Sample records for alligator weeds alternanthera

  1. The evolutionary history of an invasive species: alligator weed, Alternanthera philoxeroides

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The eco-evolutionary mechanisms of biological invasions are still not thoroughly understood. Alligator weed, Alternanthera philoxeroides (Martius) Gisebach (Amaranthaceae), is a plant native to South America and a weed in Australia and other countries. To better understand its success as an invader,...

  2. Cadmium and lead residues in field-collected red swamp crayfish (Procambarus clarkii) and uptake by alligator weed, Alternanthera philoxiroides

    SciTech Connect

    Naqvi, S.M.; Howell, R.D.; Sholas, M. . Dept. of Biological Sciences and Health Research Center)


    The whole-body residues of Cd and Pb in the tissues of Louisiana swamp crayfish (Procambarus clarkii) were determined by flame AAS technique. Test animals were collected from roadside ditches alongside major highways. The water and soil samples were also collected from the same sites. The mean Cd and Pb concentrations in crayfish tissues were 0.46 and 0.07, respectively. The levels of Cd and Pb in the water were 0.09 and 0.04; and in soil were 2.85 and 0.87 mg/1, respectively. The concentration of cadmium was 32 and Pb 12 times more than in the water. The bioaccumulation factors (BF) for Cd and Pb in crayfish tissues were 5.1 and 1.7, respectively. Alligator weed (Alternanthera philoxiroides) plants were exposed to 0.5 mg/1 Cd-chloride or Pb-nitrate solutions for 3 wk period, thrice. The mean Pb accumulation in roots was 1.31 mg/1, followed by stem (0.078 mg/1), but Cd only accumulated in root (0.83 mg/1). The BF for Pb and Cd in plant tissues were 14.8 and 16.6, respectively. The uptake of metals was time-dependent. These data suggest that although there is no biomagnification of Cd and Pb from alligator weed to crayfish, both metals readily accumulate in field-collected crayfish and laboratory-exposed alligator weed.

  3. Cytogenetic effect of Alternanthera philoxeroides (alligator weed) on Agasicles hygrophila (Coleoptera: Chrysomelidae) in its native range

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Plant polyploidy potentially affects plant-insect interactions; however, its effect on insect fitness remains largely unexplored. Alternanthera philoxeroides is a South American amphibious Amaranthaceae, which invades aquatic and terrestrial habitats. Different morphotypes and cytotypes were identif...

  4. Phenrica littoralis a potential candidate for the biological control of alligator weed, Alternanthera philoxeroides: redscription of the adult, first description of immature stages and biological notes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Flea beetles of aliligator weed, Alternanthera philoxeroides (Martius) Grisebach (Amaranthaceae), were collected in Argentina, Uruguay, Paraguay and Brazil. Species in the genera Disonycha Chevrolat, Agasicles Jacoby Systena Chevrolat and Phenrica Bechyne were frequently found on this weed. Phenric...

  5. Bio-gas production from alligator weeds

    NASA Technical Reports Server (NTRS)

    Latif, A.


    Laboratory experiments were conducted to study the effect of temperature, sample preparation, reducing agents, light intensity and pH of the media, on bio-gas and methane production from the microbial anaerobic decomposition of alligator weeds (Alternanthera philoxeroides. Efforts were also made for the isolation and characterization of the methanogenic bacteria.

  6. Alternathera philoxeroides (Martius) Grisebach - alligator weed

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biological control of Alternanthera philoxeroides, alligator weed, began when George Vogt, USDA, conducted several surveys by public transport in South America during the 1960s. Three agents were released in USA and two of them, the flea beetle Agasicles hygrophila and the moth Arcola malloi were re...

  7. Water Hyacinths and Alligator Weeds for Final Filtration of Sewage

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.; Gordon, J.


    The potential of water hyacinths (Eichhornia crassipes) (Mart.) Solms and alligator weeds (Alternanthera philoxerides) (Mart.) Griesb. as secondary and tertiary filtration systems for domestic sewage was demonstrated. These two vascular aquatic plants reduced the suspended solids, total Kjeldahl nitrogen, total phosphorus, BOD sub 5, and total organic carbon levels in domestic sewage from 60 percent to 98 percent within a two week period. These plants grown in domestic sewage were also free of toxic levels of trace heavy metals.

  8. Environmental risk assessment of compost prepared from salvinia, egeria densa, and alligator weed.


    Dorahy, C G; Pirie, A D; McMaster, I; Muirhead, L; Pengelly, P; Chan, K Y; Jackson, M; Barchia, I M


    Approximately 70,000 m(3) of salvinia (Salvinia molesta) was removed from the Hawkesbury-Nepean River, New South Wales (NSW), Australia, during 2004. This study assessed the risks associated with applying compost prepared from aquatic weeds (AWC) to land, namely, survival and spread of aquatic and terrestrial weeds, eutrophication of waterways, accumulation of heavy metals and phytotoxicity. The results demonstrate composting is an effective method of reducing the viability of aquatic and terrestrial weeds. However, mortality of alligator weed (Alternanthera philoxeroides), which was used as an indicator plant, was significantly (P < 0.001) correlated with the temperature within the windrows and the length of time the material was subjected to composting. Conditions within the central core of the windrow were sufficient to kill the alligator weed, although not all of the aquatic weed material was exposed to the windrows' central core. This resulted in alligator weed continuing to grow at the base of the windrow. To reduce the risk of weeds surviving and spreading in aquatic and terrestrial environments it is suggested compost windrows should be located on an appropriate hard pad to enable complete mixing of the material and ensure all material is exposed to temperatures >55 degrees C for greater than three consecutive days. The likelihood of other risks associated with the AWC was low. If composting is selected as the preferred method for managing organic material harvested from waterways, then ongoing monitoring and evaluation is required to validate the composting process and ensure consumer confidence in the final product.

  9. Water hyacinths and alligator weeds for removal of lead and mercury from polluted waters

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.


    Removal of lead and mercury by water hyacinths (Eichhornia crassipes) (Mart.) Solms and alligator weeds (Alternanthera philoxeroides) (Mart.) Griesb. was investigated. Water hyacinths demonstrated the ability to remove 0.176 mg of lead and 0.150 mg of mercury per gram of dry plant material from distilled water and river water in a 24-hour period. One acre of water hyacinths is potentially capable of removing 105.6 grams of lead and 90.0 grams of mercury per day. Alligator weeds removed 0.101 mg of lead per gram of dry plant material in a 24-hour period. This same plant also demonstrated the ability to remove a minimum of 0.153 mg of mercury per gram of dry plant material in a six hour period.

  10. Invertebrate community composition differs between invasive herb alligator weed and native sedges

    NASA Astrophysics Data System (ADS)

    Bassett, Imogen E.; Paynter, Quentin; Beggs, Jacqueline R.


    Chemical and/or architectural differences between native and exotic plants may influence invertebrate community composition. According to the enemy release hypothesis, invasive weeds should host fewer and less specialised invertebrates than native vegetation. Invertebrate communities were compared on invasive Alternanthera philoxeroides (alligator weed) and native sedges (Isolepis prolifer and Schoenoplectus tabernaemontani) in a New Zealand lake. A. philoxeroides is more architecturally and chemically similar to I. prolifer than to S. tabernaemontani. Lower invertebrate abundance, richness and proportionally fewer specialists were predicted on A. philoxeroides compared to native sedges, but with greatest differences between A. philoxeroides and S. tabernaemontani. A. philoxeroides is more architecturally and chemically similar to I. prolifer than to S. tabernaemontani. Invertebrate abundance showed taxa-specific responses, rather than consistently lower abundance on A. philoxeroides. Nevertheless, as predicted, invertebrate fauna of A. philoxeroides was more similar to that of I. prolifer than to S. tabernaemontani. The prediction of a depauperate native fauna on A. philoxeroides received support from some but not all taxa. All vegetation types hosted generalist-dominated invertebrate communities with simple guild structures. The enemy release hypothesis thus had minimal ability to predict patterns in this system. Results suggest the extent of architectural and chemical differences between native and invasive vegetation may be useful in predicting the extent to which they will host different invertebrate communities. However, invertebrate ecology also affects whether invertebrate taxa respond positively or negatively to weed invasion. Thus, exotic vegetation may support distinct invertebrate communities despite similar overall invertebrate abundance to native vegetation.

  11. Phenrica littoralis (Bechyné, 1955) (Coleoptera: Chrysomelidae) a potential candidate for the biological control of alligator weed, Alternantheraphiloxeroides (Martius) Grisebach (Amaranthaceae): redescription of the adult, first description of immature stages, and biological notes.


    Cabrera, Nora; Sosa, Alejandro J; Julien, Mic


    Flea beetles of alligator weed, Alternanthera philoxeroides (Martius) Grisebach (Amaranthaceae), were collected in Argentina, Uruguay, Paraguay, and Brazil. Species in the genera Disonycha Chevrolat, Agasicles Jacoby, Systena Chevrolat and Phenrica Bechyné were frequently found on this weed. Phenrica littoralis (Bechyn6) was the most abundant within this genus. The male is described and the holotype female is redescribed adding new diagnostic characters of the mouthparts, hind wings, metendosternite, and male and female genitalia. Larva and pupa are described and illustrated for the first time providing data for future phylogenetic studies in the subtribe Disonychina.

  12. Water hyacinths and alligator weeds for removal of silver, cobalt, and strontium from polluted waters

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Mcdonald, R. C.


    Water hyacinths and alligator weeds demonstrated the ability to rapidly remove heavy metals from an aqueous system by root absorption and concentration. Water hyacinths demonstrated the ability to remove 0.439 mg of silver, 0.568 mg of cobalt, and 0.544 mg of strontium in an ionized form per gram of dry plant material in a 24-hour period. Alligator weeds removed a maximum of 0.439 mg of silver, 0.130 mg of cobalt, and 0.161 mg of strontium per gram of dry plant material per day.

  13. “Patterns of morphological variation of alligator weed (Alternanthera philoxeroides): from native to invasive regions”

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The damage caused by biological invasions has traditionally been thought to result from alien species taking advantage of ecological differences between the native and introduced regions. In contrast, evidence is increasing that invasive plants can undergo rapid adaptive evolution during the process...

  14. Biosorption of As(V) onto dried alligator weed root: role of metal (hydro) oxides.


    Chen, Jian; Tao, Weihua; Sun, Cheng


    The present work investigates the adsorption of As(V) onto the dried powder of alligator weed root as bio-sorbent, using acid pre-treated alligator weed root powder as the reference. The isotherm study suggested there is a favorable As(V) adsorption happened on the AWR surface. The batch adsorption experimental results indicated that the ionic strength has little impact on the adsorption, while the solution pH has a significant effect on the adsorption with apparent inhibition appearing in both extreme acidic and alkaline pH region. In addition, the properties of the biosorbent were characterized by various techniques including SEM-EDS, FT-IR, and ICP detection. The analysis results suggested that the metals including Mn, Fe, and Al enrich over the alligator weed root surface in the morphology of metal (hydro) oxide. Based on the nature of the biosorbent and As(V) besides the adsorption performance, the metal (hydro) oxides over biosorbent surface is suggested as the essential role to drive the adsorption. With the metal (hydro) oxides denuded in the pre-treatment, the biosorbent loses its adsorption capability for As(V) totally.

  15. Biosorption of As(V) onto dried alligator weed root: role of metal (hydro) oxides.


    Chen, Jian; Tao, Weihua; Sun, Cheng


    The present work investigates the adsorption of As(V) onto the dried powder of alligator weed root as bio-sorbent, using acid pre-treated alligator weed root powder as the reference. The isotherm study suggested there is a favorable As(V) adsorption happened on the AWR surface. The batch adsorption experimental results indicated that the ionic strength has little impact on the adsorption, while the solution pH has a significant effect on the adsorption with apparent inhibition appearing in both extreme acidic and alkaline pH region. In addition, the properties of the biosorbent were characterized by various techniques including SEM-EDS, FT-IR, and ICP detection. The analysis results suggested that the metals including Mn, Fe, and Al enrich over the alligator weed root surface in the morphology of metal (hydro) oxide. Based on the nature of the biosorbent and As(V) besides the adsorption performance, the metal (hydro) oxides over biosorbent surface is suggested as the essential role to drive the adsorption. With the metal (hydro) oxides denuded in the pre-treatment, the biosorbent loses its adsorption capability for As(V) totally. PMID:26458188

  16. Phenotypic plasticity of invasive Alternanthera philoxeroides in relation to different water availability, compared to its native congener

    NASA Astrophysics Data System (ADS)

    Geng, Yu-Peng; Pan, Xiao-Yun; Xu, Cheng-Yuan; Zhang, Wen-Ju; Li, Bo; Chen, Jia-Kuan


    Phenotypic plasticity and genetic differentiation are two possible mechanisms that plants use to cope with varying environments. Although alligator weed ( Alternanthera philoxeroides) possesses very low genetic diversity, this alien weed has successfully invaded diverse habitats with considerably varying water availability (from swamps to dry lands) in China. In contrast, its native congener ( Alternanthera sessilis) has a much narrower ecological breadth, and is usually found in moist habitats. To understand the mechanisms underlying the contrasting pattern, we performed a greenhouse experiment to compare the reaction norms of alligator weed with those of its native congener, in which water availability was manipulated. Our results revealed that the two congeners had similar direction of phenotypic plasticity. However, A. philoxeroides showed greater plasticity in amount than did A. sessilis in many traits examined during the switch from wet to drought treatment. Nearly all of the phenotypic variance in A. philoxeroides could be ascribed to plasticity, while A. sessilis had a much higher fraction of phenotypic variance that could be explained by genotypic variation. These interspecific differences in plastic responses to variable water availability partially explained the difference in spatial distribution of the two congeners.

