate and glucoregulatory hormone concentrations in several birds of prey and a phylogenetically close relative of birds, the alligator. The hypothesis was that the combination of carnivorous diets and high metabolic rates favored the evolution of greater protein and fatty acid utilization leading to insulin resistance and high plasma glucose concentrations in carnivorous birds. In contrast, it was hypothesized that alligators would have low substrate utilization attributable to a low metabolic rate. Fasting plasma substrate and glucoregulatory hormone concentrations were compared for bald eagles (Haliaeetus leucocephalus), great horned owls (Bubo virginianus), red-tailed hawks (Buteo jamaicensis), and American alligators (Alligator mississippiensis). Avian species had high circulating β-hydroxybutyrate (10-21 mg/dl) compared to alligators (2.81 ± 0.16 mg/dl). In mammals high concentrations of this byproduct of fatty acid utilization are correlated with insulin resistance. Fasting glucose and insulin concentrations were positively correlated in eagles whereas no relationship was found between these variables for owls, hawks or alligators. Additionally, β-hydroxybutyrate concentrations were low in alligators. Similar to carnivorous mammals, ingestion of a high protein diet may have favored the utilization of fatty acids and protein for energy thereby promoting the development of insulin

  1. Comparison of metabolic substrates in alligators and several birds of prey.


    Sweazea, Karen L; McMurtry, John P; Elsey, Ruth M; Redig, Patrick; Braun, Eldon J


    On average, avian blood glucose concentrations are 1.5-2 times those of mammals of similar mass and high concentrations of insulin are required to lower blood glucose. Whereas considerable data exist for granivorous species, few data are available for plasma metabolic substrate and glucoregulatory hormone concentrations for carnivorous birds and alligators. Birds and mammals with carnivorous diets have higher metabolic rates than animals consuming diets with less protein whereas alligators have low metabolic rates. Therefore, the present study was designed to compare substrate and glucoregulatory hormone concentrations in several birds of prey and a phylogenetically close relative of birds, the alligator. The hypothesis was that the combination of carnivorous diets and high metabolic rates favored the evolution of greater protein and fatty acid utilization leading to insulin resistance and high plasma glucose concentrations in carnivorous birds. In contrast, it was hypothesized that alligators would have low substrate utilization attributable to a low metabolic rate. Fasting plasma substrate and glucoregulatory hormone concentrations were compared for bald eagles (Haliaeetus leucocephalus), great horned owls (Bubo virginianus), red-tailed hawks (Buteo jamaicensis), and American alligators (Alligator mississippiensis). Avian species had high circulating β-hydroxybutyrate (10-21 mg/dl) compared to alligators (2.81 ± 0.16 mg/dl). In mammals high concentrations of this byproduct of fatty acid utilization are correlated with insulin resistance. Fasting glucose and insulin concentrations were positively correlated in eagles whereas no relationship was found between these variables for owls, hawks or alligators. Additionally, β-hydroxybutyrate concentrations were low in alligators. Similar to carnivorous mammals, ingestion of a high protein diet may have favored the utilization of fatty acids and protein for energy thereby promoting the development of insulin

  2. Possible generational effects of habitat degradation on alligator reproduction

    USGS Publications Warehouse

    Fujisaki, Ikuko; Rice, K.G.; Woodward, A.R.; Percival, H.F.


    Population decline of the American alligator (Alligator mississippiensis) was observed in Lake Apopka in central Florida, USA, in the early 1980s. This decline was thought to result from adult mortality and nest failure caused by anthropogenic increases in sediment loads, nutrients, and contaminants. Reproductive impairment also was reported. Extensive restoration of marshes associated with Lake Apopka has been conducted, as well as some limited restoration measures on the lake. Monitoring by the Florida Fish and Wildlife Conservation Commission (FFWCC) has indicated that the adult alligator population began increasing in the early 1990s. We expected that the previously reported high proportion of complete nest failure (??0) during the 1980s may have decreased. We collected clutches from alligator nests in Lake Apopka from 1983 to 2003 and from 5 reference areas from 1988 to 1991, and we artificially incubated them. We used a Bayesian framework with Gibbs sampler of Markov chain Monte Carlo simulation to analyze ??0. Estimated ??0was consistently higher in Lake Apopka compared with reference areas, and the difference in ??0 ranged from 0.19 to 0.56. We conducted change point analysis to identify and test the significance of the change point in ??0in Lake Apopka between 1983 and 2003, indicating the point of reproductive recovery. The estimated Bayes factor strongly supported the single change point hypothesis against the no change point hypothesis. The major downward shift in ??0 probably occurred in the mid-1990s, approximately a generation after the major population decline in the 1980s. Furthermore, estimated ??0 values after the change point (0.21) were comparable with those of reference areas (0.07-0.31). These results combined with the monitoring by FFWCC seem to suggest that anthropogenic habitat degradation caused reproductive impairment of adult females and decreases in ??0 occurred with the sexual maturity of a new generation of breeding females. Long

  3. Traumatic Amputation of Finger From an Alligator Snapping Turtle Bite.


    Johnson, Robert D; Nielsen, Cynthia L


    Legend states that the alligator snapping turtle (Macrochelys temminckii) should be handled with extreme caution as it has jaw strength powerful enough to bite a wooden broomstick in half. Tales of bite injuries from what is the largest freshwater turtle in North America exist anecdotally, yet there are few descriptions of medical encounters for such. The risk of infection from reptilian bites to the hand in an aquatic environment warrants thorough antibiotic treatment in conjunction with hand surgery consultation. We present the first case report of a near total amputation of an index finger in an adolescent boy who had been bitten by a wild "gator snapper." PMID:27116923


    USGS Publications Warehouse

    Carey, William P.


    The South Fork Cumberland River begins in Tennessee at the confluence of the New River and Clear Fork. Strip mining for coal in the New River basin has been ongoing for decades with little reclamation prior to 1977. Water-quality data show that suspended-sediment and dissolved-constituent loads from the New River dominate the water quality in the National River and Recreation Area. The suspended sediment can impart a highly turbid and aesthetically displeasing appearance to the water during low-flow periods which are times of maximum recreational use. High suspended-sediment concentrations are also potentially harmful to the aquatic habitat in the Recreation Area. In addition to the suspended-sediment load, a large supply of coarse material is slowly moving through the channels of the New River basin toward the Recreation Area.

  5. [Formation of the genome of the alligator gar Lepisosteus osseus (Ganoidomorpha) genome].


    Vladychenskaia, N S; Kedrova, O S; Petrov, N B


    Genome structure of the alligator gar was studied by means of a comparison of reassociation kinetics of short and long DNA fragments, an estimation of hyperchromicity of reassociated repetitive DNA as a function of fragments length, and length estimation of S1-resistant duplexes by gel filtration. It was shown that most of the repeated sequences in the alligator gar DNA are no less than 2000 b.p. long and weakly divergent. Little or no interspersion of unique and short repeated sequences were observed in this genome. No highly divergent repeats were found in the alligator gar genome. PMID:6855762

  6. [Formation of the genome of the alligator gar Lepisosteus osseus (Ganoidomorpha) genome].


    Vladychenskaia, N S; Kedrova, O S; Petrov, N B


    Genome structure of the alligator gar was studied by means of a comparison of reassociation kinetics of short and long DNA fragments, an estimation of hyperchromicity of reassociated repetitive DNA as a function of fragments length, and length estimation of S1-resistant duplexes by gel filtration. It was shown that most of the repeated sequences in the alligator gar DNA are no less than 2000 b.p. long and weakly divergent. Little or no interspersion of unique and short repeated sequences were observed in this genome. No highly divergent repeats were found in the alligator gar genome.

  7. Water Quality of the Snake River and Five Eastern Tributaries in the Upper Snake River Basin, Grand Teton National Park, Wyoming, 1998-2002

    USGS Publications Warehouse

    Clark, Melanie L.; Sadler, Wilfrid J.; O'Ney, Susan E.


    To address water-resource management objectives of the National Park Service in Grand Teton National Park, the U.S. Geological Survey in cooperation with the National Park Service has conducted water-quality sampling in the upper Snake River Basin. Routine sampling of the Snake River was conducted during water years 1998-2002 to monitor the water quality of the Snake River through time. A synoptic study during 2002 was conducted to supplement the routine Snake River sampling and establish baseline water-quality conditions of five of its eastern tributaries?Pilgrim Creek, Pacific Creek, Buffalo Fork, Spread Creek, and Ditch Creek. Samples from the Snake River and the five tributaries were collected at 12 sites and analyzed for field measurements, major ions and dissolved solids, nutrients, selected trace metals, pesticides, and suspended sediment. In addition, the eastern tributaries were sampled for fecal-indicator bacteria by the National Park Service during the synoptic study. Major-ion chemistry of the Snake River varies between an upstream site above Jackson Lake near the northern boundary of Grand Teton National Park and a downstream site near the southern boundary of the Park, in part owing to the inputs from the eastern tributaries. Water type of the Snake River changes from sodium bicarbonate at the upstream site to calcium bicarbonate at the downstream site. The water type of the five eastern tributaries is calcium bicarbonate. Dissolved solids in samples collected from the Snake River were significantly higher at the upstream site (p-value<0.001), where concentrations in 43 samples ranged from 62 to 240 milligrams per liter, compared to the downstream site where concentrations in 33 samples ranged from 77 to 141 milligrams per liter. Major-ion chemistry of Pilgrim Creek, Pacific Creek, Buffalo Fork, Spread Creek, and Ditch Creek generally did not change substantially between the upstream sites near the National Park Service boundary with the National

  8. Destructive Testing of an ES-3100 Shipping Container at the Savannah River National Laboratory

    SciTech Connect

    Loftin, B.; Abramczyk, G.


    Destructive testing of an ES-3100 Shipping Container was completed by the Packaging Technology and Pressurized Systems organization within the Savannah River National Laboratory in order to qualify the ES-3100 as a candidate storage and transport package for applications at various facilities at the Savannah River Site. The testing consisted of the detonation of three explosive charges at separate locations on a single ES-3100. The locations for the placement were chosen based the design of the ES-3100 as well as the most likely places for the package to incur damage as a result of the detonation. The testing was completed at an offsite location, which raised challenges as well as allowed for development of new partnerships for this testing and for potential future testing. The results of the testing, the methods used to complete the testing, and similar, potential future work will be discussed.

  9. Assessing and Understanding Trail Degradation: Results from Big South Fork National River and Recreational Area

    USGS Publications Warehouse

    Marion, J.L.; Olive, N.


    This report describes results from a comprehensive assessment of resource conditions on a large (24%) sample of the trail system within Big South Fork National River and Recreational Area (BSF). Components include research to develop state-of-knowledge trail impact assessment and monitoring methods, application of survey methods to BSF trails, analysis and summary of results, and recommendations for trail management decision making and future monitoring. Findings reveal a trail system with some substantial degradation, particularly soil erosion, which additionally threatens water quality in areas adjacent to streams and rivers. Factors that contribute to or influence these problems are analyzed and described. Principal among these are trail design factors (trail topographic position, soil texture, grade and slope alignment angle), use-related factors (type and amount of use), and maintenance factors (water drainage). Recommendations are offered to assist managers in improving the sustainability of the trails system to accommodate visitation while enhancing natural resource protection.

  10. Three cases of severe hyponatremia during a river run in Grand Canyon National Park.


    Pearce, Emily A; Myers, Thomas M; Hoffman, Martin D


    We present 3 cases of severe hyponatremia occurring on a commercially guided river rafting trip on the Colorado River in Grand Canyon National Park. All 3 women appeared to have been overhydrating because of concern about dehydration and required evacuation within 24 hours of each other after the staggered onset of symptoms, which included fatigue and emesis progressing to disorientation or seizure. Each was initially transferred to the nearest hospital and ultimately required intensive care. Imaging and laboratory data indicated all 3 patients had hypervolemic hyponatremia. Unlike the well-documented exercise-associated hyponatremia cases commonly occurring in prolonged endurance athletic events, these 3 unique cases of acute hyponatremia were not associated with significant exercise. The cases illustrate the diagnostic and treatment challenges related to acute hyponatremia in an austere setting, and underscore the importance of preventive measures focused on avoidance of overhydration out of concern for dehydration.

  11. Three cases of severe hyponatremia during a river run in Grand Canyon National Park.


    Pearce, Emily A; Myers, Thomas M; Hoffman, Martin D


    We present 3 cases of severe hyponatremia occurring on a commercially guided river rafting trip on the Colorado River in Grand Canyon National Park. All 3 women appeared to have been overhydrating because of concern about dehydration and required evacuation within 24 hours of each other after the staggered onset of symptoms, which included fatigue and emesis progressing to disorientation or seizure. Each was initially transferred to the nearest hospital and ultimately required intensive care. Imaging and laboratory data indicated all 3 patients had hypervolemic hyponatremia. Unlike the well-documented exercise-associated hyponatremia cases commonly occurring in prolonged endurance athletic events, these 3 unique cases of acute hyponatremia were not associated with significant exercise. The cases illustrate the diagnostic and treatment challenges related to acute hyponatremia in an austere setting, and underscore the importance of preventive measures focused on avoidance of overhydration out of concern for dehydration. PMID:25736400

  12. Using electrical conductivity to monitor geothermal solute flux in major rivers of Yellowstone National Park

    NASA Astrophysics Data System (ADS)

    McCleskey, R. B.; Mahony, D.; Lowenstern, J. B.; Heasler, H.; Nordstrom, D. K.


    Thermal output from the magma chamber underlying Yellowstone National Park (YNP) can be estimated by monitoring Cl flux in major rivers draining the park. The U.S. Geological Survey (USGS) and the National Park Service have collaborated on Cl flux monitoring towards this end since the 1970s. Researchers collected water samples from the major rivers in YNP, but funding restrictions, winter travel, and the great distances between sites limits the number of samples collected annually. The use of electrical conductivity, which is relatively easy to measure and can be automated, as a proxy for Cl enables a more consistent monitoring of thermal output. To accomplish this, it is crucial to accurately quantify the relationship between electrical conductivity, Cl, and other geothermal solutes (SO4, F, HCO3, SiO2, K, Li, B, and As) along the Madison, Firehole, Gibbon, Snake, Gardner, and Yellowstone Rivers. Conductivity measurements were made every 15 minutes adjacent to USGS stream gages, allowing for the determination of solute fluxes. In addition, continuous conductivity measurements can be used to identify changes in river chemistry as a result of geysers eruptions, rain events, or changes in thermal inputs as a result of earthquakes or other natural events. Depending on the site, we have collected 2 to 5 years of conductivity measurements. Except for some trace elements (Fe and Hg), most solutes behave conservatively, and the ratio of geothermal solute concentrations are constant. Hence, dissolved concentrations of Cl, SO4, F, HCO3, SiO2, K, Li, Ca, B, and As correlate well with conductivity (R2 > 0.96). The use of conductivity to estimate solute concentrations and fluxes will provide a greater understanding of the systematics of the Yellowstone thermal output and allow for monitoring of many more solutes at a much higher temporal frequency.

  13. Specialized stem cell niche enables repetitive renewal of alligator teeth.


    Wu, Ping; Wu, Xiaoshan; Jiang, Ting-Xin; Elsey, Ruth M; Temple, Bradley L; Divers, Stephen J; Glenn, Travis C; Yuan, Kuo; Chen, Min-Huey; Widelitz, Randall B; Chuong, Cheng-Ming


    Reptiles and fish have robust regenerative powers for tooth renewal. However, extant mammals can either renew their teeth one time (diphyodont dentition) or not at all (monophyodont dentition). Humans replace their milk teeth with permanent teeth and then lose their ability for tooth renewal. Here, we study tooth renewal in a crocodilian model, the American alligator, which has well-organized teeth similar to mammals but can still undergo life-long renewal. Each alligator tooth is a complex family unit composed of the functional tooth, successional tooth, and dental lamina. Using multiple mitotic labeling, we map putative stem cells to the distal enlarged bulge of the dental lamina that contains quiescent odontogenic progenitors that can be activated during physiological exfoliation or artificial extraction. Tooth cycle initiation correlates with β-catenin activation and soluble frizzled-related protein 1 disappearance in the bulge. The dermal niche adjacent to the dermal lamina dynamically expresses neural cell adhesion molecule, tenascin-C, and other molecules. Furthermore, in development, asymmetric β-catenin localization leads to the formation of a heterochronous and complex tooth family unit configuration. Understanding how these signaling molecules interact in tooth development in this model may help us to learn how to stimulate growth of adult teeth in mammals.

  14. A 3D interactive model and atlas of the jaw musculature of Alligator mississippiensis.


    Holliday, Casey M; Tsai, Henry P; Skiljan, Rebecca J; George, Ian D; Pathan, Sami


    Modern imaging and dissemination methods enable morphologists to share complex, three-dimensional (3D) data in ways not previously possible. Here we present a 3D interactive model of the jaw musculature of the American Alligator (Alligator mississippiensis). Alligator and crocodylian jaw musculature is notoriously challenging to inspect and interpret because of the derived nature of the feeding apparatus. Using Iodine-contrast enhanced microCT imaging, a segmented model of jaw muscles, trigeminal nerve, brain and skull are presented as a cross-sectional atlas and 3D, interactive pdf of the rendered model. Modern 3D dissemination methods like this 3D Alligator hold great potential for morphologists to share anatomical information to scientists, educators, and the public in an easily downloadable format. PMID:23762228


    EPA Science Inventory

    Morphological difference in spleen and thymus are closely related to functional immune differences. Hormonal regulation of the immune system has been demonstrated in reptilian splenic and thymic tissue. Spleens and thymus were obtained from juvenile alligators at two reference si...

  16. Concentrations of contaminants in muscle of the American alligator in Florida

    SciTech Connect

    Delany, M.F.; Bell, J.U.; Sundlof, S.F.


    Samples of tail muscle from 32 American alligators (Alligator mississippiensis) in Florida were analyzed for contaminant concentrations to provide preliminary information on the potential public health hazard of meat consumption. Detectable levels were found for eight metals; copper, zinc, iron, chromium, mercury, lead, cadmium and arsenic. Mean residue was highest for mercury (geometric mean = 0.61 ppm). DDE, DDD, DDT, dieldrin, heptachlor epoxide, lindane, and PCB's were found. Mean residue concentrations were compared by lake. Alligators appeared to be suitable monitors of environmental pollution. Concentrations of contaminants found in these animals probably pose little threat to public health. However, recommendations must await analysis of larger sample sizes and information on amount and frequency of meat consumption. Alligators killed for human consumption should continue to be monitored for contaminant residues.

  17. A long-term national-scale hydrological simulation of river flows across Great Britain

    NASA Astrophysics Data System (ADS)

    Rudd, Alison; Bell, Victoria; Kay, Alison; Davies, Helen


    The Centre for Ecology and Hydrology's national-scale hydrological model, Grid-to-Grid, can be used to estimate river flows and soil moisture across Great Britain. It is used operationally at the flood forecasting centre and there have been a number of studies on floods and climate change using this model, however to date, low flows and droughts have been comparatively neglected. The launch of a five-year NERC-funded interdisciplinary research programme "UK Droughts and Water Scarcity" is allowing us to address this. Our work on one of these projects, MaRIUS (Managing the Risks, Impacts and Uncertainties of droughts and water Scarcity), uses the model to identify drought periods. The model is driven by a new long-term (1890 - 2012) precipitation dataset (CEH-GEAR) and estimates of potential evaporation. Model performance is assessed against observed river flows for both high and low flows. Gridded time series of monthly mean river flow and soil moisture from the model have been analysed to identify historic hydrological droughts across Great Britain using concepts such as severity and duration. We also investigate how drought occurrence and severity have changed over the last 100 years and identify regions that have been particularly susceptible to drought.


    NASA Technical Reports Server (NTRS)


    Double-parked, an angry alligator straddles two parking spaces outside an office trailer at NASA's Launch Complex 17. Hank Curtin of Pan Am watches from a safe perch as John Tanner gets ready to wrap a rope around the snout of the 10-foot, 9-inch beast. It's all in a day's work for Tanner, who has a contract with the state of Florida to remove nuisance alligators.

  19. Presumptive Sources of Fecal Contamination in Four Tributaries to the New River Gorge National River, West Virginia, 2004

    USGS Publications Warehouse

    Mathes, Melvin V.; O'Brien, Tara L.; Strickler, Kriston M.; Hardy, Joshua J.; Schill, William B.; Lukasik, Jerzy; Scott, Troy M.; Bailey, David E.; Fenger, Terry L.


    Several methods were used to determine the sources of fecal contamination in water samples collected during September and October 2004 from four tributaries to the New River Gorge National River -- Arbuckle Creek, Dunloup Creek, Keeney Creek, and Wolf Creek. All four tributaries historically have had elevated levels of fecal coliform bacteria. The source-tracking methods used yielded various results, possibly because one or more methods failed. Sourcing methods used in this study included the detection of several human-specific and animal-specific biological or molecular markers, and library-dependent pulsed-field gel electrophoresis analysis that attempted to associate Escherichia coli bacteria obtained from water samples with animal sources by matching DNA-fragment banding patterns. Evaluation of the results of quality-control analysis indicated that pulsed-field gel electrophoresis analysis was unable to identify known-source bacteria isolates. Increasing the size of the known-source library did not improve the results for quality-control samples. A number of emerging methods, using markers in Enterococcus, human urine, Bacteroidetes, and host mitochondrial DNA, demonstrated some potential in associating fecal contamination with human or animal sources in a limited analysis of quality-control samples. All four of the human-specific markers were detected in water samples from Keeney Creek, a watershed with no centralized municipal wastewater-treatment facilities, thus indicating human sources of fecal contamination. The human-specific Bacteroidetes and host mitochondrial DNA markers were detected in water samples from Dunloup Creek, Wolf Creek, and to a lesser degree Arbuckle Creek. Results of analysis for wastewater compounds indicate that the September 27 sample from Arbuckle Creek contained numerous human tracer compounds likely from sewage. Dog, horse, chicken, and pig host mitochondrial DNA were detected in some of the water samples with the exception of the

  20. Colorado River campsite monitoring, Grand Canyon National Park, Arizona, 1998-2012

    USGS Publications Warehouse

    Kaplinski, Matt; Hazel, Joe; Parnell, Rod; Hadley, Daniel R.; Grams, Paul


    River rafting trips and hikers use sandbars along the Colorado River in Marble and Grand Canyons as campsites. The U.S. Geological Survey evaluated the effects of Glen Canyon Dam operations on campsite areas on sandbars along the Colorado River in Grand Canyon National Park. Campsite area was measured annually from 1998 to 2012 at 37 study sites between Lees Ferry and Diamond Creek, Arizona. The primary purpose of this report is to present the methods and results of the project. Campsite area surveys were conducted using total station survey methods to outline the perimeter of camping area at each study site. Campsite area is defined as any region of smooth substrate (most commonly sand) with no more than an 8 degree slope and little or no vegetation. We used this definition, but relaxed the slope criteria to include steeper areas near boat mooring locations where campers typically establish their kitchens. The results show that campsite area decreased over the course of the study period, but at a rate that varied by elevation zone and by survey period. Time-series plots show that from 1998 to 2012, high stage-elevation (greater than the 25,000 ft3/s stage-elevation) campsite area decreased significantly, although there was no significant trend in low stage-elevation (15,000–20,000 ft3/s) campsite area. High stage-elevation campsite area increased after the 2004 and 2008 high flows, but decreased in the intervals between high flows. Although no overall trend was detected for low stage-elevation campsite areas, they did increase after high-volume dam releases equal to or greater than about 20,000 ft3/s. We conclude that dam operations have not met the management objectives of the Glen Canyon Adaptive Management program to increase the size of camping beaches in critical and non-critical reaches of the Colorado River between Glen Canyon Dam and Lake Mead.

  1. Relationship between body condition of American alligators and water depth in the Everglades, Florida

    USGS Publications Warehouse

    Fujisaki, Ikuko; Rice, Kenneth G.; Pearlstine, Leonard G.; Mazzotti, Frank J.


    Feeding opportunities of American alligators (Alligator mississippiensis) in freshwater wetlands in south Florida are closely linked to hydrologic conditions. In the Everglades, seasonally and annually fluctuating surface water levels affect populations of aquatic organisms that alligators consume. Since prey becomes more concentrated when water depth decreases, we hypothesized an inverse relationship between body condition and water depth in the Everglades. On average, condition of adult alligators in the dry season was significantly higher than in the wet season, but this was not the case for juveniles/subadults. The correlation between body condition and measured water depth at capture locations was weak; however, there was a significant negative correlation between the condition and predicted water depth prior to capture for all animals except for spring juveniles/subadults which had a weak positive condition-water depth relationship. Overall, a relatively strong inverse correlation occurred at 10-49 days prior to the capture day, suggesting that current body condition of alligators may depend on feeding opportunities during that period. Fitted regression of body condition on water depth (mean depth of 10 days when condition-water depth correlation was greatest) resulted in a significantly negative slope, except for spring adult females and spring juveniles/subadults for which slopes were not significantly different from zero. Our results imply that water management practices may be critical for alligators in the Everglades since water depth can affect animal condition in a relatively short period of time.

  2. Detection of West Nile virus RNA in mosquitoes and identification of mosquito blood meals collected at alligator farms in Louisiana.


    Unlu, Isik; Kramer, Wayne L; Roy, Alma F; Foil, Lane D


    Since 2001, alligator farms in the United States have sustained substantial economic losses because of West Nile virus (WNV) outbreaks in American alligators (Alligator mississippiensis). Once an initial infection is introduced into captive alligators, WNV can spread among animals by contaminative transmission. Some outbreaks have been linked to feeding on infected meat or the introduction of infected hatchlings, but the initial source of WNV infection has been uncertain in other outbreaks. We conducted a study to identify species composition and presence of WNV in mosquito populations associated with alligator farms in Louisiana. A second objective of this study was to identify the origin of mosquito blood meals collected at commercial alligator farms. Mosquitoes were collected from 2004 to 2006, using Centers for Disease Control light traps, gravid traps, backpack aspirators, and resting boxes. We collected a total of 58,975 mosquitoes representing 24 species. WNV was detected in 41 pools of females from 11 mosquito species: Anopheles crucians, Anopheles quadrimaculatus, Coquillettidia perturbans, Culex coronator, Culex erraticus, Culex nigripalpus, Culex quinquefasciatus, Mansonia titillans, Aedes sollicitans, Psorophora columbiae, and Uranotaenia lowii. The blood meal origins of 213 field-collected mosquitoes were identified based on cytochrome B sequence identity. Alligator blood was detected in 21 mosquitoes representing six species of mosquitoes, including Cx. quinquefasciatus and Cx. nigripalpus. Our results showed that mosquitoes of species that are known to be competent vectors of WNV fed regularly on captive alligators. Therefore, mosquitoes probably are important in the role of transmission of WNV at alligator farms.

  3. Use of alligator hole abundance and occupancy rate as indicators for restoration of a human-altered wetland

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, Frank J.; Hart, Kristen M.; Rice, Kenneth G.; Ogurcak, Danielle; Rochford, Michael; Jeffery, Brian M.; Brandt, Laura A.; Cherkiss, Michael S.


    Use of indicator species as a measure of ecosystem conditions is an established science application in environmental management. Because of its role in shaping wetland systems, the American alligator (Alligator mississippiensis) is one of the ecological indicators for wetland restoration in south Florida, USA. We conducted landscape-level aerial surveys of alligator holes in two different habitats in a wetland where anthropogenic modification of surface hydrology has altered the natural system. Alligator holes were scarcer in an area where modified hydrology caused draining and frequent dry-downs compared to another area that maintains a functional wetland system. Lower abundance of alligator holes indicates lack of alligator activities, lower overall species diversity, and lack of dry-season aquatic refugia for other organisms. The occupancy rate of alligator holes was lower than the current restoration target for the Everglades, and was variable by size class with large size-class alligators predominantly occupying alligator holes. This may indicate unequal size-class distribution, different habitat selection by size classes, or possibly a lack of recruitment. Our study provides pre-restoration baseline information about one indicator species for the Everglades. Success of the restoration can be assessed via effective synthesis of information derived by collective research efforts on the entire suite of selected ecological indicators.


    SciTech Connect

    Dewberry, R; Saleem Salaymeh, S


    In this paper we describe use of the Aquila active well neutron coincidence counter for nuclear material assays of {sup 235}U in multiple analytical techniques at Savannah River Site (SRS), at the Savannah River National Laboratory (SRNL), and at Argonne West National Laboratory (AWNL). The uses include as a portable passive neutron counter for field measurements searching for evidence of {sup 252}Cf deposits and storage; as a portable active neutron counter using an external activation source for field measurements searching for trace {sup 235}U deposits and holdup; for verification measurements of U-Al reactor fuel elements; for verification measurements of uranium metal; and for verification measurements of process waste of impure uranium in a challenging cement matrix. The wide variety of uses described demonstrate utility of the technique for neutron coincidence verification measurements over the dynamic ranges of 100 g-5000 g for U metal, 200 g-1300 g for U-Al, and 8 g-35 g for process waste. In addition to demonstrating use of the instrument in both the passive and active modes, we also demonstrate its use in both the fast and thermal neutron modes.

  5. Fishes of the Missouri national recreational river, South Dakota and Nebraska

    USGS Publications Warehouse

    Berry, C.R.; Young, B.


    Two sections of the Missouri River, one extending 94 km downstream from Gavins Point Dam, and the other extending 62 km downstream from Fort Randall Dam, are legally designated as National Recreational Rivers. An ichthyofaunal list and fish habitat data were needed for conservation planning by states and federal agencies (e.g., National Park Service). We collected fish during three summers from four macrohabitats, using five fish collection techniques, and measured fish habitat characteristics. Temperature, conductivity, and turbidity varied little, but substrate, depth, and velocity differed among macrohabitats (e.g., depth and velocity in the channel exceeded those elsewhere; sand dominated the substrate except in silt-laden tributary mouths and backwaters). We collected 21,699 fish of 53 species and combined our survey with others to compile a list of 92 species. Common recreational species included walleye (Sander vitreum) and catfishes (Ictaluridae). Twenty nonnative species were present. Seventy-two native species have persisted, but the pallid sturgeon (Scaphirhynchus albus) is endangered and a few other species (e.g., native minnows) may be in decline.

  6. Water quality analysis of River Yamuna using water quality index in the national capital territory, India (2000-2009)

    NASA Astrophysics Data System (ADS)

    Sharma, Deepshikha; Kansal, Arun


    River Yamuna, in the national capital territory (NCT), commonly called Delhi (India), has been subjected to immense degradation and pollution due to the huge amount of domestic wastewater entering the river. Despite the persistent efforts in the form of the Yamuna Action Plan phase I and II (YAP) (since 1993 to date), the river quality in NCT has not improved. The restoration of river water quality has been a major challenge to the environmental managers. In the present paper, water quality index (WQI) was estimated for the River Yamuna within the NCT to study the aftereffects of the projects implemented during YAP I and II. The study was directed toward the use of WQI to describe the level of pollution in the river for a period of 10 years (2000-2009). The study also identifies the critical pollutants affecting the river water quality during its course through the city. The indices have been computed for pre-monsoon, monsoon and post-monsoon season at four locations, namely Palla, ODRB, Nizamuddin and Okhla in the river. It was found that the water quality ranged from good to marginal category at Palla and fell under poor category at all other locations. BOD, DO, total and fecal coliforms and free ammonia were found to be critical parameters for the stretch.

  7. Attitudes of stakeholders towards the Podyji/Thaya River Basin National Park in the Czech Republic.


    Cihar, Martin; Stankova, Jindriska


    In August 2000, a survey of public opinion was carried out among visitors, local residents and representatives of local self-governments in the territory of the Podyji/Thaya River Basin National Park in the Czech Republic. The goal was to obtain stakeholders' opinions and attitudes towards nature conservation, the National Park and tourism within the territory which used to be closed to the public for 40 years due to the Iron Curtain. Without the knowledge of opinions of stakeholders it is not possible to manage nature conservation and development in the protected area properly. Using the method of direct interviews, 646 questionnaires where collected, of which 523 were from visitors and tourists, 115 from local residents and 8 from mayors of towns/villages. The questionnaires were analysed in order to detect differences in attitudes among the respondent groups in the following thematic areas: (a) the National Park, its environment and perception of it by respondents; (b) relationship of respondents to the territory; (c) tourism and attitudes towards recreational activities; (d) the Administration of the National Park and evaluation of its work; and (e) economic impact of tourism for local communities. One section of the study focused on comparing the attitudes between local inhabitants and mayors and the other section presents a collation of opinions from locals, mayors and tourists. Although a positive evaluation of the national park dominated the results, some negative attitudes and experiences were identified among locals. In addition, the situation also differed within communities. Results also indicated a relatively strong relationship to the territory by locals, but low job opportunities and income from tourism. The level of tourism intensity was perceived as an increasing and sometimes disturbing factor for local communities; motoring was observed as being the most negative activity for nature. The Administration of the Podyji/Thaya River Basin National

  8. Attitudes of stakeholders towards the Podyji/Thaya River Basin National Park in the Czech Republic.


    Cihar, Martin; Stankova, Jindriska


    In August 2000, a survey of public opinion was carried out among visitors, local residents and representatives of local self-governments in the territory of the Podyji/Thaya River Basin National Park in the Czech Republic. The goal was to obtain stakeholders' opinions and attitudes towards nature conservation, the National Park and tourism within the territory which used to be closed to the public for 40 years due to the Iron Curtain. Without the knowledge of opinions of stakeholders it is not possible to manage nature conservation and development in the protected area properly. Using the method of direct interviews, 646 questionnaires where collected, of which 523 were from visitors and tourists, 115 from local residents and 8 from mayors of towns/villages. The questionnaires were analysed in order to detect differences in attitudes among the respondent groups in the following thematic areas: (a) the National Park, its environment and perception of it by respondents; (b) relationship of respondents to the territory; (c) tourism and attitudes towards recreational activities; (d) the Administration of the National Park and evaluation of its work; and (e) economic impact of tourism for local communities. One section of the study focused on comparing the attitudes between local inhabitants and mayors and the other section presents a collation of opinions from locals, mayors and tourists. Although a positive evaluation of the national park dominated the results, some negative attitudes and experiences were identified among locals. In addition, the situation also differed within communities. Results also indicated a relatively strong relationship to the territory by locals, but low job opportunities and income from tourism. The level of tourism intensity was perceived as an increasing and sometimes disturbing factor for local communities; motoring was observed as being the most negative activity for nature. The Administration of the Podyji/Thaya River Basin National

  9. Isolation and characterization of sulfite oxidase from Alligator mississipiensis

    SciTech Connect

    Robbins, A.; Neame, P.J.; Barber, M.J. )


    Sulfite oxidase has been isolated from fresh alligator liver using ammonium sulfate and acetone fractionation, DEAE chromatography and FPLC on Mono Q. The enzyme is dimeric and exhibits a subunit M. Wt. of approximately 58 kDa, larger than that of chicken SO. EPR spectroscopy of the partially-reduced enzyme revealed a single Mo(V) species while visible spectroscopy revealed the presence of cytochrome b{sub 557}. Maximal activities were obtained at pH 8 and 9, respectively. K{sub m}'s for SO{sub 3}{sup 2 {minus}}, cyt. c and Fe(CN){sub 6}{sup 3 {minus}} were 23.5 uM, 2.9 uM and 8.0 uM, respectively. Sequencing of peptides obtained by endoprotease K digestion indicated regions of extensive sequence similarity to chicken and rat enzymes in both heme and Mo-pterin domains. Regions of sequence dissimilarity were also found.

  10. Glacial history and runoff components of the Tlikakila River Basin, Lake Clark National Park and Preserve, Alaska

    USGS Publications Warehouse

    Brabets, Timothy P.; March, Rod S.; Trabant, Dennis C.


    The Tlikakila River is located in Lake Clark National Park and Preserve and drains an area of 1,610 square kilometers (622 square miles). Runoff from the Tlikakila River Basin accounts for about one half of the total inflow to Lake Clark. Glaciers occupy about one third of the basin and affect the runoff characteristics of the Tlikakila River. As part of a cooperative study with the National Park Service, glacier changes and runoff characteristics in the Tlikakila River Basin were studied in water years 2001 and 2002. Based on analyses of remote sensing data and on airborne laser profiling, most glaciers in the Tlikakila River Basin have retreated and thinned from 1957 to the present. Volume loss from 1957-2001 from the Tanaina Glacier, the largest glacier in the Tlikakila River Basin, was estimated to be 6.1 x 109 cubic meters or 1.4 x 108 cubic meters per year. For the 2001 water year, mass balance measurements made on the three largest glaciers in the Tlikakila River BasinTanaina, Glacier Fork, and North Forkall indicate a negative mass balance. Runoff measured near the mouth of the Tlikakila River for water year 2001 was 1.70 meters. Of this total, 0.18 meters (11 percent) was from glacier ice melt, 1.27 meters (75 percent) was from snowmelt, 0.24 meters (14 percent) was from rainfall runoff, and 0.01 meters (1 percent) was from ground water. Although ground water is a small component of runoff, it provides a critical source of warm water for fish survival in the lower reaches of the Tlikakila River.

  11. A Chinese alligator in heliox: formant frequencies in a crocodilian

    PubMed Central

    Reber, Stephan A.; Nishimura, Takeshi; Janisch, Judith; Robertson, Mark; Fitch, W. Tecumseh


    ABSTRACT Crocodilians are among the most vocal non-avian reptiles. Adults of both sexes produce loud vocalizations known as ‘bellows’ year round, with the highest rate during the mating season. Although the specific function of these vocalizations remains unclear, they may advertise the caller's body size, because relative size differences strongly affect courtship and territorial behaviour in crocodilians. In mammals and birds, a common mechanism for producing honest acoustic signals of body size is via formant frequencies (vocal tract resonances). To our knowledge, formants have to date never been documented in any non-avian reptile, and formants do not seem to play a role in the vocalizations of anurans. We tested for formants in crocodilian vocalizations by using playbacks to induce a female Chinese alligator (Alligator sinensis) to bellow in an airtight chamber. During vocalizations, the animal inhaled either normal air or a helium/oxygen mixture (heliox) in which the velocity of sound is increased. Although heliox allows normal respiration, it alters the formant distribution of the sound spectrum. An acoustic analysis of the calls showed that the source signal components remained constant under both conditions, but an upward shift of high-energy frequency bands was observed in heliox. We conclude that these frequency bands represent formants. We suggest that crocodilian vocalizations could thus provide an acoustic indication of body size via formants. Because birds and crocodilians share a common ancestor with all dinosaurs, a better understanding of their vocal production systems may also provide insight into the communication of extinct Archosaurians. PMID:26246611

  12. A Chinese alligator in heliox: formant frequencies in a crocodilian.


    Reber, Stephan A; Nishimura, Takeshi; Janisch, Judith; Robertson, Mark; Fitch, W Tecumseh


    Crocodilians are among the most vocal non-avian reptiles. Adults of both sexes produce loud vocalizations known as 'bellows' year round, with the highest rate during the mating season. Although the specific function of these vocalizations remains unclear, they may advertise the caller's body size, because relative size differences strongly affect courtship and territorial behaviour in crocodilians. In mammals and birds, a common mechanism for producing honest acoustic signals of body size is via formant frequencies (vocal tract resonances). To our knowledge, formants have to date never been documented in any non-avian reptile, and formants do not seem to play a role in the vocalizations of anurans. We tested for formants in crocodilian vocalizations by using playbacks to induce a female Chinese alligator (Alligator sinensis) to bellow in an airtight chamber. During vocalizations, the animal inhaled either normal air or a helium/oxygen mixture (heliox) in which the velocity of sound is increased. Although heliox allows normal respiration, it alters the formant distribution of the sound spectrum. An acoustic analysis of the calls showed that the source signal components remained constant under both conditions, but an upward shift of high-energy frequency bands was observed in heliox. We conclude that these frequency bands represent formants. We suggest that crocodilian vocalizations could thus provide an acoustic indication of body size via formants. Because birds and crocodilians share a common ancestor with all dinosaurs, a better understanding of their vocal production systems may also provide insight into the communication of extinct Archosaurians. PMID:26246611

  13. Post-hatching development of Alligator mississippiensis ovary and testis

    PubMed Central

    Moore, Brandon C.; Hamlin, Heather J.; Botteri, Nicole L.; Lawler, Ashley N.; Mathavan, Ketan K.; Guillette, Louis J.