  17. Salinity Effects on Photosynthesis and Growth in Alternanthera philoxeroides (Mart.) Griseb. 1

    PubMed Central

    Longstreth, David J.; Bolaños, Jorge A.; Smith, James E.


    Alternanthera philoxeroides, alligator weed, was grown at five different NaCl concentrations to determine the effect of salinity on factors related to the net rate of CO2 uptake (Pn). Over the range of 0 to 400 millimolar NaCl, Pn declined 51%. Stomatal conductance declined in parallel with Pn and as a result there was no reduction in intercellular CO2 concentration and therefore no reduction in the amount of CO2 available for photosynthesis. The CO2 compensation point did not change with salt stress. Increases in leaf thickness tended to compensate slightly for the negative effects of salinity on leaf cell metabolism, at least in relation to Pn. On a mesophyll cell area basis, soluble protein was relatively constant in leaves developed at 100 to 400 millimolar NaCl while total chlorophyll decreased at all salinities. Dry weight production and Pn were closely correlated in alligator weed grown at different salinities. Plants produced less leaf area per unit dry weight as salinity increased, which may aid in water conservation. PMID:16663731

  18. Salinity effects on photosynthesis and growth in Alternanthera philoxeroides (Mart. ) Griseb

    SciTech Connect

    Longstreth, D.J.; Bolanos, J.A.; Smith, J.E.


    Alternanthera philoxeroides, alligator weed, was grown at five different NaCl concentrations to determine the effect of salinity on factors related to the net rate of CO/sub 2/ uptake (P/sub n/). Over the range of 0 to 400 millimolar NaCl, P/sub n/ declined 51%. Stomatal conductance declined in parallel with P/sub n/ and as a result there was no reduction in intercellular CO/sub 2/ concentrations and therefore no reduction in the amount of CO/sub 2/ available for photosynthesis. The CO/sub 2/ compensation point did not change with salt stress. Increases in leaf thickness tended to compensate slightly for the negative effects of salinity on leaf cell metabolism, at least in relation to P/sub n/. On a mesophyll cell area basis, soluble protein was relatively constant in leaves developed at 100 to 400 millimolar NaCl while total chlorophyll decreased at all salinities. Dry weight production and P/sub n/ were closely correlated in alligator weed grown at different salinities. Plants produced less leaf area per unit dry weight as salinity increased, which may aid in water conservation. 26 references, 5 figures, 2 tables.

  19. Phenotypic variation and water selection potential in the stem structure of invasive alligator weed

    NASA Astrophysics Data System (ADS)

    Du, Leshan; Yang, Beifen; Guan, Wenbin; Li, Junmin


    The morphological and anatomical characteristics of stems have been found to be related to drought resistance in plants. Testing the phenotypic selection of water availability on stem anatomical traits would be useful for exploring the evolutionary potential of the stem in response to water availability. To test the phenotypic variation of the stem anatomical traits of an invasive plant in response to water availability, we collected a total of 320 individuals of Alternanthera philoxeroides from 16 populations from terrestrial and aquatic habitats in 8 plots in China and then analyzed the variation, differentiation, plasticity and selection potential of water availability on the stem anatomical traits. We found that except for the thickness of the cortex, all of the examined phenotypic parameters of the A. philoxeroides stem were significantly and positively correlated with soil water availability. The phenotypic differentiation coefficient for all of the anatomical structural parameters indicated that most of the variation existed between habitats within the same plot, whereas there was little variation among plots or among individuals within the same habitat except for variation in the thickness of the cortex. A significant phenotypic plasticity response to water availability was found for all of the anatomical traits of A. philoxeroides stem except for the thickness of the cortex. The associations between fitness and some of the anatomical traits, such as the stem diameter, the cortex area-to-stem area ratio, the pith cavity area-to-stem area ratio and the density of vascular bundles, differed with heterogeneous water availability. In both the aquatic and terrestrial habitats, no significant directional selection gradient was found for the stem diameter, the cortex area-to-stem area ratio or the density of vascular bundles. These results indicated that the anatomical structure of the A. philoxeroides stem may play an important role in the adaptation to changes

  20. Salinity effects on water potential components and bulk elastic modulus of Alternanthera philoxeroides (Mart. ) Griseb

    SciTech Connect

    Bolanos, J.A.; Longstreth, D.J.


    Pressure volume curves for Alternanthera philoxeroides (Mart.) Grixeb. (alligator weed) grown in 0 to 400 millimolar NaCl were used to determine water potential (PSI), osmotic potential (psi/sub s/), turgor potential (psi/sub p/) and the bulk elastic modulus (element of) of shoots at different tissue water contents. Values of psi decreased with increasing salinity and tissue PSI was always lower than rhizosphere PSI. The relationship between psi/sub p/ and tissue water content changed because element of increased with salinity. As a results, salt-stressed plants had larger ranges of positive turgor but smaller ranges of tissue water content over which psi/sub p/ was positive. To our knowledge, this is the first report of such a salinity effect on element of in higher plants. These increases in element of with salinity provided a mechanism by which a large difference between plant PSI and rhizosphere PSI, the driving force for water uptake, could be produced with relatively little water loss by the plant. A time-course study of response after salinization to 400 millimolar NaCl showed PSI was constant with 1 day, psi/sub s/ and psi/sub p/ continued to change for 2 to 4 days, and element of continued to change for 4 to 12 days. Changes in element of modified the capacity of alligator weed to maintain a positive water balance and consideration of such changes in other species of higher plants should improve our understanding of salt stress. 24 references, 6 figures.

  1. The influence of abiotic stress and phenotypic plasticity on the distribution of invasive Alternanthera philoxeroides along a riparian zone

    NASA Astrophysics Data System (ADS)

    Pan, Xiaoyun; Geng, Yupeng; Zhang, Wenju; Li, Bo; Chen, Jiakuan


    Relatively few studies have compared invasibility and species invasiveness among microhabitats within communities, synchronously. We surveyed the abundance and performance of non-native Alternanthera philoxeroides (Mart.) Griseb. (alligator weed), its co-occurring native congener, Alternanthera sessilis (L.) DC. (sessile joyweed), and other species in a wetland community along a riparian zone in southeast China to test the hypotheses that: i) degree of invasion differs between different types of microhabitats within the community; and ii) microhabitat types that differ in invasibility also differ in soil resource availability or in sediment characteristics likely to affect resource availability; iii) phenotypic plasticity of A. philoxeroides may play a key role in its adaptation to diverse habitats as can be concluded from its extremely low genetic diversity in China. The study riparian zone comprises different types of microhabitats including wet abandoned field, swamp, marsh dunes and gravel dunes. Consistent with these hypotheses, cover of A. philoxeroides was high in abandoned fields (73 ± 2.9%) and swamps (94 ± 1.3%), which had high soil nutrients and water availability. On the contrary, cover of native A. sessilis was relatively high in marsh dunes and grave dunes, which had coarse gravel surfaces, low soil nutrients and low water availability. A. philoxeroides showed greater morphological plasticity in response to habitat variation. In abiotically harsh habitats, stems had limited growth, and were prostrate with weak adventitious roots at nodes, forming thin, scattered patches. In the two richer habitats, the highly branched plants spread over the water or soil surface, supporting dense stronger leaf-bearing stems which grew vertically. The growth pattern of A. sessilis among microhabitats did not exhibit significant variations. These results suggest that morphological plasticity and microhabitat types with high soil resources may facilitate invasions of A

  2. A literature review for the exotic invasive Alternanthera philoxeroides (alligatorweed)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In this review, we present a detailed account of Alternanthera philoxeroides(alligatorweed), including A. philoxeroides description, intraspecific variation from native to introduced regions, its life history strategy, invasive mechanisms, and management strategy. Alternanthera philoxeroides is a he...

  3. Molecular phenotypes associated with anomalous stamen development in Alternanthera philoxeroides

    PubMed Central

    Zhu, Zhu; Zhou, Chengchuan; Yang, Ji


    Alternanthera philoxeroides is a perennial amphibious weed native to South America but has now spread to diverse parts of the world. A. philoxeroides reproduces both sexually and asexually in its native range, but propagates solely through vegetative means in its introduced range. Traits associated with sexual reproduction become degraded for sexual dysfunction, with flowers possessing either pistillate stamens or male-sterile anthers. Degradations of sexual characters for loss of sexuality commonly take place in clonal plants. The underlying molecular-genetic processes remain largely unknown. We compared the gene expression profiles of abnormal stamens with that of normal stamens by RNA-Seq analysis, and identified a large number of differentially expressed genes between abnormal and normal stamens. In accordance with flower morphology, the expression of B-class MADS-box genes (ApAP3, ApTM6, and ApPI) was markedly reduced in pistillate stamens. However, most of the genes involved in meiosis were expressed normally in stamens with male-sterile anthers. In addition to verifying the expression patterns of genes previously known to be related to stamen and pollen grain development, we also identified previously unknown molecular phenotypes associated with sexual dysfunction in A. philoxeroides, that is helpful for dissecting the molecular mechanisms underpinning various male-sterile phenotypes and the molecular processes underlying the transition from sexuality to asexuality in clonal plants. PMID:25926842

  4. Nonpineal melatonin in the alligator (Alligator mississippiensis).


    Roth, J J; Gern, W A; Roth, E C; Ralph, C L; Jacobson, E


    All living and most fossil representatives of the reptilian subclass Archosauria lack pineal bodies. Arrhythmic, low-level, nonpineal melatonin is present, however, in the blood of Alligator mississippiensis. Although pineal bodies have been implicated in circadian phenomena, these results suggest that arrhytmic melatonin in alligators may not be involved incircadian events and indicate that the pineal is not the only source of the hormone melatonin. The evolutionary loss of the pineal in Archosauria occurred during the Mesozoic, and era noted for its seasonal stability. Arrhythmic melatonin titers inalligators and pineal loss in alligators and other archosaurs may be related to Mesozoic seasonal stability.

  5. A big alligator snacks on a smaller alligator

    NASA Technical Reports Server (NTRS)


    A large alligator attacks and eats a smaller one in a natural display of cannibalism. Although this event has been observed infrequently by Kennedy Space Center's staff photographers, it is common feeding behavior among the wild alligator population on the space center. Alligators are carnivorous and will eat any living thing that crosses their paths and is small enough for them to kill. For this reason, it is dangerous to feed wild alligators, and in Florida, it is also illegal. Kennedy Space Center is located on the Merritt Island National Wildlife Refuge which is operated by the U.S. Fish and Wildlife Service.

  6. Fibrous trabeculae in the liver of alligator (alligator mississippiensis).


    Beresford, W A


    In the mature alligator, fibrous trabeculae run from the portal areas and capsule through the hepatic parenchyma. The extent of these trabeculae becomes clear only after staining for collagen with, for example, Fast green or Picrosirius red. The trabeculae are less well developed in young caiman. The alligator's liver might use the trabeculae to withstand thrashing of the body.

  7. The 'Angry Alligator'

    NASA Technical Reports Server (NTRS)


    The Augmented Target Docking Adapter (ATDA) as seen from the Gemini 9 spacecraft during one of their three rendezvous in space. The ATDA and Gemini 9 spacecraft are 66.5 ft. apart. Failure of the docking adapter protective cover to fully separate on the ATDA prevented the docking of the two spacecraft. The ATDA was described by the Gemini 9 crew as an 'angry alligator.'

  8. Agronomic Weeds.

    ERIC Educational Resources Information Center

    Hartwig, Nathan L.

    This agriculture extension service publication from Pennsylvania State University examines agronomic weed problems and control. Contents include a listing of the characteristics of weeds, a section on herbicides, and a section on the important weeds of agronomic crops in Pennsylvania. The herbicide section discusses systemic herbicides, contact…


    EPA Science Inventory

    Although folliculogenesis and oogenesis have been observed in numerous reptiles, these phenomena have not been described in detail in a crocodilian. Oogenesis and histological features of the adult ovary of Alligator mississippiensis are described. Using a complex process, the ov...

  10. Mercury in alligators (Alligator mississippiensis) in the southeastern United States

    USGS Publications Warehouse

    Jagoe, C.H.; Arnold-Hill, B.; Yanochko, G.M.; Winger, P.V.; Brisbin, I.L.


    Mercury methylation may be enhanced in wetlands and humic-rich, blackwater systems that crocodiles and alligators typically inhabit. Given their high trophic level and long life-spans, crocodilians could accumulate significant burdens of Hg. Our objectives were to survey Hg concentrations in alligators from several areas in the southeastern United States to test their utility as sentinels of Hg contamination, to examine relationships among Hg concentrations in various tissues and to look for any differences in tissue Hg concentrations among locations. We measured total Hg concentrations in alligators collected in the Florida Everglades (n = 18), the Okefenokee National Wildlife Refuge, Georgia (n = 9), the Savannah River Site (SRS), South Carolina (n = 49) and various locations in central Florida ( n = 21), sampling tissues including blood, brain, liver, kidney, muscle, bone, fat, spleen, claws and dermal scutes. Alligators from the Everglades were mostly juvenile, but Hg concentrations in tissues were high (means: liver 41.0, kidney 36.4, muscle 5.6 mg Hg/kg dry wt.). Concentrations in alligators from other locations in Florida were lower (means: liver 14.6, kidney 12.6, muscle 1.8 mg Hg/kg dry wt.), although they tended to be larger adults. Alligators from the Okefenokee were smallest and had the lowest Hg concentrations (means: liver 4.3, kidney 4.8, muscle 0.8 mg Hg/kg dry wt.). At some locations, alligator length was correlated with Hg concentrations in some internal organs. However, at three of the four locations, muscle Hg was not related to length. Tissue Hg concentrations were correlated at most locations; however, claw or dermal scute Hg explained less than 74% of the variation of Hg in muscle or organs, suggesting readily-obtained tissues, such as scutes or claws, have limited value for nondestructive screening of Hg in alligator populations.

  11. Essential fatty acid nutrition of the American alligator (Alligator mississippiensis).


    Staton, M A; Edwards, H M; Brisbin, I L; Joanen, T; McNease, L


    The essential fatty acid (EFA) nutrition of young American alligators (Alligator mississippiensis) was examined by feeding a variety of fats/oils with potential EFA activity. Over a 12-wk period, alligators fed diets containing 2.5 or 5.0% chicken liver oil grew longer and heavier and converted feed to body mass more efficiently than alligators fed other fat/oil combinations that lacked or contained only trace amounts of arachidonic acid [20:4(n-6)]. Alligators fed an EFA-deficient diet (containing only coconut fat as the dietary fat) were the slowest-growing animals and converted feed to body mass least efficiently. However, over a 41-wk feeding period, alligators fed this diet showed no obvious external signs of deficiency other than being reduced in size and unthrifty. Fatty acid composition of heart, liver, muscle, skin and adipose tissue lipids was influenced markedly by dietary fat composition. Tissues varied significantly in response to dietary fat composition. Heart lipids contained the lowest levels of short- and medium-chain fatty acids and the highest levels of arachidonic acid. Arachidonic acid levels were less influenced by diet than were levels of other 20- and 22-carbon polyunsaturated fatty acids. Radiotracer studies indicated that linoleic acid was converted to arachidonic acid in the liver. Nevertheless, tissue arachidonic acid levels also appeared to be maintained by concentration from dietary sources and selective conservation. It appears that a dietary source of arachidonic acid may be required for a maximum rate of growth.

  12. Mortality of American alligators attributed to cannibalism

    USGS Publications Warehouse

    Delany, Michael F.; Woodward, Allan R.; Kiltie, Richard A.; Moore, Clinton T.


    Mortality of juvenile (Alligator mississippiensis) attributed to cannibalism on Orange Lake, Florida was examined. Alligator web tags used in mark–recapture studies were found in 12% of 267 stomachs sampled from alligators ≥168 cm TL. Captive alligators retained 76% of force-fed tags during a 588-d tag-retention trial. Models relating the probability of tag recovery to the annual probabilities of juvenile survival, cannibalism, tag retention, adult survival, and adult harvest suggested that cannibalism may on average remove 6–7% of the juvenile alligator population annually. Vulnerability continued to 140 cm TL (age 6–8 yr). Cannibalism of juveniles may serve to regulate the alligator population on Orange Lake. Alligator cannibalism may vary widely among populations, depending on demography and environmental conditions. The role and importance of cannibalism in alligator population dynamics should be more fully assessed and environmental and population factors that influence cannibalism identified to better evaluate management programs.

  13. Glutamine synthetase in liver of the American alligator, Alligator mississippiensis.


    Smith, D D; Campbell, J W


    Glutamine synthetase was shown to be localized in liver mitochondria of the American alligator, Alligator mississippiensis, by immunofluorescent staining of frozen liver sections and by the detection of enzymatic activity and immunoreactive protein in the mitochondrial fraction following subcellular fractionation of liver tissue by differential centrifugation. The primary translation product of alligator liver glutamine synthetase mRNA was shown to have an Mr = 45,000 which is similar if not identical in size to that of the mature subunit. This mRNA was found to be heterogeneous in size with a major form corresponding to 2.8-3.0 kb and a lesser form corresponding to around 2 kb. Both are in excess of the size required to code for the glutamine synthetase subunit. The synthesis and presumably the mitochondrial import of glutamine synthetase in alligator liver are thus very similar to the same processes in avian liver. Despite the excretion of a high percentage of nitrogen as ammonia, the demonstration of a mitochondrial glutamine synthetase indicates the alligator has the typical avian-type uricotelic ammonia-detoxification system in liver. This suggests that the transition to uricotelism occurred in the sauropsid line of evolution and has persisted through both the lepidosaurian (snakes, lizards) and archosaurian (dinosaurs, crocodilians, birds) lines.

  14. Growth rates of Chinese and American alligators.


    Herbert, J D; Coulson, T D; Coulson, R A


    Growth rates in two closely related species, Alligator mississippiensis (American alligator) and Alligator sinensis (Chinese alligator), were compared under identical conditions for at least 1 year after hatching. When hatched, Chinese alligators were approximately 2/3 the length and approximately 1/2 the weight of American alligator hatchlings. At the end of 1 year of growth in captivity in heated chambers, the Chinese alligators were approximately 1/2 as long and weighed approximately 1/10 as much as American alligator yearlings. When the animals were maintained at 31 degrees C, Chinese alligator food consumption and length gain rates dropped to near zero during autumn and winter and body weights decreased slightly, apparently in response to the change in day length. At constant temperature (31 degrees C), food consumption by American alligators remained high throughout the year. Length gain rates in American alligators decreased slowly as size increased, but were not affected by photoperiod. Daily weight gains in American alligators increased steadily throughout the year. In autumn, provision of artificial light for 18 h a day initially stimulated both length and weight gain in Chinese alligators, but did not affect growth in American alligators. Continuation of the artificial light regimen seemed to cause deleterious effects in the Chinese alligators after several months, however, so that animals exposed to the normal light cycle caught up to and then surpassed the extra-light group in size. Even after removal of the artificial light, it was several months before these extra-light animals reverted to a normal growth pattern. These findings may be of interest to those institutions engaged in captive growth programs intended to provide animals for reintroduction to the wild or to protected habitat. PMID:11897202

  15. Alligator diet in relation to alligator mortality on Lake Griffin, FL

    USGS Publications Warehouse

    Rice, A.N.; Ross, J.P.; Woodward, A.R.; Carbonneau, D.A.; Percival, H.F.


    Alligator mississippiensis (American Alligators) demonstrated low hatch-rate success and increased adult mortality on Lake Griffin, FL, between 1998 and 2003. Dying Lake Griffin alligators with symptoms of poor motor coordination were reported to show specific neurological impairment and brain lesions. Similar lesions were documented in salmonines that consumed clupeids with high thiaminase levels. Therefore, we investigated the diet of Lake Griffin alligators and compared it with alligator diets from two lakes that exhibited relatively low levels of unexplained alligator mortality to see if consumption of Dorosoma cepedianum (gizzard shad) could be correlated with patterns of mortality. Shad in both lakes Griffin and Apopka had high levels of thiaminase and Lake Apopka alligators were consuming greater amounts of shad relative to Lake Griffin without showing mortality rates similar to Lake Griffin alligators. Therefore, a relationship between shad consumption alone and alligator mortality is not supported.

  16. Gene Expression Reaction Norms Unravel the Molecular and Cellular Processes Underpinning the Plastic Phenotypes of Alternanthera Philoxeroides in Contrasting Hydrological Conditions

    PubMed Central

    Gao, Lexuan; Geng, Yupeng; Yang, Hongxing; Hu, Yonghong; Yang, Ji


    Alternanthera philoxeroides is an amphibious invasive weed that can colonize both aquatic and terrestrial habitats. Individuals growing in different habitats exhibit extensive phenotypic variation but little genetic differentiation. Little is known about the molecular basis underlying environment-induced phenotypic changes. Variation in transcript abundance in A. philoxeroides was characterized throughout the time-courses of pond and upland treatments using RNA-Sequencing. Seven thousand eight hundred and five genes demonstrated variable expression in response to different treatments, forming 11 transcriptionally coordinated gene groups. Functional enrichment analysis of plastically expressed genes revealed pathway changes in hormone-mediated signaling, osmotic adjustment, cell wall remodeling, and programmed cell death, providing a mechanistic understanding of the biological processes underlying the phenotypic changes in A. philoxeroides. Both transcriptional modulation of environmentally sensitive loci and environmentally dependent control of regulatory loci influenced the plastic responses to the environment. Phenotypic responses and gene expression patterns to contrasting hydrological conditions were compared between A. philoxeroides and its alien congener Alternanthera pungens. The terricolous A. pungens displayed limited phenotypic plasticity to different treatments. It was postulated based on gene expression comparison that the interspecific variation in plasticity between A. philoxeroides and A. pungens was not due to environmentally-mediated changes in hormone levels but to variations in the type and relative abundance of different signal transducers and receptors expressed in the target tissue. PMID:26617628

  17. Flowers & Weeds.

    ERIC Educational Resources Information Center

    Flannery, Maura C.


    Describes the topics and teaching strategies employed in an Issues in Biology course. Discusses flowers, plant breeding, potatoes and tomatoes, the chocolate tree, weeds, Arabidopis, gene transfers, and plant genes/human genes. Contains 22 references. (JRH)

  18. Weed Management

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Adaptive management can complement integrated programs to manage weeds in forage production systems. This approach requires establishing management goals, developing and implementing management programs based on the goals, monitoring and assessing impacts of management efforts, and modifying goals a...


    EPA Science Inventory

    Top predators, like the American alligator (Alligator mississippiensis) bioaccumulate and biomagnify persistent pollutants, such as organochlorine pesticides. In a recently published study, several pesticides and pesticide metabolites not previously reported in alligator eggs wer...

  20. Morphology and histochemistry of juvenile American alligator (Alligator mississippiensis) nephrons.


    Moore, Brandon C; Hyndman, Kelly A; Cox, Ashley; Lawler, Ashley; Mathavan, Ketan; Guillette, Louis J


    Here we present a detailed morphological description of the alligator (Alligator mississippiensis) kidney and nephron. We present a series of histological, histochemical, and immunohistochemical markers that clearly define the seven regions of the alligator nephron. The alligator kidney is composed of many paired (mirrored) lobules on each kidney (lobe). Single nephrons span the width of lobules three times. The fine structure of glomeruli, lying in rows spanning the height of the lobule, is resolved by periodic acid methionine silver (PAMS) and periodic acid Schiff's (PAS) histochemistry. Glomeruli are connected to the proximal tubule (PT) via a neck segment. The PT is alcian blue-negative, making it distinct from the distal tubule (DT), connecting segment (CS), and collecting duct (CD). The PT is clearly identifiable by a PAS-positive brush border membrane. The PT is connected to the DT via an intermediate segment (IS) that makes a 180 degrees turn to connect these tubules. PAMS-positive material is found in the lumens of the PT, IS, and DT. Also, PAMS-positive granules are found in the DT, CS, and CD. Immunolocalization of the Na(+), K(+)-ATPase to the basolateral membrane of the DT, CS, and CD suggests a role of this enzyme in driving primary and secondary transport processes in these segments, including bicarbonate transport into the lumen of the DT (leading to an alkaline urine). Through the techniques described here, we have identified a series of distinct markers to be used by pathologists, veterinarians, and researchers to easily identify alligator nephron segments. Anat Rec, 2009. (c) 2009 Wiley-Liss, Inc.

  1. Alligators in the Sewers? Really?

    ERIC Educational Resources Information Center

    Egbert, Joy


    A large number of alligators, flushed down toilets as babies, have grown up and proliferated in the bowels of New York City. Over the years, they have grown in number and size and frequently terrorize those foolish enough to visit the subways. This tale has been making its way around the Internet ever since there's been an Internet. It's wild…

  2. Gender differences in haemogregarine infections in American alligators (Alligator mississippiensis) at Savannah River, South Carolina, USA.


    Davis, Andrew K; Horan, Robert V; Grosse, Andrew M; Harris, Bess B; Metts, Brian S; Scott, David E; Tuberville, Tracey D


    We report a host gender bias in haemogregarine infection characteristics in the American alligator (Alligator mississippiensis) at the Savannah River Site, South Carolina, USA. Prevalence and severity in female alligators was higher than it was in males. The reason for this pattern is not clear.

  3. Occurrence of decabromodiphenyl ethane in captive Chinese alligators (Alligator sinensis) from China.


    Hong, Bing; Wu, Ting; Zhao, Guangchao; Sun, Yuxin; Wang, Xinming; Zhao, Juan; Yi, Zhigang; Wu, Xiaobing; Mai, Bixian


    Decabromodiphenyl ethane (DBDPE), a replacement for decabromodiphenyl ether (deca-BDE), was investigated in captive Chinese alligators from China. DBDPE was detected in adult tissues, neonates and eggs of Chinese alligators with concentrations ranging from 4.74-192, 0.24-1.94, and 0.01-0.51 ng g(-1) lipid weight, respectively. Compared to PBDEs and PCBs, DBDPE contamination was limited in Chinese alligators. Additionally, DBDPE concentrations in adult muscles were one to three orders of magnitude higher than those in neonates and eggs, suggesting the limited maternal transfer potential of DBDPE in Chinese alligators. This is the first study to report the occurrence of DBDPE in Chinese alligators.

  4. Distribution of ventilation in American alligator Alligator mississippiensis

    SciTech Connect

    Bickler, P.E.; Spragg, R.G.; Hartman, M.T.; White, F.N.


    The regional distribution of ventilation in the multicameral lung of spontaneously ventilating alligators (Alligator mississippiensis) was studied with TTXe scintigraphy. Frequent gamma camera images of TTXe washin and washout were obtained and processed to allow evaluation of regional ventilation. Washin of TTXe to equilibrium occurred in three to four breaths in anterior, central, and posterior compartments. Washin was most rapid in the posterior compartment and slowest in the anterior. The structure of the lungs and distribution of ventilation of inspired gas is consistent with the rapid radial spread of gas through a parallel arrangement of lung units surrounding the central intrapulmonary bronchus. Washout to equilibrium of TTXe from all compartments occurred within three to four breaths. This rapid washin and washout of gas to all parts of the lung stands in contrast to the lungs of turtles and snakes, in which the caudal air sacs are relatively poorly ventilated.