    We investigated ovary and testis development of Alligator mississippiensis during the first five months post-hatch. To better describe follicle assembly and seminiferous cord development, we employed histochemical techniques to detect carbohydrate-rich extracellular matrix components in one-week, one-month, three-month, and five-month-old gonads. We found profound morphological changes in both ovary and testis. During this time, oogenesis progressed up to diplotene arrest and meiotic germ cells increasingly interacted with follicular cells. Concomitant with follicles becoming invested with full complements of granulosa cells, a periodic acid Schiff’s (PAS)-positive basement membrane formed. As follicles enlarged and thecal layers were observed, basement membranes and thecal compartments gained periodic acid-methionine silver (PAMS)-reactive fibers. The ovarian medulla increased first PAS- and then PAMS-reactivity as it fragmented into wide lacunae lined with low cuboidal to squamous epithelia. During this same period, testicular germ cells found along the tubule margins were observed progressing from spermatogonia to round spermatids located within the center of tubules. Accompanying this meiotic development, interstitial Leydig cell clusters become more visible and testicular capsules thickened. During the observed testis development, the thickening tunica albuginea and widening interstitial tissues showed increasing PAS- and PAMS-reactivity. We observed putative inter-sex structures in both ovary and testis. On the coelomic aspect of testes were cell clusters with germ cell morphology and at the posterior end of ovaries, we observed “medullary rests” resembling immature testis cords. We hypothesize laboratory conditions accelerated gonad maturation due to optimum conditions, including nutrients and temperature. Laboratory alligators grew more rapidly and with increased body conditions compared to previous measured, field-caught animals. Additionally, we

  14. Flood discharges and hydraulics near the mouths of Wolf Creek, Craig Branch, Manns Creek, Dunloup Creek, and Mill Creek in the New River Gorge National River, West Virginia

    USGS Publications Warehouse

    Wiley, J.B.


    The U.S. Geological Survey, in cooperation with the National Park Service, studied the frequency and magnitude of flooding near the mouths of five tributaries to the New River in the New River Gorge National River. The 100-year peak discharge at each tributary was determined from regional frequency equations. The 100-year discharge at Wolf Creek, Craig Branch, Manns Creek, Dunloup Creek, and Mill Creek was 3,400 cubic feet per second, 640 cubic feet per second, 8,200 cubic feet per second, 7,100 cubic feet per second, and 9,400 cubic feet per second, respectively. Flood elevations for each tributary were determined by application of a steady-state, one-dimensional flow model. Manning's roughness coefficients for the stream channels ranged from 0.040 to 0.100. Bridges that would be unable to contain the 100-year flood within the bridge opening included: the State Highway 82 bridge on Wolf Creek, the second Fayette County Highway 25 bridge upstream from the confluence with New River on Dunloup Creek, and an abandoned log bridge on Mill Creek.

  15. Thermal acclimation, mitochondrial capacities and organ metabolic profiles in a reptile (Alligator mississippiensis).


    Guderley, Helga; Seebacher, Frank


    Reptiles thermoregulate behaviourally, but change their preferred temperature and the optimal temperature for performance seasonally. We evaluated whether the digestive and locomotor systems of the alligator show parallel metabolic adjustments during thermal acclimation. To this end, we allowed juvenile alligators to grow under thermal conditions typical of winter and summer, providing them with seasonally appropriate basking opportunities. Although mean body temperatures of alligators in these groups differed by approximately 10°C, their growth and final anatomic status was equivalent. While hepatic mitochondria isolated from cold-acclimated alligators had higher oxidative capacities at 30°C than those from warm-acclimated alligators, the capacities did not differ at 20°C. Cold acclimation decreased maximal oxidative capacities of muscle mitochondria. For mitochondria from both organs and acclimation groups, palmitate increased oligomycin-inhibited respiration. GDP addition reduced palmitate-uncoupled rates more in liver mitochondria from warm- than cold-acclimated alligators. In muscle mitochondria, carboxyatractyloside significantly reduced palmitate-uncoupled rates. This effect was not changed by thermal acclimation. The aerobic capacity of liver, skeletal muscle and duodenum, as estimated by activities of cytochrome c oxidase (COX), increased with cold acclimation. At acclimation temperatures, the activities of COX and citrate synthase (CS) in these organs were equivalent. By measuring COX and CS in isolated mitochondria and tissue extracts, we estimated that cold acclimation did not change the mitochondrial content in liver, but increased that of muscle. The thermal compensation of growth rates and of the aerobic capacity of the locomotor and digestive systems suggests that alligators optimised metabolic processes for the seasonally altered, preferred body temperature. The precision of this compensatory response exceeds that typically shown by aquatic

  16. Microhabitat use, home range, and movements of the alligator snapping turtle, Macrochelys temminckii, in Oklahoma

    USGS Publications Warehouse

    Riedle, J.D.; Shipman, P.A.; Fox, S. F.; Leslie, David M.


    Little is known about the ecology of the alligator snapping turtle, Macrochelys temminckii, particularly dentography and behavior. To learn more about the species in Oklahoma, we conducted a telemetry project on 2 small streams at Sequoyah National Wildlife Refuge, an 8,417.5-ha refuge located in east-central Oklahoma. Between June 1999 and August 2000, we fitted 19 M. temminckii with ultrasonic telemetry tags and studied turtle movements and microhahitat use. Turtles were checked 2 to 3 times weekly in summer and sporadically in winter. Several microhabitat variables were measured at each turtle location and a random location to help quantify microhabitat use vs. availability. We recorded 147 turtle locations. Turtles were always associated with submerged cover with a high percentage of overhead canopy cover. Turtles used deeper depths in late summer (but not deeper depths than random locations) and deeper depths in mid-winter (and deeper depths than random locations) than in early summer. They used shallower depths than random locations in early summer. This seasonal shift in depth use might be thermoregulatory, although evidence for this is indirect. The mean linear home range for all turtles was 777.8 m. Females had larger home ranges than males, and juveniles had larger home ranges than adults, although the latter was not statistically significant. Macrochelys temminckii used submerged structures as a core site, and stayed at each core site for an average of 12.3 d.

  17. The Savannah River National Laboratory's Response to the Graniteville, SC Train Accident

    SciTech Connect

    Hunter, C. H.; Parker, M. J.; Buckley, R. L.; Weber, A. H.; Addis, R. P.


    The Savannah River National Laboratory's (SRNL) Weather INformation and Display (WIND) System was used to provide meteorological and atmospheric modeling/consequence assessment support to state and local agencies following the collision of two Norfolk Southern freight trains on the morning of January 6, 2005. This collision resulted in the release of several toxic chemicals to the environment, including chlorine. The dense and highly toxic cloud of chlorine gas that formed in the vicinity of the accident was responsible for nine fatalities and injuries to more than five hundred others. Transport model results depicting the forecast path of the ongoing release were made available to emergency managers in the county's Unified Command Center shortly after SRNL received a request for assistance. Support continued over the ensuing two days of the active response. The SRNL also provided weather briefings and transport/consequence assessment model results to responders from South Carolina Department of Health and Environmental control (SCDHEC), the Savannah River Site's (SRS) Emergency Operations Center (EOC), DOE Headquarters, and hazmat teams dispatched from the SRS.

  18. Occurrence of Escherichia coli in the Cuyahoga River in the Cuyahoga Valley National Park, Ohio

    USGS Publications Warehouse

    Brady, Amie M.G.; Plona, Meg B.


    There are several measures of the 'cleanliness' of a natural body of water, including concentrations of indicator bacteria, anthropogenic chemicals (chemicals derived from human activities), and nutrients, such as nitrogen and phosphorous. Escherichia coli (E. coli) is a bacterium that lives in the intestinal tract of warm-blooded animals, such as humans, deer, cows, and dogs. Most strains of E. coli are not harmful and are in fact beneficial to humans by aiding in the digestive process. A few strains, such as the O157 strain, produce toxins that can cause gastrointestinal illness, but occurrence of toxic strains in the environment is not common. E. coli is considered a good indicator bacterium because its occurrence in the environment indicates the presence of fecal contamination and therefore the possible presence of pathogenic organisms associated with feces. The U.S. Environmental Protection Agency (USEPA) recommends using measurements of E. coli to monitor freshwaters and set criteria for the concentration of bacteria that can be present in the water with minimal adverse human-health effects. Typically, a State's waters are assigned a recreational-use designation, such as bathing, primary-contact, or secondary contact waters, which is used to set the State's water-quality standards based on the USEPA criteria. The Cuyahoga River in the Cuyahoga Valley National Park is designated for primary-contact recreation; therefore, when concentrations of E. coli exceed 298 CFU/100mL, the river would be considered potentially unsafe for recreation.

  19. Regional patterns of total nitrogen concentrations in the National Rivers and Streams Assessment

    USGS Publications Warehouse

    Omernik, James M.; Paulsen, Steven G.; Griffith, Glenn E.; Weber, Marc H.


    Patterns of nitrogen (N) concentrations in streams sampled by the National Rivers and Streams Assessment (NRSA) were examined semiquantitatively to identify regional differences in stream N levels. The data were categorized and analyzed by watershed size classes to reveal patterns of the concentrations that are consistent with the spatial homogeneity in natural and anthropogenic characteristics associated with regional differences in N levels. Ecoregions and mapped information on human activities including agricultural practices were used to determine the resultant regions. Marked differences in N levels were found among the nine aggregations of ecoregions used to report the results of the NRSA. We identified distinct regional patterns of stream N concentrations within the reporting regions that are associated with the characteristics of specific Level III ecoregions, groups of Level III ecoregions, groups of Level IV ecoregions, certain geographic characteristics within ecoregions, and/or particular watershed size classes. We described each of these regions and illustrated their areal extent and median and range in N concentrations. Understanding the spatial variability of nutrient concentrations in flowing waters and the apparent contributions that human and nonhuman factors have on different sizes of streams and rivers is critical to the development of effective water quality assessment and management plans. This semi-quantitative analysis is also intended to identify areas within which more detailed quantitative work can be conducted to determine specific regional factors associated with variations in stream N concentrations.

  20. Water chemistry and electrical conductivity database for rivers in Yellowstone National Park, Wyoming

    USGS Publications Warehouse

    Clor, Laura E.; McCleskey, R. Blaine; Huebner, Mark A.; Lowenstern, Jacob B.; Heasler, Henry P.; Mahony, Dan L.; Maloney, Tim; Evans, William C.


    This study aims to quantify relations between solute concentrations (especially chloride) and electrical conductivity for several rivers in Yellowstone National Park (YNP), by using automated samplers and conductivity meters. Norton and Friedman (1985) found that chloride concentrations and electrical conductivity have a good correlation in the Falls, Snake, Madison, and Yellowstone Rivers. However, their results are based on limited sampling and hydrologic conditions and their relation with other solutes was not determined. Once the correlations are established, conductivity measurements can then be used as a proxy for chloride concentrations, thereby enabling continuous heat-flow estimation on a much finer timescale and at lower cost than is currently possible with direct sampling. This publication serves as a repository for all data collected during the course of the study from May 2010 through July 2011, but it does not include correlations between solutes and conductivity or recommendations for quantification of chloride through continuous electrical conductivity measurements. This will be the object of a future document.

  1. Tropospheric ozone in the Nisqually River Drainage, Mount Rainier National Park

    USGS Publications Warehouse

    Peterson, D.L.; Bowers, Darci


    We quantified the summertime distribution of tropospheric ozone in the topographically complex Nisqually River drainage of Mount Rainier National Park from 1994 to 1997. Passive ozone samplers were used along an elevational transect to measure weekly average ozone concentrations ranging from 570 m to 2040 m elevation. Weekly average ozone concentrations were positively correlated with elevation, with the highest concentrations consistently measured at the highest sampling site (Panorama Point). Weekly average ozone concentrations at Mount Rainier National Park are considerably higher than those in the Seattle-Tacoma metropolitan area to the west. The anthropogenic contribution to ozone within the Nisqually drainage was evaluated by comparing measurements at this location with measurements from a 'reference' site in the western Olympic Mountains. The comparison suggests there is a significant anthropogenic source of ozone reaching the Cascade Range via atmospheric transport from urban areas to the west. In addition. temporal (week to week) variation in ozone distribution is synchronous within the Nisqually drainage, which indicates that subregional patterns are detectable with weekly averages. The Nisqually drainage is likely the 'hot spot' for air pollution in Mount Rainier National Park. By using passive ozone samplers in this drainage in conjunction with a limited number of continuous analyzers, the park will have a robust monitoring approach for measuring tropospheric ozone over time and protecting vegetative and human health.

  2. Hydrogeomorphic and hydraulic habitats of the Niobrara River, Nebraska-with special emphasis on the Niobrara National Scenic River

    USGS Publications Warehouse

    Alexander, Jason S.; Zelt, Ronald B.; Schaepe, Nathan J.


    The Niobrara River is an ecologically and economically important resource in Nebraska. The Nebraska Department of Natural Resources' recent designation of the hydraulically connected surface- and groundwater resources of the Niobrara River Basin as ?fully appropriated? has emphasized the importance of understanding linkages between the physical and ecological dynamics of the Niobrara River so it can be sustainably managed. In cooperation with the Nebraska Game and Parks Commission, the U.S. Geological Survey investigated the hydrogeomorphic and hydraulic attributes of the Niobrara River in northern Nebraska. This report presents the results of an analysis of hydrogeomorphic segments and hydraulic microhabitats of the Niobrara River and its valley for the approximately 330-mile reach from Dunlap Diversion Dam to its confluence with the Missouri River. Two spatial scales were used to examine and quantify the hydrogeomorphic segments and hydraulic microhabitats of the Niobrara River: a basin scale and a reach scale. At the basin scale, digital spatial data and hydrologic data were analyzed to (1) test for differences between 36 previously determined longitudinal hydrogeomorphic segments; (2) quantitatively describe the hydrogeomorphic characteristics of the river and its valley; and (3) evaluate differences in hydraulic microhabitat over a range of flow regimes among three fluvial geomorphic provinces. The statistical analysis of hydrogeomorphic segments resulted in reclassification rates of 3 to 28 percent of the segments for the four descriptive geomorphic elements. The reassignment of classes by discriminant analysis resulted in a reduction from 36 to 25 total hydrogeomorphic segments because several adjoining segments shared the same ultimate class assignments. Virtually all of the segment mergers were in the Canyons and Restricted Bottoms (CRB) fluvial geomorphic province. The most frequent classes among hydrogeomorphic segments, and the dominant classes per unit

  3. Baseline water-quality characteristics of the Alaska Army National Guard Stewart River Training Area near Nome, Alaska

    USGS Publications Warehouse

    Eash, Josh D.


    The Alaska Army National Guard Stewart River Training Area is approximately 23 miles north of Nome on the Seward Peninsula in northwest Alaska. The Stewart River Training Area encompasses much of the Stewart River Basin and a small part of the Snake River Basin. Hydrologic, water-quality, and physical-habitat data were collected at seven surface-water sites within the Stewart River Training Area during the summer runoff months (late-May to early-September) in 2004. Two of the sampling sites selected for this study were on the main stem Stewart River, one at the upstream boundary and one at the downstream boundary of the training area. Continuous hydrologic, precipitation, and water temperature data were collected at these two sites throughout the summer of 2004. Three pond sites, along the upper, middle, and lower reaches of the Stewart River within the training area, were each sampled twice during the summer of 2004 for analysis of water-quality constituents. Two tributaries to the Snake River Basin, Goldbottom Creek and North Fork Snake River, within the Stewart River Training Area boundary, also were sampled twice during the summer of 2004. Water-quality data collected from the Stewart River at the upstream and downstream study sites indicate similar constituent concentrations. Concentrations of most water-quality constituents collected during the summer of 2004 did not exceed standards for drinking water or recreational contact. Analysis of trace-element concentrations in bed sediment samples indicate the threshold effect concentration (below which no adverse effects on organisms is expected) was exceeded for arsenic, chromium, and nickel concentrations at all sample sites within the Stewart River Training Area and cadmium, copper, zinc, and lead concentrations were found to exceed the threshold effect concentration in varying degrees at the sample sites. The probable effect concentration (above which toxic effects on organisms is likely) was exceeded by

  4. Terrestrial arthropods of Steel Creek, Buffalo National River, Arkansas. IV. Asilidae and other Diptera

    PubMed Central

    Barnes, Jeffrey K.; Fisher, Danielle M.; Dowling, Ashley P. G.


    Abstract Background This is the fourth in a series of papers detailing the terrestrial arthropods collected during an intensive survey of a site near Steel Creek campground along the Buffalo National River in Arkansas. The survey was conducted over a period of eight and a half months in 2013 using twelve trap types, including Malaise and canopy traps, Lindgren multifunnel traps, and pan traps. New information We provide collection records for 38 species of Asilidae and other Diptera, 7 of which are new state records for Arkansas: (Asilidae) Lasiopogon opaculus Loew, 1874; (Lygistorrhinidae) Lygistorrhina sancthecatharinae Thompson, 1975; (Stratiomyidae) Cephalochrysa nigricornis (Loew, 1866), Gowdeyana punctifera (Malloch, 1915), Sargus decorus Say, 1824; (Ulidiidae) Callopistromyia annulipes Macquart, 1855; and (Xylophagidae) Rachicerus obscuripennis Loew, 1863.

  5. Visitor survey results for the Souris River Loop National Wildlife Refuges: Completion report

    USGS Publications Warehouse

    Sexton, Natalie R.; Koontz, Lynne; Stewart, Susan C.


    In support of the CCP planning effort for the Souris River Loop Refuges, the Policy Analysis and Science Assistance Branch/Fort Collins Science Center (PASA) of the U.S. Geological Survey conducted visitor surveys at three refuges in North Dakota: Des Lacs, J. Clark Salyer, and Upper Souris National Wildlife Refuges. This research was conducted in order to assess visitor experience, perceptions, and preferences and visitor spending related to recreation on these public lands. This baseline information and input is needed by the refuges to inform their CCP process. Specifically, this survey research assesses the characteristics of visitors and their trips, the activities in which visitors engage while on the refuge, details regarding their trip experience, as well as their preferences and attitudes about various management features, including existing and future conditions. 

  6. Arthropods of Steel Creek, Buffalo National River, Arkansas. III. Heteroptera (Insecta: Hemiptera)

    PubMed Central

    Fisher, Danielle M.; Dowling, Ashley P.G.


    Abstract Background This is the third in a series of papers detailing the terrestrial arthropods collected during an intensive survey of a site near Steel Creek campground along the Buffalo National River in Arkansas. The survey was conducted over a period of eight and a half months using twelve trap types – Malaise traps, canopy traps (upper and lower collector), Lindgren multifunnel traps (black, green, and purple), pan traps (blue, purple, red, white, and yellow), and pitfall traps – and Berlese-Tullgren extraction of leaf litter. New information We provide collection records for 54 species of Heteroptera, 11 of which were new state records for Arkansas: (Aradidae) Aradus approximatus, Aradus duzeei, Aradus ornatus, Neuroctenus elongatus, Neuroctenus pseudonymus, Notapictinus aurivilli; (Cydnidae) Sehirus cinctus; (Lygaeidae) Nysius raphanus; (Miridae) Prepops insitivus; (Reduviidae) Zelus tetracanthus; (Rhyparochromidae) Kolenetrus plenus. PMID:27346950

  7. SAES St 909 Getter Testing at the Savannah River National Laboratory

    SciTech Connect

    Klein, J. E.; Holder, J. E


    Process gas tritium stripper technology has gone from catalytic oxidation followed by absorption on molecular sieve/zeolite beds to non-evaporate metal getter technology. SAES Getters produces a number of commercial getter products including St 909. St 909, a Zr-Mn-Fe alloy, is sold in pellet form, can decompose (''crack'') a number of process gas impurities, and retains lower levels of tritium than other getters. The performance of this material to remove process impurities, especially methane, under of variety of operating conditions has been part of a Savannah River National Laboratory (SRNL) for five years. St 909 has been tested at the bench (6 gram) scale, the pilot (500 gram) scale, and at the full (5300) gram scale under a variety of test conditions. This paper gives a brief summary of test results obtained for the different scale tests.

  8. Terrestrial arthropods of Steel Creek, Buffalo National River, Arkansas. IV. Asilidae and other Diptera

    PubMed Central

    Barnes, Jeffrey K.; Fisher, Danielle M.; Dowling, Ashley P. G.


    Abstract Background This is the fourth in a series of papers detailing the terrestrial arthropods collected during an intensive survey of a site near Steel Creek campground along the Buffalo National River in Arkansas. The survey was conducted over a period of eight and a half months in 2013 using twelve trap types, including Malaise and canopy traps, Lindgren multifunnel traps, and pan traps. New information We provide collection records for 38 species of Asilidae and other Diptera, 7 of which are new state records for Arkansas: (Asilidae) Lasiopogon opaculus Loew, 1874; (Lygistorrhinidae) Lygistorrhina sancthecatharinae Thompson, 1975; (Stratiomyidae) Cephalochrysa nigricornis (Loew, 1866), Gowdeyana punctifera (Malloch, 1915), Sargus decorus Say, 1824; (Ulidiidae) Callopistromyia annulipes Macquart, 1855; and (Xylophagidae) Rachicerus obscuripennis Loew, 1863. PMID:27660536

  9. Source and fate of inorganic solutes in the Gibbon River, Yellowstone National Park, Wyoming, USA. II. Trace element chemistry

    USGS Publications Warehouse

    McCleskey, R. Blaine; Nordstrom, D. Kirk; Susong, David D.; Ball, James W.; Taylor, Howard E.


    The Gibbon River in Yellowstone National Park receives inflows from several geothermal areas, and consequently the concentrations of many trace elements are elevated compared to rivers in non-geothermal watersheds. Water samples and discharge measurements were obtained from the Gibbon River and its major tributaries near Norris Geyser Basin under the low-flow conditions of September 2006 allowing for the identification of solute sources and their downstream fate. Norris Geyser Basin, and in particular Tantalus Creek, is the largest source of many trace elements (Al, As, B, Ba, Br, Cs, Hg, Li, Sb, Tl, W, and REEs) to the Gibbon River. The Chocolate Pots area is a major source of Fe and Mn, and the lower Gibbon River near Terrace Spring is the major source of Be and Mo. Some of the elevated trace elements are aquatic health concerns (As, Sb, and Hg) and knowing their fate is important. Most solutes in the Gibbon River, including As and Sb, behave conservatively or are minimally attenuated over 29 km of fluvial transport. Some small attenuation of Al, Fe, Hg, and REEs occurs but primarily there is a transformation from the dissolved state to suspended particles, with most of these elements still being transported to the Madison River. Dissolved Hg and REEs loads decrease where the particulate Fe increases, suggesting sorption onto suspended particulate material. Attenuation from the water column is substantial for Mn, with little formation of Mn as suspended particulates.

  10. Source and fate of inorganic solutes in the Gibbon River, Yellowstone National Park, Wyoming, USA. II. Trace element chemistry

    NASA Astrophysics Data System (ADS)

    McCleskey, R. Blaine; Nordstrom, D. Kirk; Susong, David D.; Ball, James W.; Taylor, Howard E.

    The Gibbon River in Yellowstone National Park receives inflows from several geothermal areas, and consequently the concentrations of many trace elements are elevated compared to rivers in non-geothermal watersheds. Water samples and discharge measurements were obtained from the Gibbon River and its major tributaries near Norris Geyser Basin under the low-flow conditions of September 2006 allowing for the identification of solute sources and their downstream fate. Norris Geyser Basin, and in particular Tantalus Creek, is the largest source of many trace elements (Al, As, B, Ba, Br, Cs, Hg, Li, Sb, Tl, W, and REEs) to the Gibbon River. The Chocolate Pots area is a major source of Fe and Mn, and the lower Gibbon River near Terrace Spring is the major source of Be and Mo. Some of the elevated trace elements are aquatic health concerns (As, Sb, and Hg) and knowing their fate is important. Most solutes in the Gibbon River, including As and Sb, behave conservatively or are minimally attenuated over 29 km of fluvial transport. Some small attenuation of Al, Fe, Hg, and REEs occurs but primarily there is a transformation from the dissolved state to suspended particles, with most of these elements still being transported to the Madison River. Dissolved Hg and REEs loads decrease where the particulate Fe increases, suggesting sorption onto suspended particulate material. Attenuation from the water column is substantial for Mn, with little formation of Mn as suspended particulates.


    SciTech Connect

    Cordaro, J.; Holland, M.; Reeves, G.; Nichols, S.; Kruzner, A.


    The Savannah River Site (SRS) has the analytical measurement capability to perform high-precision plutonium concentration measurements by controlled-potential coulometry. State-of-the-art controlled-potential coulometers were designed and fabricated by the Savannah River National Laboratory and installed in the Analytical Laboratories process control laboratory. The Analytical Laboratories uses coulometry for routine accountability measurements of and for verification of standard preparations used to calibrate other plutonium measurement systems routinely applied to process control, nuclear safety, and other accountability applications. The SRNL Coulometer has a demonstrated measurement reliability of {approx}0.05% for 10 mg samples. The system has also been applied to the characterization of neptunium standard solutions with a comparable reliability. The SRNL coulometer features: a patented current integration system; continuous electrical calibration versus Faraday's Constants and Ohm's Law; the control-potential adjustment technique for enhanced application of the Nernst Equation; a wide operating room temperature range; and a fully automated instrument control and data acquisition capability. Systems have been supplied to the International Atomic Energy Agency (IAEA), Russia, Japanese Atomic Energy Agency (JAEA) and the New Brunswick Laboratory (NBL). The most recent vintage of electronics was based on early 1990's integrated circuits. Many of the components are no longer available. At the request of the IAEA and the Department of State, SRNL has completed an electronics upgrade of their controlled-potential coulometer design. Three systems have built with the new design, one for the IAEA which was installed at SAL in May 2011, one system for Los Alamos National Laboratory, (LANL) and one for the SRS Analytical Laboratory. The LANL and SRS systems are undergoing startup testing with installation scheduled for this summer.

  12. Geohydrologic reconnaissance of Lake Mead National Recreation Area; Las Vegas Wash to Virgin River, Nevada

    USGS Publications Warehouse

    Laney, R.L.; Bales, J.T.


    This study is the last of a series of eight geohydrologic reconnaissance studies that were done in the Lake Mead National Recreation Area. The studies were done to evaluate the water resources in the recreation area and to identify areas having potential for the development of water supplies that would be adequate for marinas and campgrounds. The study area includes about 250 square miles north of Lake Mead from Las Vegas Wash to the Virgin River (Overton Arm), Nevada. Volcanic rocks, consolidated sedimentary rocks, and unconsolidated to semiconsolidated sedimentary rocks underlie the area. Surface-water sources include the Colorado River, Virgin River, Muddy River, and Las Vegas Wash. Elsewhere in the area, streamflow is meager and extremely variable. Ground water originates from four sources: (1) subsurface flow in local basins, (2) infiltration of water from Lake Mead into permeable rocks near the lake, (3) subsurface flow in valleys of perennial streams, and (4) subsurface flow in consolidated rocks of the Muddy Mountains. The quantity of water from Lake Mead that has saturated rocks adjacent to the lake probably is greater than the quantity of ground water from all the Other sources. Rocks saturated by water from the lake probably extend less than 0.5 mileinland from the lake shore. The quality of virtually all the ground water in the area is not acceptable for drinking purposes. The most favorable areas for obtaining ground water are those underlain by the coarse-grained deposits of the older alluvium and the younger alluvium adjacent to Lake Mead. The least favorable areas are those underlain by the mudstone facies of the Muddy Creek Formation and fine-grained rocks of the Horse Spring Formation. Four areas identified as having potential for ground-water development are (1) near Overton Beach, (2) west of Callville Bay, (3) near Middle Point, and (4) in the lower Moapa Valley. Usable quantities of water probably can be obtained at these sites, but the

  13. A national-scale analysis of the impacts of drought on water quality in UK rivers

    NASA Astrophysics Data System (ADS)

    Coxon, G.; Howden, N. J. K.; Freer, J. E.; Whitehead, P. G.; Bussi, G.


    Impacts of droughts on water quality qre difficult to quanitify but are essential to manage ecosystems and maintain public water supply. During drought, river water quality is significantly changed by increased residence times, reduced dilution and enhanced biogeochemical processes. But, the impact severity varies between catchments and depends on multiple factors including the sensitivity of the river to drought conditions, anthropogenic influences in the catchment and different delivery patterns of key nutrient, contaminant and mineral sources. A key constraint is data availability for key water quality parameters such that impacts of drought periods on certain determinands can be identified. We use national-scale water quality monitoring data to investigate the impacts of drought periods on water quality in the United Kingdom (UK). The UK Water Quality Sampling Harmonised Monitoring Scheme (HMS) dataset consists of >200 UK sites with weekly to monthly sampling of many water quality variables over the past 40 years. This covers several major UK droughts in 1975-1976, 1983-1984,1989-1992, 1995 and 2003, which cover severity, spatial and temporal extent, and how this affects the temporal impact of the drought on water quality. Several key water quality parameters, including water temperature, nitrate, dissolved organic carbon, orthophosphate, chlorophyll and pesticides, are selected from the database. These were chosen based on their availability for many of the sites, high sampling resolution and importance to the drinking water function and ecological status of the river. The water quality time series were then analysed to investigate whether water quality during droughts deviated significantly from non-drought periods and examined how the results varied spatially, for different drought periods and for different water quality parameters. Our results show that there is no simple conclusion as to the effects of drought on water quality in UK rivers; impacts are

  14. 50 CFR 23.70 - How can I trade internationally in American alligator and other crocodilian skins, parts, and...

    Code of Federal Regulations, 2014 CFR


    ... laws regulating harvest seasons and methods. (iii) Total allowable harvest of the species. (iv..., including harvest of nuisance alligators, methods used to determine harvest levels, demographics of the harvest, and methods used to determine the total number and population trends of alligators in the...

  15. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2012 CFR


    ... 33 Navigation and Navigable Waters 3 2012-07-01 2012-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  16. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2011 CFR


    ... 33 Navigation and Navigable Waters 3 2011-07-01 2011-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  17. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2014 CFR


    ... 33 Navigation and Navigable Waters 3 2014-07-01 2014-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  18. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2013 CFR


    ... 33 Navigation and Navigable Waters 3 2013-07-01 2013-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  19. Chronic Ingestion of Coal Fly-Ash Contaminated Prey and Its Effects on Health and Immune Parameters in Juvenile American Alligators (Alligator mississippiensis).


    Finger, John W; Hamilton, Matthew T; Metts, Brian S; Glenn, Travis C; Tuberville, Tracey D


    Coal-burning power plants supply approximately 37 % of the electricity in the United States. However, incomplete combustion produces ash wastes enriched with toxic trace elements that have historically been disposed of in aquatic basins. Organisms inhabiting such habitats may accumulate these trace elements; however, studies investigating the effects on biota have been primarily restricted to shorter-lived, lower-trophic organisms. The American alligator (Alligator mississippiensis), a long-lived, top-trophic carnivore, has been observed inhabiting these basins, yet the health or immune effects of chronic exposure and possible accumulation remains unknown. In this study, we investigated how chronic dietary ingestion of prey contaminated with coal combustion wastes (CCWs) for 25 months, and subsequent accumulation of trace elements present in CCWs, affected juvenile alligator immune function and health. Alligators were assigned to one of four dietary-treatment groups including controls and those fed prey contaminated with CCWs for one, two, or three times a week. However, no effect of Dietary Treatment (p > 0.05) was observed on any immune parameter or hematological or plasma analyte we tested. Our results suggest that neither exposure to nor accumulation of low doses of CCWs had a negative effect on certain aspects of the immune and hematological system. However, future studies are required to elucidate this further. PMID:27475646

  20. Phase I and II liver enzyme activities in juvenile alligators (Alligator mississippiensis) collected from three sites in the Kissimmee-Everglades drainage, Florida (USA).


    Gunderson, M P; Oberdörster, E; Guillette, L J


    We examined CYP1A (measured using hepatic EROD and MROD activities) and glutathione-S-transferase (GST) activities in juvenile alligators (Alligator mississippiensis) collected from three sites with varying contamination in the Kissimmee-Everglades drainage in south Florida. We hypothesized that contaminants present in areas with intermediate or higher contaminant concentrations would alter hepatic enzyme activities in juvenile alligators from those sites when compared to hepatic enzyme activity in animals from the area with the least contamination. EROD activity was found to be higher in animals from the site with lower reported levels of contamination relative to those from the site with the highest reported contamination suggesting an inhibition of CYP1A expression or activity. No differences among animals from the three sites were observed for hepatic MROD and GST activities. A significant negative relationship between EROD, MROD, and GST activities and body size was exhibited in alligators from the site with the lowest contamination. No relationship between body size and hepatic enzyme activity was found in animals from the sites with intermediate and higher contamination, suggesting that contaminants present at these sites act to alter this relationship. No correlation was observed in this study between plasma steroid concentrations (estradiol-17 beta or testosterone) and hepatic EROD, MROD, or GST activities.

  1. Plutonium Surveillance Destructive Examination Requirements at Savannah River National Laboratory for K-Area Interim Surveillance

    SciTech Connect

    Stefek, T. M.


    The DOE 3013 storage standard requires nested, welded 300 series stainless steel containers to store plutonium-bearing materials for up to 50 years. Packaged contents include stabilized plutonium-bearing residues that contain chloride salts and a low (< 0.5 weight %) water content. The DOE 3013 STD requires surveillance of the packages over the 50 year lifetime. These surveillance requirements have been further defined by the Integrated Surveillance Program to include both non-destructive examination (NDE) and destructive examination (DE) of the 3013 container. The DE portion of surveillance involves examining the 3013 nested containers, analyzing the head space gas, and evaluating the plutonium oxide chemistry. At SRS, the stored 3013 containers will undergo preparation for the DE surveillance activities in facilities located in K-Area. The actual DE surveillance will be performed in SRNL. This report provides preliminary functional requirements for the destructive examination (DE) of plutonium-bearing oxide materials and containers in support of K-Area Interim Surveillance (KIS). The KIS project will install interim facilities to prepare the samples for analysis in SRNL. This document covers the requirements for the interim period beginning in 2007, and lasting until the Container Storage and Surveillance Capability (CSSC) project provides the permanent facilities in K-Area to perform sampling and repackaging operations associated with the 3013 container storage and surveillance program. Initial requirements for the CSSC project have been previously defined in WSRC-TR-2004-00584 ''Plutonium Surveillance Destructive Examination Requirements at Savannah River National Laboratory''. As part of the Plutonium Surveillance Program of 3013 Containers at the Savannah River Site (SRS), the Savannah River National Laboratory (SRNL) will receive the emptied 3013 container components, plutonium oxide samples and headspace gas samples from K-Area. The DE program scope

  2. River bed Elevation Changes and Increasing Flood Hazards in the Nisqually River at Mount Rainier National Park, Washington

    NASA Astrophysics Data System (ADS)

    Halmon, S.; Kennard, P.; Beason, S.; Beaulieu, E.; Mitchell, L.


    Mount Rainier, located in Southwestern Washington, is the most heavily glaciated volcano of the Cascade Mountain Range. Due to the large quantities of glaciers, Mount Rainier also has a large number of braided rivers, which are formed by a heavy sediment load being released from the glaciers. As sediment builds in the river, its bed increases, or aggrades,its floodplain changes. Some contributions to a river's increased sediment load are debris flows, erosion, and runoff, which tend to carry trees, boulders, and sediment downstream. Over a period of time, the increased sediment load will result in the river's rise in elevation. The purpose of this study is to monitor aggradation rates, which is an increase in height of the river bed, in one of Mount Rainier's major rivers, the Nisqually. The studied location is near employee offices and visitor attractions in Longmire. The results of this study will also provide support to decision makers regarding geological hazard reduction in the area. The Nisqually glacier is located on the southern side of the volcano, which receives a lot of sunlight, thus releasing large amounts of snowmelt and sediment in the summer. Historical data indicate that several current features which may contribute to future flooding, such as the unnatural uphill slope to the river, which is due to a major depositional event in the late 1700s where 15 ft of material was deposited in this area. Other current features are the glaciers surrounding the Nisqually glacier, such as the Van Trump and Kaultz glaciers that produced large outbursts, affecting the Nisqually River and the Longmire area in 2001, 2003, and 2005. In an effort to further explore these areas, the research team used a surveying device, total station, in the Nisqually River to measure elevation change and angles of various positions within ten cross sections along the Longmire area. This data was then put into GIS for analyzation of its current sediment level and for comparison to

  3. Mercury concentrations in fillets of fish collected in the U.S. EPA National Rivers and Streams Assessment of the continental USA

    EPA Science Inventory

    The National Rivers and Streams Assessment (NRSA) is a statistical survey of flowing waters of the U.S. The purpose of this survey was to assess the condition of the nation's rivers and streams, establish a baseline to evaluate progress of pollution control activities in flowing...

  4. A national statistical survey assessment of mercury concentrations in fillets of fish collected in the U.S. EPA national rivers and streams assessment of the continental USA.


    Wathen, John B; Lazorchak, James M; Olsen, Anthony R; Batt, Angela


    The U.S. EPA conducted a national statistical survey of fish fillet tissue with a sample size of 541 sites on boatable rivers =>5th order in 2008-2009. This is the first such study of mercury (Hg) in fish tissue from river sites focused on potential impacts to human health from fish consumption to also address wildlife impacts. Sample sites were identified as being urban or non-urban. All sample mercury concentrations were above the 3.33ugkg(-1) (ppb) quantitation limit, and an estimated 25.4% (±4.4%) of the 51663 river miles assessed exceeded the U.S. EPA 300ugkg(-1) fish-tissue based water quality criterion for mercury, representing 13144±181.8 river miles. Estimates of river miles exceeding comparable aquatic life thresholds (translated from fillet concentrations to whole fish equivalents) in avian species were similar to the number of river miles exceeding the human health threshold, whereas some mammalian species were more at risk than human from lower mercury concentrations. A comparison of means from the non-urban and urban data and among three ecoregions did not indicate a statistically significant difference in fish tissue Hg concentrations at p<0.05.

  5. 76 FR 77768 - Information Collection; Flathead and McKenzie Rivers and McKenzie National Recreational Trail...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Information Collection; Flathead and McKenzie Rivers and McKenzie National Recreational Trail Visitor Surveys AGENCY: Forest Service, USDA. ACTION: Notice; request for comment. SUMMARY: In accordance with the Paperwork Reduction Act of 1995, the Forest Service is seeking comments from...

  6. Towards national mapping of aquatic condition (II): Predicting the probable biological condition of USA streams and rivers

    EPA Science Inventory

    The US EPA’s National River and Stream Assessment (NRSA) uses spatially balanced sampling to estimate the proportion of streams within the conterminous US (CONUS) that deviate from least-disturbed biological condition (BC). These assessments do not infer BC at un-sampled st...