  5. Bioprospecting the American Alligator (Alligator mississippiensis) Host Defense Peptidome

    PubMed Central

    Bishop, Barney M.; Juba, Melanie L.; Devine, Megan C.; Barksdale, Stephanie M.; Rodriguez, Carlos Alberto; Chung, Myung C.; Russo, Paul S.; Vliet, Kent A.; Schnur, Joel M.; van Hoek, Monique L.


    Cationic antimicrobial peptides and their therapeutic potential have garnered growing interest because of the proliferation of bacterial resistance. However, the discovery of new antimicrobial peptides from animals has proven challenging due to the limitations associated with conventional biochemical purification and difficulties in predicting active peptides from genomic sequences, if known. As an example, no antimicrobial peptides have been identified from the American alligator, Alligator mississippiensis, although their serum is antimicrobial. We have developed a novel approach for the discovery of new antimicrobial peptides from these animals, one that capitalizes on their fundamental and conserved physico-chemical properties. This sample-agnostic process employs custom-made functionalized hydrogel microparticles to harvest cationic peptides from biological samples, followed by de novo sequencing of captured peptides, eliminating the need to isolate individual peptides. After evaluation of the peptide sequences using a combination of rational and web-based bioinformatic analyses, forty-five potential antimicrobial peptides were identified, and eight of these peptides were selected to be chemically synthesized and evaluated. The successful identification of multiple novel peptides, exhibiting antibacterial properties, from Alligator mississippiensis plasma demonstrates the potential of this innovative discovery process in identifying potential new host defense peptides. PMID:25671663

  6. Biophysics of directional hearing in the American alligator (Alligator mississippiensis)

    PubMed Central

    Bierman, Hilary S.; Thornton, Jennifer L.; Jones, Heath G.; Koka, Kanthaiah; Young, Bruce A.; Brandt, Christian; Christensen-Dalsgaard, Jakob; Carr, Catherine E.; Tollin, Daniel J.


    Physiological and anatomical studies have suggested that alligators have unique adaptations for spatial hearing. Sound localization cues are primarily generated by the filtering of sound waves by the head. Different vertebrate lineages have evolved external and/or internal anatomical adaptations to enhance these cues, such as pinnae and interaural canals. It has been hypothesized that in alligators, directionality may be enhanced via the acoustic coupling of middle ear cavities, resulting in a pressure difference receiver (PDR) mechanism. The experiments reported here support a role for a PDR mechanism in alligator sound localization by demonstrating that (1) acoustic space cues generated by the external morphology of the animal are not sufficient to generate location cues that match physiological sensitivity, (2) continuous pathways between the middle ears are present to provide an anatomical basis for coupling, (3) the auditory brainstem response shows some directionality, and (4) eardrum movement is directionally sensitive. Together, these data support the role of a PDR mechanism in crocodilians and further suggest this mechanism is a shared archosaur trait, most likely found also in the extinct dinosaurs. PMID:24671963

  7. Winter Weeds.

    ERIC Educational Resources Information Center

    Lindberg, Lois


    Try to learn all you can about a plant in the winter. As the season changes, you can see what the dried seed pod is like in bloom. You are a convert if you notice a spectacular show of summer wildflowers and wonder what sort of winter weed will result. (Author/CM)

  8. Green Weeding

    ERIC Educational Resources Information Center

    Penniman, Sarah; McColl, Lisa


    Gone are the days of tiptoeing to the dumpsters with boxes of weeded books in tow. Lots of libraries are now taking advantage of the many low-cost services and solutions that promise to help extend the lives of collection discards. Some of these options can be very profitable. Some create goodwill within the local community. Some may seem more…

  9. Jumping the Alligators in the Ditch.

    ERIC Educational Resources Information Center

    Barber, Rims

    Poor black young people in rural Mississippi contemplate their schooling with the same feelings as their friends who dare to jump the local ditches filled with alligators: the odds are against escaping the alligators, and the advantages of getting to the far side are not very apparent. Living in conditions of extreme poverty, these young people…

  10. Methyltestosterone alters sex determination in the American alligator (Alligator mississippiensis).


    Murray, Christopher M; Easter, Michael; Merchant, Mark; Rheubert, Justin L; Wilson, Kelly A; Cooper, Amos; Mendonça, Mary; Wibbels, Thane; Marin, Mahmood Sasa; Guyer, Craig


    Effects of xenobiotics can be organizational, permanently affecting anatomy during embryonic development, and/or activational, influencing transitory actions during adulthood. The organizational influence of endocrine-disrupting contaminants (EDC's) produces a wide variety of reproductive abnormalities among vertebrates that exhibit temperature-dependent sex determination (TSD). Typically, such influences result in subsequent activational malfunction, some of which are beneficial in aquaculture. For example, 17-αmethyltestosterone (MT), a synthetic androgen, is utilized in tilapia farming to bias sex ratio towards males because they are more profitable. A heavily male-biased hatchling sex ratio is reported from a crocodile population near one such tilapia operation in Guanacaste, Costa Rica. In this study we test the effects of MT on sexual differentiation in American alligators, which we used as a surrogate for all crocodilians. Experimentally, alligators were exposed to MT in ovo at standard ecotoxicological concentrations. Sexual differentiation was determined by examination of primary and secondary sex organs post hatching. We find that MT is capable of producing male embryos at temperatures known to produce females and demonstrate a dose-dependent gradient of masculinization. Embryonic exposure to MT results in hermaphroditic primary sex organs, delayed renal development and masculinization of the clitero-penis (CTP). PMID:27401264

  11. Coronary blood flow in the anesthetized American alligator (Alligator mississippiensis).


    Jensen, Bjarke; Elfwing, Magnus; Elsey, Ruth M; Wang, Tobias; Crossley, Dane A


    Coronary circulation of the heart evolved early within ectothermic vertebrates and became of vital importance to cardiac performance in some teleost fish, mammals and birds. In contrast, the role and function of the coronary circulation in ectothermic reptiles remains largely unknown. Here, we investigated the systemic and coronary arterial responses of five anesthetized juvenile American alligators (Alligator mississippiensis) to hypoxia, acetylcholine, adenosine, sodium nitroprusside, isoproterenol, and phenylephrine. We recorded electrocardiograms, monitored systemic blood pressure, blood flows in both aortae, and blood flow in a major coronary artery supplying most of the right ventricle. Coronary arterial blood flow was generally forward, but there was a brief retrograde flow during a ventricular contraction. Blood pressure was significantly changed in all conditions. Acetylcholine decreased coronary forward flow, but this response was confounded by the concomitant lowered work of the ventricles due to decreased heart rate and blood pressure. Coronary forward flow was poorly correlated with heart rate and mean arterial pressure across treatments. Overall changes in coronary forward flow, significant and not significant, were generally in the same direction as mean arterial pressure and ventricular power, approximated as the product of systemic cardiac output and mean arterial pressure. PMID:26436857

  12. Coronary blood flow in the anesthetized American alligator (Alligator mississippiensis).


    Jensen, Bjarke; Elfwing, Magnus; Elsey, Ruth M; Wang, Tobias; Crossley, Dane A


    Coronary circulation of the heart evolved early within ectothermic vertebrates and became of vital importance to cardiac performance in some teleost fish, mammals and birds. In contrast, the role and function of the coronary circulation in ectothermic reptiles remains largely unknown. Here, we investigated the systemic and coronary arterial responses of five anesthetized juvenile American alligators (Alligator mississippiensis) to hypoxia, acetylcholine, adenosine, sodium nitroprusside, isoproterenol, and phenylephrine. We recorded electrocardiograms, monitored systemic blood pressure, blood flows in both aortae, and blood flow in a major coronary artery supplying most of the right ventricle. Coronary arterial blood flow was generally forward, but there was a brief retrograde flow during a ventricular contraction. Blood pressure was significantly changed in all conditions. Acetylcholine decreased coronary forward flow, but this response was confounded by the concomitant lowered work of the ventricles due to decreased heart rate and blood pressure. Coronary forward flow was poorly correlated with heart rate and mean arterial pressure across treatments. Overall changes in coronary forward flow, significant and not significant, were generally in the same direction as mean arterial pressure and ventricular power, approximated as the product of systemic cardiac output and mean arterial pressure.

  13. Methyltestosterone alters sex determination in the American alligator (Alligator mississippiensis).


    Murray, Christopher M; Easter, Michael; Merchant, Mark; Rheubert, Justin L; Wilson, Kelly A; Cooper, Amos; Mendonça, Mary; Wibbels, Thane; Marin, Mahmood Sasa; Guyer, Craig


    Effects of xenobiotics can be organizational, permanently affecting anatomy during embryonic development, and/or activational, influencing transitory actions during adulthood. The organizational influence of endocrine-disrupting contaminants (EDC's) produces a wide variety of reproductive abnormalities among vertebrates that exhibit temperature-dependent sex determination (TSD). Typically, such influences result in subsequent activational malfunction, some of which are beneficial in aquaculture. For example, 17-αmethyltestosterone (MT), a synthetic androgen, is utilized in tilapia farming to bias sex ratio towards males because they are more profitable. A heavily male-biased hatchling sex ratio is reported from a crocodile population near one such tilapia operation in Guanacaste, Costa Rica. In this study we test the effects of MT on sexual differentiation in American alligators, which we used as a surrogate for all crocodilians. Experimentally, alligators were exposed to MT in ovo at standard ecotoxicological concentrations. Sexual differentiation was determined by examination of primary and secondary sex organs post hatching. We find that MT is capable of producing male embryos at temperatures known to produce females and demonstrate a dose-dependent gradient of masculinization. Embryonic exposure to MT results in hermaphroditic primary sex organs, delayed renal development and masculinization of the clitero-penis (CTP).

  14. On the variability of alligator sex ratios

    USGS Publications Warehouse

    Nichols, J.D.; Chabreck, R.H.


    Samples of alligators from wild and 'farm' populations exhibited disproportionate sex ratios. Males predominated among young alligators from wild populations, whereas females were much more abundant than males in the farm population, where resources were superabundant. These results and other considerations lead us to hypothesize that environmental factors influence sex determination in alligators. During favorable environmental conditions natural selection is expected to favor a preponderance of the sex whose individuals exhibit the greater environmentally associated variation in relative fitness. We hypothesize that environmentally associated variation in age at sexual maturity of females produces sufficient variation in relative fitness of females to result in selection for low sex ratios during periods of resource abundance.

  15. Complete Genome Sequence of Alternanthera mosaic virus, Isolated from Achyranthes bidentata in Asia

    PubMed Central

    Iwabuchi, Nozomu; Yoshida, Tetsuya; Yusa, Akira; Nishida, Shuko; Tanno, Kazuyuki; Keima, Takuya; Nijo, Takamichi; Yamaji, Yasuyuki


    Alternanthera mosaic virus (AltMV) infecting Achyranthes bidentata was first detected in Asia, and the complete genome sequence (6,604 nucleotides) was determined. Sequence identity analysis and phylogenetic analysis confirmed that this isolate is the most phylogenetically distant AltMV isolate worldwide. PMID:26988034

  16. Chronic incidental lead ingestion in a group of captive-reared alligators (Alligator mississippiensis): possible contribution to reproductive failure.


    Lance, Valentine A; Horn, Thomas R; Elsey, Ruth M; de Peyster, Ann


    An American alligator (Alligator mississippiensis) breeding facility using male and female alligators raised from artificially incubated eggs was established in 1975. These alligators first reproduced at 6 years of age as compared to 10-12 years in wild alligators, but the eggs produced showed a lower hatching rate than those collected from the wild. By age 21 reproduction had failed almost completely. The alligators were sacrificed and tissues collected at necropsy from 44 captive and 15 wild animals and assayed for metals. Results showed that captive alligators had significantly higher tissue levels of lead than wild alligators. Cadmium did not differ between wild and captive and selenium was 50% higher in wild than captive alligator kidneys. Bone lead in captive alligators was 252,443 +/- 20,462 ng/g. High yolk lead was suggested as a probable cause for early embryonic death in alligator eggs. The high tissue lead levels in captive alligators was attributed to long-term consumption of nutria (Myocastor coypus) meat contaminated with lead shot. Liver, ovary, and testis were assayed for lipid peroxidation using the thiobarbituric acid (TBA) test. Captive alligators had 3.6 fold increased TBA-reactive materials in the liver tissue compared to wild. Lipid peroxidation was strongly suspected as having been enhanced by consumption of rancid nutria meat containing lead.


    EPA Science Inventory

    Seasonal variation in plasma sex steroid concentrations is common in mature vertebrates, and is occasionally seen in juvenile animals. In this study, we examine the seasonal pattern of sex hormone concentration in juvenile American alligators (Alligator mississippiensis) and make...


    EPA Science Inventory

    Reproductive disorders in American alligators (Alligator mississippiensis) inhabiting Lake Apopka, Florida, have been observed for several years. Such disorders are hypothesized to be caused by endocrine disrupting contaminants occurring in the Lake due to pesticide spills and ...


    EPA Science Inventory

    Exposure to environmental contaminants has been shown to alter normal thyroid function in various wildlife species, including the American alligator (Alligator mississippiensis). Abnormalities in circulating levels of the thyroid hormone thyroxine (T4) have been reported in juven...

  20. 75 FR 34365 - Safety Zone, Alligator River, NC

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone, Alligator River, NC AGENCY: Coast Guard... the waters of the Alligator River at East Lake, North Carolina. The safety zone is intended to... on the Alligator River makes safety zone regulations necessary to provide for the safety...

  1. Systena silvestrii bechyne (Coleoptera:Chrysomelidae):Redescripton,new distribution and adult host records

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The flea beetle Systena silvestrii Bechyné 1957, was studied in context with the evaluation of natural enemies of the alligator weed, Alternanthera philoxeroides (Martius) Grisebach (Amaranthaceae). The female is described and the holotype male is redescribed adding new diagnostic characters: mouth...

  2. Alterations in steroidogenesis in alligators (Alligator mississippiensis) exposed naturally and experimentally to environmental contaminants.

    PubMed Central

    Crain, D A; Guillette, L J; Rooney, A A; Pickford, D B


    Many environmental contaminants alter the reproduction of animals by altering the development and function of the endocrine system. The ability of environmental contaminants to alter the endocrine system of alligators was studied both in a descriptive study in which juvenile alligators from a historically contaminated lake were compared to animals from a control lake and in an experimental study in which hatchling control alligators were exposed in ovo to several endocrine-disrupting standards and two modern-use herbicides. Endocrine status was assessed by examining plasma hormone concentrations, gonadal-adrenal mesonephros (GAM) aromatase activity, and gonadal histopathology. In the descriptive study, juvenile alligators from the contaminated lake had significantly lower plasma testosterone concentrations (29.2 pg/ml compared to 51.3 pg/ml), whereas plasma 17 beta-estradiol concentrations did not vary when compared to controls. GAM aromatase activity was significantly decreased n the alligators from the contaminated lake (7.6 pmol/g/hr compared to 11.4 pmol/g/hr). In the experimental study, the endocrine-disrupting standards had the expected effects. 17 beta-Estradiol and tamoxifen caused sex reversal from male to female, with a corresponding increase in aromatase activity. Vinclozolin had no apparent effect on male or female alligators. Among the herbicides tested, atrazine induced GAM aromatase activity in male hatchling alligators that was neither characteristic of males nor females, although testicular differentiation was not altered. Exposure to 2,4-dichlorophenoxyacetic acid had no effect on the endocrine parameters that were measured. Together, these studies show that exposure to some environmental chemicals (such as atrazine) can alter steroidogenesis in alligators, but the endocrine alterations previously noted for Lake Apopka, Florida, alligators can not be fully explained by this mechanism. Images Figure 1. PMID:9222139

  3. Endogenous and exogenous estrogens during embryonic development affect timing of hatch and growth in the American alligator (Alligator mississippiensis).


    Cruze, Lori; Roark, Alison M; Rolland, Gabrielle; Younas, Mona; Stacy, Nicole; Guillette, Louis J


    Prenatal exposure to estrogenic endocrine disrupting chemicals (EDCs) can affect length of gestation and body mass and size of offspring. However, the dose, timing, and duration of exposure as well as sex and strain of the experimental animals determine the direction and magnitude of these effects. In this study, we examined the effects of a one-time embryonic exposure to either 17 β-estradiol (E2) or bisphenol A (BPA) on rate of development and growth in American alligators (Alligator mississippiensis). Our results indicate that BPA and E2-treated alligators hatched approximately 1.4 days earlier than vehicle-treated (control) alligators, suggesting that estrogenic chemicals hasten hatching in these animals. We assessed growth rates, growth allometry, and body condition for 21 weeks after hatching and found that BPA-treated alligators grew more quickly shortly after hatching but more slowly thereafter compared to control alligators. Conversely, E2-treated alligators grew more slowly shortly after hatching but more quickly thereafter compared to control alligators. As a result of differences in growth rate, BPA-treated alligators were heavier, longer, and fatter than control alligators at age 5 weeks but were similar in size and leaner than control alligators at age 21 weeks. Biochemical analytes were examined at the end of the 21-week study to assess overall metabolic condition. We found that E2-treated alligators had significantly higher circulating plasma concentrations of cholesterol and triglycerides than control alligators while BPA-treated alligators had blood profiles comparable to control alligators. Our results provide important insights into the effects of exogenous estrogens on morphology and metabolism in an oviparous, semi-aquatic reptile.

  4. Eradication of Major Weeds

    ERIC Educational Resources Information Center

    Indian Journal of Adult Education, 1975


    Strategies for weed control in cropped and non-cropped areas are presented together with an operational plan for implementing a program for weed control at the national level. The program includes training personnel and community education procedures. (EC)

  5. Horny Goat Weed


    Horny goat weed is an herb. The leaves are used to make medicine. As many as 15 horny goat weed species are known as “yin yang huo” ... Herbs and supplements that might lower blood pressureHorny goat weed might lower blood pressure. Taking it along ...

  6. A mother alligator protects her young

    NASA Technical Reports Server (NTRS)


    In the water near Kennedy Space Center, a mother alligator gathers her six offspring. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  7. An algae-covered alligator rests warily

    NASA Technical Reports Server (NTRS)


    An algae-covered alligator keeps a wary eye open as it rests in one of the ponds at Kennedy Space Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.


    EPA Science Inventory

    The goal of this study was to determine whether hepatic biotransformation of testosterone is normally sexually dimorphic in juvenile alligators and whether living in a contaminated environment affects hepatic dimorphism. Lake Woodruff served as our reference site. Moonshine Bay, ...


    EPA Science Inventory

    Morphological variation of 508 hatchling alligators from three lakes in north central Florida (Lakes Woodruff, Apopka, and Orange) was analyzed using multivariate statistics. Morphological variation was found among clutches as well as among lakes. Principal components analysis wa...

  10. Alligators, contaminants and steroid hormones.


    Guillette, Louis J; Edwards, Thea M; Moore, Brandon C


    Steroids are essential for successful reproduction in all vertebrate species. Over the last several decades, extensive research has indicated that exposure to various environmental pollutants can disrupt steroidogenesis and steroid signaling. Although steroidogenesis is regulated by the hypothalamic-pituitary axis, it is also modified by various paracrine and autocrine factors. Furthermore, the classical two-cell model of steroidogenesis in the developing ovarian follicle, involving the granulosa and theca cells in mammals, may not be universal. Instead, birds and probably reptiles use the two thecal compartments (theca interna and theca externa) as sites of steroid production. We have documented that embryonic or juvenile exposure to a complex mixture of contaminants from agricultural and storm water runoff leads to altered steroid hormone profiles in American alligators. Our observations suggest that alterations in plasma steroid hormone concentrations are due in part to altered gene expression, modified hepatic biotransformation and altered gonadal steroidogenesis. Future studies must examine the interplay between endocrine and paracrine regulation in the development and expression of gonadal steroidogenesis in individuals exposed to endocrine disrupting contaminants at various life stages if we are to fully understand potential detrimental outcomes.

  11. International Alligator Rivers Analog Project

    SciTech Connect

    Bichard, G.F.


    The Australian Nuclear Science and Technology Organization (ANSTO), the Japan Atomic Energy Research Institute, the Swedish Nuclear Power Inspectorate, the U.K. Department of the Environment, the US Nuclear Regulatory Commission (NRC), and the Power Reactor and Nuclear Fuel Development Corporation of Japan are participating under the aegis of the Nuclear Energy Agency in the International Alligator Rivers Analog Project. The project has a duration of 3 yr, starting in 1988. The project has grown out of a research program on uranium ore bodies as analogs of high-level waste (HLW) repositories undertaken by ANSTO supported by the NRC. A primary objective of the project is to develop an approach to radionuclide transport model validation that may be used by the participants to support assessments of the safety of radioactive waste repositories. The approach involves integrating mathematical and physical modeling with hydrological and geochemical field and laboratory investigations of the analog site. The Koongarra uranium ore body has been chosen as the analog site because it has a secondary ore body that has formed over the past million years as a result of leaching by groundwater flowing through fractures in the primary ore body.


    EPA Science Inventory

    Concentrations of metals and selenium were examined in tissues of American alligators (Alligator mississippiensis) from three lakes in central Florida, in one of which alligators have exhibited reproductive or developmental defects. Our overall objective was to determine whether ...

  13. Home range and movements of American alligators (Alligator mississippiensis) in an estuary habitat

    USGS Publications Warehouse

    Fujisaki, Ikuko; Hart, Kristen M.; Mazzotti, Frank J.; Cherkiss, Michael S.; Sartain-Iverson, Autumn R.; Jeffery, Brian M.; Beauchamp, Jeffrey S.; Denton, Mathew J.


    This study reveals consistent use of estuary habitat by American alligators. The alligators showed variations in their movement pattern and seasonal habitat, with movement attributable to environmental factors. Although satellite-derived locations were more dispersed compared to locations collected using VHF radio-tags, data collected from VHF tracking omitted some habitat used for a short period of time, indicating the effectiveness of satellite telemetry to continuously track animals for ecosystem-scale studies.

  14. The isolation of parvalbumin isoforms from the tail muscle of the American alligator (Alligator mississipiensis).


    Laney, E L; Shabanowitz, J; King, G; Hunt, D F; Nelson, D J


    Multiple parvalbumin isoforms have been detected in the tail (skeletal) muscle of the American alligator (Alligator mississipiensis). One of these isoforms (APV-1) has been highly purified and partially characterized. Protein purification involved mainly gel filtration and anion exchange chromatography, and characterization included gel electrophoresis, amino acid composition analysis, metal ion analysis, MALDI-TOF and ESI mass spectrometry, ultraviolet and fluorescence spectroscopy, and one- and two-dimensional 500 MHz proton NMR spectroscopy. The alligator isoforms are rich in phenylalanine and deficient in the other aromatic residues as is typical for parvalbumins. In fact, the one highly purified isoform that forms the basis of this study has only phenyl-alanine as an aromatic residue. Ion exchange chromatography further indicates that this isoform has a relatively high isoelectric point (pl approximately 5.0), indicating that it is an alpha-lineage parvalbumin. This alligator parvalbumin isoform is unusual in that it has an atypically high Ca2+ content (almost 3.0 mole of Ca2+ per mole of protein) following purification, a fact supported by terbium fluorescence titration experiments. Preliminary comparative analysis of the highly purified alligator parvalbumin isoform (in the Ca2-loaded state) by two-dimensional 1H-NMR (2D 1H TOCSY and 2D 1H NOESY) indicates that there is considerable similarity in structure between the alligator protein and a homologous protein obtained from the silver hake (a saltwater fish species). PMID:9076974

  15. Ecological studies on the American alligator (Alligator mississippiensis) on the Savannah River Plant

    SciTech Connect

    Seigel, R.A.; Brandt, L.A.; Knight, J.L.; Novak, S.S.


    The American alligator (Alligator mississippiensis) is the largest vertebrate of the Savannah River Plant (SRP), reaching a maximum length of 3.7 meters (12 feet) and weighing up to 175 kg (385 pounds). Currently, populations in coastal South Carolina are considered Threatened, whereas populations in inland areas (such as the SRP) are still Endangered. Because of their legal status and economic and ecological importance, it is important to determine the environmental impacts of SRP operations on the local alligator population. The major objectives under the Endangered Species Program of the Comprehensive Cooling Water Study (CCWS) were as follows: (1) document and compare the present status and distribution of alligators on the SRP to previous surveys, in order to determine long-term changes in population abundance; (2) establish baseline population and ecological parameters of the Steel Creek population so that the ecological effects of L-Reactor operations can be determined, and (3) conduct ecological research on the immediate impacts of thermal effluents on American alligators. Gladden et al., (1985) summarized data on previous population surveys, temporal changes in the Par Pond population, preliminary results of the Steel Creek surveys and Savannah River Ecology Laboratory (SREL) research on the effects of thermal effluents. This report summarizes the current status of the SRP population, presents data on the abundance, movement patterns and activity cycles of the Steel Creek population, and presents additional data on the effect of cooling water releases on alligator ecology and behavior.

  16. Urinary Phthalate Metabolites in American Alligators (Alligator mississippiensis) from Selected Florida Wetlands.


    Brock, John W; Bell, Jane Margaret; Guillette, Louis J


    Phthalates have been shown to cause endocrine disruption in laboratory animals and are associated with altered development of the reproductive system in humans. Further, human have significant exposure to phthalates. However, little is known concerning the exposure of wildlife to phthalates. We report urinary phthalate metabolite concentrations from fifty juvenile alligators from three Florida lakes and a site in the Everglades. Urinary phthalate monoester concentrations varied widely among alligators from the different sites but also among alligators from the same site. Mono-2-ethylhexy phthalate and monobutyl phthalate were found in most samples of alligator urine with maximums of 35,700 ng/mL and 193 ng/mL, respectively. Monobenzyl phthalate was found in 5 alligators with a maximum of 66.7 ng/mL. Other monoesters were found in only one or two alligator urine samples. The wide variation within and among sites, in addition to the high levels of mEHP, mBP and mBzP, is consistent with exposure arising from the intermittent spraying of herbicide formulations to control invasive aquatic plants in Florida freshwater sites. Phthalate diesters are used as adjuvants in many of these formulations. PMID:26743198

  17. Survival and growth of American alligator (Alligator mississippiensis) hatchlings after artificial incubation and repatriation

    USGS Publications Warehouse

    Temsiripong, Y.; Woodward, A.R.; Ross, J.P.; Kubilis, P.S.; Percival, H.F.