  7. 75 FR 11511 - Rogue River-Siskiyou National Forest; Mt. Ashland Ski Area Expansion, Jackson County, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Rogue River-Siskiyou National Forest; Mt. Ashland Ski Area Expansion, Jackson County, OR...-03004-PA, to conditionally authorize expansion of the Mt. Ashland Ski Area. SUMMARY: In September 2004, the Forest Service issued a Record of Decision (ROD) for the Mt. Ashland Ski Area (MASA)...

  8. Evaluation of An Alternate Benthic Macroinvertebrate Sampling Method for Low Gradient Streams Sampled in the National Rivers and Streams Assessment

    EPA Science Inventory

    Benthic macroinvertebrates are one of the primary biological indicators of condition used in the U.S. Environmental Protection Agency’s National Rivers and Streams Assessment. Following EPA’s Wadeable Streams Assessment, States recommended that a different yet compara...

  9. Geothermal solute flux monitoring and the source and fate of solutes in the Snake River, Yellowstone National Park, WY

    USGS Publications Warehouse

    McCleskey, R. Blaine; Lowenstern, Jacob B.; Schaper, Jonas; Nordstrom, D Kirk; Heasler, Henry P.; Mahony, Dan


    The combined geothermal discharge from over 10,000 features in Yellowstone National Park (YNP) can be can be estimated from the Cl flux in the Madison, Yellowstone, Falls, and Snake Rivers. Over the last 30 years, the Cl flux in YNP Rivers has been calculated using discharge measurements and Cl concentrations determined in discrete water samples and it has been determined that approximately 12% of the Cl flux exiting YNP is from the Snake River. The relationship between electrical conductivity and concentrations of Cl and other geothermal solutes was quantified at a monitoring site located downstream from the thermal inputs in the Snake River. Beginning in 2012, continuous (15 min) electrical conductivity measurements have been made at the monitoring site. Combining continuous electrical conductivity and discharge data, the Cl and other geothermal solute fluxes were determined. The 2013–2015 Cl fluxes (5.3–5.8 kt/yr) determined using electrical conductivity are comparable to historical data. In addition, synoptic water samples and discharge data were obtained from sites along the Snake River under low-flow conditions of September 2014. The synoptic water study extended 17 km upstream from the monitoring site. Surface inflows were sampled to identify sources and to quantify solute loading. The Lewis River was the primary source of Cl, Na, K, Cl, SiO2, Rb, and As loads (50–80%) in the Snake River. The largest source of SO4 was from the upper Snake River (50%). Most of the Ca and Mg (50–55%) originate from the Snake Hot Springs. Chloride, Ca, Mg, Na, K, SiO2, F, HCO3, SO4, B, Li, Rb, and As behave conservatively in the Snake River, and therefore correlate well with conductivity (R2 ≥ 0.97).

  10. Effects of egg and hatchling harvest on American alligators in Florida

    USGS Publications Warehouse

    Rice, K.G.; Percival, H.F.; Woodward, A.R.; Jennings, Michael L.


    Harvest of crocodilian eggs and young for captive rearing (ranching) has been used worldwide as an option for producing crocodilian skins and meat from wild stock. The long-term effects of harvesting a certain proportion of early age class, wild American alligators (Alligator mississippiensis) without repatriation is unknown. We removed an estimated 50% of annual production of alligators on Lakes Griffin and Jesup in central Florida over an 11-year period and monitored population levels via night-light counts. Densities of the total alligator population increased (P 0.117), and subadult (122-182 cm TL) alligators increased (P < 0.011) on harvest areas. The density of juveniles on the control area increased (P = 0.006), and the density of subadults showed some evidence of increasing (P = 0.088). No changes were detected in size distributions on the treatment areas. Nest production, as observed from aerial helicopter surveys, increased (P < 0.039) on Lake Woodruff NWR and Lake Jesup and showed some evidence of an increase on Lake Griffin (P = 0.098) during 1983-91. A 50% harvest rate of eggs or hatchlings did not adversely affect recruitment into the subadult or adult size classes.

  11. American alligator digestion rate of blue crabs and its implications for stomach contents analysis

    USGS Publications Warehouse

    Nifong, James C.; Rosenblatt, Adam E.; Johnson, Nathan A.; Barichivich, William; Silliman, Brian; Heithaus, Michael R.


    Stomach contents analysis (SCA) provides a snap-shot observation of a consumer's diet. Interpretation of SCA data can be complicated by many factors, including variation in gastric residence times and digestion rates among prey taxa. Although some SCA methods are reported to efficiently remove all stomach contents, the effectiveness of these techniques has rarely been tested for large irregular shaped prey with hard exoskeletons. We used a controlled feeding trial to estimate gastric residency time and decomposition rate of a large crustacean prey item, the Blue Crab (Callinectes sapidus), which is consumed by American Alligators (Alligator mississippiensis), an abundant apex predator in coastal habitats of the southeastern United States. The decomposition rate of C. sapidus in the stomachs of A. mississippiensis followed a predictable pattern, and some crab pieces remained in stomachs for at least 14 days. We also found that certain portions of C. sapidus were prone to becoming caught within the stomach or esophagus, meaning not all crab parts are consistently recovered using gastric lavage techniques. However, because the state of decomposition of crabs was predictable, it is possible to estimate time since consumption for crabs recovered from wild alligators. This information, coupled with a detailed understanding of crab distributions and alligator movement tactics could help elucidate patterns of cross-ecosystem foraging by the American Alligator in coastal habitats

  12. Body temperatures and behavior of American alligators during cold winter weather

    SciTech Connect

    Brisbin, I.L., Jr.; Standora, E.A.; Vargo, M.J.


    Data from two large (188 and 135 kg) male alligators (Alligator mississippiensis) indicated that 4-5 C seemed to be the lowest body temperatures that they could endure with subsequent recovery. Although one animal in shallow water managed to keep a breathing hole open for several days, in ice that was 1.5 cm thick, it later died following a decrease of its body temperature to 4.0 C. The second alligator which was located in a deeper portion of the reservoir used both terrestrial and aquatic basking behavior to raise its body temperature and level of activity. Except in the case of basking events, there was not clear evidence of significant evaluations of the body temperatures of either the live or dead alligators above those of their adjacent water. When located side-by-side, diurnal cycles of deep body temperatures exceeding adjacent water temperatures to a maximum extent near dawn and usually falling below water temperatures during the afternoon and early evening hours. The physical properties and thermal inertia of the bodies of such large alligators, when placed in appropriate microclimates, may be sufficient in themselves to explain the general patterns and levels of body temperature changes observed at these low temperatures.

  13. The effects of hurricane Rita and subsequent drought on alligators in southwest Louisiana.


    Lance, Valentine A; Elsey, Ruth M; Butterstein, George; Trosclair, Phillip L; Merchant, Mark


    Hurricane Rita struck the coast of southwest Louisiana in September 2005. The storm generated an enormous tidal surge of approximately four meters in height that inundated many thousands of acres of the coastal marsh with full strength seawater. The initial surge resulted in the deaths of a number of alligators and severely stressed those who survived. In addition, a prolonged drought (the lowest rainfall in 111 years of recorded weather data) following the hurricane resulted in highly saline conditions that persisted in the marsh for several months. We had the opportunity to collect 11 blood samples from alligators located on Holly Beach less than a month after the hurricane, but were unable to collect samples from alligators on Rockefeller Wildlife Refuge until February 2006. Conditions at Rockefeller Refuge did not permit systematic sampling, but a total of 201 samples were collected on the refuge up through August 2006. The blood samples were analyzed for sodium, potassium, chloride, osmolality, and corticosterone. Blood samples from alligators sampled on Holly Beach in October 2005, showed a marked elevation in plasma osmolality, sodium, chloride, potassium, corticosterone, and an elevated heterophil/lymphocyte ratio. Blood samples from alligators on Rockefeller Refuge showed increasing levels of corticosterone as the drought persisted and elevated osmolality and electrolytes. After substantial rainfall in July and August, these indices of osmotic stress returned to within normal limits.

  14. Conservation genetics of the alligator snapping turtle: cytonuclear evidence of range-wide bottleneck effects and unusually pronounced geographic structure

    USGS Publications Warehouse

    Echelle, A.A.; Hackler, J.C.; Lack, Justin B.; Ballard, S. R.; Roman, J.; Fox, S. F.; Leslie,, David M.; Van Den Bussche, Ronald A.


    A previous mtDNA study indicated that female-mediated gene flow was extremely rare among alligator snapping turtle populations in different drainages of the Gulf of Mexico. In this study, we used variation at seven microsatellite DNA loci to assess the possibility of male-mediated gene flow, we augmented the mtDNA survey with additional sampling of the large Mississippi River System, and we evaluated the hypothesis that the consistently low within-population mtDNA diversity reflects past population bottlenecks. The results show that dispersal between drainages of the Gulf of Mexico is rare (F STmsat  = 0.43, ΦSTmtDNA = 0.98). Past range-wide bottlenecks are indicated by several genetic signals, including low diversity for microsatellites (1.1–3.9 alleles/locus; H e = 0.06–0.53) and mtDNA (h = 0.00 for most drainages; π = 0.000–0.001). Microsatellite data reinforce the conclusion from mtDNA that the Suwannee River population might eventually be recognized as a distinct taxonomic unit. It was the only population showing fixation or near fixation for otherwise rare microsatellite alleles. Six evolutionarily significant units are recommended on the basis of reciprocal mtDNA monophyly and high levels of microsatellite DNA divergence.

  15. Animal-borne imaging reveals novel insights into the foraging behaviors and Diel activity of a large-bodied apex predator, the American alligator (Alligator mississippiensis).


    Nifong, James C; Nifong, Rachel L; Silliman, Brian R; Lowers, Russell H; Guillette, Louis J; Ferguson, Jake M; Welsh, Matthew; Abernathy, Kyler; Marshall, Greg


    Large-bodied, top- and apex predators (e.g., crocodilians, sharks, wolves, killer whales) can exert strong top-down effects within ecological communities through their interactions with prey. Due to inherent difficulties while studying the behavior of these often dangerous predatory species, relatively little is known regarding their feeding behaviors and activity patterns, information that is essential to understanding their role in regulating food web dynamics and ecological processes. Here we use animal-borne imaging systems (Crittercam) to study the foraging behavior and activity patterns of a cryptic, large-bodied predator, the American alligator (Alligator mississippiensis) in two estuaries of coastal Florida, USA. Using retrieved video data we examine the variation in foraging behaviors and activity patterns due to abiotic factors. We found the frequency of prey-attacks (mean = 0.49 prey attacks/hour) as well as the probability of prey-capture success (mean = 0.52 per attack) were significantly affected by time of day. Alligators attempted to capture prey most frequently during the night. Probability of prey-capture success per attack was highest during morning hours and sequentially lower during day, night, and sunset, respectively. Position in the water column also significantly affected prey-capture success, as individuals' experienced two-fold greater success when attacking prey while submerged. These estimates are the first for wild adult American alligators and one of the few examples for any crocodilian species worldwide. More broadly, these results reveal that our understandings of crocodilian foraging behaviors are biased due to previous studies containing limited observations of cryptic and nocturnal foraging interactions. Our results can be used to inform greater understanding regarding the top-down effects of American alligators in estuarine food webs. Additionally, our results highlight the importance and power of using animal-borne imaging when

  16. Molecular cloning, characterization, tissue distribution and mRNA expression changes during the hibernation and reproductive periods of estrogen receptor alpha (ESR1) in Chinese alligator, Alligator sinensis.


    Zhang, Ruidong; Hu, Yuehong; Wang, Huan; Yan, Peng; Zhou, Yongkang; Wu, Rong; Wu, Xiaobing


    Chinese alligator, Alligator sinensis, is a critically endangered reptile species unique to China. Little is known about the mechanism of growth- and reproduction-related hormones gene expression in Chinese alligator. Estrogens play important roles in regulating multiple reproduction- and non-reproduction-related functions by binding to their corresponding receptors. Here, the full-length cDNA of estrogen receptor alpha (ERα/ESR1) was cloned and sequenced from Chinese alligator for the first time, which comprises 1764bp nucleotides and encodes a predicted protein of 587 amino acids. Phylogenetic analysis of ESR1 showed that crocodilians and turtles were the sister-group of birds. The results of real-time quantitative PCR indicated that the ESR1 mRNA was widely expressed in the brain and peripheral tissues. In the brain and pituitary gland, ESR1 was most highly transcribed in the cerebellum. But in other peripheral tissues, ESR1 mRNA expression level was the highest in the ovary. Compared with hibernation period, ESR1 mRNA expression levels were increased significantly in the reproductive period (P<0.05) in cerebellum, pituitary gland, liver, spleen, lung, kidney and ovary, while no significant change in other examined tissues (P>0.05). The ESR1 mRNA expression levels changes during the two periods of different tissues suggested that ESR1 might play an important role in mediation of estrogenic multiple reproductive effects in Chinese alligator. Furthermore, it was the first time to quantify ESR1 mRNA level in the brain of crocodilians, and the distribution and expression of ESR1 mRNA in the midbrain, cerebellum and medulla oblongata was also reported for the first time in reptiles. PMID:27212643

  17. Animal-Borne Imaging Reveals Novel Insights into the Foraging Behaviors and Diel Activity of a Large-Bodied Apex Predator, the American Alligator (Alligator mississippiensis)

    PubMed Central

    Nifong, James C.; Nifong, Rachel L.; Silliman, Brian R.; Lowers, Russell H.; Guillette, Louis J.; Ferguson, Jake M.; Welsh, Matthew; Abernathy, Kyler; Marshall, Greg


    Large-bodied, top- and apex predators (e.g., crocodilians, sharks, wolves, killer whales) can exert strong top-down effects within ecological communities through their interactions with prey. Due to inherent difficulties while studying the behavior of these often dangerous predatory species, relatively little is known regarding their feeding behaviors and activity patterns, information that is essential to understanding their role in regulating food web dynamics and ecological processes. Here we use animal-borne imaging systems (Crittercam) to study the foraging behavior and activity patterns of a cryptic, large-bodied predator, the American alligator (Alligator mississippiensis) in two estuaries of coastal Florida, USA. Using retrieved video data we examine the variation in foraging behaviors and activity patterns due to abiotic factors. We found the frequency of prey-attacks (mean = 0.49 prey attacks/hour) as well as the probability of prey-capture success (mean = 0.52 per attack) were significantly affected by time of day. Alligators attempted to capture prey most frequently during the night. Probability of prey-capture success per attack was highest during morning hours and sequentially lower during day, night, and sunset, respectively. Position in the water column also significantly affected prey-capture success, as individuals’ experienced two-fold greater success when attacking prey while submerged. These estimates are the first for wild adult American alligators and one of the few examples for any crocodilian species worldwide. More broadly, these results reveal that our understandings of crocodilian foraging behaviors are biased due to previous studies containing limited observations of cryptic and nocturnal foraging interactions. Our results can be used to inform greater understanding regarding the top-down effects of American alligators in estuarine food webs. Additionally, our results highlight the importance and power of using animal

  18. Hydropower Ambitions of South Asian Nations: Ganges and Brahmaputra River basins

    NASA Astrophysics Data System (ADS)

    Mizanur Rahaman, Muhammad


    This paper analyses the current status of hydropower development in two major river basins in South Asia, the Ganges and the Brahmaputra. The total drainage area of the basins is about 1660,000 km2 shared by China, Nepal, India, Bhutan, and Bangladesh. The basins are blessed with ample water resources and huge hydropower potential. Hydropower development is strongly linked with the overall development framework of the region. The abundant hydropower potential of the Ganges and the Brahmaputra can help give riparian countries a safer energy future that is the key driving force behind the prospect of potential cooperation in the field of water. Based on four years research studies (2005-2009), this paper analyse the hydropower development plans and ambitions of riparian nations with special focus on China and India. The finding suggests that it is essential to develop an integrated hydropower development approach involving all riparian nations intended to foster regional development and overcome the prospect of severe conflict because of unilateral hydropower ambitions of China and India. The hydropower development cooperation between China and India could also become the positive turning point in the integration of South and South-East Asia.

  19. Iodine-129 in the Snake River Plain aquifer at the Idaho National Engineering Laboratory, Idaho

    USGS Publications Warehouse

    Mann, L.J.; Chew, E.W.; Morton, J.S.; Randolph, R.B.


    From 1953 to 1983, an estimated 0.01 to 0.136 Ci (curies)/year of iodine-129 were contained in wastewater generated by the ICPP (Idaho Chemical Processing Plant) at the Idaho National Engineering Laboratory. The wastewater was directly discharged to the Snake River Plain aquifer through a deep disposal well until February 9, 1984, when the well was replaced by an unlined infiltration pond; a second pond was put into use on October 17, 1985. For 1984-86, the annual amount of iodine-129 in wastewater discharged to the ponds ranged from 0.0064 to 0.039 Ci. In August 1986, iodine-129 concentrations in water from 35 wells near the ICPP ranged from less than the reporting level to 3.6 +or-0.4 pCi/L (picocuries/L). By comparison, in April 1977 the water from 20 wells contained a maximum of 27 +or-1 pCi/L of iodine-129; in 1981, the maximum concentration in water from 32 wells was 41 +or-2 pCi/L. The average concentrations of iodine-129 in water from 18 wells that were sampled in 1977, 1981 and 1986 were 4.0, 6.7 and 1.3 pCi/L, respectively. The marked decrease in the iodine-129 concentration from 1981 to 1986 is the result of three factors: (1) The amount of iodine-129 disposed annually; (2) a change from the routine use of the disposal well to the infiltration ponds; and (3) a dilution of the iodine-129 in the aquifer by recharge from the Big Lost River. (USGS)

  20. Flood hazard assessment of the Hoh River at Olympic National Park ranger station, Washington

    USGS Publications Warehouse

    Kresch, D.L.; Pierson, T.C.


    Federal regulations require buildings and public facilities on Federal land to be located beyond or protected from inundation by a 100-year flood. Flood elevations, velocities and boundaries were determined for the occurrence of a 100-year flood through a reach, approximately 1-mi-long, of the Hoh River at the ranger station complex in Olympic National Park. Flood elevations, estimated by step-backwater analysis of the 100-year flood discharge through 14 channel and flood-plain cross sections of the Hoh River, indicate that the extent of flooding in the vicinity of buildings or public facilities at the ranger station complex is likely to be limited mostly to two historic meander channels that lie partly within loop A of the public campground and that average flood depths of about 2 feet or less would be anticipated in these channels. Mean flow velocities at the cross sections, corresponding to the passage of a 100-year flood, ranged from about 5 to over 11 ft/sec. Flooding in the vicinity of either the visitors center or the residential and maintenance areas is unlikely unless the small earthen dam at the upstream end of Taft Creek were to fail. Debris flows with volumes on the order of 100 to 1,000 cu yards could be expected to occur in the small creeks that drain the steep valley wall north of the ranger station complex. Historic debris flows in these creeks have generally traveled no more than about 100 yards out onto the valley floor. The potential risk that future debris flows in these creeks might reach developed areas within the ranger station complex is considered to be small because most of the developed areas within the complex are situated more than 100 yards from the base of the valley wall. Landslides or rock avalanches originating from the north valley wall with volumes potentially much larger than those for debris flows could have a significant impact on the ranger station complex. The probability that such landslides or avalanches may occur is

  1. Coplanar PCB distribution between chorioallantoic membranes and eggs of alligators and Loggerhead sea turtles

    SciTech Connect

    Bargar, T.A.; Cobb, G.P.


    The relative distribution of coplanar polychlorinated biphenyls (PCBs) between chorioallantoic membranes (CAMS) and eggs was investigated in inviable American alligator (Alligator mississippiensis) and Loggerhead sea turtle (Caretta caretra) eggs. Cam and egg extracts were fractionated by HPLC using a porous graphitic column (PGC) and an in line switching valve to separate coplanar from non-coplanar PCBs. The fractions were collected, concentrated by nitrogen evaporation, and injected on GC-ECD (60M DB-5 capillary column) for quantification. Alligator and Loggerhead sea turtle eggs contain toxicologically significant coplanar PCBs. Mono-ortho substituted PCBs were present with greater frequency relative to non-ortho substituted PCBs in both eggs and CAMS. The presence of coplanar PCBs in eggs appears to be correlated to coplanar PCB presence in CAMS. The chorioallantoic membrane could serve as a biomarker of embryo exposure to coplanar PCBs.

  2. American alligator proximal pedal phalanges resemble human finger bones: Diagnostic criteria for forensic investigators.


    Ferraro, Joseph V; Binetti, Katie M


    A scientific approach to bone and tooth identification requires analysts to pursue the goal of empirical falsification. That is, they may attribute a questioned specimen to element and taxon only after having ruled out all other possible attributions. This requires analysts to possess a thorough understanding of both human and non-human osteology, particularly so for remains that may be morphologically similar across taxa. To date, forensic anthropologists have identified several potential 'mimics' for human skeletal remains, including pig teeth and bear paws. Here we document another possible mimic for isolated human skeletal elements--the proximal pedal phalanges of American alligators (Alligator mississippiensis) closely resemble the proximal and intermediate hand phalanges of adult humans. We detail morphological similarities and differences between these elements, with the goal of providing sufficient information for investigators to confidently falsify the hypothesis that a questioned phalanx is derived from an American alligator.

  3. [Comparison of the genome of the alligator gar with the genomes of several other fish].


    Kedrova, O S; Vladychenskaia, N S; Antonov, A S


    Hybridization of alligator gar (Lepisosteus osseus, Lepisosteiformes, Ganoidomorpha) [125I]- or [3H]DNA fractions with DNAs of more or less phylogenetically related fishes was studied. Almost all of the repeated and unique sequences of alligator gar DNA and DNA of the spotted gar (from the same genus) are highly homologous (1-2% of nucleotide substitutions). The degrees of homology between repeated and unique sequences of alligator gar DNA and DNAs of the representatives of Acipenseriformes (the same super-order Ganoidomorpha), Latimeria chalumnae (another subclass, Sarcopterygii) and a shark (another class, Chondrichthyes) are of the same order, and the levels of divergency of their DNAs sequences are similar. These results demonstrate, that the joining of Lepisosteiformes and Acipenseriformes in one and the same group of Ganoidomorpha is artificial, and that the superclass of fishes, Pisces, includes more taxons of the class rank then it has been taken in theory. PMID:6855763

  4. [Comparison of the genome of the alligator gar with the genomes of several other fish].


    Kedrova, O S; Vladychenskaia, N S; Antonov, A S


    Hybridization of alligator gar (Lepisosteus osseus, Lepisosteiformes, Ganoidomorpha) [125I]- or [3H]DNA fractions with DNAs of more or less phylogenetically related fishes was studied. Almost all of the repeated and unique sequences of alligator gar DNA and DNA of the spotted gar (from the same genus) are highly homologous (1-2% of nucleotide substitutions). The degrees of homology between repeated and unique sequences of alligator gar DNA and DNAs of the representatives of Acipenseriformes (the same super-order Ganoidomorpha), Latimeria chalumnae (another subclass, Sarcopterygii) and a shark (another class, Chondrichthyes) are of the same order, and the levels of divergency of their DNAs sequences are similar. These results demonstrate, that the joining of Lepisosteiformes and Acipenseriformes in one and the same group of Ganoidomorpha is artificial, and that the superclass of fishes, Pisces, includes more taxons of the class rank then it has been taken in theory.

  5. Water hyacinths and alligator weeds for removal of silver, cobalt, and strontium from polluted waters

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.


    Water hyacinths and alligator weeds demonstrated the ability to rapidly remove heavy metals from an aqueous system by root absorption and concentration. Water hyacinths demonstrated the ability to remove 0.439 mg of silver, 0.568 mg of cobalt, and 0.544 mg of strontium in an ionized form per gram of dry plant material in a 24-hour period. Alligator weeds removed a maximum of 0.439 mg of silver, 0.130 mg of cobalt, and 0.161 mg of strontium per gram of dry plant material per day.

  6. Dujardinascaris gigantea sp. n. (Nematoda: Ascaridida) from the critically endangered crocodile Alligator sinensis Fauvel (Reptilia: Crocodylia).


    Zhao, Jin-Hong; Li, Liang; Guo, Yan-Ning; Zhang, Lu-Ping


    The Chinese alligator Alligator sinensis Fauvel (Reptilia: Crocodylia) is considered as one of the most critically endangered species of the 23 extant crocodiles. However, our knowledge of the helminth parasites of this rare animal is completely lacking. During a helminthological survey of reptiles in China, we found a new ascaridoid nematode, Dujardinascaris gigantea sp. n. from A. sinensis. The morphology of D. gigantea sp. n. was studied using light and scanning electron microscopy. The new species was also characterised using molecular methods by sequencing and analysing the small ribosomal DNA (18S) and the second internal transcribed spacer (ITS-2).

  7. Nearshore thermal gradients of the Colorado River near the Little Colorado River confluence, Grand Canyon National Park, Arizona, 2010

    USGS Publications Warehouse

    Ross, Rob; Grams, Paul E.


    Construction and operation of Glen Canyon Dam has dramatically impacted the flow of the Colorado River through Glen, Marble, and Grand Canyons. Extremes in both streamflow and water temperature have been suppressed by controlled releases from the dam. Trapping of sediment in Lake Powell, the reservoir formed by Glen Canyon Dam, has also dramatically reduced the supply of suspended sediment entering the system. These changes have altered the riverine ecosystem and the habitat of native species, including fish such as the endangered humpback chub (Gila cypha). Most native fish are adapted to seasonally warm water, and the continuous relatively cold water released by the dam is one of the factors that is believed to limit humpback chub growth and survival. While average mainstem temperatures in the Colorado River are well documented, there is limited understanding of temperatures in the nearshore environments that fish typically occupy. Four nearshore geomorphic unit types were studied between the confluence of the Colorado and Little Colorado Rivers and Lava Canyon in the summer and fall of 2010, for study periods of 10 to 27 days. Five to seven sites were studied during each interval. Persistent thermal gradients greater than the 0.2 °C accuracy of the instruments were not observed in any of the sampled shoreline environments. Temperature gradients between the shoreline and mainstem on the order of 4 °C, believed to be important to the habitat-seeking behavior of native or nonnative fishes, were not detected.

  8. Patterns of sexual dimorphism in Mexican alligator lizards, Barisia imbricata

    PubMed Central

    Dashevsky, Daniel; Meik, Jesse M; Mociño-Deloya, Estrella; Setser, Kirk; Schaack, Sarah


    We compare morphological characteristics of male and female Barisia imbricata, Mexican alligator lizards, and find that mass, head length, coloration, incidence of scars from conspecifics, tail loss, and frequency of bearing the color/pattern of the opposite sex are all sexually dimorphic traits. Overall size (measured as snout–vent length), on the other hand, is not different between the two sexes. We use data on bite scar frequency and fecundity to evaluate competing hypotheses regarding the selective forces driving these patterns. We contend that sexual selection, acting through male-male competition, may favor larger mass and head size in males, whereas large females are likely favored by natural selection for greater fecundity. In addition, the frequency of opposite-sex patterning in males versus females may indicate that the costs of agonistic interactions among males are severe enough to allow for an alternative mating strategy. Finally, we discuss how sexual and natural selective forces may interact to drive or mask the evolution of sexually dimorphic traits. PMID:23467394

  9. Nutrients in Streams and Rivers Across the Nation -- 1992-2001

    USGS Publications Warehouse

    Mueller, David K.; Spahr, Norman E.


    Nutrient compounds of nitrogen and phosphorus were investigated in streams and rivers sampled as part of the U.S. Geological Survey National Water-Quality Assessment (NAWQA) Program. Nutrient data were collected in 20 NAWQA study units during 1992-95, 16 study units during 1996-98, and 15 study units during 1999-2001. To facilitate comparisons among sampling sites with variable sampling frequency, daily loads were determined by using regression models that relate constituent transport to streamflow and time. Model results were used to compute mean annual loads, yields, and concentrations of ammonia, nitrate, total nitrogen, orthophosphate, and total phosphorus, which were compared among stream and river sampling sites. Variations in the occurrence and distribution of nutrients in streams and rivers on a broad national scale reflect differences in the sources of nutrient inputs to the upstream watersheds and in watershed characteristics that affect movement of those nutrients. Sites were classified by watershed size and by land use in the upstream watershed: agriculture, urban, and undeveloped (forest or rangeland). Selection of NAWQA urban sites was intended to avoid effects of major wastewater-treatment plants and other point sources, but in some locations this was not feasible. Nutrient concentrations and yields generally increased with anthropogenic development in the watershed. Median concentrations and yields for all constituents at sites downstream from undeveloped areas were less than at sites downstream from agricultural or urban areas. Concentrations of ammonia, orthophosphate, and total phosphorus at agricultural and urban sites were not significantly different; however, concentrations of nitrate and total nitrogen were higher at agricultural than at urban sites. Total nitrogen concentrations at agricultural sites were higher in areas of high nitrogen input or enhanced transport, such as irrigation or artificial drainage that can rapidly move water from

  10. Water quality of the Crescent River basin, Lake Clark National Park and Preserve, Alaska, 2003-2004

    USGS Publications Warehouse

    Brabets, Timothy P.; Ourso, Robert T.


    The U.S. Geological Survey and the National Park Service conducted a water-quality investigation of the Crescent River Basin in Lake Clark National Park and Preserve from May 2003 through September 2004. The Crescent River Basin was studied because it has a productive sockeye salmon run that is important to the Cook Inlet commercial fishing industry. Water-quality, biology, and limnology characteristics were assessed. Glacier-fed streams that flow into Crescent Lake transport suspended sediment that is trapped by the lake. Suspended sediment concentrations from the Lake Fork Crescent River (the outlet stream of Crescent Lake) were less than 10 milligrams per liter, indicating a high trapping efficiency of Crescent Lake. The North Fork Crescent River transports suspended sediment throughout its course and provides most of the suspended sediment to the main stem of the Crescent River downstream from the confluence of the Lake Fork Crescent River. Three locations on Crescent Lake were profiled during the summer of 2004. Turbidity profiles indicate sediment plumes within the water column at various times during the summer. Turbidity values are higher in June, reflecting the glacier-fed runoff into the lake. Lower values of turbidity in August and September indicate a decrease of suspended sediment entering Crescent Lake. The water type throughout the Crescent River Basin is calcium bicarbonate. Concentrations of nutrients, major ions, and dissolved organic carbon are low. Alkalinity concentrations are generally less than 20 milligrams per liter, indicating a low buffering capacity of these waters. Streambed sediments collected from three surface sites analyzed for trace elements indicated that copper concentrations at all sites were above proposed guidelines. However, copper concentrations are due to the local geology, not anthropogenic factors. Zooplankton samples from Crescent Lake indicated the main taxa are Cyclops sp., a Copepod, and within that taxa were a

  11. Mapping invasive wetland plants in the Hudson River National Estuarine Research Reserve using quickbird satellite imagery

    USGS Publications Warehouse

    Laba, M.; Downs, R.; Smith, S.; Welsh, S.; Neider, C.; White, S.; Richmond, M.; Philpot, W.; Baveye, P.


    The National Estuarine Research Reserve (NERR) program is a nationally coordinated research and monitoring program that identifies and tracks changes in ecological resources of representative estuarine ecosystems and coastal watersheds. In recent years, attention has focused on using high spatial and spectral resolution satellite imagery to map and monitor wetland plant communities in the NERRs, particularly invasive plant species. The utility of this technology for that purpose has yet to be assessed in detail. To that end, a specific high spatial resolution satellite imagery, QuickBird, was used to map plant communities and monitor invasive plants within the Hudson River NERR (HRNERR). The HRNERR contains four diverse tidal wetlands (Stockport Flats, Tivoli Bays, Iona Island, and Piermont), each with unique water chemistry (i.e., brackish, oligotrophic and fresh) and, consequently, unique assemblages of plant communities, including three invasive plants (Trapa natans, Phragmites australis, and Lythrum salicaria). A maximum-likelihood classification was used to produce 20-class land cover maps for each of the four marshes within the HRNERR. Conventional contingency tables and a fuzzy set analysis served as a basis for an accuracy assessment of these maps. The overall accuracies, as assessed by the contingency tables, were 73.6%, 68.4%, 67.9%, and 64.9% for Tivoli Bays, Stockport Flats, Piermont, and Iona Island, respectively. Fuzzy assessment tables lead to higher estimates of map accuracies of 83%, 75%, 76%, and 76%, respectively. In general, the open water/tidal channel class was the most accurately mapped class and Scirpus sp. was the least accurately mapped. These encouraging accuracies suggest that high-resolution satellite imagery offers significant potential for the mapping of invasive plant species in estuarine environments. ?? 2007 Elsevier Inc. All rights reserved.

  12. Community Forestry as Perceived by Local People Around Cross River National Park, Nigeria

    NASA Astrophysics Data System (ADS)

    Ezebilo, Eugene E.


    The prior identification of local people's preferences for conservation-development projects will help gear nature-conservation strategies toward the needs of different groups of local people. This will help policy-makers in designing a more acceptable and effective conservation strategy. This article reports a study of local perceptions of a community forestry project that aims to help improve the design as well as local acceptance of the project. The data originated from personal interviews conducted in communities around Okwangwo Division of the Cross River National Park in southeast Nigeria and were analysed using ordered logit and binary logit models. The results showed that >50% of the respondents were satisfied with the community forestry project. The respondents' perceptions were mainly influenced by education, age, gender, and willingness to contribute money to tourism as well as the contributions of cocoa, banana, and afang ( Gnetum africanum) to the respondents' income. The results from this study have important implications for nature conservation in Nigeria and potentially other conservation contexts across the developing world.

  13. Community forestry as perceived by local people around Cross River National Park, Nigeria.


    Ezebilo, Eugene E


    The prior identification of local people's preferences for conservation-development projects will help gear nature-conservation strategies toward the needs of different groups of local people. This will help policy-makers in designing a more acceptable and effective conservation strategy. This article reports a study of local perceptions of a community forestry project that aims to help improve the design as well as local acceptance of the project. The data originated from personal interviews conducted in communities around Okwangwo Division of the Cross River National Park in southeast Nigeria and were analysed using ordered logit and binary logit models. The results showed that >50% of the respondents were satisfied with the community forestry project. The respondents' perceptions were mainly influenced by education, age, gender, and willingness to contribute money to tourism as well as the contributions of cocoa, banana, and afang (Gnetum africanum) to the respondents' income. The results from this study have important implications for nature conservation in Nigeria and potentially other conservation contexts across the developing world.

  14. RNRFA: an R package to interact with the UK National River Flow Archive

    NASA Astrophysics Data System (ADS)

    Vitolo, Claudia; Fry, Matthew; Buytaert, Wouter


    The UK National River Flow Archive (NRFA) serves daily streamflow data, spatial rainfall averages and information regarding elevation, geology, land cover and FEH related catchment descriptors. In order to view, filter and download data, users are required to use a web interface which has several limitations. For instance, only one station can be selected at a time, therefore the bulk download of multiple datasets (whenever possible) can become a rather tedious task. An application programming interface to the NRFA web services is currently under development but no application has been built yet to interact with its services. A joint effort between Imperial College London and the UK Centre of Ecology and Hydrology has led to the development of an open source project, the R package "rnrfa", to provide alternative and more efficient access and usage of the following NRFA web services: - Metadata catalogue - Catalogue filters based on a geographical bounding-box - Catalogue filters based on metadata entries - Gauged daily data for about 400 stations available in WaterML2 format, the OGC standard used to describe hydrological time series. The rnrfa package, beside being a convenient stand-alone application, is also an ideal back-end tool for virtual observatory type web applications as it simplifies the interaction between data provider and data consumers.

  15. Terrestrial arthropods of Steel Creek, Buffalo National River, Arkansas. II. Sawflies (Insecta: Hymenoptera: "Symphyta")

    PubMed Central

    Smith, David R.; Fisher, Danielle M.; Dowling, Ashley P.G.


    Abstract Background This is the second in a series of papers detailing the terrestrial arthropods collected during an intensive survey of a site near Steel Creek campground along the Buffalo National River in Arkansas. The survey was conducted over a period of eight and a half months using twelve trap types – Malaise traps, canopy traps (upper and lower collector), Lindgren multifunnel traps (black, green, and purple), pan traps (blue, purple, red, white, and yellow), and pitfall traps – and Berlese-Tullgren extraction of leaf litter. New information We provide collection records for 47 species of "Symphyta" (Insecta: Hymenoptera), 30 of which are new state records for Arkansas: (Argidae) Sterictiphora serotina; (Cimbicidae) Abia americana; (Diprionidae) Monoctenus fulvus; (Orussidae) Orussus terminalis; (Pamphiliidae) Onycholyda luteicornis, Pamphilius ocreatus, P. persicum, P. rileyi; (Pergidae) Acordulecera dorsalis, A. mellina, A. pellucida; (Tenthredinidae) Caliroa quercuscoccineae, Empria coryli, Hoplocampa marlatti, Macrophya cassandra, Monophadnoides conspiculatus, Monophadnus bakeri, Nematus abbotii, Neopareophora litura, Pachynematus corniger, Paracharactus rudis, Periclista marginicollis, Pristiphora banski, P. chlorea, Strongylogaster impressata, S. remota, Taxonus epicera, Thrinax albidopictus, T. multicinctus, Zaschizonyx montana; (Xiphydriidae) Xiphydria tibialis. PMID:27222635

  16. Effects of Jackson Lake Dam on the Snake River and its floodplain, Grand Teton National Park, Wyoming, USA

    NASA Astrophysics Data System (ADS)

    Marston, Richard A.; Mills, John D.; Wrazien, David R.; Bassett, Beau; Splinter, Dale K.


    In 1906, the Bureau of Reclamation created Jackson Lake Dam on the Snake River in what later became Grand Teton National Park. The geomorphic, hydrologic and vegetation adjustments downstream of the dam have yet to be documented. After a larger reservoir was completed further downstream in 1957, the reservoir release schedule from Jackson Lake Dam was changed in a manner that lowered the magnitude and frequency of floods. The stability of the Snake River exhibited a complex response to the change in flow regime. Close to major tributaries, the Snake River increased in total sinuosity and rates of lateral channel migration. Away from the influence of tributaries, the river experienced fewer avulsions and a decrease in sinuosity. Vegetation maps were constructed from 1945 and 1989 aerial photography and field surveys. Using these data, we determined how vegetation is directly related to the number of years since each portion of the floodplain was last occupied by the channel. The vegetation has changed from a flood-pulse dominated mosaic to a more terrestrial-like pattern of succession. Changes in the Snake River and its floodplain have direct implications on bald eagle habitat, moose habitat, fish habitat, safety of rafting and canoeing, and biodiversity at the community and species levels.

  17. Geomorphic Classification and Assessment of Channel Dynamics in the Missouri National Recreational River, South Dakota and Nebraska

    USGS Publications Warehouse

    Elliott, Caroline M.; Jacobson, Robert B.


    A multiscale geomorphic classification was established for the 39-mile, 59-mile, and adjacent segments of the Missouri National Recreational River administered by the National Park Service in South Dakota and Nebraska. The objective of the classification was to define naturally occurring clusters of geomorphic characteristics that would be indicative of discrete sets of geomorphic processes, with the intent that such a classification would be useful in river-management and rehabilitation decisions. The statistical classification was based on geomorphic characteristics of the river collected from 1999 orthophotography and the persistence of classified units was evaluated by comparison with similar datasets for 2003 and 2004 and by evaluating variation of bank erosion rates by geomorphic class. Changes in channel location and form were also explored using imagery and maps from 1993-2004, 1941 and 1894. The multivariate classification identified a hierarchy of naturally occurring clusters of reach-scale geomorphic characteristics. The simplest level of the hierarchy divides the river from segments into discrete reaches characterized by single and multithread channels and additional hierarchical levels established 4-part and 10-part classifications. The classification system presents a physical framework that can be applied to prioritization and design of bank stabilization projects, design of habitat rehabilitation projects, and stratification of monitoring and assessment sampling programs.