    Hatchling American Alligators (Alligator mississippiensis) produced from artificially incubated wild eggs were returned to their natal areas (repatriated). We compared artificially incubated and repatriated hatchlings released within and outside the maternal alligator's home range with naturally incubated hatchlings captured and released within the maternal alligator's home range on Lake Apopka, Lake Griffin, and Orange Lake in Florida. We used probability of recapture and total length at approximately nine months after hatching as indices of survival and growth rates. Artificially incubated hatchlings released outside of the maternal alligator's home range had lower recapture probabilities than either naturally incubated hatchlings or artificially incubated hatchlings released near the original nest site. Recapture probabilities of other treatments did not differ significantly. Artificially incubated hatchlings were approximately 6% shorter than naturally incubated hatchlings at approximately nine months after hatching. We concluded that repatriation of hatchlings probably would not have long-term effects on populations because of the resiliency of alligator populations to alterations of early age-class survival and growth rates of the magnitude that we observed. Repatriation of hatchlings may be an economical alternative to repatriation of older juveniles for population restoration. However, the location of release may affect subsequent survival and growth. Copyright 2006 Society for the Study of Amphibians and Reptiles.

  18. Crocodiles and Alligators. Young Discovery Library Series.

    ERIC Educational Resources Information Center

    Farre, Marie

    This book is written for children ages 5 through 10. Part of a series designed to develop their curiosity, fascinate them and educate them, this volume describes the physical characteristics, behavior, and peculiar habits of crocodiles, including how to distinguish them from close relatives such as alligators, cayman, and gharials. (YP)

  19. Introduction to Weeds and Herbicides.

    ERIC Educational Resources Information Center

    Hartwig, Nathan L.

    This agriculture extension service publication from Pennsylvania State University is an introduction to weed control and herbicide use. An initial discussion of the characteristics of weeds includes scientific naming, weed competition with crops, weed dispersal and dormancy, and conditions affecting weed seed germination. The main body of the…

  20. Elemental Levels Analyzed by PIXE in Florida Alligators

    NASA Astrophysics Data System (ADS)

    Kuharik, J. C.; Kravchenko, I. I.; Dunnam, F. E.; Van Rinsvelt, H. A.; Ross, J. P.


    Unusual and alarming mortality of alligators (Alligator mississippiensis) has been reported from Lake Griffin, Florida, where almost 400 dead alligators have been observed since 1997. In addition, the hatch rate for alligator eggs around Lake Griffin fell below 10% and remains low (30-45%) while the normal hatch rate is typically 80%. Standard diagnostic methods have been ineffective in determining the cause of the phenomenon. Many possibilities have been considered including pollutants, nutrition, and toxic algae. Particle Induced X-ray Emission (PIXE) analysis is highly suitable for investigating concentrations of a wide range of elements in animal tissue. Liver, kidney and spinal cord tissues from healthy and sick alligators have been analyzed by PIXE for elemental content. Initial results showed positive correlation between certain elements and neural impairment and morbidity of alligators in Lake Griffin, but have failed to prove significant.

  1. Elemental Levels Analyzed by PIXE in Florida Alligators

    SciTech Connect

    Kuharik, J.C.; Kravchenko, I.I.; Dunnam, F.E.; Rinsvelt, H.A. van; Ross, J.P.


    Unusual and alarming mortality of alligators (Alligator mississippiensis) has been reported from Lake Griffin, Florida, where almost 400 dead alligators have been observed since 1997. In addition, the hatch rate for alligator eggs around Lake Griffin fell below 10% and remains low (30-45%) while the normal hatch rate is typically 80%. Standard diagnostic methods have been ineffective in determining the cause of the phenomenon. Many possibilities have been considered including pollutants, nutrition, and toxic algae. Particle Induced X-ray Emission (PIXE) analysis is highly suitable for investigating concentrations of a wide range of elements in animal tissue. Liver, kidney and spinal cord tissues from healthy and sick alligators have been analyzed by PIXE for elemental content. Initial results showed positive correlation between certain elements and neural impairment and morbidity of alligators in Lake Griffin, but have failed to prove significant.

  2. A study on biliary ductal system and bile fistula in the American alligator, Alligator mississippiensis.


    Xu, G; Elsey, R M; Lance, V A; Javors, B; Chen, T S; Salen, G; Tint, G S


    The anomalous arrangement of bile ducts in the Crocodylia has not been fully appreciated. A clear understanding of biliary anatomy is necessary in order to create complete bile drainage in these reptiles. The object of this study was to clarify the anatomy of the bile ductal system and to establish total bile fistulas in the American alligator, Alligator mississippiensis. Bile duct anatomy was studied in 104 juvenile alligators, and bile fistulas were constructed in seven alligators. In 93 out of 104 (89%) of the juveniles dissected there was an interconnection between the right and left hepatic duct before the right hepatic duct emptied into the gallbladder. The left hepatic duct then entered the duodenum independently of the cystic duct which drained the gallbladder directly into the duodenum. In 8% of the animals, the left hepatic duct did not enter the duodenum but joined with the right duct, forming a common hepatic duct that emptied into the gallbladder. In 3% of the cases, the right hepatic duct emptied into the gallbladder, while the left duct had no communication with the right hepatic duct and drained separately into the duodenum. This arrangement of bile ducts is similar to that seen in birds and reflects the common ancestry of crocodiles and birds. In other reptiles, the biliary system shows much more variability and is different from the alligator. In five of seven alligators in which total biliary diversion was attempted, the biliary catheter remained in place and stayed patent from 2-7 weeks. Bile flow was extremely low (1.5-2.5 ml/24 h) when compared to that of mammals (80-100 ml/24 h). This study demonstrates the variable nature of the biliary ductal system in Alligator mississippiensis and suggest a method for constructing an effective total bile fistula in these animals.

  3. Levels of mercury in alligators (Alligator mississippiensis) collected along a transect through the Florida Everglades

    USGS Publications Warehouse

    Rumbold, D.G.; Fink, L.E.; Laine, K.A.; Niemczyk, S.L.; Chandrasekhar, T.; Wankel, Scott D.; Kendall, C.


    As part of a multi-agency study of alligator health, 28 American alligators (Alligator mississippiensis) were captured along a transect through the Florida Everglades in 1999. Liver and tail muscle tissues were sampled and analyzed on a wet weight basis for total mercury (THg) using cold-vapor atomic absorption spectrophotometry. All tissues had detectable concentrations of THg that ranged from 0.6 to 17 mg/kg in liver and from 0.1 to 1.8 mg/kg in tail muscle. THg was more concentrated in liver tissue than tail muscle, but levels were highly correlated between tissues. THg concentrations in tissue differed significantly among locations, with animals from Everglades National Park (ENP) having mean concentrations of THg in liver (10.4 mg/kg) and tail muscle (1.2 mg/kg) that were two-fold higher than basin-wide averages (4.9 and 0.64 mg/kg, respectively). The reasons for higher contamination of ENP alligators were unclear and could not be explained by differences in sex, length, weight or animal age. While ??15N values were positively correlated with THg concentrations in tail muscle, spatial patterns in isotopic composition did not explain the elevated THg levels in ENP alligators. Therefore, it appears that ENP alligators were more highly exposed to mercury in their environment than individuals in other areas. Comparisons to a previous survey by Yanochko et al. [Arch Environ Contam Toxicol 32 (1997) 323] suggest that mercury levels have declined in some Everglades alligators since 1994. ?? 2002 Elsevier Science B.V. All rights reserved.

  4. Identification and Characterization of the Androgen Receptor From the American Alligator, Alligator mississippiensis

    PubMed Central

    Miyagawa, Shinichi; Yatsu, Ryohei; Kohno, Satomi; Doheny, Brenna M.; Ogino, Yukiko; Ishibashi, Hiroshi; Katsu, Yoshinao; Ohta, Yasuhiko; Guillette, Louis J.


    Androgens are essential for the development, reproduction, and health throughout the life span of vertebrates, particularly during the initiation and maintenance of male sexual characteristics. Androgen signaling is mediated by the androgen receptor (AR), a member of the steroid nuclear receptor superfamily. Mounting evidence suggests that environmental factors, such as exogenous hormones or contaminants that mimic hormones, can disrupt endocrine signaling and function. The American alligator (Alligator mississippiensis), a unique model for ecological research in that it exhibits environment-dependent sex determination, is oviparous and long lived. Alligators from a contaminated environment exhibit low reproductive success and morphological disorders of the testis and phallus in neonates and juveniles, both associated with androgen signaling; thus, the alterations are hypothesized to be related to disrupted androgen signaling. However, this line of research has been limited because of a lack of information on the alligator AR gene. Here, we isolated A mississippiensis AR homologs (AmAR) and evaluated receptor-hormone/chemical interactions using a transactivation assay. We showed that AmAR responded to all natural androgens and their effects were inhibited by cotreatment with antiandrogens, such as flutamide, p,p′-dichlorodiphenyldichloroethylene, and vinclozolin. Intriguingly, we found a spliced form of the AR from alligator cDNA, which lacks seven amino acids within the ligand-binding domain that shows no response to androgens. Finally, we have initial data on a possible dominant-negative function of the spliced form of the AR against androgen-induced AmAR. PMID:25974402

  5. Blood and Plasma Biochemistry Reference Intervals for Wild Juvenile American Alligators ( Alligator mississippiensis ).


    Hamilton, Matthew T; Kupar, Caitlin A; Kelley, Meghan D; Finger, John W; Tuberville, Tracey D


    : American alligators ( Alligator mississippiensis ) are one of the most studied crocodilian species in the world, yet blood and plasma biochemistry information is limited for juvenile alligators in their northern range, where individuals may be exposed to extreme abiotic and biotic stressors. We collected blood samples over a 2-yr period from 37 juvenile alligators in May, June, and July to establish reference intervals for 22 blood and plasma analytes. We observed no effect of either sex or blood collection time on any analyte investigated. However, our results indicate a significant correlation between a calculated body condition index and aspartate aminotransferase and creatine kinase. Glucose, total protein, and potassium varied significantly between sampling sessions. In addition, glucose and potassium were highly correlated between the two point-of-care devices used, although they were significantly lower with the i-STAT 1 CG8+ cartridge than with the Vetscan VS2 Avian/Reptile Rotor. The reference intervals presented herein should provide baseline data for evaluating wild juvenile alligators in the northern portion of their range. PMID:27224213

  6. Identification and Characterization of the Androgen Receptor From the American Alligator, Alligator mississippiensis.


    Miyagawa, Shinichi; Yatsu, Ryohei; Kohno, Satomi; Doheny, Brenna M; Ogino, Yukiko; Ishibashi, Hiroshi; Katsu, Yoshinao; Ohta, Yasuhiko; Guillette, Louis J; Iguchi, Taisen


    Androgens are essential for the development, reproduction, and health throughout the life span of vertebrates, particularly during the initiation and maintenance of male sexual characteristics. Androgen signaling is mediated by the androgen receptor (AR), a member of the steroid nuclear receptor superfamily. Mounting evidence suggests that environmental factors, such as exogenous hormones or contaminants that mimic hormones, can disrupt endocrine signaling and function. The American alligator (Alligator mississippiensis), a unique model for ecological research in that it exhibits environment-dependent sex determination, is oviparous and long lived. Alligators from a contaminated environment exhibit low reproductive success and morphological disorders of the testis and phallus in neonates and juveniles, both associated with androgen signaling; thus, the alterations are hypothesized to be related to disrupted androgen signaling. However, this line of research has been limited because of a lack of information on the alligator AR gene. Here, we isolated A mississippiensis AR homologs (AmAR) and evaluated receptor-hormone/chemical interactions using a transactivation assay. We showed that AmAR responded to all natural androgens and their effects were inhibited by cotreatment with antiandrogens, such as flutamide, p,p'-dichlorodiphenyldichloroethylene, and vinclozolin. Intriguingly, we found a spliced form of the AR from alligator cDNA, which lacks seven amino acids within the ligand-binding domain that shows no response to androgens. Finally, we have initial data on a possible dominant-negative function of the spliced form of the AR against androgen-induced AmAR. PMID:25974402

  7. Respiratory bronchoscopy of subadult American alligators (Alligator mississippiensis) and tracheal wash evaluation.


    Lafortune, Maud; Göbel, Thomas; Jacobson, Elliot; Heard, Darryl; Brown, Dan; Alleman, Rick; Vliet, Kent; Harr, Kendal E; Hernandez, Jorge


    Twelve healthy approximately 3-yr-old captive-born 4.5-9 kg American alligators (Alligator mississipiensis) each had bronchoscopy and tracheal washes performed four times during a 10-mo period to evaluate seasonal respiratory microbiology and cytology. Cytologic evaluation of most samples showed a small amount of mucus and low numbers of ciliated columnar epithelium, cubodial epithelium, and keratinized squamous cells. No bacteria or parasites were observed, and there was no seasonal variation in the cytology. No significant bacterial or fungal growth was identified in any season. Hematology performed in the spring and fall evaluations showed seasonal variation in the red blood cell count, hemoglobin concentration, mean corpuscular volume, mean corpuscular hemoglobin concentration, eosinophil count, and thrombocyte count. The lower respiratory tract (at the tracheal level) of healthy subadult alligators appears to be sterile, and cytology is similar to that described in domestic mammals. PMID:17315452

  8. Low cost of pulmonary ventilation in American alligators (Alligator mississippiensis) stimulated with doxapram.


    Skovgaard, Nini; Crossley, Dane A; Wang, Tobias


    To determine the costs of pulmonary ventilation without imposing severe oxygen limitations or acidosis that normally accompany exposures to hypoxia or hypercapnia, we opted to pharmacologically stimulate ventilation with doxapram (5 and 10 mg kg(-1)) in alligators. Doxapram is used clinically to alleviate ventilatory depression in response to anaesthesia and acts primarily on the peripheral oxygen-sensitive chemoreceptors. Using this approach, we investigated the hypothesis that pulmonary ventilation is relatively modest in comparison to resting metabolic rate in crocodilians and equipped seven juvenile alligators with masks for concurrent determination of ventilation and oxygen uptake. Doxapram elicited a dose-dependent and up to fourfold rise in ventilation, primarily by increasing ventilatory frequency. The accompanying rise in oxygen uptake was very small; ventilation in resting animals constitutes no more than 5% of resting metabolic rate. The conclusion that pulmonary ventilation is energetically cheap is consistent with earlier studies on alligators where ventilation was stimulated by hypoxia or hypercapnia. PMID:26896538

  9. Weed Research in Mint

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Production of high quality and high yielding peppermint and spearmint oil requires effective management of weeds. Since soil disturbance is kept to a minimum to reduce the spread of Verticillium wilt in mint production, weed control is accomplished primarily with herbicides. Flucarbazone, and propox...