  18. Spatial and temporal geochemical trends in the hydrothermal system of Yellowstone National Park: Inferences from river solute fluxes

    USGS Publications Warehouse

    Hurwitz, S.; Lowenstern, J. B.; Heasler, H.


    We present and analyze a chemical dataset that includes the concentrations and fluxes of HCO3-, SO42-, Cl-, and F- in the major rivers draining Yellowstone National Park (YNP) for the 2002-2004 water years (1 October 2001 - 30 September 2004). The total (molar) flux in all rivers decreases in the following order, HCO3- > Cl- > SO42- > F-, but each river is characterized by a distinct chemical composition, implying large-scale spatial heterogeneity in the inputs of the various solutes. The data also display non-uniform temporal trends; whereas solute concentrations and fluxes are nearly constant during base-flow conditions, concentrations decrease, solute fluxes increase, and HCO3-/Cl-, and SO42-/Cl- increase during the late-spring high-flow period. HCO3-/SO42- decreases with increasing discharge in the Madison and Falls Rivers, but increases with discharge in the Yellowstone and Snake Rivers. The non-linear relations between solute concentrations and river discharge and the change in anion ratios associated with spring runoff are explained by mixing between two components: (1) a component that is discharged during base-flow conditions and (2) a component associated with snow-melt runoff characterized by higher HCO3-/Cl- and SO42-/Cl-. The fraction of the second component is greater in the Yellowstone and Snake Rivers, which host lakes in their drainage basins and where a large fraction of the solute flux follows thaw of ice cover in the spring months. Although the total river HCO3- flux is larger than the flux of other solutes (HCO3-/Cl- ??? 3), the CO2 equivalent flux is only ??? 1% of the estimated emission of magmatic CO2 soil emissions from Yellowstone. No anomalous solute flux in response to perturbations in the hydrothermal system was observed, possibly because gage locations are too distant from areas of disturbance, or because of the relatively low sampling frequency. In order to detect changes in river hydrothermal solute fluxes, sampling at higher

  19. Regional economic analysis of current and proposed management alternatives for Rappahannock River Valley National Wildlife Refuge

    USGS Publications Warehouse

    Koontz, Lynne; Sexton, Natalie; Donovan, Ryan


    The National Wildlife Refuge System Improvement Act of 1997 requires all units of the National Wildlife Refuge System to be managed under a Comprehensive Conservation Plan. The Comprehensive Conservation Plan must describe the desired future conditions of a refuge and provide long-range guidance and management direction to achieve refuge purposes. The Rappahannock River Valley National Wildlife Refuge (refuge) is in the process of developing a range of management goals, objectives, and strategies for the Comprehensive Conservation Plan. The Comprehensive Conservation Plan for the refuge must contain an analysis of expected effects associated with current and proposed refuge management strategies. The purpose of this study was to assess the regional economic implications associated with draft Comprehensive Conservation Plan management strategies. Special interest groups and local residents often criticize a change in refuge management, especially if there is a perceived negative impact to the local economy. Having objective data on economic impacts may show that these fears are overstated. Quite often, the extent of economic benefits a refuge provides to a local community is not fully recognized, yet at the same time the effects of negative changes is overstated. Spending associated with refuge recreational activities, such as wildlife viewing and hunting, can generate considerable tourist activity for surrounding communities. Additionally, refuge personnel typically spend considerable amounts of money purchasing supplies in local stores, repairing equipment and purchasing fuel at the local service stations, and reside and spend their salaries in the local community. For refuge Comprehensive Conservation Plan planning, a regional economic assessment provides a means of estimating how current management (no action alternative) and proposed management activities (alternatives) could affect the local economy. This type of analysis provides two critical pieces of

  20. Detrital zircon geochronology of the Adams Argillite and Nation River Formation, east-central Alaska, U.S.A

    USGS Publications Warehouse

    Gehrels, G.E.; Johnsson, M.J.; Howell, D.G.


    The Cambrian Adams Argillite and the Devonian Nation River Formation are two sandstone-bearing units within a remarkably complete Paleozoic stratigraphic section in east-central Alaska. These strata, now foreshortened and fault-bounded, were originally contiguous with miogeoclinal strata to the east that formed as a passive-margin sequence along the northwestern margin of the North American continent. Seventy-five detrital zircon grains from the Adams Argillite and the Nation River Formation were analyzed in an effort to provide constraints on the original sources of the grains, and to generate a detrital zircon reference for miogeoclinal strata in the northern Cordillera. Thirty-five single zircon grains from a quartzite in the Adams Argillite yield dominant age clusters of 1047-1094 (n = 6), 1801-1868 (n = 10), and 2564-2687 (n = 5) Ma. Forty zircons extracted from a sandstone in the Nation River Formation yield clusters primarily of 424-434 (n = 6), 1815-1838 (n = 6), 1874-1921 (n = 7), and 2653-2771 (n = 4) Ma. The Early Proterozoic and Archean grains in both units probably originated in basement rocks in a broad region of the Canadian Shield. In contrast, the original igneous sources for mid-Protcrozoic grains in the Adams Argillite and ??? 430 Ma grains in the Nation River Formation are more difficult to identify. Possible original sources for the mid-Proterozoic grains include: (1) the Grenville Province of eastern Laurentia, (2) the Pearya terrane along the Arctic margin, and (3) mid-Proterozoic igneous rocks that may have been widespread along or outboard of the Cordilleran margin. The ??? 430 Ma grains may have originated in: (1) arc-type sources along the Cordilleran margin, (2) the Caledonian orogen, or (3) a landmass, such as Pearya, Siberia, or crustal fragments now in northern Asia, that resided outboard of the Innuitian orogen during mid-Paleozoic time. Copyright ?? 1999, SEPM (Society for Sedimentary Geology).

  1. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser.


    Hamilton, Matthew T; Finger, John W; Winzeler, Megan E; Tuberville, Tracey D


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3 (-)), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F 2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. Lastly, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood. PMID:27382469

  2. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser

    SciTech Connect

    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3₋), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. In conclusion, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood.

  3. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser


    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressuremore » of carbon dioxide (PCO2), bicarbonate (HCO3₋), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. In conclusion, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood.« less

  4. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser

    PubMed Central

    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3−), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. Lastly, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood. PMID:27382469

  5. Follicle-stimulating hormone receptor (FSHR) in Chinese alligator, Alligator sinensis: molecular characterization, tissue distribution and mRNA expression changes during the female reproductive cycle.


    Zhang, Rui; Zhang, Shengzhou; Zhu, Xue; Zhou, Yongkang; Wu, Xiaobing


    The follicle-stimulating hormone (FSH) plays a central role in vertebrate reproduction, with the actions of FSH mediated by FSH receptors (FSHRs) on the granulosa cells of the ovary. The present study reports the cloning and characterization of FSHR in Chinese alligator, Alligator sinensis (caFSHR), and its tissue distribution and mRNA expression changes during the reproductive cycle. The mature protein of caFSHR displays typical features of the glycoprotein hormone receptor family, but also contains some remarkable differences when compared with other vertebrate FSHRs. The deduced amino acid sequence of the caFSHR shares identity of 85% with Chinese softshell turtle, 84-87% with birds, 77-78% with mammals, 67-73% with amphibians and 51-58% with fishes. Phylogenetic tree analysis of the FSHR amino acid sequence indicated that alligators cluster into the bird branch. Tissue expression analysis showed that caFSHR was not only expressed in the ovary, but also in the stomach, intestine, pancreas liver and oviduct at similar levels, while it was not detectable in heart, thymus or thyroid. Expression of caFSHR in the ovary is high in May (breeding prophase) and peaks in July during the breeding period, where it is maintained at high levels through September (breeding anaphase). Expression decreases significantly in November (hibernating period) and then remains relatively low from January to March (hibernating period). These temporal changes in FSHR expression suggest that it plays an important role in promoting ovarian development during the female reproductive cycle of Chinese alligator. PMID:25765682

  6. Guide to Surficial Geology and River-Bluff Exposures, Noatak National Preserve, Northwestern Alaska

    USGS Publications Warehouse

    Hamilton, Thomas D.


    From its origin in rugged granitic highlands of the central Brooks Range, the Noatak River flows westward between the De Long Mountains and the Baird Mountains before turning south to enter Kotzebue Sound. Glaciers of middle and late Pleistocene age entered the Noatak River valley from the east, north, and south. Glaciers flowed down the upper Noatak River valley from the rugged peaks at its head, merging with tributary glaciers that issued from cirque-headed valleys along its south flank. Farther downvalley, small glaciers flowed northward from the Baird Mountains and much larger glaciers issued from the De Long Mountains. The De Long Mountains glaciers expanded southward to cover parts of the Noatak valley floor; they dammed the Noatak River during successive advances, creating a series of glacial lakes. The more extensive glacial advances dammed huge lakes that filled the Aniuk Lowland to overflowing. At various times, overflow waters spilled northward through Howard Pass, southward via Hunt River into the Kobuk River system, and westward down a series of channelways that skirted south of the glacier margins. Prominent bluffs along the Noatak River and its principal tributaries reveal glacial, glaciolacustrine, fluvial, and eolian sediments. More than 120 measured bluff exposures are described and illustrated in this report. These are dated by 92 radiocarbon age determinations and by the presence of the old Crow tephra, which was deposited about 130,000-140,000 years ago. Six geologic base maps, which cover sections of the Noatak River valley from east to west, show the locations of the river bluffs in relation to the glacial, glaciolacustrine, and fluvial deposits that cover the valley floor. The upper Noatak River valley is dominated by a bulky end moraine near Douglas Creek that was deposited during the last glacial maximum about 25,000-15,000 14C yr BP (termed the Itkillik II phase in the central Brooks Range glacial succession). Bluffs along this section of

  7. TRPV4 associates environmental temperature and sex determination in the American alligator

    PubMed Central

    Yatsu, Ryohei; Miyagawa, Shinichi; Kohno, Satomi; Saito, Shigeru; Lowers, Russell H.; Ogino, Yukiko; Fukuta, Naomi; Katsu, Yoshinao; Ohta, Yasuhiko; Tominaga, Makoto; Guillette Jr, Louis J.; Iguchi, Taisen


    Temperature-dependent sex determination (TSD), commonly found among reptiles, is a sex determination mode in which the incubation temperature during a critical temperature sensitive period (TSP) determines sexual fate of the individual rather than the individual’s genotypic background. In the American alligator (Alligator mississippiensis), eggs incubated during the TSP at 33 °C (male producing temperature: MPT) yields male offspring, whereas incubation temperatures below 30 °C (female producing temperature: FPT) lead to female offspring. However, many of the details of the underlying molecular mechanism remains elusive, and the molecular link between environmental temperature and sex determination pathway is yet to be elucidated. Here we show the alligator TRPV4 ortholog (AmTRPV4) to be activated at temperatures proximate to the TSD-related temperature in alligators, and using pharmacological exposure, we show that AmTRPV4 channel activity affects gene expression patterns associated with male differentiation. This is the first experimental demonstration of a link between a well-described thermo-sensory mechanism, TRPV4 channel, and its potential role in regulation of TSD in vertebrates, shedding unique new light on the elusive TSD molecular mechanism. PMID:26677944

  8. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula.


    Schwarz, Daniel E; Allen, Peter J


    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth rates and ionic and osmoregulation, juvenile alligator gar (330 days after hatch; 185 g) were exposed to 4 different salinities (0, 8, 16, and 24 ppt) for a 30-day period. Specific growth rate, plasma osmolality and ion concentrations, gill and gastrointestinal tract Na(+), K(+)-ATPase activities, and drinking rate were compared. Juvenile alligator gar were able to tolerate hyperosmotic salinities up to 24 ppt for a 30 day period, albeit with decreased growth resulting largely from decreased food consumption. Plasma osmolality and ionic concentrations were elevated in hyperosmotic salinities, and drinking rates and gastrointestinal tract Na(+), K(+)-ATPase activities increased, particularly in the pyloric caeca, presumably the primary location of water absorption. Therefore, juvenile alligator gar<1 year of age are capable of prolonged exposure to hyperosmotic salinities, but, based on the inference of these data, require access to lower salinities for long-term survival. PMID:24368134

  9. Achieving environmentally relevant organochlorine pesticide concentrations in eggs through maternal exposure in Alligator mississippiensis

    USGS Publications Warehouse

    Rauschenberger, R.H.; Wiebe, J.J.; Buckland, J.E.; Smith, Joe T.; Sepulveda, M.S.; Gross, T.S.


    Alligator mississippiensis eggs from organochlorine pesticide (OCP) contaminated sites in Florida exhibit high rates of embryonic mortality compared to reference sites (p<0.05). The objective of the present study was to use captive adult alligators to test the hypotheses that maternal exposure to OCPs results in increased OCP concentrations in eggs, and that increased exposure is associated with increased embryonic mortality. A total of 24 adult alligators (8 males and 16 females) were housed in eight pens. Eight females in four pens were dosed with a mixture of p,p'-DDE, toxaphene, dieldrin, and chlordane at a rate of 0.2 ? 0.01 mg/kg/day for 274 ? 8 days. Treated females produced eggs containing higher OCP concentrations (12,814 ? 813 ng/g yolk) than controls (38 ? 4 ng/g yolk). Eggs of treated females exhibited decreased viability (13 ? 22%) as compared to controls (45 ? 20%). Results indicated that 0.6% of administered OCPs were maternally transferred to the eggs of American alligators, and that maternal exposure is associated with decreased egg/embryo viability in this species.

  10. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth ra...

  11. The evolutionary history of an invasive species: alligator weed, Alternanthera philoxeroides

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The eco-evolutionary mechanisms of biological invasions are still not thoroughly understood. Alligator weed, Alternanthera philoxeroides (Martius) Gisebach (Amaranthaceae), is a plant native to South America and a weed in Australia and other countries. To better understand its success as an invader,...

  12. TRPV4 associates environmental temperature and sex determination in the American alligator.


    Yatsu, Ryohei; Miyagawa, Shinichi; Kohno, Satomi; Saito, Shigeru; Lowers, Russell H; Ogino, Yukiko; Fukuta, Naomi; Katsu, Yoshinao; Ohta, Yasuhiko; Tominaga, Makoto; Guillette, Louis J; Iguchi, Taisen


    Temperature-dependent sex determination (TSD), commonly found among reptiles, is a sex determination mode in which the incubation temperature during a critical temperature sensitive period (TSP) determines sexual fate of the individual rather than the individual's genotypic background. In the American alligator (Alligator mississippiensis), eggs incubated during the TSP at 33 °C (male producing temperature: MPT) yields male offspring, whereas incubation temperatures below 30 °C (female producing temperature: FPT) lead to female offspring. However, many of the details of the underlying molecular mechanism remains elusive, and the molecular link between environmental temperature and sex determination pathway is yet to be elucidated. Here we show the alligator TRPV4 ortholog (AmTRPV4) to be activated at temperatures proximate to the TSD-related temperature in alligators, and using pharmacological exposure, we show that AmTRPV4 channel activity affects gene expression patterns associated with male differentiation. This is the first experimental demonstration of a link between a well-described thermo-sensory mechanism, TRPV4 channel, and its potential role in regulation of TSD in vertebrates, shedding unique new light on the elusive TSD molecular mechanism. PMID:26677944

  13. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula.


    Schwarz, Daniel E; Allen, Peter J


    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth rates and ionic and osmoregulation, juvenile alligator gar (330 days after hatch; 185 g) were exposed to 4 different salinities (0, 8, 16, and 24 ppt) for a 30-day period. Specific growth rate, plasma osmolality and ion concentrations, gill and gastrointestinal tract Na(+), K(+)-ATPase activities, and drinking rate were compared. Juvenile alligator gar were able to tolerate hyperosmotic salinities up to 24 ppt for a 30 day period, albeit with decreased growth resulting largely from decreased food consumption. Plasma osmolality and ionic concentrations were elevated in hyperosmotic salinities, and drinking rates and gastrointestinal tract Na(+), K(+)-ATPase activities increased, particularly in the pyloric caeca, presumably the primary location of water absorption. Therefore, juvenile alligator gar<1 year of age are capable of prolonged exposure to hyperosmotic salinities, but, based on the inference of these data, require access to lower salinities for long-term survival.

  14. Methods for Monitoring Fish Communities of Buffalo National River and Ozark National Scenic Riverways in the Ozark Plateaus of Arkansas and Missouri: Version 1.0

    USGS Publications Warehouse

    Petersen, James C.; Justus, B.G.; Dodd, H.R.; Bowles, D.E.; Morrison, L.W.; Williams, M.H.; Rowell, G.A.


    Buffalo National River located in north-central Arkansas, and Ozark National Scenic Riverways, located in southeastern Missouri, are the two largest units of the National Park Service in the Ozark Plateaus physiographic province. The purpose of this report is to provide a protocol that will be used by the National Park Service to sample fish communities and collect related water-quality, habitat, and stream discharge data of Buffalo National River and Ozark National Scenic Riverways to meet inventory and long-term monitoring objectives. The protocol includes (1) a protocol narrative, (2) several standard operating procedures, and (3) supplemental information helpful for implementation of the protocol. The protocol narrative provides background information about the protocol such as the rationale of why a particular resource or resource issue was selected for monitoring, information concerning the resource or resource issue of interest, a description of how monitoring results will inform management decisions, and a discussion of the linkages between this and other monitoring projects. The standard operating procedures cover preparation, training, reach selection, water-quality sampling, fish community sampling, physical habitat collection, measuring stream discharge, equipment maintenance and storage, data management and analysis, reporting, and protocol revision procedures. Much of the information in the standard operating procedures was gathered from existing protocols of the U.S. Geological Survey National Water Quality Assessment program or other sources. Supplemental information that would be helpful for implementing the protocol is included. This information includes information on fish species known or suspected to occur in the parks, sample sites, sample design, fish species traits, index of biotic integrity metrics, sampling equipment, and field forms.

  15. Stream and River Condition Across the BLM's National System of Public Lands

    EPA Science Inventory

    Meeting Abstract: The Bureau of Land Management (BLM), in collaboration with the U.S. Environmental Protection Agency, conducted the first ever Western Rivers and Streams Assessment (WRSA), a survey of the condition of BLM streams and rivers throughout the contiguous western U.S...

  16. Stream and River Condition Across the BLM's National System of Public Lands.

    EPA Science Inventory

    The Bureau of Land Management (BLM), in collaboration with the U.S. Environmental Protection Agency, conducted the first ever Western Rivers and Streams Assessment (WRSA), a survey of the condition of BLM streams and rivers throughout the contiguous western U.S. The WRSA was desi...

  17. 77 FR 25106 - Special Local Regulations for Marine Events; Potomac River, National Harbor Access Channel, MD

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... notice regarding our public dockets in the January 17, 2008, issue of the Federal Register (73 FR 3316... rulemaking. SUMMARY: The Coast Guard proposes to establish special local regulations during the ``Swim Across the Potomac River'' swimming competition, to be held on the waters of the Potomac River on July...

  18. Simple solar technology saves money for alligator farms

    SciTech Connect

    Goldman, A.


    In 1990, a high-volume solar thermal water-heating system in Florida was installed in Okeechobee County by Solar Development, Inc. (SDI). The system is designed to provide large quantities of hot water for commercial use and heat water to as high as 140[degrees]F. The design in Florida is known as a Shallow Solar Pond (SSP). It was completed with the help of the Florida Alligator Farmers Association, the Florida Energy Office, Foster Farms, and SDI. The SSP is a modular system built on site and modified to meet the specific needs of each application. The tank and the collector are the same unit, which keeps the system cost very low. The typical SSP module is 16 feet wide and up to 200 feet long. The module contains one or two reinforced-rubber flat water bags similar to a water bed. The bags rest on a layer of insulation or sand inside concrete or fiberglass curbs. In the Foster Farms SSP, the insulation was omitted and the water bags are placed on sand. The bag is protected against damage and heat loss by greenhouse-type glazing. At Foster Farms there are 3 SSPs, set in approximately 8,000 square feet, with two 5,000-gallon bags per unit. In addition, there is a pressurizing pump/tank system. Every morning, the heated water from the bags drains into a sump tank. While the bags are emptied into the backup system, well water is pumped in and the solar heating process starts all over again.

  19. Water-Quality and Fish-Community Data for the Niobrara National Scenic River, Nebraska, 2003-05

    USGS Publications Warehouse

    Dietsch, Benjamin


    In 1991, a 76-mile reach of the Niobrara River in north-central Nebraska was designated as a National Scenic River (NSR). This reach of the river hosts a unique ecosystem that provides habitat for a diverse fish and wildlife population that include several threatened and endangered species. The Niobrara NSR also is a popular destination for campers, canoeists, kayakers, and tubers. Changes in surface-water quality, related to recreation, industrial and municipal discharge, and agricultural activities in the region have the potential to affect fish and wildlife populations within the Niobrara NSR. Additionally, water users may be at risk if elevated concentrations of chemical or biological contaminants are present in the waterway. The U.S. Geological Survey (USGS) and the National Park Service (NPS) began a 3-year cooperative study of water-quality characteristics in Niobrara NSR in 2003. During the study, water samples were collected for analysis of a suite of physical, chemical, and biological indicators of water quality in the Niobrara River. The resulting data have been published previously (Hitch and others, 2004; Hitch and others, 2005) and included: major ions, nutrients, trace elements, pesticides, organic (wastewater) compounds, bacteria, and suspended sediment. In addition to water-quality sampling, fish communities were sampled to identify the presence and diversity of species at selected sites (data available online in Annual Water Data Reports). These water-quality and fish-community data are summarized in this report. The data were collected to provide baseline information that will help NPS managers determine if changes in recreational activities, land-use practices, and other factors are affecting the Niobrara River.

  20. Development and Implementation of a Scaled Saltstone Facility at Savannah River National Laboratory - 13346

    SciTech Connect

    Reigel, Marissa M.; Fowley, Mark D.; Hansen, Erich K.; Hera, Kevin R.; Marzolf, Athneal D.; Cozzi, Alex D.


    The Savannah River National Laboratory (SRNL) has supported the Saltstone Production Facility (SPF) since its conception. However, bench scaled tests have not always provided process or performance data related to the mixing, transfer, and other operations utilized in the SPF. A need was identified to better understand the SPF processes and to have the capabilities at SRNL to simulate the SPF unit operations to support an active low-level radioactive waste (LLW) processing facility. At the SPF, the dry premix is weighed, mixed and transferred to the Readco '10-inch' continuous mixer where it is mixed with the LLW salt solution from the Salt Feed Tank (SFT) to produce fresh Saltstone slurry. The slurry is discharged from the mixer into a hopper. The hopper feeds the grout pump that transfers the slurry through at least 457.2 meters of piping and discharges it into the Saltstone Disposal Units (SDU) for permanent disposal. In conjunction with testing individual SPF processes over several years, SRNL has designed and fabricated a scaled Saltstone Facility. Scaling of the system is primarily based on the volume capacity of the mixer and maintaining the same shear rate and total shear at the wall of the transfer line. At present, SRNL is utilizing the modular capabilities of the scaled Saltstone Facility to investigate the erosion issues related to the augers and paddles inside the SPF mixer. Full implementation of the scaled Saltstone Facility is still ongoing, but it is proving to be a valuable resource for testing alternate Saltstone formulations, cleaning sequences, the effect of pumping Saltstone to farther SDU's, optimization of the SPF mixer, and other operational variables before they are implemented in the SPF. (authors)

  1. Growth and sustainability of black bears at White River National Wildlife Refuge, Arkansas

    USGS Publications Warehouse

    Clark, Joseph D.; Eastridge, R.


    The black bear (Ursus americanus) population at White River National Wildlife Refuge is isolated and genetically distinct, but hunting occurs adjacent to refuge boundaries and females with cubs are removed annually for a reintroduction project. We trapped and radiotracked bears to determine level of exploitation and compare methods for estimating population growth and sustainability. We captured 260 bears (113 M:147 F), 414 times, from 1998 through 2003. Survival estimates based on radiotracking and mark–recapture indicated that hunting and translocations were significant sources of loss. Based on mark–recapture data (Pradel estimator), the annual population growth rate (λ) averaged 1.066 (SE = 0.077) when translocation removals occurred and averaged 0.961 (SE = 0.155) when both harvest and translocations occurred. Estimates of λ based on a population simulation model (program RISKMAN) averaged 1.061 (SD = 0.104) and 1.100 (SD = 0.111) when no removals occurred, 1.003 (SD = 0.097) and 1.046 (SD = 0.102) when translocations occurred, and 0.973 (SD = 0.096) and 1.006 (SD = 0.099) when both harvest and translocations occurred, depending on the survival rate estimates we used. The probability of population decline by >25% over a 10-year period ranged from 13.8 to 68.8%, given our estimated removal rates. We conclude that hunting and translocation losses are at or exceed the maximum the population is capable of sustaining. Although extinction risks of this important bear population are low over the near term, it should continue to be closely monitored by state and federal agencies. The mark–recapture method we used to estimate λ proved to be a reliable alternative to more costly population modeling methods.

  2. A Novel Hydro-information System for Improving National Weather Service River Forecast System

    NASA Astrophysics Data System (ADS)

    Nan, Z.; Wang, S.; Liang, X.; Adams, T. E.; Teng, W. L.; Liang, Y.


    A novel hydro-information system has been developed to improve the forecast accuracy of the NOAA National Weather Service River Forecast System (NWSRFS). An MKF-based (Multiscale Kalman Filter) spatial data assimilation framework, together with the NOAH land surface model, is employed in our system to assimilate satellite surface soil moisture data to yield improved evapotranspiration. The latter are then integrated into the distributed version of the NWSRFS to improve its forecasting skills, especially for droughts, but also for disaster management in general. Our system supports an automated flow into the NWSRFS of daily satellite surface soil moisture data, derived from the TRMM Microwave Imager (TMI) and Advanced Microwave Scanning Radiometer-Earth Observing System (AMSR-E), and the forcing information of the North American Land Data Assimilation System (NLDAS). All data are custom processed, archived, and supported by the NASA Goddard Earth Sciences Data Information and Services Center (GES DISC). An optional data fusing component is available in our system, which fuses NEXRAD Stage III precipitation data with the NLDAS precipitation data, using the MKF-based framework, to provide improved precipitation inputs. Our system employs a plug-in, structured framework and has a user-friendly, graphical interface, which can display, in real-time, the spatial distributions of assimilated state variables and other model-simulated information, as well as their behaviors in time series. The interface can also display watershed maps, as a result of the integration of the QGIS library into our system. Extendibility and flexibility of our system are achieved through the plug-in design and by an extensive use of XML-based configuration files. Furthermore, our system can be extended to support multiple land surface models and multiple data assimilation schemes, which would further increase its capabilities. Testing of the integration of the current system into the NWSRFS is

  3. Sedimentology and tectonics of Devonian Nation River Formation, Alaska, part of yet another allochthonous terrane

    SciTech Connect

    Howell, D.G.; Murray, R.W.; Wiley, T.J.; Boundy-Sanders, S.; Kauffman-Linam, L.; Jones, D.L.


    Sandwiched between terra incognito of the Yukon Flats, Alaska, and the disrupted cratonal sequences of Yukon Territory, Canada, is a complex array of Proterozoic and Phanerozoic rock units composing a poorly defined group of tectonostratigraphic terranes. The Nation River formation (NRF) is a conspicuous siliciclastic submarine fan complex interbedded in a Paleozoic sequence characterized by deep-water cherts, siliceous shales, and platform to basin-plain carbonates. The NRF ranges from 500 to 2000 m thick. Where the basal part is exposed, NRF overlies the Devonian McCann Hill Chert, a deep-water radiolarian chert sequence. Above the NRF is either another radiolarian chert sequence, the Mississippian Ford Lake Shale, or Permian shallow-water Tahkandit Limestone or Step Conglomerate. NRF lithologies include fine-grained to pebbly turbidites assembled in both thinning- and fining-upward and thickening- and coarsening-upward cycles typical of middle to outer fan settings. Compositionally the grains are principally chert (green, gray, white, black, and rarely red) with minor amounts of vein quartz and quartz sandstone. Most of the chert seems to be replacement chert from a carbonate terrane, though some pebbles yield an Ordovician radiolarian assemblage. Paleocurrent flow directions based on thousands of bottom features (flutes, prods, and grooves) indicate, in present-day coordinates, flow toward the east. Individual azimuth directions are throughout the two easterly quadrants, by 60% of these data indicate flow between 045 and 150/sup 0/. This spread of data is consistent from outcrop to outcrop, indicating that there are no localized block rotations. Easterly flow has also been determined for the overlying Cretaceous units of the Kandik basin (Biederman Argillite and Kathul Graywacke).

  4. Hydrologic conditions and hazards in the Kennicott River basin, Wrangell-St. Elias National Park Preserve, Alaska

    USGS Publications Warehouse

    Rickman, R.L.; Rosenkrans, D.S.


    McCarthy, Alaska, is on the Kennicott River, about 1 mile from the terminus of Kennicott Glacier in the Wrangell-St. Elias National Park and Preserve. Most visitors to McCarthy and the park cross the West Fork Kennicott River using a hand-pulled tram and cross the East Fork Kennicott River on a temporary footbridge. Outburst floods from glacier-dammed lakes result in channel erosion, aggradation, and migration of the Kennicott River, which disrupt transportation links, destroy property, and threaten life. Hidden Creek Lake, the largest of six glacier-dammed lakes in the Kennicott River Basin, has annual outbursts that cause the largest floods on the Kennicott River. Outbursts from Hidden Creek Lake occur from early fall to mid-summer, and lake levels at the onset of the outbursts have declined between 1909 and 1995. Criteria for impending outbursts for Hidden Creek Lake include lake stage near or above 3,000 to 3,020 feet, stationary or declining lake stage, evidence of recent calving of large ice blocks from the ice margin, slush ice and small icebergs stranded on the lakeshore, and fresh fractures in the ice-margin region. The lower Kennicott Glacier has thinned and retreated since about 1860. The East and West Fork Kennicott River channels migrated in response to changes in the lower Kennicott Glacier. The largest channel changes occur during outburst floods from Hidden Creek Lake, whereas channel changes from the other glacier-dammed lake outbursts are small. Each year, the West Fork Kennicott River conveys a larger percentage of the Kennicott Glacier drainage than it did the previous year. Outburst floods on the Kennicott River cause the river stage to rise over a period of several hours. Smaller spike peaks have a very rapid stage rise. Potential flood magnitude was estimated by combining known maximum discharges from Hidden Creek Lake and Lake Erie outburst floods with a theoretical large regional flood. Flood hazard areas at the transportation corridor were

  5. Genome analysis and signature discovery for diving and sensory properties of the endangered Chinese alligator

    PubMed Central

    Wan, Qiu-Hong; Pan, Sheng-Kai; Hu, Li; Zhu, Ying; Xu, Peng-Wei; Xia, Jin-Quan; Chen, Hui; He, Gen-Yun; He, Jing; Ni, Xiao-Wei; Hou, Hao-Long; Liao, Sheng-Guang; Yang, Hai-Qiong; Chen, Ying; Gao, Shu-Kun; Ge, Yun-Fa; Cao, Chang-Chang; Li, Peng-Fei; Fang, Li-Ming; Liao, Li; Zhang, Shu; Wang, Meng-Zhen; Dong, Wei; Fang, Sheng-Guo


    Crocodilians are diving reptiles that can hold their breath under water for long periods of time and are crepuscular animals with excellent sensory abilities. They comprise a sister lineage of birds and have no sex chromosome. Here we report the genome sequence of the endangered Chinese alligator (Alligator sinensis) and describe its unique features. The next-generation sequencing generated 314 Gb of raw sequence, yielding a genome size of 2.3 Gb. A total of 22 200 genes were predicted in Alligator sinensis using a de novo, homology- and RNA-based combined model. The genetic basis of long-diving behavior includes duplication of the bicarbonate-binding hemoglobin gene, co-functioning of routine phosphate-binding and special bicarbonate-binding oxygen transport, and positively selected energy metabolism, ammonium bicarbonate excretion and cardiac muscle contraction. Further, we elucidated the robust Alligator sinensis sensory system, including a significantly expanded olfactory receptor repertoire, rapidly evolving nerve-related cellular components and visual perception, and positive selection of the night vision-related opsin and sound detection-associated otopetrin. We also discovered a well-developed immune system with a considerable number of lineage-specific antigen-presentation genes for adaptive immunity as well as expansion of the tripartite motif-containing C-type lectin and butyrophilin genes for innate immunity and expression of antibacterial peptides. Multifluorescence in situ hybridization showed that alligator chromosome 3, which encodes DMRT1, exhibits significant synteny with chicken chromosome Z. Finally, population history analysis indicated population admixture 0.60-1.05 million years ago, when the Qinghai-Tibetan Plateau was uplifted. PMID:23917531

  6. The Good, the Bad, and the Unknown: Microbial Symbioses of the American Alligator.


    Keenan, Sarah W; Elsey, Ruth M


    Vertebrates coexist with microorganisms in diverse symbiotic associations that range from beneficial to detrimental to the host. Most research has aimed at deciphering the nature of the composite microbial assemblage's genome, or microbiome, from the gastrointestinal (GI) tract and skin of mammals (i.e., humans). In mammals, the GI tract's microbiome aids digestion, enhances uptake of nutrients, and prevents the establishment of pathogenic microorganisms. However, because the GI tract microbiome of the American alligator (Alligator mississippiensis) is distinct from that of all other vertebrates studied to date, being comprised of Fusobacteria in the lower GI tract with lesser abundances of Firmicutes, Proteobacteria, and Bacteroidetes, the function of these assemblages is largely unknown. This review provides a synthesis of our current understanding of the composition of alligators' microbiomes, highlights the potential role of microbiome members in alligators' health (the good), and presents a brief summary of microorganisms detrimental to alligators' health (the bad) including Salmonella spp. and others. Microbial assemblages of the GI tract have co-evolved with their vertebrate host over geologic time, which means that evolutionary hypotheses can be tested using information about the microbiome. For reptiles and amphibians, the number of taxa studied at present is limited, thereby restricting evolutionary insights. Nevertheless, we present a compilation of our current understanding of reptiles' and amphibians' microbiomes, and highlight future avenues of research (the unknown). As in humans, composition of microbiome assemblages provides a promising tool for assessing hosts' health or disease. By further exploring present-day associations between symbiotic microorganisms in the microbiomes of reptiles and amphibians, we can better identify good (beneficial) and bad (detrimental) microorganisms, and unravel the evolutionary history of the acquisition of

  7. National Water-Quality Assessment Program: Data collection in the Red River of the North Basin, Minnesota, North Dakota, and South Dakota, 1992-95

    USGS Publications Warehouse

    Stoner, J.D.; Lorenz, D.L.


    A water-quality assessment began in 1991 for the Red River of the North (Red River) Basin as part of a national study. Data collection for the reconnainssance and intensive phases of the study briefly is described for each of the major components (streams, aquatic biology, and ground water) used to assess regional water quality. The data will be analyzed to address national and local water-quality concerns.

  8. 75 FR 45089 - Rogue River-Siskiyou National Forest, Oregon; Motorized Vehicle Use on the Rogue River-Siskiyou...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Routes and Areas for Motor Vehicle Use, Final Rule that was published on November 9, 2005 (70 FR 216... Register (FR Vol. 70, No. 216-- Nov. 9, 2005, pp 68264-68291). This final Travel Management Rule requires...-Siskiyou National Forest; Intent to Prepare a Supplemental Environmental Impact Statement (SEIS) To...

  9. The oldest record of Alligator sinensis from the Late Pliocene of Western Japan, and its biogeographic implication

    NASA Astrophysics Data System (ADS)

    Iijima, Masaya; Takahashi, Keiichi; Kobayashi, Yoshitsugu


    The late Cenozoic fossil record of alligators in East Asia is crucial in understanding the origin and past distribution of Asian alligators that are now represented by a single species, Alligator sinensis. This study reports a partial skeleton of A. sinensis from the Late Pliocene (approximately 3.0 Ma) of western Japan. This Japanese A. sinensis is large in size (>200 cm total length), comparable to the maximum size of extant individuals. It demonstrates the oldest record of A. sinensis and wider distribution of this species in the past. Tectonic and geographic history of East Asia suggests that alligators presumably dispersed into Japan before 25 Ma or after 10 Ma, yet finally were wiped out from Japan due to the semi-isolated condition of the Japanese island arc and the deteriorated climate during the Plio-Pleistocene.

  10. Quality of rivers of the United States, 1975 water year; based on the National Stream Quality Accounting Network (NASQAN)

    USGS Publications Warehouse

    Briggs, John C.; Ficke, John F.


    The National Stream Quality Accounting Network (NASQAN) was established by the U.S. Geological Survey to provide a nationally uniform basis for continuously assessing the quality of U.S. rivers. Stations generally are at the downstream end of hydrologic accounting units in order to measure the quantity and quality of water flowing from the units. Data are available on a large number of water-quality constituents measured at 345 stations during the 1975 water year. Temperature data (usually continuous or daily measurements) from NASQAN stations were fitted to a first order harmonic equation and the parameters for the harmonic function are reported for each station. Considering chemical and biological characteristics of U.S. streams as described by NASQAN data, water quality is best (by many standards) in the Northeast, Southeast, and Northwest. Many of these waters show the effects of pollution and carry moderate or high levels of major nutrients. High counts of indicator bacteria also show signs of local pollution. In the Northeast, some heavy metals are at moderate levels, but not above most water-quality criteria. Rivers of most of the Mid-Continent and Southwest reflect the arid or semi-arid climate, erodible soils, and agricultural activities. A special analysis was made to study the patterns of dissolved solids, major nutrients, phytoplankton, and zinc in the Mississippi River above Memphis, Tennessee. (Kosco-USGS)

  11. Quality of rivers of the United States, 1974 water year: based on the National Stream Quality Accounting Network (NASQAN)

    USGS Publications Warehouse

    Hawkinson, Richard O.; Ficke, John F.; Saindon, L.G.


    The National Stream Quality Accounting Network (NASQAN) was established by the U.S Geological Survey to determine and compare the quality at key locations on the Nation 's major rivers. There are 345 stations in the network--data from the first 101 of these (those operating during the 1974 water year) are summarized in this report. Temperature data from NASQAN stations have been summarized for each station. At most stations the harmonic provides an estimate of daily temperatures with a standard error of estimate of 2.5 degrees C or less. According to 1974 water-year data summarized from NASQAN operations, water quality of the rivers of the United States is best (by most standards) in the Northeast, Southeast, and Northwest. Waters there generally are low in dissolved solids and major and minor chemical constitutents, generally are soft (except in Florida), and carry relatively small amounts of sediment. However, many of these waters carry moderate or high levels of major nutrients and have correspondingly high populations of attached and floating plants. High counts of indicator bacteria also show signs of local pollution at some sites. Rivers of most of the Midcontinent and Southwest are characterized by moderate to high levels of dissolved major and minor constituents, sediment, major nutrients, and biota (floating and attached aquatic plants and indicator bacteria. (Woodard-USGS)

  12. 76 FR 34859 - Safety Zone; Augusta Southern Nationals Drag Boat Race, Savannah River, Augusta, GA

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Augusta Southern Nationals Drag Boat Race... during the Augusta Southern Nationals Drag Boat Race. The Augusta Southern Nationals Drag Boat Race will..., 2011 Augusta Southern Nationals, Inc. is hosting the Augusta Southern Nationals Drag Boat Race,...

  13. Microbiological Water Quality in Relation to Water-Contact Recreation, Cuyahoga River, Cuyahoga Valley National Park, Ohio, 2000 and 2002

    USGS Publications Warehouse

    Bushon, Rebecca N.; Koltun, G.F.