  10. Weed Research in Mint

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weeds present in peppermint and spearmint reduce mint oil yield and quality. Mustard seed meal applied at 1 and 2 ton/acre to newly planted peppermint reduced annual weed emergence for several weeks without injuring peppermint. Field pennycress seed meal applied at similar rates did not suppress wee...

  11. A mother alligator protects her young

    NASA Technical Reports Server (NTRS)


    American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Center shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  12. In ovo and in vitro susceptibility of American alligators (Alligator mississippiensis) to avian influenza virus infection.


    Temple, Bradley L; Finger, John W; Jones, Cheryl A; Gabbard, Jon D; Jelesijevic, Tomislav; Uhl, Elizabeth W; Hogan, Robert J; Glenn, Travis C; Tompkins, S Mark


    Avian influenza has emerged as one of the most ubiquitous viruses within our biosphere. Wild aquatic birds are believed to be the primary reservoir of all influenza viruses; however, the spillover of H5N1 highly pathogenic avian influenza (HPAI) and the recent swine-origin pandemic H1N1 viruses have sparked increased interest in identifying and understanding which and how many species can be infected. Moreover, novel influenza virus sequences were recently isolated from New World bats. Crocodilians have a slow rate of molecular evolution and are the sister group to birds; thus they are a logical reptilian group to explore susceptibility to influenza virus infection and they provide a link between birds and mammals. A primary American alligator (Alligator mississippiensis) cell line, and embryos, were infected with four, low pathogenic avian influenza (LPAI) strains to assess susceptibility to infection. Embryonated alligator eggs supported virus replication, as evidenced by the influenza virus M gene and infectious virus detected in allantoic fluid and by virus antigen staining in embryo tissues. Primary alligator cells were also inoculated with the LPAI viruses and showed susceptibility based upon antigen staining; however, the requirement for trypsin to support replication in cell culture limited replication. To assess influenza virus replication in culture, primary alligator cells were inoculated with H1N1 human influenza or H5N1 HPAI viruses that replicate independent of trypsin. Both viruses replicated efficiently in culture, even at the 30 C temperature preferred by the alligator cells. This research demonstrates the ability of wild-type influenza viruses to infect and replicate within two crocodilian substrates and suggests the need for further research to assess crocodilians as a species potentially susceptible to influenza virus infection.



    Zhao, Jinhong; Wang, Shaosheng; Tu, Genjun; Zhou, Yongkang; Wu, Xiaobing; Li, Chaopin


    Crocodiles are susceptible to infection with a wide array of external and internal gastrointestinal helminths, yet little is known on the histopathology following infection or the effects of these parasites. The present study was aimed at evaluating the impact of infection by Ortleppascaris sinensis (Nematoda: Ascaridoidea) on the stomach of captive Alligator sinensis. The histological examination of the stomach revealed presence of superficial ulcer in mucous layer and granulomatous inflammation in submucous layer at entire gastric walls of the Alligator sinensis. Our findings also confirm that development of Ortleppascaris sinensis is in close association with the wall of the stomach. PMID:26319836

  14. Stem tissue mass density is linked to growth and resistance to a stem-boring insect in Alternanthera philoxeroides

    Technology Transfer Automated Retrieval System (TEKTRAN)

    To investigate how stem anatomical structure is linked to growth and resistance to stem-boring insects in a herbaceous species, six populations of alligatorweed (Alternanthera philoxeroides) were grown in a common garden. Stem growth rate (GR) of A. philoxeroides and pupation rate as an estimate of ...

  15. Hexavalent chromium is cytotoxic and genotoxic to American alligator cells.


    Wise, Sandra S; Wise, Catherine; Xie, Hong; Guillette, Louis J; Zhu, Cairong; Wise, John Pierce; Wise, John Pierce


    Metals are a common pollutant in the aquatic ecosystem. With global climate change, these levels are anticipated to rise as lower pH levels allow sediment bound metals to be released. The American alligator (Alligator mississippiensis) is an apex predator in the aquatic ecosystem and is considered a keystone species; as such it serves as a suitable monitor for localized pollution. One metal of increasing concern is hexavalent chromium (Cr(VI)). It is present in the aquatic environment and is a known human carcinogen and reproductive toxicant. We measured the cytotoxicity and genotoxicity of Cr(VI) in American alligator cells derived from scute tissue. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to alligator cells in a concentration-dependent manner. These data suggest that alligators may be used as a model for assessing the effects of environmental Cr(VI) contamination as well as for other metals of concern. PMID:26730726

  16. Hexavalent chromium is cytotoxic and genotoxic to American alligator cells.


    Wise, Sandra S; Wise, Catherine; Xie, Hong; Guillette, Louis J; Zhu, Cairong; Wise, John Pierce; Wise, John Pierce


    Metals are a common pollutant in the aquatic ecosystem. With global climate change, these levels are anticipated to rise as lower pH levels allow sediment bound metals to be released. The American alligator (Alligator mississippiensis) is an apex predator in the aquatic ecosystem and is considered a keystone species; as such it serves as a suitable monitor for localized pollution. One metal of increasing concern is hexavalent chromium (Cr(VI)). It is present in the aquatic environment and is a known human carcinogen and reproductive toxicant. We measured the cytotoxicity and genotoxicity of Cr(VI) in American alligator cells derived from scute tissue. We found that particulate and soluble Cr(VI) are both cytotoxic and genotoxic to alligator cells in a concentration-dependent manner. These data suggest that alligators may be used as a model for assessing the effects of environmental Cr(VI) contamination as well as for other metals of concern.

  17. Pathology, physiologic parameters, tissue contaminants, and tissue thiamine in morbid and healthy central Florida adult American alligators (Alligator mississippiensis)

    USGS Publications Warehouse

    Honeyfield, D.C.; Ross, J.P.; Carbonneau, D.A.; Terrell, S.P.; Woodward, A.R.; Schoeb, T.R.; Perceval, H.F.; Hinterkopf, J.P.


    An investigation of adult alligator (Alligator mississippiensis) mortalities in Lake Griffin, central Florida, was conducted from 1998-2004. Alligator mortality was highest in the months of April and May and annual death count peaked in 2000. Bacterial pathogens, heavy metals, and pesticides were not linked with the mortalities. Blood chemistry did not point to any clinical diagnosis, although differences between impaired and normal animals were noted. Captured alligators with signs of neurologic impairment displayed unresponsive and uncoordinated behavior. Three of 21 impaired Lake Griffin alligators were found to have neural lesions characteristic of thiamine deficiency in the telencephalon, particularly the dorsal ventricular ridge. In some cases, lesions were found in the thalamus, and parts of the midbrain. Liver and muscle tissue concentrations of thiamine (vitamin B"1) were lowest in impaired Lake Griffin alligators when compared to unimpaired alligators or to alligators from Lake Woodruff. The consumption of thiaminase-positive gizzard shad (Dorosoma cepedianum) is thought to have been the cause of the low tissue thiamine and resulting mortalities. ?? Wildlife Disease Association 2008.

  18. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis).


    Nilsen, Frances M; Parrott, Benjamin B; Bowden, John A; Kassim, Brittany L; Somerville, Stephen E; Bryan, Teresa A; Bryan, Colleen E; Lange, Ted R; Delaney, J Patrick; Brunell, Arnold M; Long, Stephen E; Guillette, Louis J


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida's north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different "treatments" of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics.

  19. Perfluorinated Alkyl Acids in Plasma of American Alligators (Alligator Mississippiensis) from Florida and South Carolina

    NASA Technical Reports Server (NTRS)

    Bangma, Jacqueline T.; Bowden, John A.; Brunell, Arnold M.; Christie, Ian; Finnell, Brendan; Guillette, Matthew P.; Jones, Martin; Lowers, Russell H.; Rainwater, Thomas R.; Reiner, Jessica L.; Wilkinson, Philip M.; Guillette, Louis J., Jr.


    This study aimed to quantitate fourteen perfluoroalkyl acids (PFAAs) in 125 adult American alligators at twelve sites across the southeastern US. Of those fourteen PFAAs, nine were detected in 65% - 100% of the samples: PFOA, PFNA, PFDA, PFUnA, PFDoA, PFTriA, PFTA, PFHxS, and PFOS. Males (across all sites) showed significantly higher concentrations of four PFAAs: PFOS (p = 0.01), PFDA (p = 0.0003), PFUnA (p = 0.021), and PFTriA (p = 0.021). Concentrations of PFOS, PFHxS, and PFDA in plasma were significantly different among the sites in each sex. Alligators at Merritt Island National Wildlife Refuge and Kiawah Nature Conservancy both exhibited some of the highest PFOS concentrations (medians 99.5 ng/g and 55.8 ng/g respectively) in plasma measured to date in a crocodilian species. A number of positive correlations between PFAAs and snout-vent length (SVL) were observed in both sexes suggesting PFAA body burdens increase with increasing size. In addition, several significant correlations among PFAAs in alligator plasma may suggest conserved sources of PFAAs at each site throughout the greater study area. This study is the first to report PFAAs in American alligators, reveals potential PFAA hot spots in Florida and South Carolina, and provides and additional contaminant of concern when assessing anthropogenic impacts on ecosystem health.

  20. Periods of cardiovascular susceptibility to hypoxia in embryonic american alligators (Alligator mississippiensis).


    Tate, Kevin B; Rhen, Turk; Eme, John; Kohl, Zachary F; Crossley, Janna; Elsey, Ruth M; Crossley, Dane A


    During embryonic development, environmental perturbations can affect organisms' developing phenotype, a process known as developmental plasticity. Resulting phenotypic changes can occur during discrete, critical windows of development. Critical windows are periods when developing embryos are most susceptible to these perturbations. We have previously documented that hypoxia reduces embryo size and increases relative heart mass in American alligator, and this study identified critical windows when hypoxia altered morphological, cardiovascular function and cardiac gene expression of alligator embryos. We hypothesized that incubation in hypoxia (10% O2) would increase relative cardiac size due to cardiac enlargement rather than suppression of somatic growth. We exposed alligator embryos to hypoxia during discrete incubation periods to target windows where the embryonic phenotype is altered. Hypoxia affected heart growth between 20 and 40% of embryonic incubation, whereas somatic growth was affected between 70 and 90% of incubation. Arterial pressure was depressed by hypoxic exposure during 50-70% of incubation, whereas heart rate was depressed in embryos exposed to hypoxia during a period spanning 70-90% of incubation. Expression of Vegf and PdgfB was increased in certain hypoxia-exposed embryo treatment groups, and hypoxia toward the end of incubation altered β-adrenergic tone for arterial pressure and heart rate. It is well known that hypoxia exposure can alter embryonic development, and in the present study, we have identified brief, discrete windows that alter the morphology, cardiovascular physiology, and gene expression in embryonic American alligator. PMID:27101296

  1. Persistent halogenated compounds in captive Chinese alligators (Alligator sinensis) from China.


    Wu, Ting; Hong, Bing; Wu, Xiaobing; Wu, Jiangping; Wang, Xinming; Yi, Zhigang; Zhao, Juan; Zhan, Miao; Mai, Bixian


    While a number of studies have reported residual levels of persistent halogenated compounds (PHCs) in crocodilia, there is still a dearth of information on the Chinese alligator, a critically endangered crocodilian species. In the present study, several PHCs, including polybrominated diphenyl ethers (PBDEs), polychlorinated biphenyls (PCBs), and dichlorodiphenyltrichloroethane and its metabolites (DDTs), were detected in the adult tissues, neonates, and eggs of captive Chinese alligators from China. The concentrations of ΣPBDEs, ΣPCBs, and ΣDDTs in Chinese alligators ranged from 0.11 to 16.1, 1.12 to 22.2, and 6.03 to 1020ngg(-1) wet weight, respectively, with higher levels of ΣPCBs and ΣDDTs in the neonates and eggs than in muscle tissues. The ΣDDT residues in the studied Chinese alligators were at the high end of reported ranges from crocodilia around the world, and some results exceeded levels known to cause a female-biased sex ratio in crocodilians.

  2. Periods of cardiovascular susceptibility to hypoxia in embryonic american alligators (Alligator mississippiensis).


    Tate, Kevin B; Rhen, Turk; Eme, John; Kohl, Zachary F; Crossley, Janna; Elsey, Ruth M; Crossley, Dane A


    During embryonic development, environmental perturbations can affect organisms' developing phenotype, a process known as developmental plasticity. Resulting phenotypic changes can occur during discrete, critical windows of development. Critical windows are periods when developing embryos are most susceptible to these perturbations. We have previously documented that hypoxia reduces embryo size and increases relative heart mass in American alligator, and this study identified critical windows when hypoxia altered morphological, cardiovascular function and cardiac gene expression of alligator embryos. We hypothesized that incubation in hypoxia (10% O2) would increase relative cardiac size due to cardiac enlargement rather than suppression of somatic growth. We exposed alligator embryos to hypoxia during discrete incubation periods to target windows where the embryonic phenotype is altered. Hypoxia affected heart growth between 20 and 40% of embryonic incubation, whereas somatic growth was affected between 70 and 90% of incubation. Arterial pressure was depressed by hypoxic exposure during 50-70% of incubation, whereas heart rate was depressed in embryos exposed to hypoxia during a period spanning 70-90% of incubation. Expression of Vegf and PdgfB was increased in certain hypoxia-exposed embryo treatment groups, and hypoxia toward the end of incubation altered β-adrenergic tone for arterial pressure and heart rate. It is well known that hypoxia exposure can alter embryonic development, and in the present study, we have identified brief, discrete windows that alter the morphology, cardiovascular physiology, and gene expression in embryonic American alligator.