    The microbiological water quality of a 23-mile segment of the Cuyahoga River within the Cuyahoga Valley National Park was examined in this study. This segment of the river receives discharges of contaminated water from stormwater, combined-sewer overflows, and incompletely disinfected wastewater. Frequent exceedances of Ohio microbiological water-quality standards result in a health risk to the public who use the river for water-contact recreation. Water samples were collected during the recreational season of May through October at four sites on the Cuyahoga River in 2000, at three sites on the river in 2002, and from the effluent of the Akron Water Pollution Control Station (WPCS) both years. The samples were collected over a similar range in streamflow in 2000 and 2002. Samples were analyzed for physical and chemical constituents, as well as the following microbiological indicators and pathogenic organisms: Escherichia coli (E. coli), Salmonella, F-specific and somatic coliphage, enterovirus, infectious enterovirus, hepatitis A virus, Clostridium perfringens (C. perfringens), Cryptosporidium, and Giardia. The relations of the microorganisms to each other and to selected water-quality measures were examined. All microorganisms analyzed for, except Cryptosporidium, were detected at least once at each sampling site. Concentrations of E. coli exceeded the Ohio primary-contact recreational standard (298 colonies per 100 milliliters) in approximately 87 percent of the river samples and generally were higher in the river samples than in the effluent samples. C. perfringens concentrations were positively and significantly correlated with E. coli concentrations in the river samples and generally were higher in the effluent samples than in the river samples. Several of the river samples that met the Ohio E. coli secondary-contact recreational standard (576 colonies per 100 milliliters) had detections of enterovirus, infectious enterovirus, hepatitis A virus, and

  14. Debris flows in Grand Canyon National Park, Arizona: magnitude, frequency and effects on the Colorado River

    USGS Publications Warehouse

    Melis, Theodre S.; Webb, Robert H.; ,


    Debris flows are recurrent sediment-transport processes in 525 tributaries of the Colorado River in Grand Canyon. Arizona. Initiated by slope failures in bedrock and (or) colluvium during intense rainfall, Grand Canyon debris flows are high-magnitude, short-duration floods. Debris flows in these tributaries transport very large boulders into the river where they accumulate on debris fans and form rapids. The frequency of debris flows range from less than 1 per century to 10 or more per century in these tributaries. Before regulation by Glen Canyon Dam in 1963, high-magnitude floods on the Colorado River reworked debris fans by eroding all particles except large boulders. Because flow regulation has substantially decreased the river's competence, debris flows occurring after 1963 have increased accumulation of finer-grained sediments on debris fans and in rapids.

  15. Community Survey Results for Rappahannock River Valley National Wildlife Refuge: Completion Report

    USGS Publications Warehouse

    Sexton, Natalie R.; Stewart, Susan C.; Koontz, Lynne


    This report provides a summary of results for the survey of residents of communities adjacent to Rappahannock River Valley NWR conducted from the spring through the summer in 2006. This research was commissioned by the Northeast Region of the U.S. Fish and Wildlife Service in support of the Rappahannock River Valley NWR CCP and conducted by the Policy Analysis and Science Assistance Branch (PASA) of the U.S. Geological Survey/Fort Collins Science Center.

  16. The River EdenDTC Project: A National Demonstration Test Catchment

    NASA Astrophysics Data System (ADS)

    Benskin, C.; Surridge, B.; Deasy, C.; Woods, C.; Rimmer, D.; Lees, E.; Owens, G.; Jonczyk, J.; Quinton, J.; Wilkinson, M.; Perks, M.; Quinn, P.; Barker, P.; Haygarth, P.; Burke, S.; Reaney, S.; Watson, N.


    Our environment is a complex system of interactions between natural process and anthropogenic activities that disrupt them. It is crucial to manage the balance for continued food production whilst maintaining the quality of the environment. The challenges we face include managing the impact of agricultural land use on aquatic quality and biodiversity as an integral system, rather than as separate issues. In order to do this, it is critical to understand how the different components are linked - how does land use affect our water courses and ground water, and their associated ecosystems, and how can the impact of agricultural land use on these systems be minimised? Regulating farm nutrient management through measures that minimise sources, their exposure to mobilisation, and reduce drainage pathways to water courses are all fundamental to the UK's approach to meeting the Water Framework Directive objective of achieving 'good ecological status' in all surface and groundwater bodies by 2015. The EdenDTC project is part of a 5-year national Demonstration Test Catchments (DTC) environmental scheme, aiming to understand the above issues through combining scientific research with local knowledge and experience from multiple stakeholders. The DTC project is a 5-year initiative by Defra, Welsh Assembly Government and the Environment Agency, which encompasses a research platform covering three distinct river catchments: the Eden in Cumbria; the Wensum in Norfolk; and the Avon in Hampshire. Within the EdenDTC, the impact and effects of multiple diffuse pollutants on ecosystems and sustainable food production are being studied on a river catchment scale. Three 10 km2 focus catchments, selected to represent the different farming practices and geologies observed across the Eden, have been instrumented to record the dynamics of agricultural diffuse pollution at multiple scales. Within each focus catchment, two sub-catchments were selected: one control and one mitigation, in which

  17. Understanding sources of carbon from a coastal mangrove forest: Shark River - Everglades National Park

    NASA Astrophysics Data System (ADS)

    Palya, A. P.; Anderson, W. T.; Jaffe, R.; Swart, P. K.


    enables us to analyze up to 24 samples per day, allowing for a more rapid sample throughput than alternative δ13C-DOC analytical methods including WCO-IRMS. This method was applied to marine samples collected from Shark River (SR) located on the western edge of Everglades National Park. DOC concentrations for water in this estuary typically fall between 2 and 18 ppm, with salinities that range from fresh to marine (~30) where SR empties into the Gulf of Mexico. Water samples were collected from Florida Coastal Everglades LTER sampling sites located in SR and analyzed for DOC concentration and δ13C-DOC composition. DOC concentration ranged from 6 to 15 ppm and δ13C-DOC values were between -32 and -27.8‰. These results are also compared to the δ13C-DIC data from the same samples. These results indicate that mangroves are the major contributor to the DOC pool in SR. The new WCO-CRDS method will enable us to continue analysis of DOC and δ13C-DOC in marine waters, such as the Shark River estuary, to better understand C dynamics. With this approach will be able to build a dataset to help identify spatial and temporal variations in and controls on DOC and δ13C-DOC in these coastal marine settings, which are an important interface between atmospheric and oceanic carbon reservoirs.

  18. Taxonomic assessment of Alligator Snapping Turtles (Chelydridae: Macrochelys), with the description of two new species from the southeastern United States.


    Thomas, Travis M; Granatosky, Michael C; Bourque, Jason R; Krysko, Kenneth L; Moler, Paul E; Gamble, Tony; Suarez, Eric; Leone, Erin; Roman, Joe


    The Alligator Snapping Turtle, Macrochelys temminckii, is a large, aquatic turtle limited to river systems that drain into the Gulf of Mexico. Previous molecular analyses using both mitochondrial and nuclear DNA suggested that Macrochelys exhibits significant genetic variation across its range that includes three distinct genetic assemblages (western, central, and eastern = Suwannee). However, no taxonomic revision or morphological analyses have been conducted previously. In this study, we test previous hypotheses of distinct geographic assemblages by examining morphology, reanalyzing phylogeographic genetic structure, and estimating divergence dating among lineages in a coalescent framework using Bayesian inference. We reviewed the fossil record and discuss phylogeographic and taxonomic implications of the existence of three distinct evolutionary lineages. We measured cranial (n=145) and post-cranial (n=104) material on field-captured individuals and museum specimens. We analyzed 420 base pairs (bp) of mitochondrial DNA sequence data for 158 Macrochelys. We examined fossil Macrochelys from ca. 15-16 million years ago (Ma) to the present to better assess historical distributions and evaluate named fossil taxa. The morphological and molecular data both indicate significant geographical variation and suggest three species-level breaks among genetic lineages that correspond to previously hypothesized genetic assemblages. The holotype of Macrochelys temminckii is from the western lineage. Therefore, we describe two new species as Macrochelys apalachicolae sp. nov. from the central lineage and Macrochelys suwanniensis sp. nov. from the eastern lineage (Suwannee River drainage). Our estimates of divergence times suggest that the most recent common ancestor (MRCA) of M. temminckii (western) and M. apalachicolae (central) existed 3.2-8.9 Ma during the late Miocene to late Pliocene, whereas M. temminckii-M. apalachicolae and M. suwanniensis last shared a MRCA 5.5-13.4 Ma

  19. Mercury and water-quality data from Rink Creek, Salmon River, and Good River, Glacier Bay National Park and Preserve, Alaska, November 2009-October 2011

    USGS Publications Warehouse

    Nagorski, Sonia A.; Neal, Edward G.; Brabets, Timothy P.


    Glacier Bay National Park and Preserve (GBNPP), Alaska, like many pristine high latitude areas, is exposed to atmospherically deposited contaminants such as mercury (Hg). Although the harmful effects of Hg are well established, information on this contaminant in southeast Alaska is scarce. Here, we assess the level of this contaminant in several aquatic components (water, sediments, and biological tissue) in three adjacent, small streams in GBNPP that drain contrasting landscapes but receive similar atmospheric inputs: Rink Creek, Salmon River, and Good River. Twenty water samples were collected from 2009 to 2011 and processed and analyzed for total mercury and methylmercury (filtered and particulate), and dissolved organic carbon quantity and quality. Ancillary stream water parameters (discharge, pH, dissolved oxygen, specific conductance, and temperature) were measured at the time of sampling. Major cations, anions, and nutrients were measured four times. In addition, total mercury was analyzed in streambed sediment in 2010 and in juvenile coho salmon and several taxa of benthic macroinvertebrates in the early summer of 2010 and 2011.

  20. Effects of exploitation on black bear populations at White River National Wildlife Refuge

    USGS Publications Warehouse

    Clark, J.D.; Eastridge, R.; Hooker, M.J.


    We live-trapped American black bears (Ursus americanus) and sampled DNA from hair at White River National Wildlife Refuge, Arkansas, USA, to estimate annual population size (N), growth (λ), and density. We estimated N and λ with open population models, based on live-trapping data collected from 1998 through 2006, and robust design models for genotyped hair samples collected from 2004 through 2007. Population growth was weakly negative (i.e., 95% CI included 1.0) for males (0.901, 95% CI  =  0.645–1.156) and strongly negative (i.e., 95% CI excluded 1.0) for females (0.846, 95% CI  =  0.711–0.981), based on live-trapping data, with N from 1999 to 2006 ranging from 94.1 (95% CI  =  70.3–137.1) to 45.2 (95% CI  =  27.1–109.3), respectively, for males and from 151.4 (95% CI  =  127.6–185.8) to 47.1 (95% CI  =  24.4–140.4), respectively, for females. Likewise, mean annual λ based on hair-sampling data was weakly negative for males (0.742, 95% CI  =  0.043–1.441) and strongly negative for females (0.782, 95% CI  =  0.661–0.903), with abundance estimates from 2004 to 2007 ranging from 29.1 (95% CI  =  21.2–65.8) to 11.9 (95% CI  =  11.0–26.9), respectively, for males and from 54.4 (95% CI  =  44.3–77.1) to 27.4 (95% CI  = 24.9–36.6), respectively, for females. We attribute the decline in the number of females in this isolated population to a decrease in survival caused by a past translocation program and by hunting adjacent to the refuge. We suggest that managers restructure the quota-based harvest limits until these growth rates recover.

  1. Water quality of the Tlikakila River and five major tributaries to Lake Clark, Lake Clark National Park and Preserve, Alaska, 1999-2001

    USGS Publications Warehouse

    Brabets, Timothy P.


    The Tlikakila River Basin, located in Lake Clark National Park and Preserve, drains an area of 622 square miles. This watershed comprises about 21 percent of the Lake Clark Basin, making it one of the major tributaries to Lake Clark. Due to a sharp decline in sockeye salmon population and the lack of hydrologic data, the Tlikakila River and five other major tributaries to Lake Clark were studied during the summer runoff months (May through September) from 1999 through 2001 as part of a cooperative study with the National Park Service. Measurements of pH and dissolved oxygen concentrations of the Tlikakila River are within acceptable limits for fish survival. Water temperatures at the measurement site reach 0 ?C during the winter and this part of the Tlikakila River may not be suitable for fish. Water temperatures are within acceptable limits for fish during the summer months. The Tlikakila River is a calcium bicarbonate type water with a low buffering capacity. Concentrations of un-ionized ammonia are well below the recommended value of 0.02 mg/L for fish propagation. Annual transport of suspended sediment by the Tlikakila River into Lake Clark ranged from 0.4 to 1.5 million tons during 1999?2001. The fine sediment from the Tlikakila River disperses through the lake over the summer, affecting light transmissivity. Most runoff from the Tlikakila River occurs from mid-to-late May through September. Average discharge for these months during 1999?2001 was 6,600 ft?/s. Total annual inflow to Lake Clark from the Tlikakila River ranged from 32 to 45 percent of the total inflow. The relatively high proportion of inflow is due to the presence of glaciers, which comprise 36 percent of the watershed. Monthly measurements of flow, field water-quality parameters, alkalinity, and suspended sediment were collected on the remaining five tributaries to Lake Clark: the Chokotonk River, Currant Creek, the Kijik River, the Tanalian River and the Chulitna River. Similar to the

  2. Seasonal acclimatisation of muscle metabolic enzymes in a reptile (Alligator mississippiensis).


    Seebacher, Frank; Guderley, Helga; Elsey, Ruth M; Trosclair, Phillip L


    Reptiles living in heterogeneous thermal environments are often thought to show behavioural thermoregulation or to become inactive when environmental conditions prevent the achievement of preferred body temperatures. By contrast, thermally homogeneous environments preclude behavioural thermoregulation, and ectotherms inhabiting these environments (particularly fish in which branchial respiration requires body temperature to follow water temperature) modify their biochemical capacities in response to long-term seasonal temperature fluctuations. Reptiles may also be active at seasonally varying body temperatures and could, therefore, gain selective advantages from regulating biochemical capacities. Hence, we tested the hypothesis that a reptile (the American alligator Alligator mississippiensis) that experiences pronounced seasonal fluctuations in body temperature will show seasonal acclimatisation in the activity of its metabolic enzymes. We measured body temperatures of alligators in the wild in winter and summer (N=7 alligators in each season), and we collected muscle samples from wild alligators (N=31 in each season) for analysis of metabolic enzyme activity (lactate dehydrogenase, citrate synthase and cytochrome c oxidase). There were significant differences in mean daily body temperatures between winter (15.66+/-0.43 degrees C; mean +/- S.E.M.) and summer (29.34+/-0.21 degrees C), and daily body temperatures fluctuated significantly more in winter compared with summer. Alligators compensated for lower winter temperatures by increasing enzyme activities, and the activities of cytochrome c oxidase and lactate dehydrogenase were significantly greater in winter compared with summer at all assay temperatures. The activity of citrate synthase was significantly greater in the winter samples at the winter body temperature (15 degrees C) but not at the summer body temperature (30 degrees C). The thermal sensitivity (Q(10)) of mitochondrial enzymes decreased

  3. Stratigraphy of the unsaturated zone and the Snake River Plain aquifer at and near the Idaho National Engineering Laboratory, Idaho

    SciTech Connect

    Anderson, S.R.; Liszewski, M.J.


    The unsaturated zone and the Snake River Plain aquifer at and near the Idaho National Engineering Laboratory (INEL) are made up of at least 178 basalt-flow groups, 103 sedimentary interbeds, 6 andesite-flow groups, and 4 rhyolite domes. Stratigraphic units identified in 333 wells in this 890-mile{sup 2} area include 121 basalt-flow groups, 102 sedimentary interbeds, 6 andesite-flow groups, and 1 rhyolite dome. Stratigraphic units were identified and correlated using the data from numerous outcrops and 26 continuous cores and 328 natural-gamma logs available in December 1993. Basalt flows make up about 85% of the volume of deposits underlying the area.

  4. Flow velocity, water temperature, and conductivity in Shark River Slough, Everglades National Park, Florida: June 2002-July 2003

    USGS Publications Warehouse

    Riscassi, Ami L.; Schaffranek, Raymond W.


    The data described in this report were collected in the U. S. Geological Survey (USGS) Priority Ecosystems Science project investigating Forcing Effects on Flow Structure in Vegetated Wetlands of the Everglades. Data collected at five locations in Shark River Slough, Everglades National Park, during the 2002-2003 wet season are documented in the report. Methods used to process the data are described. Daily mean flow velocities, water temperatures, and specific conductance values are presented in the appendices. The quality-checked and edited data have been compiled and stored on the USGS South Florida Information Access (SOFIA) website

  5. A bill to reauthorize the Rivers of Steel National Heritage Area, the Lackawanna Valley National Heritage Area, the Delaware and Lehigh National Heritage Corridor, and the Schuylkill River Valley National Heritage Area.

    THOMAS, 113th Congress

    Sen. Casey, Robert P., Jr. [D-PA


    07/31/2013 Committee on Energy and Natural Resources Subcommittee on National Parks. Hearings held. With printed Hearing: S.Hrg. 113-93. (All Actions) Tracker: This bill has the status IntroducedHere are the steps for Status of Legislation:

  6. Water quality and quantity of selected springs and seeps along the Colorado River corridor, Utah and Arizona: Arches National Park, Canyonlands National Park, Glen Canyon National Recreation Area, and Grand Canyon National Park, 1997-98

    USGS Publications Warehouse

    Taylor, Howard E.; Spence, John R.; Antweiler, Ronald C.; Berghoff, Kevin; Plowman, Terry I.; Peart, Dale B.; Roth, David A.


    The U.S. Geological Survey, in cooperation with the National Park Service conducted an intensive assessment of selected springs along the Colorado River Corridor in Arches National Park, Canyonlands National Park, Glen Canyon National Recreation Area, and Grand Canyon National Park in 1997 and 1998, for the purpose of measuring and evaluating the water quality and quantity of the resource. This study was conducted to establish baseline data for the future evaluation of possible effects from recreational use and climate change. Selected springs and seeps were visited over a study period from 1997 to 1998, during which, discharge and on-site chemical measurements were made at selected springs and seeps, and samples were collected for subsequent chemical laboratory analysis. This interdisciplinary study also includes simultaneous studies of flora and fauna, measured and sampled coincidently at the same sites. Samples collected during this study were transported to U.S. Geological Survey laboratories in Boulder, Colorado, where analyses were performed using state-of-the-art laboratory technology. The location of the selected springs and seeps, elevation, geology, aspect, and onsite measurements including temperature, discharge, dissolved oxygen, pH, and specific conductance, were recorded. Laboratory analyses include determinations for alkalinity, aluminum, ammonium (nitrogen), antimony, arsenic, barium, beryllium, bismuth, boron, bromide, cadmium, calcium, cerium, cesium, chloride, chromium, cobalt, copper, dissolved inorganic carbon, dissolved organic carbon, dysprosium, erbium, europium, fluoride, gadolinium, holmium, iodine, iron, lanthanum, lead, lithium, lutetium, magnesium, manganese, mercury, molybdenum, neodymium, nickel, nitrate (nitrogen), nitrite (nitrogen), phosphate, phosphorus, potassium, praseodymium, rhenium, rubidium, samarium, selenium, silica, silver, sodium, strontium, sulfate, tellurium, terbium, thallium, thorium, thulium, tin, titanium, tungsten

  7. 77 FR 64541 - Trinity River National Wildlife Refuge, Liberty County, TX; Final Comprehensive Conservation Plan...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... process for Trinity River NWR. We started this process through a notice in the Federal Register (72 FR... comments in a notice of availability in the Federal Register (77 FR 18853-18856; March 28, 2012). The..., including opportunities for hunting, fishing, wildlife observation and photography, and...

  8. 77 FR 18853 - Trinity River National Wildlife Refuge, Liberty County, TX; Comprehensive Conservation Plan and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... will announce upcoming public meetings in local news media. ADDRESSES: You may submit comments or... this process through a notice in the Federal Register (72 FR 45059; August 10, 2007). The Trinity River... opportunities available to the public, including opportunities for wildlife observation and photography,...

  9. 78 FR 1832 - Nez Perce-Clearwater National Forests; Id; Crooked River Valley Rehabilitation Project

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-01-09 ''. 2. On the same page, in the same column, in the thirty-fourth through thirty-sixth lines, `` http://www.fs.fed.usinepa/fs-usda-pop.php/?project=40648 '' should read `` ''. BILLING CODE 1505-01-D...

  10. 78 FR 13692 - Clarks River National Wildlife Refuge, KY; Final Comprehensive Conservation Plan/Land Protection...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ..., we describe how we will manage this refuge for the next 15 years. ADDRESSES: You may obtain a copy of... administering Clarks River NWR for the next 15 years. The LPP will expand the current acquisition boundary of... is to provide refuge managers with a 15-year plan for achieving refuge purposes and...

  11. The Evolution of the Lower Missouri River: National Mapping Discipline Research at Lisbon Bottom

    USGS Publications Warehouse



    Before 1800, the Missouri River was one of North America's most diverse and dynamic ecosystems. During the past 200 years, civil engineering has transformed it into a navigation system regulated by reservoirs and confined by bank stabilization and flood control structures. These modifications have reduced seasonal flow variability and sediment load and have disconnected the river from backwater, off-channel, and floodplain habitats. Flooding along the Lower Missouri River in 1993 and again in 1996 created a side-channel chute across Lisbon Bottom, a well-formed loop bottom near Glasgow, Mo. The formation and subsequent development of the chute have provided USGS scientists with a glimpse of a preregulated Missouri River. Knowledge of geologic characteristics and processes in an alluvial setting like Lisbon Bottom provides a scientific basis for floodplain management. This knowledge is also vital to a complete understanding of riverine habitat disturbance, recovery, and rehabilitation. A critical component of this knowledge is an understanding of the spatial and temporal relationships between riverine habitats and geomorphic processes.

  12. Contaminants in American alligator eggs from Lake Apopka, Lake Griffin, and Lake Okeechobee, Florida

    USGS Publications Warehouse

    Heinz, G.H.; Percival, H.F.; Jennings, Michael L.


    Residues of organochlorine pesticides, polychlorinated biphenyls (PCBs), and 16 elements were measured in American alligator (Alligator mississippiensis) eggs collected in 1984 from Lakes Apopka, Griffin, and Okeechobee in central and south Florida. Organochlorine pesticides were highest in eggs from Lake Apopka. None of the elements appeared to be present at harmful concentrations in eggs from any of the lakes. A larger sample of eggs was collected in 1985, but only from Lakes Griffin, a lake where eggs were relatively clean, and Apopka, where eggs were most contaminated. In 1985, hatching success of artificially incubated eggs was lower for Lake Apopka, and several organochlorine pesticides were higher than in eggs from Lake Griffin. However, within Lake Apopka, higher levels of pesticides in chemically analyzed eggs were not associated with reduced hatching success of the remaining eggs in the clutch. Therefore, it did not appear that any of the pesticides we measured were responsible for the reduced hatching of Lake Apopka eggs.

  13. Regulatory peptides in the gastrointestinal tract of Alligator mississipiensis. An immunocytochemical study.


    Buchan, A M; Lance, V; Polak, J M


    The gastrointestinal tract of the alligator Alligator mississipiensis has been investigated for the presence of immunoreactivity to fourteen regulatory peptides all known to occur in the mammalian gut system. Mucosal endocrine cells reacting specifically with the antisera to neurotensin, C-terminal gastrin, somatostatin, bombesin, secretin, pancreatic glucagon and enteroglucagon were detectable, the distribution of these cells being, in general, similar to the mammalian pattern. Peripheral nerve cell bodies and nerve fibres were detected with the antisera to vasoactive intestinal polypeptide, substance P, bombesin and somatostatin again with a distribution similar to that seen in mammals. No immunoreactivity was observed with the available antisera to glicentin, motilin, gastric inhibitory polypeptide, gastrin 34, cholecystokinin 9-20 and met-enkephalin.

  14. Hydrodynamic analysis, performance assessment, and actuator design of a flexible tail propulsor in an artificial alligator

    NASA Astrophysics Data System (ADS)

    Philen, Michael; Neu, Wayne


    The overall objective of this research is to develop analysis tools for determining actuator requirements and assessing viable actuator technology for design of a flexible tail propulsor in an artificial alligator. A simple hydrodynamic model that includes both reactive and resistive forces along the tail is proposed and the calculated mean thrust agrees well with conventional estimates of drag. Using the hydrodynamic model forces as an input, studies are performed for an alligator ranging in size from 1 cm to 2 m at swimming speeds of 0.3-1.8 body lengths per second containing five antagonistic pairs of actuators distributed along the length of the tail. Several smart materials are considered for the actuation system, and preliminary analysis results indicate that the acrylic electroactive polymer and the flexible matrix composite actuators are potential artificial muscle technologies for the system.

  15. Determining the size of American alligators using hind-foot track length

    USGS Publications Warehouse

    Wilkinson, Philip M.; Rice, Kenneth G.


    Size distribution information is useful for crocodilian management, but can be hard to obtain. Indirect and less costly demographic inferences made from track measurements may be valuable for management decisions. We related hind-foot lengths (HF) with total length (TL) to determine if we could indirectly assess alligator size using track length. Regression showed that HF was an excellent predictor (F1,246= 15722.9, R2=0.98, P<0.01) of TL and track length was an exceptional predictor of HF (F1,14=7520.3, R2= 1.00, P<0.01). The correlation between track length and HF length also was significant (N= 15, r=0.99, P <0.01). Thus, alligator size can be accurately estimated from measures of track length at sites where capture and direct measurement is impractical.

  16. Assessment of sediments in the riverine impoundments of national wildlife refuges in the Souris River Basin, North Dakota

    USGS Publications Warehouse

    Tangen, Brian A.; Laubhan, Murray K.; Gleason, Robert A.


    Accelerated sedimentation of reservoirs and riverine impoundments is a major concern throughout the United States. Sediments not only fill impoundments and reduce their effective life span, but they can reduce water quality by increasing turbidity and introducing harmful chemical constituents such as heavy metals, toxic elements, and nutrients. U.S. Fish and Wildlife Service national wildlife refuges in the north-central part of the United States have documented high amounts of sediment accretion in some wetlands that could negatively affect important aquatic habitats for migratory birds and other wetland-dependent wildlife. Therefore, information pertaining to sediment accumulation in refuge impoundments potentially is important to guide conservation planning, including future management actions of individual impoundments. Lands comprising Des Lacs, Upper Souris, and J. Clark Salyer National Wildlife Refuges, collectively known as the Souris River Basin refuges, encompass reaches of the Des Lacs and Souris Rivers of northwestern North Dakota. The riverine impoundments of the Souris River Basin refuges are vulnerable to sedimentation because of the construction of in-stream dams that interrupt and slow river flows and because of post-European settlement land-use changes that have increased the potential for soil erosion and transport to rivers. Information regarding sediments does not exist for these refuges, and U.S. Fish and Wildlife Service personnel have expressed interest in assessing refuge impoundments to support refuge management decisions. Sediment cores and surface sediment samples were collected from impoundments within Des Lacs, Upper Souris, and J. Clark Salyer National Wildlife Refuges during 2004–05. Cores were used to estimate sediment accretion rates using radioisotope (cesium-137 [137Cs], lead-210 [210Pb]) dating techniques. Sediment cores and surface samples were analyzed for a suite of elements and agrichemicals, respectively. Examination of

  17. Source and fate of inorganic solutes in the Gibbon River, Yellowstone National Park, Wyoming, USA. I. Low-flow discharge and major solute chemistry

    NASA Astrophysics Data System (ADS)

    McCleskey, R. Blaine; Nordstrom, D. Kirk; Susong, David D.; Ball, James W.; Holloway, JoAnn M.


    The Gibbon River in Yellowstone National Park (YNP) is an important natural resource and habitat for fisheries and wildlife. However, the Gibbon River differs from most other mountain rivers because its chemistry is affected by several geothermal sources including Norris Geyser Basin, Chocolate Pots, Gibbon Geyser Basin, Beryl Spring, and Terrace Spring. Norris Geyser Basin is one of the most dynamic geothermal areas in YNP, and the water discharging from Norris is much more acidic (pH 3) than other geothermal basins in the upper-Madison drainage (Gibbon and Firehole Rivers). Water samples and discharge data were obtained from the Gibbon River and its major tributaries near Norris Geyser Basin under the low-flow conditions of September 2006. Surface inflows from Norris Geyser Basin were sampled to identify point sources and to quantify solute loading to the Gibbon River. The source and fate of the major solutes (Ca, Mg, Na, K, SiO 2, Cl, F, HCO 3, SO 4, NO 3, and NH 4) in the Gibbon River were determined in this study and these results may provide an important link in understanding the health of the ecosystem and the behavior of many trace solutes. Norris Geyser Basin is the primary source of Na, K, Cl, SO 4, and N loads (35-58%) in the Gibbon River. The largest source of HCO 3 and F is in the lower Gibbon River reach. Most of the Ca and Mg originate in the Gibbon River upstream from Norris Geyser Basin. All the major solutes behave conservatively except for NH 4, which decreased substantially downstream from Gibbon Geyser Basin, and SiO 2, small amounts of which precipitated on mixing of thermal drainage with the river. As much as 9-14% of the river discharge at the gage is from thermal flows during this period.

  18. Functional morphology of the Alligator mississippiensis larynx with implications for vocal production.


    Riede, Tobias; Li, Zhiheng; Tokuda, Isao T; Farmer, Colleen G


    Sauropsid vocalization is mediated by the syrinx in birds and the larynx in extant reptiles; but whereas avian vocal production has received much attention, the vocal mechanism of basal reptilians is poorly understood. The American alligator (Alligator mississippiensis) displays a large vocal repertoire during mating and in parent-offspring interactions. Although vocal outputs of these behaviors have received some attention, the underlying mechanism of sound production remains speculative. Here, we investigate the laryngeal anatomy of juvenile and adult animals by macroscopic and histological methods. Observations of the cartilaginous framework and associated muscles largely corroborate earlier findings, but one muscle, the cricoarytenoideus, exhibits a heretofore unknown extrinsic insertion that has important implications for effective regulation of vocal fold length and tension. Histological investigation of the larynx revealed a layered vocal fold morphology. The thick lamina propria consists of non-homogenous extracellular matrix containing collagen fibers that are tightly packed below the epithelium but loosely organized deep inside the vocal fold. We found few elastic fibers but comparatively high proportions of hyaluronan. Similar organizational complexity is also seen in mammalian vocal folds and the labia of the avian syrinx: convergent morphologies that suggest analogous mechanisms for sound production. In tensile tests, alligator vocal folds demonstrated a linear stress-strain behavior in the low strain region and nonlinear stress responses at strains larger than 15%, which is similar to mammalian vocal fold tissue. We have integrated morphological and physiological data in a two-mass vocal fold model, providing a systematic description of the possible acoustic space that could be available to an alligator larynx. Mapping actual call production onto possible acoustic space validates the model's predictions.

  19. Nutrient and organochlorine pesticide concentrations in American alligator eggs and their associations with clutch viability.


    Rauschenberger, R Heath; Sepúlveda, Maria S; Wiebe, Jon J; Wiebe, Janet E; Honeyfield, Dale C; Gross, Timothy S


    Since the early 1900s, the lakes of the Ocklawaha basin in central Florida have experienced ecological degradation due to anthropogenic development. One species affected by this degradation is the American alligator Alligator mississippiensis, which has suffered from poor clutch viability and embryo mortality. Although some studies indicate that organochlorine pesticides (OCPs) may be involved, OCPs do not account for all of the variation seen in hatch rates. Indeed, nutrition and non-OCP contaminants have been associated with developmental problems in fish and birds. Our study evaluated embryo mortality in alligators at reference and OCP-contaminated sites as a function of exposure to OCPs, polychlorinated biphenyls (PCBs), and polyaromatic hydrocarbons (PAHs), along with egg nutrients (Zn, Se, and vitamins A, E, and B1). The four-pronged study consisted of a case-control cohort study, an expanded field study, a topical egg treatment thiamine amelioration experiment, and a topical egg treatment thiamine antagonist experiment. The results from the two field studies suggested that the total thiamine levels in the eggs were positively associated with clutch viability and negatively associated with the lipid content and certain OCPs measured in egg yolks. In addition, PCBs, PAHs, Zn, Se, and vitamins A and E were not found to be associated with the observed clutch viability defects. The thiamine levels in the eggs explained 38% of the variation in clutch survival in the case-control cohort study and 27% in the expanded field study. The topical egg treatment experiments were successful in elevating the thiamine concentrations in the albumin but not the yolk. No significant differences were noted among treatment groups in either egg treatment experiment with respect to clutch survival. In summary, thiamine egg concentrations explain some of the variation in the clutch viability of free-ranging alligators, but the cause-effect relationships are still unclear. PMID


    NASA Technical Reports Server (NTRS)


    A big, toothy saurian grin is flashed by this alligator in the pond in front of the KSC Headquarters Building. And wy not? After years of namelessness, he [or she] has a name. The 'gator was dubbed Kasey following a ''Name the Gator'' contest in which scores of Spaceport employees submitted name suggestions. Kasey is one of two 'gators placed in the pond in an attempt to restore its natural ecology.

  1. Water-quality, streamflow, and ancillary data for nutrients in streams and rivers across the nation, 1992-2001

    USGS Publications Warehouse

    Mueller, David K.; Spahr, Norman E.


    Introduction: This report is the companion data report for: Nutrients in Streams and Rivers Across the Nation - 1992-2001 (D.K. Mueller and N.E. Spahr, U.S. Geological Survey written commun., 2005). The data contained in this report were collected as part of the National Water-Quality Assessment (NAWQA) Program. Investigations were conducted in 51 large river basins and aquifer systems, which are referred to as 'study units.' Implementation of study-unit investigations were phased so that high-intensity sampling occurred in about one-third of the study units at a time. Investigations in the first 20 study units began in 1991, and stream sampling began in 1992; however, most samples were collected during water years 1993-95. (Water year is defined as the period from October through September and is identified by the year in which it ends.) A second group of 16 study-unit investigations began in 1994, with most of the sampling completed during water years 1996-98. A third group, consisting of 15 study units, began in 1997 with most of the data collected during water years 1999-2001. At some sites, additional sampling continued after the high-intensity time period. Gilliom and others (1995) provide additional information about study-unit sampling design. Additional information about the NAWQA program is available at

  2. Additions to the aquatic diptera (Chaoboridae, Chironomidae, Culicidae, Tabanidae, Tipulidae) fauna of the White River National Wildlife Refuge, Arkansas

    USGS Publications Warehouse

    Chordas, Stephen W.; Hudson, Patrick L.; Chapman, Eric G.


    The dipteran fauna of Arkansas is generally poorly known. A previous study of the Aquatic macroinvertebrates of the White River National Wildlife Refuge, the largest refuge in Arkansas, reported only 12 diptera taxa out of 219 taxa collected (Chordas et al., 1996). Most of the dipterans from this study were identified only to the family level. The family Chironomidae is a large, diverse group and was predicted to be much more diverse in the refuge than indicated by previous studies. In this study, Chironomidae were targeted, with other aquatic or semiaquatic dipterans also retained, in collections designed to better define the dipteran fauna of the White River National Wildlife Refuge. Adult dipterans were collected from 22 sites within the refuge using sweep-nets, two types of blacklight traps, and lighted fan traps in June of 2001. Specimens from previous studies were retrieved and identified to the lowest possible taxonomic level. A total of 4,917 specimens representing 122 taxa was collected. The 122 taxa were comprised of the following: two chaoborids, 83 chironomids, 15 culicids, nine tabanids, and 13 tipulids. Of these, 46 species are new state records for Arkansas. Nine undescribed species of chironomids were collected, and eight species records represent significant range extensions.

  3. Biosorption of As(V) onto dried alligator weed root: role of metal (hydro) oxides.


    Chen, Jian; Tao, Weihua; Sun, Cheng


    The present work investigates the adsorption of As(V) onto the dried powder of alligator weed root as bio-sorbent, using acid pre-treated alligator weed root powder as the reference. The isotherm study suggested there is a favorable As(V) adsorption happened on the AWR surface. The batch adsorption experimental results indicated that the ionic strength has little impact on the adsorption, while the solution pH has a significant effect on the adsorption with apparent inhibition appearing in both extreme acidic and alkaline pH region. In addition, the properties of the biosorbent were characterized by various techniques including SEM-EDS, FT-IR, and ICP detection. The analysis results suggested that the metals including Mn, Fe, and Al enrich over the alligator weed root surface in the morphology of metal (hydro) oxide. Based on the nature of the biosorbent and As(V) besides the adsorption performance, the metal (hydro) oxides over biosorbent surface is suggested as the essential role to drive the adsorption. With the metal (hydro) oxides denuded in the pre-treatment, the biosorbent loses its adsorption capability for As(V) totally.

  4. Incubation history prior to the canonical thermosensitive period determines sex in the American alligator.


    McCoy, Jessica A; Parrott, Benjamin B; Rainwater, Thomas R; Wilkinson, Phillip M; Guillette, Louis J


    Despite the widespread occurrence of environmental sex determination (ESD) among vertebrates, our knowledge of the temporal dynamics by which environmental factors act on this process remains limited. In many reptiles, incubation temperature determines sex during a discrete developmental window just prior to and coincident with the differentiation of the gonads. Yet, there is substantial variation in sex ratios among different clutches of eggs incubated at identical temperatures during this period. Here, we test the hypothesis that temperatures experienced prior to the reported thermosensitive period for alligators (Alligator mississippiensis) can impact how the sex determination system responds to thermal cues later in development. Temperature shift experiments on eggs collected from the field within 24  h of oviposition were employed to decouple various maternal influences from thermal effects, and results demonstrate a previously undefined window of thermosensitivity occurring by stage 15 of embryonic development, six stages earlier than previously reported. We also examine the intrasexual expression of several male- and female-biased genes and show that while male-biased genes display no intrasexual differences, ovarian CYP19A1 (aromatase) transcript abundance differs by approximately twofold depending on thermal exposures experienced at early stages of embryonic development. These findings expand our understanding of the ESD in the alligator and provide the rationale for reevaluation of the temporal dynamics of sex determination in other crocodilians. PMID:26183894

  5. Do egg-laying crocodilian (Alligator mississippiensis) archosaurs form medullary bone?


    Schweitzer, M H; Elsey, R M; Dacke, C G; Horner, J R; Lamm, E-T


    It is beyond question that Mesozoic dinosaurs, like Aves and Crocodylia, are archosaurs. However, within the archosaurian clade, the origin and distribution of some major features are less clear, particularly with respect to reproductive physiology. Medullary bone, a highly mineralized, bony reproductive tissue present in the endosteal cavities of all extant egg-laying birds thus far examined, has recently been reported in Tyrannosaurus rex. Its presence or absence in extant crocodilians, therefore, may shed light on the timing of its evolutionary appearance. If medullary bone is present in all three taxa, it arose before the three lineages diverged. However, if medullary bone arose after this divergence, it may be present in both extinct dinosaurs and birds, or in birds only. If present in extinct dinosaurs and birds, but not crocodilians, it would indicate that it arose in the common ancestor of this clade, thus adding support to the closer phylogenetic relationship of dinosaurs and birds relative to crocodilians. Thus, the question of whether the crocodilian Alligator mississippiensis forms medullary bone during the production of eggs has important evolutionary significance. Our examination of long bones from several alligators (two alligators with eggs in the oviducts, one that had produced eggs in the past but was not currently in reproductive phase, an immature female and an adult male) shows no differences on the endosteal surfaces of the long bones, and no evidence of medullary bone, supporting the hypothesis that medullary bone first evolved in the dinosaur-bird line, after the divergence of crocodilians from this lineage.

  6. Biosorption of As(V) onto dried alligator weed root: role of metal (hydro) oxides.


    Chen, Jian; Tao, Weihua; Sun, Cheng


    The present work investigates the adsorption of As(V) onto the dried powder of alligator weed root as bio-sorbent, using acid pre-treated alligator weed root powder as the reference. The isotherm study suggested there is a favorable As(V) adsorption happened on the AWR surface. The batch adsorption experimental results indicated that the ionic strength has little impact on the adsorption, while the solution pH has a significant effect on the adsorption with apparent inhibition appearing in both extreme acidic and alkaline pH region. In addition, the properties of the biosorbent were characterized by various techniques including SEM-EDS, FT-IR, and ICP detection. The analysis results suggested that the metals including Mn, Fe, and Al enrich over the alligator weed root surface in the morphology of metal (hydro) oxide. Based on the nature of the biosorbent and As(V) besides the adsorption performance, the metal (hydro) oxides over biosorbent surface is suggested as the essential role to drive the adsorption. With the metal (hydro) oxides denuded in the pre-treatment, the biosorbent loses its adsorption capability for As(V) totally. PMID:26458188

  7. A reconnaissance geochemical survey of the Clarion River Roadless Area, Allegheny National Forest, Elk County, Pennsylvania

    USGS Publications Warehouse

    Hickling, N.L.; Schweinfurth, Stanley P.; Adrian, Betty M.


    Semiquantitative emission spectrographic analyses for 31 elements were determined on 9 stream-sediment samples and 18 bedrock samples from the Clarion River Roadless Area, Elk County, Pennsylvania. All sample localities are given in Universal Transverse Mercator (UTM) coordinates. Brief descriptions of bedrock samples are also included. Rocks analyzed are mostly sandstone, and siltstone. The analytical data do not indicate the presence of mineralized rock in the study area.

  8. Hepatic and renal trace element concentrations in American alligators (Alligator mississippiensis) following chronic dietary exposure to coal fly ash contaminated prey.


    Tuberville, Tracey D; Scott, David E; Metts, Brian S; Finger, John W; Hamilton, Matthew T


    Little is known about the propensity of crocodilians to bioaccumulate trace elements as a result of chronic dietary exposure. We exposed 36 juvenile alligators (Alligator mississippiensis) to one of four dietary treatments that varied in the relative frequency of meals containing prey from coal combustion waste (CCW)-contaminated habitats vs. prey from uncontaminated sites, and evaluated tissue residues and growth rates after 12 mo and 25 mo of exposure. Hepatic and renal concentrations of arsenic (As), cadmium (Cd) and selenium (Se) varied significantly among dietary treatment groups in a dose-dependent manner and were higher in kidneys than in livers. Exposure period did not affect Se or As levels but Cd levels were significantly higher after 25 mo than 12 mo of exposure. Kidney As and Se levels were negatively correlated with body size but neither growth rates nor body condition varied significantly among dietary treatment groups. Our study is among the first to experimentally examine bioaccumulation of trace element contaminants in crocodilians as a result of chronic dietary exposure. A combination of field surveys and laboratory experiments will be required to understand the effects of different exposure scenarios on tissue residues, and ultimately link these concentrations with effects on individual health. PMID:27149145

  9. Evidence of Rapidly Warming Rivers in the UK from an Extensive Additive Modelling Study at the National Scale Using R

    NASA Astrophysics Data System (ADS)

    Simpson, G. L.


    River water temperature data exhibit non-linear behaviour over the past 50 or so years. Standard techniques for identifying and quantifying trends have centred around the use of linear regression and Mann-Kendall and Thiel-Sen procedures. Observational data from UK rivers suggest that temperatures are far more variable then assumed under these statistical models. In a national-scale assessment of the response of riverine systems to global climatic change, an additive model framework was employed to model patterns in water temperatures from a large database of temporal observational data. Models were developed using R, which allowed for the deployment of cutting-edge additive modelling techniques to describe trends at 2773 sites across England and Wales, UK. At a subset of sites, additive models were used to model long-term trends, trends within seasons and the long-term variation in the seasonal pattern of water temperatures. Changes in water temperature have important consequences for aquatic ecology, with some species being particularly sensitive even to small shifts in temperature during some or all of their lifecycle. While there are many studies reporting increasing regional and global air temperatures, evidence for changes in river water temperature has thus far been site specific and/or from sites heavily influenced by human activities that could themselves lead to warming. Here I present selected results from a national-scale assessment of changing river water temperatures, covering the whole of England and Wales, comprising data from 2,773 locations. Positive trends in water temperature were observed at 86% of sites. At a subset of sites, seasonal trend models were developed, which showed that 90% of locations demonstrated statistically significant increases in water temperature during Autumn and Winter periods. Multivariate smoothers, that allow for within-year and longer-term trend interactions in time, suggest that periods of warmer waters now extend

  10. Evaluation of an alternate method for sampling benthic macroinvertebrates in low-gradient streams sampled as part of the National Rivers and Streams Assessment.


    Flotemersch, Joseph E; North, Sheila; Blocksom, Karen A


    Benthic macroinvertebrates are sampled in streams and rivers as one of the assessment elements of the US Environmental Protection Agency's National Rivers and Streams Assessment. In a 2006 report, the recommendation was made that different yet comparable methods be evaluated for different types of streams (e.g., low gradient vs. high gradient). Consequently, a research element was added to the 2008-2009 National Rivers and Streams Assessment to conduct a side-by-side comparison of the standard macroinvertebrate sampling method with an alternate method specifically designed for low-gradient wadeable streams and rivers that focused more on stream edge habitat. Samples were collected using each method at 525 sites in five of nine aggregate ecoregions located in the conterminous USA. Methods were compared using the benthic macroinvertebrate multimetric index developed for the 2006 Wadeable Streams Assessment. Statistical analysis did not reveal any trends that would suggest the overall assessment of low-gradient streams on a regional or national scale would change if the alternate method was used rather than the standard sampling method, regardless of the gradient cutoff used to define low-gradient streams. Based on these results, the National Rivers and Streams Survey should continue to use the standard field method for sampling all streams. PMID:24081815

  11. Evaluation of an alternate method for sampling benthic macroinvertebrates in low-gradient streams sampled as part of the National Rivers and Streams Assessment.


    Flotemersch, Joseph E; North, Sheila; Blocksom, Karen A


    Benthic macroinvertebrates are sampled in streams and rivers as one of the assessment elements of the US Environmental Protection Agency's National Rivers and Streams Assessment. In a 2006 report, the recommendation was made that different yet comparable methods be evaluated for different types of streams (e.g., low gradient vs. high gradient). Consequently, a research element was added to the 2008-2009 National Rivers and Streams Assessment to conduct a side-by-side comparison of the standard macroinvertebrate sampling method with an alternate method specifically designed for low-gradient wadeable streams and rivers that focused more on stream edge habitat. Samples were collected using each method at 525 sites in five of nine aggregate ecoregions located in the conterminous USA. Methods were compared using the benthic macroinvertebrate multimetric index developed for the 2006 Wadeable Streams Assessment. Statistical analysis did not reveal any trends that would suggest the overall assessment of low-gradient streams on a regional or national scale would change if the alternate method was used rather than the standard sampling method, regardless of the gradient cutoff used to define low-gradient streams. Based on these results, the National Rivers and Streams Survey should continue to use the standard field method for sampling all streams.

  12. Digital geologic map and database of the Chesapeake and Ohio Canal National Historical Park and Potomac River corridor, District of Columbia, Virginia, Maryland, and West Virginia

    USGS Publications Warehouse

    Southworth, C. Scott; Brezinski, David K.; Orndorff, Randall C.; Chirico, Peter G.; Lagueux, Kerry M.


    The Chesapeake and Ohio (CO) Canal National Historical Park is unique in that it is the only land within the National Park system that crosses 5 physiographic provinces along a major river. From Georgetown, District of Columbia (D.C.) to Cumberland, Maryland (Md.), the CO Canal provides an opportunity to examine the geologic history of the central Appalachian region and how the canal contributed to the development of this area. The geologic map data covers the 184.5-mile long park in a 2-mile wide corridor centered on the Potomac River

  13. Predicting Recreational Water Quality Using Turbidity in the Cuyahoga River, Cuyahoga Valley National Park, Ohio, 2004-7

    USGS Publications Warehouse

    Brady, Amie M.G.; Bushon, Rebecca N.; Plona, Meg B.


    The Cuyahoga River within Cuyahoga Valley National Park (CVNP) in Ohio is often impaired for recreational use because of elevated concentrations of bacteria, which are indicators of fecal contamination. During the recreational seasons (May through August) of 2004 through 2007, samples were collected at two river sites, one upstream of and one centrally-located within CVNP. Bacterial concentrations and turbidity were determined, and streamflow at time of sampling and rainfall amounts over the previous 24 hours prior to sampling were ascertained. Statistical models to predict Escherichia coli (E. coli) concentrations were developed for each site (with data from 2004 through 2006) and tested during an independent year (2007). At Jaite, a sampling site near the center of CVNP, the predictive model performed better than the traditional method of determining the current day's water quality using the previous day's E. coli concentration. During 2007, the Jaite model, based on turbidity, produced more correct responses (81 percent) and fewer false negatives (3.2 percent) than the traditional method (68 and 26 percent, respectively). At Old Portage, a sampling site just upstream from CVNP, a predictive model with turbidity and rainfall as explanatory variables did not perform as well as the traditional method. The Jaite model was used to estimate water quality at three other sites in the park; although it did not perform as well as the traditional method, it performed well - yielding between 68 and 91 percent correct responses. Further research would be necessary to determine whether using the Jaite model to predict recreational water quality elsewhere on the river would provide accurate results.

  14. Iodine-129 in the Snake River Plain aquifer at and near the Idaho National Engineering Laboratory, Idaho, 1990-91

    USGS Publications Warehouse

    Mann, L.J.; Beasley, T.M.


    From 1953 to 1990, an estimated 0.56 to 1.18 curies of iodine-129 were contained in wastewater generated by the Idaho Chemical Processing Plant (ICPP) at the Idaho National Engineering Laboratory. The waste- water was discharged directly to the Snake River Plain aquifer through a deep disposal well prior to February 1984 and through unlined disposal ponds in 1984-90. The wastewater did not contain measurable concentrations of iodine-129 in 1989-90. Samples were collected from 51 wells that obtain water from the Snake River Plain aquifer and 1 well that obtains water from a perched ground-water zone. The samples were analyzed for iodine-129 using an accelerator mass spectrometer which is two to six orders of magnitude more sensitive than neutron- activation methods. Therefore, iodine-129 was detectable in samples from a larger number of wells distributed over a larger area than previously was possible. Ground-water flow velocities calculated using iodine-129 data are estimated to be at least 6 feet per day. These velocities compare favorably with those of 4 to 10 feet per day calculated from tritium data and tracer studies at wells down- gradient from the ICPP. In 1990-91, concentrations of iodine-129 in water samples from wells that obtain water from the Snake River Plain aquifer ranged from less than 0.0000006+0.0000002 to 3.82.+0.19 picocuries per liter (pCi/L). The mean concentration in water from 18 wells was 0.81+0.19 pCi/L as compared with 1.30+0.26 pCi/L in 1986. The decrease in the iodine-l29 concentrations from 1986 to 1990-91 chiefly was the result of a decrease in the amount of iodine-129 disposed of annually, and changes in disposal techniques.

  15. The national stream quality accounting network: A flux-basedapproach to monitoring the water quality of large rivers

    USGS Publications Warehouse

    Hooper, R.P.; Aulenbach, Brent T.; Kelly, V.J.


    Estimating the annual mass flux at a network of fixed stations is one approach to characterizing water quality of large rivers. The interpretive context provided by annual flux includes identifying source and sink areas for constituents and estimating the loadings to receiving waters, such as reservoirs or the ocean. Since 1995, the US Geological Survey's National Stream Quality Accounting Network (NASQAN) has employed this approach at a network of 39 stations in four of the largest river basins of the USA: The Mississippi, the Columbia, the Colorado and the Rio Grande. In this paper, the design of NASQAN is described and its effectiveness at characterizing the water quality of these rivers is evaluated using data from the first 3 years of operation. A broad range of constituents was measured by NASQAN, including trace organic and inorganic chemicals, major ions, sediment and nutrients. Where possible, a regression model relating concentration to discharge and season was used to interpolate between chemical observations for flux estimation. For water-quality network design, the most important finding from NASQAN was the importance of having a specific objective (that is, estimating annual mass flux) and, from that, an explicitly stated data analysis strategy, namely the use of regression models to interpolate between observations. The use of such models aided in the design of sampling strategy and provided a context for data review. The regression models essentially form null hypotheses for concentration variation that can be evaluated by the observed data. The feedback between network operation and data collection established by the hypothesis tests places the water-quality network on a firm scientific footing.

  16. Agency interaction at the Savannah River Plant under the Endangered Species Act

    SciTech Connect

    Mackey, H.E. Jr.


    The 300 square mile Savannah River Plant (SRP) offers a variety of protected habitats for endangered species including the alligator (resident), red-cockaded woodpecker (resident), short-nose sturgeon (migratory), and wood stock (fish-forager). The most recent of these four species to be listed by the US Fish and Wildlife Service (US FWS) is the wood stock. It had been observed prior to 1983 as an infrequent forager in the SRP Savannah River swamp which adjoins SRP on the south and southwest. In anticipation of its listing as an endangered species, DOE-SR requested in the spring of 1983 that the Savannah River Ecology Laboratory, University of Georgia, conduct field surveys and studies of the nearest colony of wood storks to SRP (the Birdsville colony in north-central Georgia). The objective of these studies was to determine potential effects of the flooding of the Steel Creek swamp area with cooling water from L-Reactor. L-Reactor, which is proposed for restart, has not been operated since 1968. The survey found that wood storks forage in the Steel Creek delta swamp area of the Savannah River at SRP. Based on the numbers of storks at various foraging locations, sites at SRP ranked higher than non-SRP sites during the pre-fledging phase of the colony. Cold flow testing of L-Reactor also demonstrated that foraging sites in the Steel Creek delta would be unavailable during L-Reactor operation because of increased water levels. Consultation meetings between DOE-SR and US FWS in April 1984, resulted in an agreement between the two agencies to develop alternative foraging habitat for the wood stork to replace potential losses in the Steel Creek delta area. A suitable habitat was located on the National Audubon Society's Silver Bluff Plantation Sanctuary just west of SRP. This location will be developed by the US Soil Conservation Service through an interagency agreement with DOE-SR. 6 references, 4 figures.

  17. Habitat Evaluation Procedures (HEP) Report : Oleson Tracts of the Tualatin River National Wildlife Refuge, 2001-2002 Technical Report.

    SciTech Connect

    Allard, Donna; Smith, maureen; Schmidt, Peter


    Located in the northern Willamette River basin, Tualatin River National Wildlife Refuge (Refuge) was established in 1992 with an approved acquisition boundary to accommodate willing sellers with potentially restorable holdings within the Tualatin River floodplain. The Refuge's floodplain of seasonal and emergent wetlands, Oregon ash riparian hardwood, riparian shrub, coniferous forest, and Garry oak communities are representative of remnant plant communities historically common in the Willamette River valley and offer an opportunity to compensate for wildlife habitat losses associated with the Willamette River basin federal hydroelectric projects. The purchase of the Oleson Units as additions to the Refuge using Bonneville Power Administration (BPA) funds will partially mitigate for wildlife habitat and target species losses incurred as a result of construction and inundation activities at Dexter and Detroit Dams. Lands acquired for mitigation of Federal Columbia River Power System (FCRPS) impacts to wildlife are evaluated using the Habitat Evaluation Procedures (HEP) methodology, which quantifies how many Habitat Units (HUs) are to be credited to BPA. HUs or credits gained lessen BPA's debt, which was formally tabulated in the FCRPS Loss Assessments and adopted as part of the Northwest Power and Conservation Council's Fish and Wildlife Program as a BPA obligation (NWPCC, 1994 and 2000). There are two basic management scenarios to consider for this evaluation: (1) Habitats can be managed without restoration activities to benefit wildlife populations, or (2) Habitats can be restored using a number of techniques to improve habitat values more quickly. Without restoration, upland and wetland areas may be periodically mowed and disced to prevent invasion of exotic vegetation, volunteer trees and shrubs may grow to expand forested areas, and cooperative farming may be employed to provide forage for migrating and wintering waterfowl. Abandoned cropland would comprise

  18. National Water-Quality Assessment Program - Red River of the North

    USGS Publications Warehouse

    Stoner, J.D.


    In 1991, the U.S. Geological Survey (USGS) began to implement a full-scale National Water-Quality Assessment (NAWQA) program. The long-term goals of the NAWQA program are to describe the status and trends in the quality of a large, representative part of the Nation's surface- and ground-water resources, and to provide a sound scientific understanding of the primary natural and human factors affecting the quality of these resources. The program will produce a wealth of water-quality information that will be useful to policy makers and managers at the national, State, and local levels.

  19. Laser ablation ICP-MS analysis of the radial distribution of lead in the femur of Alligator mississippiensis.


    Seltzer, Michael D; Lance, Valentine A; Elsey, Ruth M


    A laser ablation ICP-MS technique has been used to examine the radial distribution of lead in transverse sections of alligator femur. Annual bone growth in the femur results in the deposition of incremental layers of calcified tissue at the periphery of existing bone. Patterns of lead concentration within these layers provide a record of time-dependent accumulation from which exposure history can potentially be deduced. Femur specimens obtained from captive-reared alligators exhibited levels of lead accumulation that were entirely consistent with previously documented clinical signs of lead intoxication. In contrast, femurs obtained from wild alligators contained only minor amounts of lead that were likely accumulated as a result of incidental exposure.

  20. Laser ablation ICP-MS analysis of the radial distribution of lead in the femur of Alligator mississippiensis.


    Seltzer, Michael D; Lance, Valentine A; Elsey, Ruth M


    A laser ablation ICP-MS technique has been used to examine the radial distribution of lead in transverse sections of alligator femur. Annual bone growth in the femur results in the deposition of incremental layers of calcified tissue at the periphery of existing bone. Patterns of lead concentration within these layers provide a record of time-dependent accumulation from which exposure history can potentially be deduced. Femur specimens obtained from captive-reared alligators exhibited levels of lead accumulation that were entirely consistent with previously documented clinical signs of lead intoxication. In contrast, femurs obtained from wild alligators contained only minor amounts of lead that were likely accumulated as a result of incidental exposure. PMID:15982720

  1. Long-term change in perennial vegetation along the Colorado river in Grand Canyon national park (1889-2010)

    USGS Publications Warehouse

    Webb, R.H.; Belnap, J.; Scott, M.L.; Esque, T.C.


    Long-term monitoring data are difficult to obtain for high-value resource areas, particularly in remote parts of national parks. One long-used method for evaluating change uses ground-based repeat photography to match historical images of landscapes. River expeditions that documented a proposed railroad route through Grand Canyon with large-format photographs occurred in 1889 and 1890. A total of 452 images from those expeditions are still in existence, and these were matched as closely as possible from December 1989 through March 1992. In 2010 and 2011, we are repeating these matches 120 years after the originals and 20 years after the first matches. This repeat photography provides visual information that can be interpreted for changes in terrestrial and riparian ecosystems along the river corridor, including change in the desert plant assemblages related to increasing winter low temperatures and severe drought. The riparian ecosystem, which originally consisted of native species established along the stage of frequent floods, has increased in area, density, and biomass as both nonnative and native species have become established following flow regulation by Glen Canyon Dam. The original and matched images provide the basis for one element of a robust monitoring program for the effects of climate change on ecosystem resources.

  2. Preliminary delineation of natural geochemical reactions, Snake River Plain aquifer system, Idaho National Engineering Laboratory and vicinity, Idaho

    SciTech Connect

    Knobel, L.L.; Bartholomay, R.C.; Orr, B.R.


    The U.S. Geological Survey, in cooperation with the U.S. Department of Energy, is conducting a study to determine the natural geochemistry of the Snake River Plain aquifer system at the Idaho National Engineering Laboratory (INEL), Idaho. As part of this study, a group of geochemical reactions that partially control the natural chemistry of ground water at the INEL were identified. Mineralogy of the aquifer matrix was determined using X-ray diffraction and thin-section analysis and theoretical stabilities of the minerals were used to identify potential solid-phase reactants and products of the reactions. The reactants and products that have an important contribution to the natural geochemistry include labradorite, olivine, pyroxene, smectite, calcite, ferric oxyhydroxide, and several silica phases. To further identify the reactions, analyses of 22 representative water samples from sites tapping the Snake River Plain aquifer system were used to determine the thermodynamic condition of the ground water relative to the minerals in the framework of the aquifer system. Principal reactions modifying the natural geochemical system include congruent dissolution of olivine, diopside, amorphous silica, and anhydrite; incongruent dissolution of labradorite with calcium montmorillonite as a residual product; precipitation of calcite and ferric oxyhydroxide; and oxidation of ferrous iron to ferric iron. Cation exchange reactions retard the downward movement of heavy, multivalent waste constituents where infiltration ponds are used for waste disposal.

  3. A 2002-2008 hydrological budget and phosphorus residence times for Shark River Slough, Everglades National Park

    NASA Astrophysics Data System (ADS)

    Saha, A. K.; Price, R. M.; Fitz, H.; Engel, V.


    A monthly and annual water budget has been created for Shark River Slough (SRS) within the Everglades National Park (ENP) over 2002-2008. Inputs considered are surface water inflows via water delivery structures (S12s and S333) and precipitation, while outputs consist of evapotranspiration, discharge to the Gulf of Mexico (Lostman, Shark, Broad, Harney and North rivers) and seepage losses from the eastern part of the slough under levee L31. Using a mass balance approach, monthly change in volume of SRS (from water level changes) is equated to the sum of inputs, outputs and a residual term, that includes error in each of the inputs and outputs as well as net groundwater exchange. Results for 2002-2008 indicate that precipitation is the largest input to the SRS, while ET is the largest output, with ET being equal to or greater than precipitation. A net groundwater discharge to freshwater flow is predicted that is also lag correlated with surface water salinity by 1 month, thereby supporting earlier hydrological and geochemical findings of coastal groundwater discharge in the mangrove zone. The small quantity of inflows relative to precipitation and ET highlights the necessity of gradually increasing surface water inflows to restore ecosystem processes in terrestrial, freshwater and marine portions of the ENP. Water flow measurement data and the Ecological Landscape Model (ELM) is used in conjunction with Phosphorus concentration data to calculate phosphorus residence times in different parts of SRS that has been found to vary seasonally.

  4. The influence of changing prey availability on the prevalence of Diphyllobothrium in river otters from Yellowstone National Park.


    Crait, Jamie R; McIntosh, Antoinette D; Greiner, Ellis C; Ben-David, Merav


    Parasite prevalence in predatory mammals is influenced by numerous factors including diet, sex, season, and habitat. We examined the effect of such factors on the prevalence of gastrointestinal helminths in North American river otters ( Lontra canadensis ) in Yellowstone Lake, Yellowstone National Park. Otters in this ecosystem have recently experienced a decline in their main prey, Yellowstone cutthroat trout ( Oncorhynchus clarkii bouvieri), and have, in turn, increased consumption of alternative foods. Helminths were found in 13.2% of otter fecal samples. The dominant parasite was a Diphyllobothrium sp. ( Diphyllobothrium ditremum or Diphyllobothrium dendriticum ), a cestode acquired from cutthroat trout. Truttaedacnitis truttae and Contracaecum spp. nematodes were incidental parasites in otter feces, and acanthocephalan eggs were found in 1 sample. The prevalence of trout remains and a Diphyllobothrium sp. in otter feces was higher during the cutthroat trout spawning season. A Diphyllobothrium sp. was more prevalent in the feces of female otters. There was no relationship between annual declines in the frequency of trout in otter feces and prevalence of parasites. Helminth prevalence and species richness in Yellowstone otters was low and likely reflects low predator densities and few intermediate hosts. This is the first study reporting the helminth fauna of river otters in the Greater Yellowstone Area and confirms the otter as a definitive host for Diphyllobothrium sp. in this region.

  5. The influence of changing prey availability on the prevalence of Diphyllobothrium in river otters from Yellowstone National Park.


    Crait, Jamie R; McIntosh, Antoinette D; Greiner, Ellis C; Ben-David, Merav


    Parasite prevalence in predatory mammals is influenced by numerous factors including diet, sex, season, and habitat. We examined the effect of such factors on the prevalence of gastrointestinal helminths in North American river otters ( Lontra canadensis ) in Yellowstone Lake, Yellowstone National Park. Otters in this ecosystem have recently experienced a decline in their main prey, Yellowstone cutthroat trout ( Oncorhynchus clarkii bouvieri), and have, in turn, increased consumption of alternative foods. Helminths were found in 13.2% of otter fecal samples. The dominant parasite was a Diphyllobothrium sp. ( Diphyllobothrium ditremum or Diphyllobothrium dendriticum ), a cestode acquired from cutthroat trout. Truttaedacnitis truttae and Contracaecum spp. nematodes were incidental parasites in otter feces, and acanthocephalan eggs were found in 1 sample. The prevalence of trout remains and a Diphyllobothrium sp. in otter feces was higher during the cutthroat trout spawning season. A Diphyllobothrium sp. was more prevalent in the feces of female otters. There was no relationship between annual declines in the frequency of trout in otter feces and prevalence of parasites. Helminth prevalence and species richness in Yellowstone otters was low and likely reflects low predator densities and few intermediate hosts. This is the first study reporting the helminth fauna of river otters in the Greater Yellowstone Area and confirms the otter as a definitive host for Diphyllobothrium sp. in this region. PMID:25192057

  6. U.S. Geological Survey National Water Census: Colorado River Basin Geographic Focus Area Study

    USGS Publications Warehouse

    Bruce, Breton W.; Clow, David W.; Maupin, Molly A.; Miller, Matthew P.; Senay, Gabriel B.; Sexstone, Graham A.; Susong, David D.


    The Colorado River Basin (CRB) and the Delaware and Apalachicola-Chattahoochee-Flint (ACF) River Basins were selected by the Department of the Interior for the first round of FASs because of the perceived water shortages in the basins and potential conflicts over water supply and allocations. After gathering input from numerous stakeholders in the CRB, the USGS determined that surface­-water resources in the basin were already being closely monitored and that the most important scientific contribution could be made by helping to improve estimates of four water­-budget components: evapotranspiration losses, snowpack hydrodynamics, water­-use information, and the relative importance of groundwater discharge in supporting streamflow across the basin. The purpose of this fact sheet is to provide a brief summary of the CRB FAS results as the study nears completion. Although some project results are still in the later stages of review and publication, this fact sheet provides an overall description of the work completed and cites the publications in which additional information can be found.

  7. Surveys of tidal river systems in the northern territory of Australia and their crocodile populations

    SciTech Connect

    Vorlicek, G.C.; Messel, H.; Green, W.J.


    This book provides an update on the population dynamics of Crocodylus porous in the tidal waterways of Van Diemen Gulf and the Southern Gulf of Carpentaria, Australia, during 1984 and 1985. Contents: Prologue; Dedication; Introduction; Status of Crocodylus porous. July 1984, in the tidal waterways of the Alligator Region and in the Adelaide River System of Northern Australia: recovery underway; Resurvey of Crocodylus porous populations in the tidal waterways of the southern Gulf of Carpentaria, September - October 1985; Local knowledge - Northern Australia style.

  8. Comprehensive cooling water study annual report. Volume X: endangered species, Savannah River Plant

    SciTech Connect

    Gladden, J.B.; Lower, M.W.; Mackey, H.E.; Specht, W.L.; Wilde, E.W.


    Federally endangered species which occur on the Savannah River Plant (SRP) include the American alligator, red-cockaded woodpecker, the shortnose sturgeon, and the wood stork. Of these species, only the alligator, sturgeon, and wood stork are likely to be affected by the intake or release of cooling water at the SRP. The nearest colony of wood storks to the SRP is the Birdsville Colony, about 40-45 km southwest of potential foraging areas in the SRP Savannah River swamp. In 1983, it contained about six percent of the nesting pairs in the United States and produced about 250 fledglings. Its reproductive success was about the same in 1984. Based on the results of surveys made of foraging areas, both on SRP and offsite in 1983 and 1984, forage fish availability could be reduced by increased water depths in the Steel Creek delta area following L-Reactor restart with once-through cooling. Effluent discharge from SRP facilities probably limits the potential use of the SRP Savannah River swamp by foraging wood storks. The SRP supports a low-to-moderate alligator population. The current information available on the alligators of the SRP suggests that populations in suitable habitats (e.g., Beaver Dam Creek, Steel Creek, and Par Pond) should continue to benefit from the protection provided by the SRP and should remain stable or continue to increase. Based upon information from the literature and fisheries data for the Savannah River, the operations of the SRP do not appear to have adverse effects on the shortnose sturgeon. Based on known life history characteristics, there is no indication that spawning, rearing, or foraging habitats are affected by SRP operations. 64 refs., 20 figs., 12 tabs.

  9. National Water-Quality Assessment Program— Pesticides in the Trinity River Basin study unit, Texas, 1968-91

    USGS Publications Warehouse

    Ulery, R.L.


    The Trinity River Basin National Water Quality Assessment (NAWQA) study-unit staff began assessment activities in 1991, and in 1992, undertook a retrospective review of existing data on pesticides. The main purpose of this review was to aid in the design of a pesticide-sampling network for the study unit. The review consisted of the compilation, screening, and analysis of available pesticide-sample information. In addition, important environmental factors, which influence the occurrence and distribution of pesticides in the study unit, were identified and compiled. A report of this review and analysis will be released in 1995 (Ulery and Brown, in press). This fact sheet provides a brief overview of significant findings.

  10. Flow Velocity, Water Temperature, and Conductivity in Shark River Slough, Everglades National Park, Florida: August 2001-June 2002

    USGS Publications Warehouse

    Riscassi, Ami L.; Schaffranek, Raymond W.


    The data-collection effort described in this report is in support of the U.S. Geological Survey (USGS) Place-Based Studies project investigating 'Forcing Effects on Flow Structure in Vegetated Wetlands of the Everglades.' Data collected at four locations in Shark River Slough, Everglades National Park, during the 2001-2002 wet season are documented in the report and methods used to process the data are described. Daily mean flow velocities, water temperatures, and specific conductance values are presented in the appendices of the report. The quality-checked and edited data have been compiled and stored on the USGS South Florida Information Access (SOFIA) website

  11. Health assessment for Hudson River PCB (polychlorinated biphenyl) NPL (National Priorities List) site, State of New York, Region 2. CERCLIS No. NYD980763841. Final report

    SciTech Connect

    Not Available


    Hudson River PCB (polychlorinated biphenyls) is a National Priorities List site located in the State of New York. Because of the past disposal of PCBs in the Hudson River, surface water, sediment, and fish from the Upper and Lower Hudson River are contaminated with elevated concentrations of PCBs. The site is of potential public health concern because of the risk to human health resulting from possible exposure to hazardous substances at concentrations that may result in adverse health effects. Human exposure to PCB-contaminated fish or other consumable aquatic organisms from the Hudson River may occur and/or may be occurring via oral exposure (ingestion). Possible inhalation of volatilized PCBs, airborne PCB-contaminated dusts, as well as dermal contact with PCB-contaminated sediment are also of potential concern to human health.

  12. Radium concentration factors in passionfruit (Passiflora foetida) from the Alligator Rivers Region, Northern Territory, Australia.


    Medley, Peter; Bollhöfer, Andreas; Parry, David; Martin, Paul


    In this study, uptake of Ra from soil into the edible fruit of the wild passionfruit species Passiflora foetida was investigated, using selective extraction from the soil samples. A wide range of environmental exposure conditions were represented by the locations that were sampled, including both natural soils, and soils influenced by past and present uranium mining activities. The bioavailable (226)Ra fraction in soils was found to be a better predictor of (226)Ra fruit activity concentrations than the total soil activity concentration, or any of the other fractions studied. Concentration Factors (CFs) derived using the bioavailable fraction varied by only a factor of 7 between different locations, whereas CFs derived using other fractions and total soil varied by up to two orders of magnitude. CFs were highest for those soils containing the lowest concentrations of Mg, Ca and Ba, and approached a saturation value at higher soil concentrations. This finding suggests that group II elements influence radium uptake, most likely the result of increased pressure on the plant to take up essential nutrient group II elements from soil with the lower concentrations, with Ra being taken up as an analogue element. It is also possible that at higher concentrations of bioavailable Ca and Mg in the soil, these ions will outcompete Ra for adsorption sites in the soil and/or on the root surfaces. The study also shows that (228)Ra can potentially be a significant contributor to ingestion doses and should also be considered when assessing committed effective doses from the ingestion of fruits.

  13. Radium concentration factors in passionfruit (Passiflora foetida) from the Alligator Rivers Region, Northern Territory, Australia.


    Medley, Peter; Bollhöfer, Andreas; Parry, David; Martin, Paul


    In this study, uptake of Ra from soil into the edible fruit of the wild passionfruit species Passiflora foetida was investigated, using selective extraction from the soil samples. A wide range of environmental exposure conditions were represented by the locations that were sampled, including both natural soils, and soils influenced by past and present uranium mining activities. The bioavailable (226)Ra fraction in soils was found to be a better predictor of (226)Ra fruit activity concentrations than the total soil activity concentration, or any of the other fractions studied. Concentration Factors (CFs) derived using the bioavailable fraction varied by only a factor of 7 between different locations, whereas CFs derived using other fractions and total soil varied by up to two orders of magnitude. CFs were highest for those soils containing the lowest concentrations of Mg, Ca and Ba, and approached a saturation value at higher soil concentrations. This finding suggests that group II elements influence radium uptake, most likely the result of increased pressure on the plant to take up essential nutrient group II elements from soil with the lower concentrations, with Ra being taken up as an analogue element. It is also possible that at higher concentrations of bioavailable Ca and Mg in the soil, these ions will outcompete Ra for adsorption sites in the soil and/or on the root surfaces. The study also shows that (228)Ra can potentially be a significant contributor to ingestion doses and should also be considered when assessing committed effective doses from the ingestion of fruits. PMID:23994954

  14. Radionuclide migration at the Koongarra uranium deposit, Northern Australia Lessons from the Alligator Rivers analogue project

    NASA Astrophysics Data System (ADS)

    Payne, Timothy E.; Airey, Peter L.

    The Koongarra uranium deposit in Northern Australia provides a ‘natural analogue’ for processes that are of relevance for assessing the safety of radioactive waste disposal. In an international project extending over two decades, the Koongarra ore body was studied to increase the understanding of radionuclide migration and retention mechanisms that might occur in the vicinity of a geological repository. The research effort included extensive characterisation of the geological, hydrological and geochemical conditions at the site. Patterns of the distribution of radionuclides (predominantly members of the 238U decay chain, but also the rare isotopes 239Pu, 99Tc and 129I) were studied in both solid and groundwater phases. The project included detailed studies of uranium adsorption on mineral surfaces, and of subsequent processes that may lead to long-term uranium immobilisation. Numerous models for uranium migration were developed during the project. This paper provides a comprehensive review of the research at Koongarra, and assesses the value of the site for integrating the results of a complex series of laboratory, modelling and field studies. The insights gained from this review of the Koongarra project may assist in maximising the potential scientific benefit of future natural analogue studies.

  15. Pesticides in the nation's rivers, 1975-1980, and implications for future monitoring

    USGS Publications Warehouse

    Gilliom, Robert J.; Alexander, Richard B.; Smith, Richard A.


    Water samples were taken four times per year and bed-sediment samples two times per year during 1975-80 at 160 to 180 stations on major rivers of the United States. Samples were analyzed for 18 insecticides and 4 herbicides, which together accounted for about one-third of the total amount of all pesticides applied to major crops during 1975-80. Fewer than 10 percent of almost 3,000 water samples and fewer than 20 percent of almost 1,000 bed-sediment samples contained reportable concentrations of any of the compounds. The patterns of detection result from a combination of widely variable detection capabilities, chemical properties, and use. Most detections in water samples were of relatively persistent yet soluble compounds: atrazine (4.8 percent of samples), diazinon (1.2), and lindane (1.1). Most detections in bed-sediment samples were of the hydrophobic and persistent insecticides: DDE (17 percent of samples), DDD (12), dieldrin (12), chlordane (9.9), and DDT (8.5). Only for atrazine in water, and for DDE, DDD, DDT, and chlordane in bed sediments, were geographic patterns of detection correlated (pH<0.10) with use on farms. Detections of organochlorine insecticides in both water and bed sediments appear to have erratically but gradually decreased during 1975-80. For the 1975-79 period, more stations had downtrends than had uptrends in bed-sediment levels of organochlorines. No clear trends were evident in concentrations of organophosphate insecticides or herbicides in either water or bed sediments. Findings suggest that future pesticide monitoring efforts must be responsive to changes in pesticides used and to geographic patterns of use. Different types of monitoring approaches are necesssary for chemicals having different chemical and physical properties. Before an effective dynamic monitoring effort can be designed, however, selected case studies are needed to characterize and refine sampling and analytical capabilities for different types of chemicals, river

  16. Keeping it clean: Creating and maintaining high quality fish data for the U.S. EPA National Rivers and Streams Assessment

    EPA Science Inventory

    One primary biological indicator of condition used in the National Rivers and Streams Assessment (NRSA) is the fish assemblage. Data for the 2008-2009 assessment were collected on field forms from over 2100 sites. After field forms were scanned into the NRSA database, we develope...

  17. 33 CFR 100.35T05-0276 - Special Local Regulations for Marine Events; Potomac River, National Harbor Access Channel, MD.

    Code of Federal Regulations, 2014 CFR


    ... Marine Events; Potomac River, National Harbor Access Channel, MD. 100.35T05-0276 Section 100.35T05-0276 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY REGATTAS AND MARINE PARADES SAFETY OF LIFE ON NAVIGABLE WATERS § 100.35T05-0276 Special Local Regulations for Marine Events;...

  18. 33 CFR 100.35T05-0276 - Special Local Regulations for Marine Events; Potomac River, National Harbor Access Channel, MD.

    Code of Federal Regulations, 2013 CFR


    ... Marine Events; Potomac River, National Harbor Access Channel, MD. 100.35T05-0276 Section 100.35T05-0276 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY REGATTAS AND MARINE PARADES SAFETY OF LIFE ON NAVIGABLE WATERS § 100.35T05-0276 Special Local Regulations for Marine Events;...

  19. Evaluation of an alternate method for sampling benthic macroinvertebrates in low-gradient streams sampled as part of the National Rivers and Streams Assessment

    EPA Science Inventory

    Benthic macroinvertebrates are sampled in streams and rivers as one of the assessment elements of the U.S. Environmental Protection Agency’s National Aquatic Resource Surveys. In a 2006 report, the recommendation was made that different yet comparable methods be evaluated for di...

  20. Hybridization and cytonuclear associations among native westslope cutthroat trout, introduced rainbow trout, and their hybrids within the Stehekin River drainage, North Cascades National Park

    USGS Publications Warehouse

    Ostberg, C.O.; Rodriguez, R.J.


    Historic introductions of nonnative rainbow trout Oncorhynchus mykiss into the native habitats of cutthroat trout O. clarkii have impacted cutthroat trout populations through introgressive hybridization, creating challenges and concerns for cutthroat trout conservation. We examined the effects of rainbow trout introductions on the native westslope cutthroat trout O. c. lewisii within the Stehekin River drainage, North Cascades National Park, Washington, by analyzing 1,763 salmonid DNA samples from 18 locations with nine diagnostic nuclear DNA markers and one diagnostic mitochondrial DNA (mtDNA) marker. Pure westslope cutthroat trout populations only occurred above upstream migration barriers in the Stehekin River and Park Creek. Two categories of rainbow trout admixture were observed: (1) less than 10% within the Stehekin River drainage above the Bridge Creek confluence and the middle and upper Bridge Creek drainage and (2) greater than 30% within the Stehekin River below the Bridge Creek confluence and in lower Bridge Creek. Hybrid indices and multilocus genotypes revealed an absence of rainbow trout and reduced hybrid diversity within the Stehekin River above the Bridge Creek confluence relative to hybrid diversity in the Stehekin River below the confluence and within lower Bridge Creek. Cytonuclear disequilibrium statistics revealed assortative mating between westslope cutthroat and rainbow trout but not among hybrids within the same locations. This suggests that a randomly mating hybrid swarm does not currently exist. However, continual migration of parental genotypes into the study location could also create significant cytonuclear disequilibria. The Stehekin River represents a novel and unique example of a dynamic hybridization zone where the invasion of rainbow trout alleles into the Stehekin River westslope cutthroat trout population above the Bridge Creek confluence appears to be impeded, suggesting that divergent ecological or evolutionary mechanisms

  1. John H. Chafee Blackstone River Valley National Historical Park Establishment Act

    THOMAS, 112th Congress

    Sen. Reed, Jack [D-RI


    03/07/2012 Committee on Energy and Natural Resources Subcommittee on National Parks. Hearings held. With printed Hearing: S.Hrg. 112-401. (All Actions) Tracker: This bill has the status IntroducedHere are the steps for Status of Legislation:

  2. A bill to reauthorize the Hudson River Valley National Heritage Area.

    THOMAS, 113th Congress

    Sen. Gillibrand, Kirsten E. [D-NY


    07/31/2013 Committee on Energy and Natural Resources Subcommittee on National Parks. Hearings held. With printed Hearing: S.Hrg. 113-93. (All Actions) Tracker: This bill has the status IntroducedHere are the steps for Status of Legislation:

  3. Little River Experimental Watershed, Georgia: National Institute of Food and Agriculture - Conservation Effects Assessment Project

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In September 2007, USDA’s Cooperative State Research, Education, and Extension Service (CSREES), now the National Institute of Food and Agriculture (NIFA), and the Natural Resources Conservation Service (NRCS) jointly funded two integrated research and outreach grants to conduct a synthesis of resul...

  4. Demonstrating the use of web analytics and an online survey to understand user groups of a national network of river level data

    NASA Astrophysics Data System (ADS)

    Macleod, Christopher Kit; Braga, Joao; Arts, Koen; Ioris, Antonio; Han, Xiwu; Sripada, Yaji; van der Wal, Rene


    The number of local, national and international networks of online environmental sensors are rapidly increasing. Where environmental data are made available online for public consumption, there is a need to advance our understanding of the relationships between the supply of and the different demands for such information. Understanding how individuals and groups of users are using online information resources may provide valuable insights into their activities and decision making. As part of the 'dot.rural wikiRivers' project we investigated the potential of web analytics and an online survey to generate insights into the use of a national network of river level data from across Scotland. These sources of online information were collected alongside phone interviews with volunteers sampled from the online survey, and interviews with providers of online river level data; as part of a larger project that set out to help improve the communication of Scotland's online river data. Our web analytics analysis was based on over 100 online sensors which are maintained by the Scottish Environmental Protection Agency (SEPA). Through use of Google Analytics data accessed via the R Ganalytics package we assessed: if the quality of data provided by Google Analytics free service is good enough for research purposes; if we could demonstrate what sensors were being used, when and where; how the nature and pattern of sensor data may affect web traffic; and whether we can identify and profile these users based on information from traffic sources. Web analytics data consists of a series of quantitative metrics which capture and summarize various dimensions of the traffic to a certain web page or set of pages. Examples of commonly used metrics include the number of total visits to a site and the number of total page views. Our analyses of the traffic sources from 2009 to 2011 identified several different major user groups. To improve our understanding of how the use of this national


    PubMed Central

    Rider, Cynthia V.; Hartig, Phillip C.; Cardon, Mary C.; Lambright, Christy R.; Bobseine, Kathy L.; Guillette, Louis J.; Gray, L. Earl; Wilson, Vickie S.


    Reproductive abnormalities in alligators exposed to contaminants in Lake Apopka, Florida, USA represent a clear example of endocrine disruption in wildlife. Several of these contaminants that are not able to bind to mammalian estrogen receptors (such as atrazine and cyanazine) have previously been reported to bind to the alligator estrogen receptor from oviductal tissue. Binding of known Lake Apopka contaminants to full length estrogen receptors alpha from human (hERα) and alligator (aERα) was assessed in a side-by-side comparison within the same assay system. Baculovirus-expressed recombinant hERα and aERα were used in a competitive binding assay. Atrazine and cyanazine were not able to bind to either receptor. p,p′-Dicofol was able to bind to aERα with a concentration inhibiting 50% of binding (IC50) of 4 μM, while only partially displacing 17β-estradiol (E2) from hERα and yielding a projected IC50 of 45 μM. Chemicals that only partially displaced E2 from either receptor, including some dichlorodiphenyltrichloroethane (DDT) metabolites and trans-nonachlor, appeared to have higher affinity for aERα than hERα. p,p′-Dicofol-mediated transcriptional activation through aERα and hERα was assessed to further explore the preferential binding of p,p′-dicofol to aERα over hERα. p,p′-Dicofol was able to stimulate transcriptional activation in a similar manner with both receptors. However, the in vitro results obtained with p,p′-dicofol were not reflected in an in vivo mammalian model, where Kelthane™ (mixed o,p′-and p,p′-dicofol isomers) did not elicit estrogenic effects. In conclusion, although there was no evidence of exclusively species-specific estrogen receptor binders, some xenoestrogens, especially p,p′-dicofol, had a higher affinity for aERα than for hERα. PMID:20821664

  6. Physiological response of alligator gar juveniles (Atractosteus spatula) exposed to sub-lethal doses of pollutants.


    González, Carlos Aguilera; Cruz, Julio; Alfaro, Roberto Mendoza


    Alligator gar populations have declined because of overfishing, habitat loss and pollution. Over time, the exposure to different pollutants have affected these fishes as a consequence of their high trophic level, bottom-dwelling habits and long life span. In order to evaluate the physiological effects of pollutants on alligator gar, juveniles (6, 12 and 24 months) were exposed to sub-lethal doses of diazinon, β-naphthoflavone (BNF) and 17 β-estradiol (E2) by intraperitoneal injection. After 2 days of exposure, liver samples were taken to determine the activities of acetylcholinesterase, butyrylcholinesterase and carboxylesterase; alkaline and acid phosphatases (ALP and ACP); ethoxyresorufin o-deethylase (EROD); glutathione s-transferase (GST); superoxide dismutase (SOD), and vitellogenin (VTG) concentration. Two additional bioassays consisting on the exposure of compounds through water or food were performed and after 4 and 28 days, respectively, biomarkers were determined. All esterases were inhibited in organisms exposed to diazinon as well as in 6-months gar exposed to E2 and BNF. In contrast, ALP activity increased in gar exposed to diazinon and E2, while ACP activity did not show any variations. No EROD activity was registered after exposure to the different pollutants, despite being one of the most sensitive and common detoxification biomarkers used for fishes. GST activity reduction was detected when gar were exposed to E2 and BNF, while SOD activity increased after exposure to diazinon and E2. Finally, VTG levels were higher in animals exposed to E2 compared to other treatments. Overall, these results suggest that alligator gar juveniles have a low biotransformation metabolism and show that they are especially sensitive to those pollutants affecting the nervous system. PMID:25948055

  7. Full-length cDNA cloning and structural characterization of preproinsulin in Alligator sinensis.


    Zhang, R; Zhang, S Z; Li, E; Wang, C; Wang, C L; Wu, X B


    Insulin is an important endocrine hormone that plays a critical physiological role in regulating metabolism and glucostasis in vertebrates. In this study, the complete cDNA of Alligator sinensis preproinsulin gene was cloned for the first time by reverse transcription-polymerase chain reaction and rapid amplification of cDNA ends methods; the amino acid sequence encoded and protein structure were analyzed. The full-length of preproinsulin cDNA sequence consists of 528 base pairs (bp), comprising a 34-bp 5'-untranslated region, a 170-bp 3'-untranslated region and an open reading frame that is 324 bp in length. The open reading frame encodes a 107-amino acid preproinsulin with a molecular weight of approximately 12,153.8 Da, theoretical isoelectric point of 5.68, aliphatic index of 92.06, and grand average of hydropathicity of -0.157, from which a signal peptide, a B-chain, a C-peptide, and an A-chain are derived. Online analysis suggested that the deduced preproinsulin amino acid sequence contains a transmembrane region, and that it has a signal peptide whose cleavage site occurs between alanine 24 and alanine 25. Comparative analysis of preproinsulin amino acid sequences indicated that the A-chain and B-chain sequences of preproinsulins are highly conserved between reptiles and birds, and that the preproinsulin amino acid sequence of Alligator sinensis shares 89% similarity to that of Chelonia mydas, but low similarity of 48-63% to those of mammals and fishes. The phylogenetic tree constructed using the neighbor-joining method revealed that preproinsulin of Alligator sinensis had high homology with reptiles and birds, such as Chelonia mydas, Gallus gallus, and Columba livia. PMID:25366775

  8. Physiological response of alligator gar juveniles (Atractosteus spatula) exposed to sub-lethal doses of pollutants.


    González, Carlos Aguilera; Cruz, Julio; Alfaro, Roberto Mendoza


    Alligator gar populations have declined because of overfishing, habitat loss and pollution. Over time, the exposure to different pollutants have affected these fishes as a consequence of their high trophic level, bottom-dwelling habits and long life span. In order to evaluate the physiological effects of pollutants on alligator gar, juveniles (6, 12 and 24 months) were exposed to sub-lethal doses of diazinon, β-naphthoflavone (BNF) and 17 β-estradiol (E2) by intraperitoneal injection. After 2 days of exposure, liver samples were taken to determine the activities of acetylcholinesterase, butyrylcholinesterase and carboxylesterase; alkaline and acid phosphatases (ALP and ACP); ethoxyresorufin o-deethylase (EROD); glutathione s-transferase (GST); superoxide dismutase (SOD), and vitellogenin (VTG) concentration. Two additional bioassays consisting on the exposure of compounds through water or food were performed and after 4 and 28 days, respectively, biomarkers were determined. All esterases were inhibited in organisms exposed to diazinon as well as in 6-months gar exposed to E2 and BNF. In contrast, ALP activity increased in gar exposed to diazinon and E2, while ACP activity did not show any variations. No EROD activity was registered after exposure to the different pollutants, despite being one of the most sensitive and common detoxification biomarkers used for fishes. GST activity reduction was detected when gar were exposed to E2 and BNF, while SOD activity increased after exposure to diazinon and E2. Finally, VTG levels were higher in animals exposed to E2 compared to other treatments. Overall, these results suggest that alligator gar juveniles have a low biotransformation metabolism and show that they are especially sensitive to those pollutants affecting the nervous system.

  9. Post-hatching development of mitochondrial function, organ mass and metabolic rate in two ectotherms, the American alligator (Alligator mississippiensis) and the common snapping turtle (Chelydra serpentina)

    PubMed Central

    Sirsat, Sarah K. G.; Sirsat, Tushar S.; Price, Edwin R.; Dzialowski, Edward M.


    ABSTRACT The ontogeny of endothermy in birds is associated with disproportionate growth of thermogenic organs and increased mitochondrial oxidative capacity. However, no similar study has been made of the development of these traits in ectotherms. For comparison, we therefore investigated the metabolism, growth and muscle mitochondrial function in hatchlings of a turtle and a crocodilian, two ectotherms that never develop endothermy. Metabolic rate did not increase substantially in either species by 30 days post-hatching. Yolk-free body mass and heart mass did not change through 30 days in alligators and heart mass was a constant proportion of body mass, even after 1 year. Yolk-free body mass and liver mass grew 36% and 27%, respectively, in turtles during the first 30 days post-hatch. The mass-specific oxidative phosphorylation capacity of mitochondria, assessed using permeabilized muscle fibers, increased by a non-significant 47% in alligator thigh and a non-significant 50% in turtle thigh over 30 days, but did not increase in the heart. This developmental trajectory of mitochondrial function is slower and shallower than that previously observed in ducks, which demonstrate a 90% increase in mass-specific oxidative phosphorylation capacity in thigh muscles over just a few days, a 60% increase in mass-specific oxidative phosphorylation capacity of the heart over a few days, and disproportionate growth of the heart and other organs. Our data thus support the hypothesis that these developmental changes in ducks represent mechanistic drivers for attaining endothermy. PMID:26962048

  10. Post-hatching development of mitochondrial function, organ mass and metabolic rate in two ectotherms, the American alligator (Alligator mississippiensis) and the common snapping turtle (Chelydra serpentina).


    Sirsat, Sarah K G; Sirsat, Tushar S; Price, Edwin R; Dzialowski, Edward M


    The ontogeny of endothermy in birds is associated with disproportionate growth of thermogenic organs and increased mitochondrial oxidative capacity. However, no similar study has been made of the development of these traits in ectotherms. For comparison, we therefore investigated the metabolism, growth and muscle mitochondrial function in hatchlings of a turtle and a crocodilian, two ectotherms that never develop endothermy. Metabolic rate did not increase substantially in either species by 30 days post-hatching. Yolk-free body mass and heart mass did not change through 30 days in alligators and heart mass was a constant proportion of body mass, even after 1 year. Yolk-free body mass and liver mass grew 36% and 27%, respectively, in turtles during the first 30 days post-hatch. The mass-specific oxidative phosphorylation capacity of mitochondria, assessed using permeabilized muscle fibers, increased by a non-significant 47% in alligator thigh and a non-significant 50% in turtle thigh over 30 days, but did not increase in the heart. This developmental trajectory of mitochondrial function is slower and shallower than that previously observed in ducks, which demonstrate a 90% increase in mass-specific oxidative phosphorylation capacity in thigh muscles over just a few days, a 60% increase in mass-specific oxidative phosphorylation capacity of the heart over a few days, and disproportionate growth of the heart and other organs. Our data thus support the hypothesis that these developmental changes in ducks represent mechanistic drivers for attaining endothermy. PMID:26962048

  11. Oak Ridge National Laboratory Biological Monitoring and Abatement Program for White Oak Creek Watershed and the Clinch River

    SciTech Connect

    Loar, J.M.; Adams, S.M.; Allison, L.J.; Blaylock, B.G.; Boston, H.L.; Huston, M.A.; Kimmel, B.L.; Smith, J.G.; Southworth, G.R.; Stewart, A.J.; Walton, B.T.; Kitchings, J.T.; Olsen, C.R.


    On April 1, 1986, a National Pollutant Discharge Elimination System (NPDES) permit was issued for the Oak Ridge National Laboratory (ORNL) (EPA 1986). As specified in Part 3: Special Conditions (Item H) of the permit, a plan for biological monitoring of the Clinch River, White Oak Creek (WOC), Northwest Tributary (NWT) of WOC, Melton Branch (MB), Fifth Creek, and First Creek shall be submitted for approval to the US Environmental Protection Agency (EPA) and the Tennessee Department of Health and Environment (TDHE) within 90 days of the effective date of the permit. The plan, which is referred to in Part 3 (H) of the permit as the Biological Monitoring Plan and Abatement Program (BMPAP), describes characterization monitoring studies to be conducted for the duration of the permit (5 years). In order to be consistent with the terminology used for the Biological Monitoring and Abatement Programs for the Oak Ridge Y-12 Plan and the Oak Ridge K-25 Plant, BMPAP will subsequently be referred to as the Biological Monitoring and Abatement Program (BMAP). The proposed BMAP outlined in this document is based on preliminary discussions held on December 9, 1985, between staff of Martin Marietta Energy Systems, Inc. (ORNL and Central Management), the US Department of Energy (DOE), EPA, and TDHE. 232 refs., 11 figs., 7 tabs.

  12. A bill to reauthorize the Rivers of Steel National Heritage Area, the Lackawanna Valley National Heritage Area, and the Delaware and Lehigh National Heritage Corridor.

    THOMAS, 112th Congress

    Sen. Casey, Robert P., Jr. [D-PA


    03/07/2012 Committee on Energy and Natural Resources Subcommittee on National Parks. Hearings held. With printed Hearing: S.Hrg. 112-401. (All Actions) Tracker: This bill has the status IntroducedHere are the steps for Status of Legislation:

  13. Extreme river response to climate-induced aggradation in a forested, montane basin, Carbon River, Mount Rainier National Park, Washington, United States

    NASA Astrophysics Data System (ADS)

    Beyeler, J. D.; Rossi, R. K.; Kennard, P. M.; Beason, S. R.


    Climate change is drastically affecting the alpine landscape of Mount Rainier, encouraging glacial retreat, changes in snowpack thickness and longevity, and sediment delivery to downstream fluvial systems, leading to an extremely transport limited system and aggradation of the river valleys. River aggradation encourages devastating interactions between the pro-glacial braided fluvial systems and streamside floodplain ecosystems, in most places occupied by old-growth conifer forests. Current aggradation rates of the channels, bordered by late seral stage riparian forests, inhibit floodplain development, leading to an inverted relationship between perched river channels and lower-elevation adjacent floodplains. This disequilibrium creates a steeper gradient laterally towards the floodplains, rather than downstream; promoting flooding of streamside forest, removal and burial of vegetation with coarse alluvium, incision of avulsion channels, tree mortality, wood recruitment to channels, and ultimately widening the alluviated valley towards the glacially carved hillslopes. Aggradation and loss of streamside old-growth forest poses a significant problem to park infrastructure (e.g. roads, trails, and campgrounds) due to flood damage with as frequent as a two-year event. Other park rivers, the White River and Tahoma Creek, characterize two end-member cases. Despite an extremely perched channel, the White River is relatively stable; experiencing small avulsions while the old-growth streamside forest has remained mostly intact. These relatively small avulsions however severely impact park infrastructure, causing extensive flood damage and closure of the heavily trafficked state highway. Conversely debris flows on Tahoma Creek destroyed the streamside forest and migration across the valley is uninhibited. Mature streamside forests tend to oppose avulsions, sieving wood at the channel margins, promoting sediment deposition and deflection of erosive flows. Our study seeks to

  14. Cadmium Accumulation in Periphyton from an Abandoned Mining District in the Buffalo National River, Arkansas.


    McCauley, Jacob R; Bouldin, Jennifer L


    The Rush Mining District along the Buffalo River in Arkansas has a significant history of zinc and lead mining operations. The tails and spoils of these operations deposit heavy amounts of raw ore into streams. One element commonly found in the earth's crust that becomes a minor constituent of the deposition is cadmium. Periphyton samples from Rush Creek and Clabber Creek, two creeks within the Rush Mining District were measured for cadmium as well as two creeks with no history of mining, Spring Creek and Water Creek. Periphyton samples from Rush and Clabber Creek contained mean cadmium concentrations of 436.6 ± 67.3 and 93.38 ± 8.67 µg/kg, respectively. Spring Creek and Water Creek had a mean cadmium concentration of 40.49 ± 3.40 and 41.78 ± 3.99 µg/kg within periphyton. The results indicate increased metal concentrations in algal communities from mined areas. As periphyton is the base of the aquatic food chain, it acts as a conduit for movement of cadmium in the food web.

  15. Cadmium Accumulation in Periphyton from an Abandoned Mining District in the Buffalo National River, Arkansas.


    McCauley, Jacob R; Bouldin, Jennifer L


    The Rush Mining District along the Buffalo River in Arkansas has a significant history of zinc and lead mining operations. The tails and spoils of these operations deposit heavy amounts of raw ore into streams. One element commonly found in the earth's crust that becomes a minor constituent of the deposition is cadmium. Periphyton samples from Rush Creek and Clabber Creek, two creeks within the Rush Mining District were measured for cadmium as well as two creeks with no history of mining, Spring Creek and Water Creek. Periphyton samples from Rush and Clabber Creek contained mean cadmium concentrations of 436.6 ± 67.3 and 93.38 ± 8.67 µg/kg, respectively. Spring Creek and Water Creek had a mean cadmium concentration of 40.49 ± 3.40 and 41.78 ± 3.99 µg/kg within periphyton. The results indicate increased metal concentrations in algal communities from mined areas. As periphyton is the base of the aquatic food chain, it acts as a conduit for movement of cadmium in the food web. PMID:27130541

  16. Water flow and nutrient flux from five estuarine rivers along the southwest coast of Everglades National Park, Florida, 1997-2001

    USGS Publications Warehouse

    Levesque, V.A.


    Discharge and nutrient fluxes for five tidally affected streams were monitored and evaluated as a part of the U.S. Geological Survey Place-Based Studies Initiative and the U.S. Department of the Interior Critical Ecosystem Studies Initiative. Locations on Lostmans Creek, and Broad, Harney, Shark, and North Rivers were selected using the criterion that a large amount of the water that flows through Shark River Slough must pass these sites. Discharge and nutrient-concentration data collection started at the Broad, Harney, and Shark River stations in January 1997 and ended in early 2001. Discharge and nutrient-concentration data collection started at the Lostmans Creek and North River stations in April 1999 and ended in early 2001. Each station was equipped with a vertically oriented acoustic-velocity sensor, water-level pressure transducer, bottom water-temperature thermistor, and specific conductance four-electrode sensor. Data collected using a vessel-mounted acoustic discharge measurement system were used to calibrate regression models of the mean river velocities and the in-situ index velocities. Information from these stations, in conjunction with data from other ongoing studies, will help to determine environmental effects on the southwest coast estuaries as changes in water management of the Everglades National Park continue. Discharges from the Lostmans Creek, and Broad, Harney, Shark, and North River stations are influenced by semidiurnal tides, meteorological events, and surface- and ground-water inflow. Each of the five rivers is usually well mixed, having no greater than 500 microSiemens per centimeter at 25? Celsius difference in specific conductance from top to bottom during flood and ebb tides. Instantaneous flood discharges (water moving upstream) are typically of greater magnitude and shorter duration than instantaneous ebb discharges (water moving downstream). Instantaneous discharge data were filtered using a low-pass filter to remove predominant

  17. Straddle-packer aquifer test analyses of the Snake River Plain aquifer at the Idaho National Engineering Laboratory

    SciTech Connect

    Johnson, G.S.; Frederick, D.B.


    The State of Idaho INEL Oversight Program, with the University of Idaho, Idaho State University, Boise State University, and the Idaho Geologic Survey, used a straddle-packer system to investigate vertical variations in characteristics of the Snake River Plain aquifer at the Idaho National Engineering Laboratory in southeast Idaho. Sixteen single-well aquifer tests were conducted on.isolated intervals in three observation wells. Each of these wells has approximately 200 feet of open borehole below the water table, penetrating the E through G and I basalt flow groups and interbedded sediments of the Snake River Plain aquifer. The success of the aquifer tests was limited by the inability to induce measurable drawdown in several zones. Time-drawdown data from aquifer tests were matched to type curves for 8 of the 16 zones tested. A single aquifer test at the water table exhibited greater curvature than those at depth. The increased degree of curvature suggests an unconfined response and resulted in an estimate of specific yield of 0.03. Aquifer tests below the water table generally yielded time-drawdown graphs with a rapid initial response followed by constant drawdown throughout the duration of the tests; up to several hours in length. The rapid initial response implies that the aquifer responds as a confined system during brief pumping periods. The nearly constant drawdown suggests a secondary source of water, probably vertical flow from overlying and underlying aquifer layers. Three analytical models were applied for comparison to the conceptual model and to provide estimates of aquifer properties. This, Hantush-Jacob leaky aquifer, and the Moench double-porosity fractured rock models were fit to time-drawdown data. The leaky aquifer type curves of Hantush and Jacob generally provided the best match to observed drawdown. A specific capacity regression equation was also used to estimate hydraulic conductivity.

  18. Arsenic and fluoride in the upper madison river system: Firehole and gibbon rivers and their tributaries, yellowstone national park, wyoming, and southeast montana

    USGS Publications Warehouse

    Thompson, J.M.


    Chemical analyses of 21 water samples from the Firehole and Gibbon Rivers, which combine to form the Madison River, gave arsenic and fluoride values above the Environmental Protection Agency Interim Primary Drinking Water maximum contaminant levels (0.05 mg/l arsenic and 2.0 mg/l fluoride). On 18 October, 1975, during a period of moderate flow (16,600 l/s), the Madison River at West Yellowstone contained 0.23 mg/l arsenic and 6.2 mg/l fluoride. Below Hebgen Lake the Madison River during periods of high flow (56,000 liter/s at West Yellowstone and 708,000 liter/s below Hebgen Lake) would contain 0.05 mg/l arsenic at both stations and 1.5 and 4.0 mg/l fluoride at West Yellowstone and below Hebgen Lake, respectively. The strong correlations of arsenic and fluoride with other chemical constituents of the river water at the sampling sites demonstrate the conservative nature of each element after it reaches the Madison River system. Calculations indicate that water from three sampling sites is above saturation with respect to fluorite. ?? 1979 Springer-Verlag New York Inc.

  19. Activities of the National Water-Quality Assessment Program in the upper Snake River Basin, Idaho and western Wyoming, 1991-2001

    USGS Publications Warehouse

    Low, Walton H.


    In 1991, the U.S. Geological Survey (USGS) began a full-scale National Water-Quality Assessment (NAWQA) Program. The long-term goals of the NAWQA Program are to describe the status and trends in the water quality of a large part of the Nation's rivers and aquifers and to improve understanding of the primary natural and human factors that affect water-quality conditions. In meeting these goals, the program will produce water-quality, ecological, and geographic information that will be useful to policy makers and managers at the national, State, and local levels. A major component of the program is study-unit investigations, upon which national-level assessment activities are based. The program's 60 study-unit investigations are associated with principal river basins and aquifer systems throughout the Nation. Study units encompass areas from 1,200 to more than 65,000 mi2 (square miles) and incorporate about 60 to 70 percent of the Nation's water use and population served by public water supply. In 1991, the upper Snake River Basin was among the first 20 NAWQA study units selected for implementation. From 1991 to 1995, a high-intensity data-collection phase of the upper Snake River Basin study unit (fig. 1) was implemented and completed. Components of this phase are described in a report by Gilliom and others (1995). In 1997, a low-intensity phase of data collection began, and work continued on data analysis, report writing, and data documentation and archiving activities that began in 1996. Principal data-collection activities during the low-intensity phase will include monitoring of surface-water and ground-water quality, assessment of aquatic biological conditions, and continued compilation of environmental setting information.

  20. Slow isotope turnover rates and low discrimination values in the American alligator: implications for interpretation of ectotherm stable isotope data.


    Rosenblatt, Adam E; Heithaus, Michael R


    Stable isotope analysis has become a standard ecological tool for elucidating feeding relationships of organisms and determining food web structure and connectivity. There remain important questions concerning rates at which stable isotope values are incorporated into tissues (turnover rates) and the change in isotope value between a tissue and a food source (discrimination values). These gaps in our understanding necessitate experimental studies to adequately interpret field data. Tissue turnover rates and discrimination values vary among species and have been investigated in a broad array of taxa. However, little attention has been paid to ectothermic top predators in this regard. We quantified the turnover rates and discrimination values for three tissues (scutes, red blood cells, and plasma) in American alligators (Alligator mississippiensis). Plasma turned over faster than scutes or red blood cells, but turnover rates of all three tissues were very slow in comparison to those in endothermic species. Alligator δ(15)N discrimination values were surprisingly low in comparison to those of other top predators and varied between experimental and control alligators. The variability of δ(15)N discrimination values highlights the difficulties in using δ(15)N to assign absolute and possibly even relative trophic levels in field studies. Our results suggest that interpreting stable isotope data based on parameter estimates from other species can be problematic and that large ectothermic tetrapod tissues may be characterized by unique stable isotope dynamics relative to species occupying lower trophic levels and endothermic tetrapods.

  1. Urinary iodine and stable isotope analysis to examine habitat influences on thyroid hormones among coastal dwelling American alligators.


    Boggs, Ashley S P; Hamlin, Heather J; Nifong, James C; Kassim, Brittany L; Lowers, Russell H; Galligan, Thomas M; Long, Stephen E; Guillette, Louis J


    The American alligator, generally a freshwater species, is known to forage in marine environments despite the lack of a salt secreting gland found in other crocodylids. Estuarine and marine foraging could lead to increased dietary uptake of iodine, a nutrient necessary for the production of thyroid hormones. To explore the influence of dietary iodine on thyroid hormone health of coastal dwelling alligators, we described the seasonal plasma thyroxine and triiodothyronine concentrations measured by radioimmunoassay and urinary iodine (UI) concentrations measured by inductively coupled plasma mass spectrometry. We also analyzed long-term dietary patterns through stable isotope analysis of scute tissue. Snout-to-vent length (SVL) was a significant factor among UI and stable isotope analyses. Large adult males greater than 135cm SVL had the highest UI concentrations but did not display seasonality of thyroid hormones. Alligators under 135 SVL exhibited seasonality in thyroid hormones and a positive relationship between UI and triiodothyronine concentrations. Isotopic signatures provided supporting evidence that large males predominantly feed on marine/estuarine prey whereas females showed reliance on freshwater/terrestrial prey supplemented by marine/estuarine prey. UI measurement provided immediate information that correlated to thyroid hormone concentrations whereas stable isotope analysis described long-term dietary patterns. Both techniques demonstrate that adult alligators in coastal environments are utilizing estuarine/marine habitats, which could alter thyroid hormone physiology.

  2. Nuclear β-catenin localization supports homology of feathers, avian scutate scales, and alligator scales in early development.


    Musser, Jacob M; Wagner, Günter P; Prum, Richard O


    Feathers are an evolutionary novelty found in all extant birds. Despite recent progress investigating feather development and a revolution in dinosaur paleontology, the relationship of feathers to other amniote skin appendages, particularly reptile scales, remains unclear. Disagreement arises primarily from the observation that feathers and avian scutate scales exhibit an anatomical placode-defined as an epidermal thickening-in early development, whereas alligator and other avian scales do not. To investigate the homology of feathers and archosaur scales we examined patterns of nuclear β-catenin localization during early development of feathers and different bird and alligator scales. In birds, nuclear β-catenin is first localized to the feather placode, and then exhibits a dynamic pattern of localization in both epidermis and dermis of the feather bud. We found that asymmetric avian scutate scales and alligator scales share similar patterns of nuclear β-catenin localization with feathers. This supports the hypothesis that feathers, scutate scales, and alligator scales are homologous during early developmental stages, and are derived from early developmental stages of an asymmetric scale present in the archosaur ancestor. Furthermore, given that the earliest stage of β-catenin localization in feathers and archosaur scales is also found in placodes of several mammalian skin appendages, including hair and mammary glands, we hypothesize that a common skin appendage placode originated in the common ancestor of all amniotes. We suggest a skin placode should not be defined by anatomical features, but as a local, organized molecular signaling center from which an epidermal appendage develops.

  3. Urinary iodine and stable isotope analysis to examine habitat influences on thyroid hormones among coastal dwelling American alligators.


    Boggs, Ashley S P; Hamlin, Heather J; Nifong, James C; Kassim, Brittany L; Lowers, Russell H; Galligan, Thomas M; Long, Stephen E; Guillette, Louis J


    The American alligator, generally a freshwater species, is known to forage in marine environments despite the lack of a salt secreting gland found in other crocodylids. Estuarine and marine foraging could lead to increased dietary uptake of iodine, a nutrient necessary for the production of thyroid hormones. To explore the influence of dietary iodine on thyroid hormone health of coastal dwelling alligators, we described the seasonal plasma thyroxine and triiodothyronine concentrations measured by radioimmunoassay and urinary iodine (UI) concentrations measured by inductively coupled plasma mass spectrometry. We also analyzed long-term dietary patterns through stable isotope analysis of scute tissue. Snout-to-vent length (SVL) was a significant factor among UI and stable isotope analyses. Large adult males greater than 135cm SVL had the highest UI concentrations but did not display seasonality of thyroid hormones. Alligators under 135 SVL exhibited seasonality in thyroid hormones and a positive relationship between UI and triiodothyronine concentrations. Isotopic signatures provided supporting evidence that large males predominantly feed on marine/estuarine prey whereas females showed reliance on freshwater/terrestrial prey supplemented by marine/estuarine prey. UI measurement provided immediate information that correlated to thyroid hormone concentrations whereas stable isotope analysis described long-term dietary patterns. Both techniques demonstrate that adult alligators in coastal environments are utilizing estuarine/marine habitats, which could alter thyroid hormone physiology. PMID:26684734

  4. The first fossil skull of Alligator sinensis from the Pleistocene, Taiwan, with a paleogeographic implication of the species

    NASA Astrophysics Data System (ADS)

    Hsi-yin, Shan; Yen-nien, Cheng; Xiao-chun, Wu


    A nearly complete fossil skull of Alligatoridae from the Pleistocene, Penghu Channel, east of Taiwan, is reported. It can be referred to the most latest clade of Alligatorinae, which includes Alligator sinensis, Alligator mississippiensis and Alligator mefferdi, on the basis of the following features: the splenial is excluded from the mandibular symphysis; the anterior tip of the splenial passes dorsal to the Meckelian groove; and the mandible is gently curved between the fourth alveoli and the mid dentary. It differs from A. mississippiensis and A. mefferdi mainly in the following characters: the breadth between the supratemporal fenestrae is approximately equal to the interorbital width, the snout is about half the length of the skull; and the anterior part of the snout is subtriangular in dorsal view. These features suggest that the Penghu alligator is most probably referable to A. sinensis. This is the only fossil skull of A. sinensis known. The discovery of the skull in Penghu Channel not only provides the first solid fossil evidence to indicate that the geological distribution of A. sinensis extended farther southeast than the historical/archeological range of the species but also adds new information on the biodiversity of the Penghu fauna.

  5. Gonadal steroidogenesis in vitro from juvenile alligators obtained from contaminated or control lakes.

    PubMed Central

    Guillette, L J; Gross, T S; Gross, D A; Rooney, A A; Percival, H F


    The ubiquitous distribution of many contaminants and the nonlethal, multigenerational effects of such contaminants on reproductive, endocrine, and immune systems have led to concerns that wildlife worldwide are affected. Although the causal agents and effects are known for some species, the underlying physiological mechanisms associated with contaminant-induced reproductive modifications are still poorly understood and require extensive research. We describe a study examining the steroidogenic activity of gonads removed from juvenile alligators (Alligator mississippiensis) obtained from contaminated or control lakes in central Florida. Synthesis of estradiol-17 beta (E2) was significantly different when ovaries from the contaminated and control lakes were compared in vitro. Additionally, testes from males obtained from the contaminated lake. Lake Apopka, synthesized significantly higher concentrations of E2 when compared to testes obtained from control males. In contrast, testosterone (T) synthesis from all testes examined in this study displayed a normal pattern and produced concentrations greater than that observed from ovaries obtained from either lake. Interestingly, the pattern of gonadal steroidogenesis differs from previously reported plasma concentrations of these hormones obtained from the same individuals. We suggest that the differences between the in vivo and in vitro patterns are due to modifications in the hepatic degradation of plasma sex steroid hormones. PMID:7556021

  6. In vivo bone strain and finite element modeling of the mandible of Alligator mississippiensis

    PubMed Central

    Porro, Laura B; Metzger, Keith A; Iriarte-Diaz, Jose; Ross, Callum F


    Forces experienced during feeding are thought to strongly influence the morphology of the vertebrate mandible; in vivo strain data are the most direct evidence for deformation of the mandible induced by these loading regimes. Although many studies have documented bone strains in the mammalian mandible, no information is available on strain magnitudes, orientations or patterns in the sauropsid lower jaw during feeding. Furthermore, strain gage experiments record the mechanical response of bone at a few locations, not across the entire mandible. In this paper, we present bone strain data recorded at various sites on the lower jaw of Alligator mississippiensis during in vivo feeding experiments. These data are used to understand how changes in loading regime associated with changes in bite location are related to changes in strain regime on the working and balancing sides of the mandible. Our results suggest that the working side mandible is bent dorsoventrally and twisted about its long-axis during biting, and the balancing side experiences primarily dorsoventral bending. Strain orientations are more variable on the working side than on the balancing side with changes in bite point and between experiments; the balancing side exhibits higher strain magnitudes. In the second part of this paper, we use principal strain orientations and magnitudes recorded in vivo to evaluate a finite element model of the alligator mandible. Our comparison demonstrates that strain orientations and mandibular deformation predicted by the model closely match in vivo results; however, absolute strain magnitudes are lower in the finite element model. PMID:23855772

  7. Spermiogenesis in the imbricate alligator lizard, Barisia imbricata (Reptilia, Squamata, Anguidae).


    Gribbins, Kevin M; Rheubert, Justin L; Touzinsky, Katherine; Hanover, Jessica; Matchett, Caroline L; Granados-González, Gisela; Hernández-Gallegos, Oswaldo


    Although the events of spermiogenesis are commonly studied in amniotes, the amount of research available for Squamata is lacking. Many studies have described the morphological characteristics of mature spermatozoa in squamates, but few detail the ultrastructural changes that occur during spermiogenesis. This study's purpose is to gain a better understanding of the subcellular events of spermatid development within the Imbricate Alligator Lizard, Barisia imbricata. The morphological data presented here represent the first complete ultrastructural study of spermiogenesis within the family Anguidae. Samples of testes from four specimens collected on the northwest side of the Nevado de Toluca, México, were prepared using standard techniques for transmission electron microscopy. Many of the ultrastructural changes occurring during spermiogenesis within B. imbricata are similar to that of other squamates (i.e., early acrosome formation, chromatin condensation, flagella formation, annulus present, and a prominent manchette). However, there are a few unique characteristics within B. imbricata spermatids that to date have not been described during spermiogenesis in other squamates. For example, penetration of the acrosomal granule into the subacrosomal space to form the basal plate of the perforatorium during round spermatid development, the clover-shaped morphology of the developing nuclear fossa of the flagellum, and the bulbous shape to the perforatorium are all unique to the Imbricate Alligator Lizard. These anatomical character differences may be valuable nontraditional data that along with more traditional matrices (such as DNA sequences and gross morphological data) may help elucidate phylogenetic relationships, which are historically considered controversial within Squamata.

  8. Quantification of intraskeletal histovariability in Alligator mississippiensis and implications for vertebrate osteohistology.


    Woodward, Holly N; Horner, John R; Farlow, James O


    Bone microanalyses of extant vertebrates provide a necessary framework from which to form hypotheses regarding the growth and skeletochronology of extinct taxa. Here, we describe the bone microstructure and quantify the histovariability of appendicular elements and osteoderms from three juvenile American alligators (Alligator mississippiensis) to assess growth mark and tissue organization within and amongst individuals, with the intention of validating paleohistological interpretations. Results confirm previous observations that lamellar and parallel fibered tissue organization are typical of crocodylians, and also that crocodylians are capable of forming woven tissue for brief periods. Tissue organization and growth mark count varies across individual skeletal elements and reveal that the femur, tibia, and humerus had the highest annual apposition rates in each individual. Cyclical growth mark count also varies intraskeletally, but data suggest these inconsistencies are due to differing medullary cavity expansion rates. There was no appreciable difference in either diaphyseal circumference or cyclical growth mark circumferences between left and right element pairs from an individual if diaphyses were sampled from roughly the same location. The considerable intraskeletal data obtained here provide validation for long-held paleohistology assumptions, but because medullary expansion, cyclical growth mark formation, and variable intraskeletal growth rates are skeletal features found in tetrapod taxa living or extinct, the validations presented herein should be considered during any tetrapod bone microanalysis. PMID:24949239

  9. Acanthostomum macroclemidis n. sp. (Digenea: Cryptogonimidae: Acanthostominae) from the alligator snapping turtle, Macroclemys temmincki.


    Tkach, Vasyl V; Snyder, Scott D


    Acanthostomum macroclemidis n. sp. is described from specimens found in the intestine of an alligator snapping turtle Macroclemys temmincki from southern Mississippi. The most important diagnostic features of the new species are the general shape and proportions of the body, the position of the pharynx (relative length of the prepharynx and esophagus), the egg size, the relative length and position of the vitelline fields, and the number, shape, and size of the circumoral spines. The new species has a very elongated body (length-width ratio, 8.9-13.0:1), 26 circumoral spines, which are almost oval in shape, a long prepharynx and a very short (shorter than the pharynx) esophagus, a seminal receptacle situated between the ovary and the anterior testis, a uterus not extending posterior to the anterior margin of the ovary, a long-stemmed and short-armed excretory vesicle, and 2 anal openings. Some features of the external morphology, such as the suckers, circumoral spines, sensory papillae, tegumental spines, and morphology of the posterior end, are examined using scanning electron microscopy. A diagnosis differentiating A. macroclemidis n. sp. from some other acanthostomine digeneans is provided. Acanthostomum macroclemidis n. sp. is the first digenean reported from an alligator snapping turtle and represents the northernmost record of an acanthostomine from turtles. PMID:12659321

  10. Three-dimensional skeletal kinematics of the shoulder girdle and forelimb in walking Alligator

    PubMed Central

    Baier, David B; Gatesy, Stephen M


    Crocodylians occupy a key phylogenetic position for investigations of archosaur locomotor evolution. Compared to the well-studied hindlimb, relatively little is known about the skeletal movements and mechanics of the forelimb. In this study, we employed manual markerless XROMM (X-ray Reconstruction Of Moving Morphology) to measure detailed 3-D kinematics of the shoulder girdle and forelimb bones of American alligators (Alligator mississippiensis) walking on a treadmill. Digital models of the interclavicle, scapulocoracoid, humerus, radius and ulna were created using a 3-D laser scanner. Models were articulated and aligned to simultaneously recorded frames of fluoroscopic and standard light video to reconstruct and measure joint motion. Joint coordinate systems were established for the coracosternal, glenohumeral and elbow joints. Our analysis revealed that the limb joints only account for about half of fore/aft limb excursion; the remaining excursion results from shoulder girdle movements and lateral bending of the vertebral column. Considerable motion of each scapulocoracoid relative to the vertebral column is consistent with coracosternal mobility. The hemisellar design of the glenohumeral joint permits some additional translation, or sliding in the fore-aft plane, but this movement does not have much of an effect on the distal excursion of the bone. PMID:24102540

  11. Abnormal bone composition in female juvenile American alligators from a pesticide-polluted lake (Lake Apopka, Florida).

    PubMed Central

    Lind, P Monica; Milnes, Matthew R; Lundberg, Rebecca; Bermudez, Dieldrich; Orberg, Jan A; Guillette, Louis J


    Reproductive disorders have been found in pesticide-exposed alligators living in Lake Apopka, Florida (USA). These disorders have been hypothesized to be caused by exposure to endocrine- disruptive estrogen-like contaminants. The aim of this study was to expand our analysis beyond previous studies by investigating whether bone tissue, known to be affected by sex steroid hormones, is a potential target of endocrine disruptors. Long bones from 16 juvenile female alligators from Lake Apopka (pesticide-contaminated lake) and Lake Woodruff (control lake) were evaluated by peripheral quantitative computed tomography. We observed significant differences in bone composition, with female alligators from the contaminated lake having greater trabecular bone mineral density (BMD), total BMD, and trabecular mineral content compared with females from the control lake (p < 0.05). Increased trabecular and total BMD measurements suggest that juvenile female alligators from Lake Apopka were exposed to contaminants that created an internal environment more estrogenic than that normally observed. This estrogenic environment could be caused by both natural and anthropogenic compounds. Effects on BMD indicate interference with bone homeostasis. We hypothesize that contaminants present in the lake inhibit the natural and continuous resorption of bone tissue, resulting in increased bone mass. Although this is the only study performed to date examining effects of environmental estrogenic compounds on alligator bones, it supports previous laboratory-based studies in rodents. Further, this study is important in demonstrating that the alterations in morphology and physiology induced in free-ranging individuals living in environments contaminated with endocrine-active compounds are not limited to a few systems or tissues; rather, effects can be observed in many tissues affected by these hormones. PMID:14998753

  12. Developmental abnormalities of the gonad and abnormal sex hormone concentrations in juvenile alligators from contaminated and control lakes in Florida.

    PubMed Central

    Guillette, L J; Gross, T S; Masson, G R; Matter, J M; Percival, H F; Woodward, A R


    The reproductive development of alligators from a contaminated and a control lake in central Florida was examined. Lake Apopka is adjacent to an EPA Superfund site, listed due to an extensive spill of dicofol and DDT or its metabolites. These compounds can act as estrogens. Contaminants in the lake also have been derived from extensive agricultural activities around the lake that continue today and a sewage treatment facility associated with the city of Winter Garden, Florida. We examined the hypothesis that an estrogenic contaminant has caused the current failure in recruitment of alligators on Lake Apopka. Supporting data include the following: At 6 months of age, female alligators from Lake Apopka had plasma estradiol-17 beta concentrations almost two times greater than normal females from the control lake, Lake Woodruff. The Apopka females exhibited abnormal ovarian morphology with large numbers of polyovular follicles and polynuclear oocytes. Male juvenile alligators had significantly depressed plasma testosterone concentrations comparable to levels observed in normal Lake Woodruff females but more than three times lower than normal Lake Woodruff males. Additionally, males from Lake Apopka had poorly organized testes and abnormally small phalli. The differences between lakes and sexes in plasma hormone concentrations of juvenile alligators remain even after stimulation with luteinizing hormone. Our data suggest that the gonads of juveniles from Lake Apopka have been permanently modified in ovo, so that normal steroidogenesis is not possible, and thus normal sexual maturation is unlikely. Images p680-a Figure 1. Figure 2. Figure 3. A Figure 3. B Figure 3. C Figure 4. A Figure 4. B Figure 4. C Figure 4. D Figure 5. A Figure 5. B Figure 5. C PMID:7895709

  13. Study of red-sore disease in alligators. Final report, September 1, 1976-September 3, 1980. [Predisposing factors

    SciTech Connect

    Gorden, R.E.; Esch, G.W.


    Necropsies of eight alligators which died following capture within a thermally-altered reservoir demonstrated the presence of the gram negative, pathogenic bacterium Aeromonas hydrophila, in internal tissues. A study designed to demonstrate whether A. hydrophila were capable of causing infection and death of the ecologically threatened alligator and, if so, the mechanism of exposure and infection in natural habitats was undertaken. The pathology and response to infection were also studied. When juvenile alligators were exposed under experimental conditions to increasing concentrations of A. hydrophila in water, by oral inoculation, or by intramuscular injections at 20/sup 0/, 25/sup 0/, 30/sup 0/, and 35/sup 0/C, they developed external lesions. These lesions were likely to become severe and lead to death of the animal at 30 and 35/sup 0/C. Infected animals produced: (a) increased numbers of white blood cells; (b) increased specific antibody titer; and (c) alpha 2 peaks higher than albumen peaks (except at 35/sup 0/C). Biweekly intraperitoneal injections of live, washed A. hydrophila were apparently more effective in the prevention of infection and of external lesions than were the antibiotics Kanamycin and OTH-Puramycin. Topical applications of Neosporin ointment resulted in the healing of severe lesions on confined animals. Alligators which were shown to be exposed to A. hydrophila in their natural habitats showed no external evidence of infection by the bacteria. It is recommended that exposure to conditions of stress, including water temperatures greater than 30/sup 0/C, be kept to a minimum during the capture, transport, and captivity of alligators. (ERB)


    EPA Science Inventory

    Environmental contaminants can act as stressors, inducing elevated circulating concentrations of stress hormones such as corticosterone and cortisol. Development in contaminated eggs has been reported to modify circulating sex steroid hormone concentrations in alligators (Alligat...


    EPA Science Inventory

    Wild alligators exposed to persistent organochlorine contaminants, municipal waste compounds, and contemporary-use herbicides exhibit reproductive alterations that are thought to be caused by endocrine disruption. This study tests the hypothesis that these alterations, at least i...

  16. Geophysical logging studies in the Snake River Plain Aquifer at the Idaho National Engineering Laboratory: Wells 44, 45, and 46

    SciTech Connect

    Morin, R.H.; Paillet, F.L.; Taylor, T.A.; Barrash, W.


    A geophysical logging program was undertaken to vertically profile changes in the hydrology and hydrochemistry of the Snake River Plain aquifer underlies the Idaho National Engineering Laboratory (INEL). Field investigations were concentrated within an area west of the Idaho Chemical Processing Plant (ICPP) in three wells that penetrated the upper 190 feet of the aquifer. The logs obtained in these wells consisted of temperature, caliper, nuclear (neutron porosity and gamma-gama density), natural gamma, borehole televiewer, gamma spectral, and thermal flowmeter (with and without pumping). The nuclear, caliper, and televiewer logs are used to delineate individual basalt flows or flow units and to recognize breaks between flows or flow units at interflow contact zones and sedimentary interbeds. The temperature logs and flowmeter measurements obtained under ambient hydraulic head conditions identified upward fluid-circulation patterns in the three wells. Gamma-spectral analyses performed at several depths in each well showed that the predominant source of gamma radiation in the formation at this site originates mainly from potassium ({sup 40}K). However, {sup 137}Cesium was detected at 32 feet below land surface in well 45. An empirical investigation of the effect of source-receiver spacing on the response of the neutron-porosity logging tool was attempted in an effort to understand the conditions under which this tool might be applied to large-diameter boreholes in-unsaturated formations.

  17. Terrestrial arthropods of Steel Creek, Buffalo National River, Arkansas. I. Select beetles (Coleoptera: Buprestidae, Carabidae, Cerambycidae, Curculionoidea excluding Scolytinae)

    PubMed Central

    Fisher, Danielle M.; Schnepp, Kyle E.; Dowling, Ashley P.G.


    Abstract Background The Ozark Mountains are a region with high endemism and biodiversity, yet few invertebrate inventories have been made and few sites extensively studied. We surveyed a site near Steel Creek Campground, along the Buffalo National River in Arkansas, using twelve trap types – Malaise traps, canopy traps (upper and lower collector), Lindgren multifunnel traps (black, green, and purple), pan traps (blue, purple, red, white, and yellow), and pitfall traps – and Berlese-Tullgren extraction for eight and half months. New information We provide collection records of beetle species belonging to eight families collected at the site. Thirty one species represent new state records: (Buprestidae) Actenodes acornis, Agrilus cephalicus, Agrilus ohioensis, Agrilus paracelti, Taphrocerus nicolayi; (Carabidae) Agonum punctiforme, Synuchus impunctatus; (Curculionidae) Acalles clavatus, Acalles minutissimus, Acoptus suturalis, Anthonomus juniperinus, Anametis granulata, Idiostethus subcalvus, Eudociminus mannerheimii, Madarellus undulatus, Magdalis armicollis, Magdalis barbita, Mecinus pascuorum, Myrmex chevrolatii, Myrmex myrmex, Nicentrus lecontei, Otiorhynchus rugosostriatus, Piazorhinus pictus, Phyllotrox ferrugineus, Plocamus hispidulus, Pseudobaris nigrina, Pseudopentarthrum simplex, Rhinoncus pericarpius, Sitona lineatus, Stenoscelis brevis, Tomolips quericola. Additionally, three endemic carabids, two of which are known only from the type series, were collected. PMID:26752967

  18. Geologic applications of thermal-inertia mapping from satellite. [Powder River, Wyoming; Cubeza Prieta, Arizona, and Yellowstone National Park

    NASA Technical Reports Server (NTRS)

    Offield, T. W. (Principal Investigator); Watson, K.; Hummer-Miller, S.


    In the Powder River Basin, Wyo., narrow geologic units having thermal inertias which contrast with their surroundings can be discriminated in optimal images. A few subtle thermal inertia anomalies coincide with areas of helium leakage believed to be associated with deep oil and gas concentrations. The most important results involved delineation of tectonic framework elements some of which were not previously recognized. Thermal and thermal inertia images also permit mapping of geomorphic textural domains. A thermal lineament appears to reveal a basement discontinuity which involves the Homestake Mine in the Black Hill, a zone of Tertiary igneous activity and facies control in oil producing horizons. Applications of these data to the Cabeza Prieta, Ariz., area illustrate their potential for igneous rock type discrimination. Extension to Yellowstone National Park resulted in the detection of additional structural information but surface hydrothermal features could not be distinguished with any confidence. A thermal inertia mapping algorithm, a fast and accurate image registration technique, and an efficient topographic slope and elevation correction method were developed.

  19. Water-quality study of a reach of the Merced River in Yosemite National Park and vicinity, California, April 1973 through September 1974

    USGS Publications Warehouse

    Hoffman, Ray J.; Dong, Alex E.; Keeter, Gail L.


    A 25-mile reach of the Merced River was studied to provide the U.S. National Park Service with water-quality data prior to the operation of a new sewage treatment plant. Water-quality variables investigated were discharge, temperature, major chemical constituents, selected trace metals, specific conductance, suspended sediment, turbidity, dissolved oxygen, pH , total alkalinity, carbon dioxide, total organic carbon, nitrogen, phosphorus, algal growth potential, coliform bacteria, periphyton, and benthic invertebrates. Results indicate that water in the reach of the Merced River studied is a dilute system of good quality. Mean concentrations of nitrogen and phosphorus were highest in the Merced River at Rancheria Flat. Algal growth potential tests revealed that phosphorus was limiting algal growth at Happy Isles Bridge, El Capitan Bridge, and South Fork Merced River, which nitrogen was limiting it at Rancheria Flat. Input of excessive nitrogen and phosphorus concentrations in the Merced River during the summer low-flow period, and mixing with warm tributary inflow could cause excessive algal growth and production. (Woodard-USGS)

  20. An allocation of undiscovered oil and gas resources to Big South Fork National Recreation Area and Obed Wild and Scenic River, Kentucky and Tennessee

    USGS Publications Warehouse

    Schenk, Christopher J.; Klett, Timothy R.; Charpentier, Ronald R.; Cook, Troy A.; Pollastro, Richard M.


    The U.S. Geological Survey (USGS) estimated volumes of undiscovered oil and gas resources that may underlie Big South Fork National Recreation Area and Obed Wild and Scenic River in Kentucky and Tennessee. Applying the results of existing assessments of undiscovered resources from three assessment units in the Appalachian Basin Province and three plays in the Cincinnati Arch Province that include these land parcels, the USGS allocated approximately (1) 16 billion cubic feet of gas, 15 thousand barrels of oil, and 232 thousand barrels of natural gas liquids to Big South Fork National Recreation Area; and (2) 0.5 billion cubic feet of gas, 0.6 thousand barrels of oil, and 10 thousand barrels of natural gas liquids to Obed Wild and Scenic River. These estimated volumes of undiscovered resources represent potential volumes in new undiscovered fields, but do not include potential additions to reserves within existing fields.

  1. Second report on the Oak Ridge National Laboratory Biological Monitoring and Abatement Program for White Oak Creek Watershed and the Clinch River

    SciTech Connect

    Loar, J.M.; Adams, S.M.; Bailey, R.D.; Blaylock, B.G.; Boston, H.L.; Cox, D.K.; Huston, M.A.; Kimmel, B.L.; Loar, J.M.; Olsen, C.R.; Ryon, M.G.; Shugart, L.R.; Smith, J.G.; Southworth, G.R.; Stewart, A.J.; Walton, B.T.; Talmage, S.S.; Murphy, J.B.; Valentine, C.K.; Appellanis, S.M.; Jimenez, B.D.; Huq, M.V.; Meyers-Schone, L.J.; Mohrbacher, D.A.; Olsen, C.R.; Stout, J.G.


    As a condition of the National Pollutant Discharge Elimination System (NPDES) permit issued to Oak Ridge National Laboratory (ORNL) on April 1, 1986, a Biological Monitoring and Abatement Program (BMAP) was developed for White Oak Creek (WOC); selected tributaries of WOC, including Fifth Creek, First Creek, Melton Branch, and Northwest Tributary; and the Clinch River. BMAP consists of seven major tasks that address both radiological and nonradiological contaminants in the aquatic and terrestrial environs on-site and the aquatic environs off-site. These tasks are (1) toxicity monitoring; (2) bioaccumulation monitoring of nonradiological contaminants in aquatic biota; (3) biological indicator studies; (4) instream ecological monitoring; (5) assessment of contaminants in the terrestrial environment; (6) radioecology of WOC and White Oak Lake (WOL); and (7) contaminant transport, distribution, and fate in the WOC embayment-Clinch River-Watts Bar Reservoir system. This document, the second of a series of annual reports, described the results of BMAP studies conducted in 1987.

  2. Social-value maps for Arapaho, Roosevelt, Medicine Bow, Routt, and White River National Forests, Colorado and Wyoming

    USGS Publications Warehouse

    Ancona, Zachary H.; Semmens, Darius J.; Sherrouse, Benson C.


    Executive SummaryThe continued pressures of population growth on the life-sustaining, economic, and cultural ecosystem services provided by our national forests, particularly those located near rapidly growing urban areas, present ongoing challenges to forest managers. Achieving an effective assessment of these ecosystem services includes a proper accounting of the ecological, economic, and social values attributable to them. However, assessments of ecosystem goods and services notably lack information describing the spatial distribution and relative intensity of social values—the perceived, nonmarket values derived particularly from cultural ecosystem services. A geographic information system (GIS) tool developed to fill this need, Social Values for Ecosystem Services (SolVES;, now provides the capability to generate social-value maps at a range of spatial scales. This report presents some of the methods behind SolVES, procedures needed to apply the tool, the first formal map products resulting from its application at a regional scale, and a discussion of the management implications associated with this type of information.In this study, we use SolVES to identify the location and relative intensity of social values as derived from survey responses gathered from residents living in counties adjacent to Arapaho, Roosevelt, Medicine Bow, Routt, and White River National Forests. The results, presented as a series of social-value maps, represent the first publicly available spatial data on social-value intensity for the southern Rocky Mountain region. Our analysis identified high-value areas for social values including aesthetic, biodiversity, and life sustaining within wilderness areas. Other values, like recreation, show high-value areas both within wilderness and throughout the general forest areas, which can be attributed to people using the forests for a diverse set of recreational activities. The economic social-value type was lower

  3. Social-value maps for Arapaho, Roosevelt, Medicine Bow, Routt, and White River National Forests, Colorado and Wyoming

    USGS Publications Warehouse

    Ancona, Zachary H.; Semmens, Darius J.; Sherrouse, Benson C.


    Executive SummaryThe continued pressures of population growth on the life-sustaining, economic, and cultural ecosystem services provided by our national forests, particularly those located near rapidly growing urban areas, present ongoing challenges to forest managers. Achieving an effective assessment of these ecosystem services includes a proper accounting of the ecological, economic, and social values attributable to them. However, assessments of ecosystem goods and services notably lack information describing the spatial distribution and relative intensity of social values—the perceived, nonmarket values derived particularly from cultural ecosystem services. A geographic information system (GIS) tool developed to fill this need, Social Values for Ecosystem Services (SolVES;, now provides the capability to generate social-value maps at a range of spatial scales. This report presents some of the methods behind SolVES, procedures needed to apply the tool, the first formal map products resulting from its application at a regional scale, and a discussion of the management implications associated with this type of information.In this study, we use SolVES to identify the location and relative intensity of social values as derived from survey responses gathered from residents living in counties adjacent to Arapaho, Roosevelt, Medicine Bow, Routt, and White River National Forests. The results, presented as a series of social-value maps, represent the first publicly available spatial data on social-value intensity for the southern Rocky Mountain region. Our analysis identified high-value areas for social values including aesthetic, biodiversity, and life sustaining within wilderness areas. Other values, like recreation, show high-value areas both within wilderness and throughout the general forest areas, which can be attributed to people using the forests for a diverse set of recreational activities. The economic social-value type was lower

  4. Landscape changes in the Mullica River basin of the Pinelands National Reserve, New Jersey, USA.


    Bunnell, John F; Zampella, Robert A; Lathrop, Richard G; Bognar, John A


    In 1979, the Pinelands Commission was established as a regional land-use planning and regulatory agency charged with the implementation of a Comprehensive Management Plan (CMP) for the Pinelands National Reserve (New Jersey, USA). The CMP was created to balance land preservation and development interests in the Reserve. Because water-quality degradation from developed and agricultural landscapes is associated with changes in the composition of biological communities, monitoring landscape changes provides one of the most direct measures of the impact of land-use policies on the Pinelands ecosystem. In this study, we prepared detailed, land-cover maps within randomly selected aerial-photograph plots for a major watershed in the Reserve. We used these land-cover maps to quantify changes in landscape composition and structure (i.e., patch size, patch area, and number of patches) and characterize land-cover transitions in the basin between 1979 and 1991. Because the study period represented the first 12 years of the regional-planning effort in the Reserve, we evaluated the relationship between land-cover transitions and Commission management-area designations which permit different land-use intensities. Although the landscape composition was similar in 1979 and 1991, we found an increase in the total area and number of developed-land, managed-grassland, and barren-land patches. An increase in the number of patches and a decrease in the total area and median and third-quartile patch sizes for forest land and for all patches regardless of cover type indicated that fragmentation of forest land and the landscape as a whole occurred during the study period. The major land-cover transitions that occurred during the period were the loss of forest land to development and associated cover types and the conversion of one agricultural type to another. Overall, land-cover transitions during the period were found to be consistent with the Commission management-area designations

  5. Flow velocity, water temperature, and conductivity at selected locations in Shark River Slough, Everglades National Park, Florida; July 1999 - July 2003

    USGS Publications Warehouse

    Schaffranek, Raymond W.; Riscassi, Ami L.


    Flow-velocity, water-temperature, and conductivity data were collected at five locations in Shark River Slough, Everglades National Park (ENP), Florida, from 1999 to 2003. The data were collected as part of the U.S. Geological Survey Priority Ecosystems Science Initiative in support of the Comprehensive Everglades Restoration Plan. This report contains digital files and graphical plots of the processed, quality-checked, and edited data. Information pertinent to the locations and monitoring strategy also is presented.

  6. Water Quality, Physical Habitat, and Biology of the Kijik River Basin, Lake Clark National Park and Preserve, Alaska, 2004-2005

    USGS Publications Warehouse

    Brabets, Timothy P.; Ourso, Robert T.


    The U.S. Geological Survey and the National Park Service conducted a water-quality investigation of the Kijik River Basin in Lake Clark National Park and Preserve from June 2004 to March 2005. The Kijik River Basin was studied because it has a productive sockeye salmon run that is important to the larger Kvichak River watershed. Water-quality, physical habitat, and biological characteristics were assessed. Water type throughout the Kijik River Basin is calcium bicarbonate although Little Kijik River above Kijik Lake does have slightly higher concentrations of sulfate and chloride. Alkalinity concentrations are generally less than 28 milligrams per liter, indicating a low buffering capacity of these waters. Lachbuna Lake traps much of the suspended sediment from the glacier streams in the headwaters of the basin as evidenced by low secchi-disc transparency of 1 to 2 meters and low suspended sediment concentrations in the Kijik River downstream from the lake. Kijik Lake is a fed by clearwater streams and has secchi-disc readings ranging from 11 to 15 meters. Streambed sediments collected from four surface sites analyzed for trace elements indicated that arsenic concentrations at all sites were above proposed guidelines. However, arsenic concentrations are due to the local geology, not anthropogenic factors. Benthic macroinvertebrate qualitative multi-habitat samples collected from two sites on the Little Kijik River and two sites on the main stem of the Kijik River indicated a total of 69 taxa present among the four sites. The class Insecta, made up the largest percentage of macroinvertebrates, totaling 70 percent of the families found. The insects were comprised of four orders; Diptera (flies and midges), Ephemeroptera (mayflies), Plecoptera (stoneflies), and Trichoptera (caddisflies). One-hundred twenty-two species of periphytic algae were identified in qualitative multi-habitat samples collected at the four stream sites. Eight species of non-motile, diatoms were

  7. Viability of male gametes in common carp (Cyprinus carpio) along the Lower Colorado River from the Cibola National Wildlife Refuge (NWR), Havasu NWR, and Lake Mohave of Lake Mead National Recreation Area

    USGS Publications Warehouse

    Jenkins, Jill A.; Goodbred, Steven L.


    To contribute to an investigation on possible endocrine impacts in three sites along the lower Colorado River in Arizona, especially in male fishes, this study addressed the null hypothesis that aquatic species in southern sites did not exhibit evidence of endocrine disruption as compared with those in nonimpacted sites. The results presented are intended to provide managers with science-based information and interpretations about the reproductive condition of biota in their habitat along the lower Colorado River to minimize any potential adverse effects to trust fish and wildlife resources and to identify water resources of acceptable quality. In particular, these data can inform decision making about wastewater discharges into the Colorado River that directly supplies water to Arizona refuges located along the river. These data are integral to the USFWS proposal entitled 'AZ - Endocrine Disruption in Razorback Sucker and Common Carp on National Wildlife Refuges along the Lower Colorado River' that was proposed to assess evidence of endocrine disruption in carp and razorback suckers downstream of Hoover Dam.

  8. Iodine-129 in the Snake River Plain Aquifer at and Near the Idaho National Laboratory, Idaho, 2003 and 2007

    USGS Publications Warehouse

    Bartholomay, Roy C.


    From 1953 to 1988, wastewater containing approximately 0.94 curies of iodine-129 (129I) was generated at the Idaho National Laboratory (INL) in southeastern Idaho. Almost all of this wastewater was discharged at or near the Idaho Nuclear Technology and Engineering Center (INTEC) on the INL site. Most of the wastewater was discharged directly into the eastern Snake River Plain aquifer through a deep disposal well until 1984; however, some wastewater also was discharged into unlined infiltration ponds or leaked from distribution systems below the INTEC. In 2003, the U.S. Geological Survey (USGS), in cooperation with the U.S. Department of Energy, collected samples for 129I from 36 wells used to monitor the Snake River Plain aquifer, and from one well used to monitor a perched zone at the INTEC. Concentrations of 129I in the aquifer ranged from 0.0000066 +- 0.0000002 to 0.72 +- 0.051 picocuries per liter (pCi/L). Many wells within a 3-mile radius of the INTEC showed decreases of as much as one order of magnitude in concentration from samples collected during 1990-91, and all of the samples had concentrations less than the Environmental Protection Agency's Maximum Contaminant Level (MCL) of 1 pCi/L. The average concentration of 129I in 19 wells sampled during both collection periods decreased from 0.975 pCi/L in 1990-91 to 0.249 pCi/L in 2003. These decreases are attributed to the discontinuation of disposal of 129I in wastewater after 1988 and to dilution and dispersion in the aquifer. Although water from wells sampled in 2003 near the INTEC showed decreases in concentrations of 129I compared with data collected in 1990-91, some wells south and east of the Central Facilities Area, near the site boundary, and south of the INL showed slight increases. These slight increases may be related to variable discharge rates of wastewater that eventually moved to these well locations as a mass of water from a particular disposal period. In 2007, the USGS collected samples for

  9. Suspended-sediment concentration and pool sedimentation data for the Gibbon River, Yellowstone National Park, Wyoming, September 2000 through October 2001

    USGS Publications Warehouse

    Wright, Peter R.; Zelt, Ronald B.


    This report presents data on streamflow, suspended-sediment concentration, geomorphic measurements of pools, and particle-size distribution of surficial bed material, collected along a 5-mile reach of the Gibbon River in Yellowstone National Park. The study was done in cooperation with the National Park Service. The Park Service was concerned about the potential effects that road reconstruction would have on water quality. A streamflow-gaging station and two automatic pumping samplers were installed in September 2000 to collect suspended-sediment samples. The gage and samplers were operated seasonally from March through September 2001. The geomorphic survey of pools and sampling of bed material occurred during October 2000.

  10. 77 FR 37707 - Draft Environmental Impact Statement on Brooks River Visitor Access for Katmai National Park and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... document evaluates the environmental impacts of four action alternatives that include bridge and boardwalk systems to replace the existing Brooks River floating bridge and sites to relocate the existing Naknek... implemented, this EIS would amend the access provisions of the 1996 Brooks River Area Final...

  11. 76 FR 70480 - Otay River Estuary Restoration Project, South San Diego Bay Unit of the San Diego Bay National...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... encourage the public and other agencies to participate in the NEPA scoping process by sending written...-year period (71 FR 64552, November 2, 2006). The wildlife and habitat management goal of the selected... River channel. Additional grading to deepen and potentially widen the Otay River channel from...

  12. Distribution of Hydrothermal Mineral Assemblages in the Sevenmile Hole Area, Grand Canyon of the Yellowstone River, Yellowstone National Park, Wyoming

    NASA Astrophysics Data System (ADS)

    Phillips, A.; Larson, P.; John, D.; Cosca, M.; Pauley, B.; Manion, J.; Pritchard, C.; Andersen, A.


    Incision of the Grand Canyon of the Yellowstone River in Yellowstone National Park has exposed approximately 350 vertical meters of hydrothermally altered rhyolites. This older alteration formed in the shallow portion of a hydrothermal system that was most likely similar to the modern Yellowstone hydrothermal environment. Hydrothermal fluid circulation is related to the ongoing rhyolitic magmatism that produced the Yellowstone caldera at 640 ka. The rhyolitic magmatism and hydrothermal system are shallow expressions of deeper mantle- derived basalts. The older alteration is well exposed in the Sevenmile Hole area, near the northeastern margin of the caldera. Here, the alteration protolith is the high silica, low-18O, rhyolitic Tuff of Sulfur Creek. The tuff erupted at about 480 ka after resurgent doming associated with the third cycle collapse of the Yellowstone caldera. The tuff is a rheomorphically deformed densely welded agglutinate fallout ash that was deposited along the caldera wall. It contains phenocrysts of quartz, sodic plagioclase, and potassium feldspar. The tuff is exposed from the rim of the canyon, which is very close to the pre-alteration paleosurface, to the river bottom where it is covered by detrital sediments and actively forming hot spring deposits. Rocks exposed within the field area are pervasively hydrothermally altered. Mineral phases in approximately 90 samples were determined in the field using a Portable Infrared Mineral Analyser (PIMA). Subsequently, more precise mineral determinations were made using standard petrographic and powder XRD techniques. The alteration mineralogy consists of variable assemblages that include zones of kaolinite + opal; kaolinite + alunite with local dickite and typically high opal and/or quartz concentrations; highly silicified zones containing illite with or without smectite; and weakly silicified zones containing mostly illite. Minor (less than 1 percent) fine-grained disseminated pyrite is ubiquitous. The

  13. Oxygen Isotopic Composition of Nitrate and Sulfate in Fog and River water in Podocarpus National Forest, Ecuador

    NASA Astrophysics Data System (ADS)

    Brothers, L. A.; Fabian, P.; Thiemens, M. H.


    The eastern slopes of the Andean rainforests of Ecuador possess some of the highest plant biodiversity found on the planet; however, these ecosystems are in jeopardy because region is experiences one of the highest deforestation rates in South America. This rainforest characterized by high acidity and low nutrient soils and experiences natural process which are both destabilizing and stabilizing to biodiversity rendering this a unique, though sensitive environment. There is increased concern that anthropogenic activities are affecting rainforests and could lead to higher extinction rates, changes in the biodiversity and far reaching effects on the global troposphere. Measurements of nitrate and sulfate in rain and fog water have shown periods of elevated concentrations in the Podocarpus National Park near Loja, Ecuador. These high episodes contribute to annual deposition rates that are comparable to polluted central Europe. Significant anthropogenic sources near this region are lacking and it is believed that the majority of the nitrate and sulfate pollution can be attributed to biomass burning in the Amazon basin. Concentration measurements do not elucidate the source of high nitrate and sulfate pollution; however, by measuring all three stable isotopes of oxygen in nitrate and sulfate from fog and river water provides a new way to examine the impacts of biomass burning on the region. By using stable isotope techniques atmospheric nitrate and sulfate can be resolved from terrestrial sources. This provides an unique way to trace the contributions from the biomass burning and farming sources. Current research at the field station monitors sulfate and nitrate concentrations in rain and fog water by standard methods to investigate water and nutrient pathways along with data from satellite and ground based remote sensing, in-situ observations and numerical models.

  14. Statistical Stationarity of Sediment Interbed Thicknesses in a Basalt Aquifer, Idaho National Laboratory, Eastern Snake River Plain, Idaho

    USGS Publications Warehouse

    Stroup, Caleb N.; Welhan, John A.; Davis, Linda C.


    The statistical stationarity of distributions of sedimentary interbed thicknesses within the southwestern part of the Idaho National Laboratory (INL) was evaluated within the stratigraphic framework of Quaternary sediments and basalts at the INL site, eastern Snake River Plain, Idaho. The thicknesses of 122 sedimentary interbeds observed in 11 coreholes were documented from lithologic logs and independently inferred from natural-gamma logs. Lithologic information was grouped into composite time-stratigraphic units based on correlations with existing composite-unit stratigraphy near these holes. The assignment of lithologic units to an existing chronostratigraphy on the basis of nearby composite stratigraphic units may introduce error where correlations with nearby holes are ambiguous or the distance between holes is great, but we consider this the best technique for grouping stratigraphic information in this geologic environment at this time. Nonparametric tests of similarity were used to evaluate temporal and spatial stationarity in the distributions of sediment thickness. The following statistical tests were applied to the data: (1) the Kolmogorov-Smirnov (K-S) two-sample test to compare distribution shape, (2) the Mann-Whitney (M-W) test for similarity of two medians, (3) the Kruskal-Wallis (K-W) test for similarity of multiple medians, and (4) Levene's (L) test for the similarity of two variances. Results of these analyses corroborate previous work that concluded the thickness distributions of Quaternary sedimentary interbeds are locally stationary in space and time. The data set used in this study was relatively small, so the results presented should be considered preliminary, pending incorporation of data from more coreholes. Statistical tests also demonstrated that natural-gamma logs consistently fail to detect interbeds less than about 2-3 ft thick, although these interbeds are observable in lithologic logs. This should be taken into consideration when

  15. Inventory of site-derived {sup 36}Cl in the Snake River plain aquifier, Idaho National Engineering Laboratory, Idaho

    SciTech Connect

    Beasley, T.M.


    Radioactive waste management practices at the U.S. Department of Energy`s Idaho National Engineering Laboratory (INEL) in Idaho have introduced {sup 36}Cl (T{sub 1/2} = 301,000 yr) into the Snake River Plain aquifer underlying the site. The {sup 36}Cl is believed to originate from neutron activation of stable {sup 35}Cl in nuclear fuels (principally) and in reactor cooling/process water. Wastewater releases of {sup 3}H at the INEL have been documented by the site operators for the period 1952 to 1988. During this time, approximately 1.2 PBq of {sup 3}H (30,000 Ci) were introduced to the subsurface through disposal wells and seepage ponds. By sampling a number of monitoring and production wells downgradient from points of introduction, {sup 3}H movement and dispersion in the groundwater have been documented by the U.S. Geological Survey. The present report uses these historical {sup 3}H release and monitoring data to choose hydrologic parameters (matrix porosity and plume penetration depth) that produce concordance between the {sup 3}H release estimates and the inventory calculated from measurements of {sup 3}H in the subsurface. These parameters are then applied to {sup 36}Cl isopleths to generate an estimated {sup 36}Cl inventory in the subsurface. Using assumptions about irradiation times, neutron fluxes, and total fuel processed, as little as 23 g of stable chloride impurity in fuel elements would be adequate to produce the amount of {sup 36}Cl estimated to be in the groundwaters underlying the site. The highest atom concentration of {sup 36}Cl measured onsite (222x10{sup 10} atoms 1{sup -1}) corresponds to an activity level of {approximately}4 pCi 1{sup -1} and represents 0.2 percent of the U.S. Environmental Protection Agency`s (EPA) drinking water standard for this radionuclide (2000 pCi 1{sup -1}).

  16. Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.


    Pollock, H G; Kimmel, J R; Hamilton, J W; Rouse, J B; Ebner, K E; Lance, V; Rawitch, A B


    Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV. PMID:3311873

  17. Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.


    Pollock, H G; Kimmel, J R; Hamilton, J W; Rouse, J B; Ebner, K E; Lance, V; Rawitch, A B


    Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV.

  18. Guidelines for choosing molecular "alligator clip" binding motifs in electron transport devices

    NASA Astrophysics Data System (ADS)

    Reuter, Matthew G.; Seideman, Tamar; Ratner, Mark A.


    We employ a one-electron, tight-binding model of an electrode-molecule-electrode junction to explore the fundamental relationship between adsorption geometry and electron transport, producing exact results (within this model). By varying the chemisorption location (e.g., atop a surface atom or in a hollow site between surface atoms) and the molecule-electrode coupling, we find that the largest currents are realized when the molecule (i) is highly coordinated by the surface and (ii) has favorable overlap with electrode states near the Fermi level. We also show the importance of electrode-induced molecular level shifting for certain adsorption geometries, which can cause molecular levels far from the Fermi level to conduct better than those near the Fermi level. Since all of these factors are greatly influenced by the chemical moiety used to link the molecule to an electrode, these results present a set of guidelines to help choose "alligator clips" for molecular electronic devices.

  19. Evolution of corticosteroid specificity for human, chicken, alligator and frog glucocorticoid receptors.


    Katsu, Yoshinao; Kohno, Satomi; Oka, Kaori; Baker, Michael E


    We investigated the evolution of the response of human, chicken, alligator and frog glucocorticoid receptors (GRs) to dexamethasone, cortisol, cortisone, corticosterone, 11-deoxycorticosterone, 11-deoxycortisol and aldosterone. We find significant differences among these vertebrates in the transcriptional activation of their full length GRs by these steroids, indicating that there were changes in the specificity of the GR for steroids during the evolution of terrestrial vertebrates. To begin to study the role of interactions between different domains on the GR in steroid sensitivity and specificity for terrestrial GRs, we investigated transcriptional activation of truncated GRs containing their hinge domain and ligand binding domain (LBD) fused to a GAL4 DNA binding domain (GAL4-DBD). Compared to corresponding full length GRs, transcriptional activation of GAL4-DBD_GR-hinge/LBD constructs required higher steroid concentrations and displayed altered steroid specificity, indicating that interactions between the hinge/LBD and other domains are important in glucocorticoid activation of these terrestrial GRs. PMID:27317937

  20. ALLIGATOR - An apparatus for ion beam assisted deposition with a broad-beam ion source

    NASA Astrophysics Data System (ADS)

    Wituschek, H.; Barth, M.; Ensinger, W.; Frech, G.; Rück, D. M.; Leible, K. D.; Wolf, G. K.


    Ion beam assisted deposition is a versatile technique for preparing thin films and coatings for various applications. Up to now a prototype setup for research purposes has been used in our laboratory. Processing of industrial standard workpieces requires a high current ion source with broad beam and high uniformity for homogeneous bombardment. In this contribution a new apparatus for large area samples will be described. It is named ALLIGATOR (German acronym of facility for ion assisted evaporation on transverse movable or rotary targets). In order to have a wide energy range available two ion sources are used. One delivers a beam energy up to 1.3 keV. The other is suitable for energies from 5 keV up to 40 keV. The ``high-energy'' ion source is a multicusp multiaperture source with 180-mA total current and a beam diameter of 280 mm at the target position.