  3. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis).


    Nilsen, Frances M; Parrott, Benjamin B; Bowden, John A; Kassim, Brittany L; Somerville, Stephen E; Bryan, Teresa A; Bryan, Colleen E; Lange, Ted R; Delaney, J Patrick; Brunell, Arnold M; Long, Stephen E; Guillette, Louis J


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida's north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different "treatments" of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics. PMID:26748003

  4. Molecular and functional characterization of BAFF from the Yangtze alligator (Alligator sinensis, Alligatoridae).


    Zhang, Jia-Xin; Song, Ren; Sang, Ming; Sun, Si-Qing; Ma, Lei; Zhang, Jie; Zhang, Shuang-Quan


    B-cell activating factor (BAFF) from the TNF family is critical for B-cell survival and maturation. In this study, we identified a Yangtze alligator (Alligator sinensis, Alligatoridae) BAFF cDNA, designated as asBAFF, using reverse transcription polymerase chain reaction (RT-PCR) and rapid amplification of cDNA ends (RACE). The open reading frame of this cDNA encodes a 287-amino acid protein containing a predicted transmembrane domain and a furin protease cleavage site, similar to mammalian and avian BAFF. The amino acid identity between biologically soluble asBAFF (assBAFF) and csBAFF, hsBAFF, and msBAFF is 94, 76, and 71%, respectively. Real-time quantitative PCR analysis showed that the asBAFF gene is strongly expressed in the spleen. Since BAFF is always expressed as inclusion bodies in bacteria, it is difficult to purify. To enhance the soluble expression of assBAFF in Escherichia coli, we fused the extracellular region of the asBAFF gene to a small ubiquitin-related modifier gene (SUMO). Purified assBAFF was able to promote the survival of splenic lymphocytes and co-stimulate the proliferation of mouse B cells with anti-mouse IgM. These findings suggest that asBAFF plays an important role in the survival and proliferation of Yangtze alligator B cells, and because it is evolutionarily highly conserved, functional cross-reactivity exists between mammalian and Yangtze alligator BAFF. PMID:26116474

  5. Polychlorinated biphenyls in eggs and chlorioallantoic membranes of American alligators (Alligator mississippiensis) from coastal South Carolina

    SciTech Connect

    Cobb, G.P.; Wood, P.D.; O`Quinn, M.


    Assessing chemical exposure in threatened or endangered wildlife species presents unique analytical problems. Chorioallantoic membranes (CAMs) have been proposed as surrogate tissues for evaluation of polychlorinated biphenyl (PCB) exposure in oviparous species. Research was undertaken to determine the extent of PCB accumulation in alligators (Alligator mississippiensis) at sites along the coast of South Carolina and to evaluate the utility of CAMs as surrogate tissues for determining PCB concentrations in whole alligator eggs. Polychlorinated biphenyls were found in eggs and CAMs of alligators from both sites examined. Concentrations of PCBs were higher in CAMs (p = 0.02) and eggs (p = 0.001) from sites known to contain chlorinated hydrocarbons than from more pristine sites. Total PCBs partitioned predictably (r{sup 2} > 0.59; p < 0.02) between egg and CAM tissues indicating the utility of CAMs to serve as surrogate tissues when comparing total PCB concentrations in whole eggs. Tetrachloro through octachloro biphenyl homologues and total PCBs in CAMs from reference areas were correlated with concentrations of these homologues in eggs. At contaminated sites, total PCB concentrations in CAMs were correlated with total PCB concentrations in eggs.

  6. Global DNA methylation loss associated with mercury contamination and aging in the American alligator (Alligator mississippiensis)

    PubMed Central

    Nilsen, Frances M.; Parrott, Benjamin B.; Bowden, John A.; Kassim, Brittany L.; Somerville, Stephen E.; Bryan, Teresa A.; Bryan, Colleen E.; Lange, Ted R.; Delaney, J. Patrick; Brunell, Arnold M.; Long, Stephen E.; Guillette, Louis J.


    Mercury is a widespread environmental contaminant with exposures eliciting a well-documented catalog of adverse effects. Yet, knowledge regarding the underlying mechanisms by which mercury exposures are translated into biological effects remains incomplete. DNA methylation is an epigenetic modification that is sensitive to environmental cues, and alterations in DNA methylation at the global level are associated with a variety of diseases. Using a liquid chromatography tandem mass spectrometry-based (LC-MS/MS) approach, global DNA methylation levels were measured in red blood cells of 144 wild American alligators (Alligator mississippiensis) from 6 sites with variable levels of mercury contamination across Florida’s north-south axis. Variation in mercury concentrations measured in whole blood was highly associated with location, allowing the comparison of global DNA methylation levels across different “treatments” of mercury. Global DNA methylation in alligators across all locations was weakly associated with increased mercury exposure. However, a much more robust relationship was observed in those animals sampled from locations more highly contaminated with mercury. Also, similar to other vertebrates, global DNA methylation appears to decline with age in alligators. The relationship between age-associated loss of global DNA methylation and varying mercury exposures was examined to reveal a potential interaction. These findings demonstrate that global DNA methylation levels are associated with mercury exposure, and give insights into interactions between contaminants, aging, and epigenetics. PMID:26748003

  7. Fluctuating water depths affect American alligator (Alligator mississippiensis) body condition in the Everglades, Florida, USA

    USGS Publications Warehouse

    Brandt, Laura A.; Beauchamp, Jeffrey S.; Jeffery, Brian M.; Cherkiss, Michael S.; Mazzotti, Frank J.


    Successful restoration of wetland ecosystems requires knowledge of wetland hydrologic patterns and an understanding of how those patterns affect wetland plant and animal populations.Within the Everglades, Florida, USA restoration, an applied science strategy including conceptual ecological models linking drivers to indicators is being used to organize current scientific understanding to support restoration efforts. A key driver of the ecosystem affecting the distribution and abundance of organisms is the timing, distribution, and volume of water flows that result in water depth patterns across the landscape. American alligators (Alligator mississippiensis) are one of the ecological indicators being used to assess Everglades restoration because they are a keystone species and integrate biological impacts of hydrological operations through all life stages. Alligator body condition (the relative fatness of an animal) is one of the metrics being used and targets have been set to allow us to track progress. We examined trends in alligator body condition using Fulton’s K over a 15 year period (2000–2014) at seven different wetland areas within the Everglades ecosystem, assessed patterns and trends relative to restoration targets, and related those trends to hydrologic variables. We developed a series of 17 a priori hypotheses that we tested with an information theoretic approach to identify which hydrologic factors affect alligator body condition. Alligator body condition was highest throughout the Everglades during the early 2000s and is approximately 5–10% lower now (2014). Values have varied by year, area, and hydrology. Body condition was positively correlated with range in water depth and fall water depth. Our top model was the “Current” model and included variables that describe current year hydrology (spring depth, fall depth, hydroperiod, range, interaction of range and fall depth, interaction of range and hydroperiod). Across all models, interaction

  8. Variations in hepatic biomarkers in American alligators (Alligator mississippiensis) from three sites in Florida, USA.


    Gunderson, Mark P; Pickett, Melissa A; Martin, Justin T; Hulse, Elizabeth J; Smith, Spenser S; Smith, Levi A; Campbell, Rachel M; Lowers, Russell H; Boggs, Ashley S P; Guillette, Louis J


    Sub-individual biomarkers are sub-lethal biological responses commonly used in the assessment of wildlife exposure to environmental contaminants. In this study, we examined the activity of glutathione-s-transferase (GST) and lactate dehydrogenase (LDH), and metallothionein (MT) concentrations among captive-raised alligator hatchlings, wild-caught juveniles, and wild-caught adults. Juveniles and adults were collected from three locations in Florida (USA) with varying degrees of contamination (i.e. Lake Apopka (organochlorine polluted site), Merritt Island National Wildlife Refuge (NWR) (metal polluted site), and Lake Woodruff NWR (reference site)). We examined whether changes in the response of these three biomarkers were age and sex dependent or reflected site-specific variations of environmental contaminants. Juvenile alligators from Merritt Island NWR had higher MT concentrations and lower GST activity compared to those from the other two sites. This outcome was consistent with higher metal pollution at this location. Sexually dimorphic patterns of MT and GST (F > M) were observed in juvenile alligators from all sites, although this pattern was not observed in adults. GST activity was lower in captive-raised alligators from Lake Apopka and Merritt Island NWR as compared to animals from Lake Woodruff NWR, suggesting a possible developmental modulator at these sites. No clear patterns were observed in LDH activity. We concluded that GST and MT demonstrate age and sex specific patterns in the alligators inhabiting these study sites and that the observed variation among sites could be due to differences in contaminant exposure. PMID:27111470

  9. Umbilical scarring in hatchling American alligators

    USGS Publications Warehouse

    Wiebe, J.J.; Sepulveda, M.S.; Buckland, J.E.; Anderson, S.R.; Gross, T.S.


    Umbilical scarring is the presence of excess scar tissue deposited between abdominal dermal layers at the site of yolk sac absorption in hatchling American alligators (Alligator mississippiensis). The presence of this dermal condition plays a key evaluatory role in the overall quality and subsequent value for various commercial leather products. Despite the prevalent nature of this condition, currently the industry has no standardized protocols for its quantification. The objectives of this study were to examine the relationship between hatchling weight and age and incidence of umbilical scarring and to develop a quantifiable and reproducible technique to measure this dermal condition in hatchling American alligators. Thirty eggs from each of nine clutches were incubated in two separate incubators at different facilities and hatchling umbilical scarring was measured at 2 and 10 days of age using digital calipers. Umbilical area was calculated by multiplying umbilical length times umbilical width. There was a significant effect of both age and clutch on umbilical area (overall decline of 64%) by 10 days post-hatch. However, only five of the nine clutches utilized expressed a noticeable decline in the size of this dermal condition (range 67-74%). We had hypothesized that larger hatchlings would have larger umbilical areas and a slower rate of improvement in this condition during the first few days post-hatch. The differences in umbilical area and percent decline with age across clutches, however, were not associated with differences in initial hatchling weights. Within clutches and time periods, hatchling weight had no significant effect on the size and/or rate of decline of this condition. ?? 2004 Published by Elsevier B.V.

  10. Healing efficacy of methanol extract of leaves of Alternanthera brasiliana Kuntze in aged wound model

    PubMed Central

    Barua, Chandana Choudhury; Begum, Shameem Ara; Sarma, Dilip Kumar; Pathak, Debesh Chandra; Borah, Rumi Saikia


    The methanol extract of Alternanthera brasiliana Kuntze (Family: Amaranthaceae) leaf was investigated for its wound healing effect by excision wound model (in vivo) in aged Sprague Dawley rats. In excision wound model, compared to the control group, percent contraction of wound was significantly (P < 0.01) higher in A. brasiliana-treated group (5% w/w ointment). The collagen, elastin, and hydroxyproline contents of the granulation tissue of A. brasiliana-treated group increased significantly (P < 0.01) compared to the control group, indicating better wound healing activity of the test plant. These findings were also confirmed by histopathological examination. The results suggested that methanol extract of A. brasiliana possesses significant wound healing potential in aged animal wound model. PMID:24826048


    NASA Technical Reports Server (NTRS)


    Harold O'Connor, manager of the Merritt Island Wildlife Refuge, watches a 10-foot-long alligator inch its way toward a busy highway at the Kennedy Space Center. O'Connor, aided by assistant Jerome Carroll, not shown, guided the large gator to safety in a nearby pond, several miles south of the Vehicle Assembly Building, in background. The Apollo 12 astronauts will be launched no earlier than November 14, 1969, from the Kennedy Space Center on the Nation's second manned lunar landing mission.

  12. American Alligator Research on the Kennedy Space Center

    NASA Technical Reports Server (NTRS)

    Lowers, Russell H.


    This slide presentation reviews the research conducted at the Kennedy Space Center on the American Alligator. The objectives of the research were to establish life history baseline at the Kennedy Space Center and at the Merit Island National Wildlife Reserve (MINWR). Some of the factors that were examined are: nesting success, movement patterns, and population structure. Another objective was to determine the overall health of the alligator population, by analyzing blood and tissue chemistry, and urine analysis. A third objective was to compare alligators at KSC/MINWR to the statewide population. Some of the results are shown in charts and graphs.

  13. Transdisciplinary weed research: new leverage on challenging weed problems?

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Transdisciplinary Weed Research (TWR) is a promising path to more effective management of challenging weed problems. We define TWR as an integrated process of inquiry and action that addresses complex weed problems in the context of broader efforts to improve economic, environmental and social aspec...

  14. Grass and weed killer poisoning


    Weedoff poisoning; Roundup poisoning ... Glyphosate is the poisonous ingredient in some weed killers. ... Glyphosate is in weed killers with these brand names: Roundup Bronco Glifonox Kleen-up Rodeo Weedoff Other ...


    EPA Science Inventory

    Many xenobiotic compounds introduced into the environment by human activity adversely affect wildlife. A number of these contaminants have been hypothesized to induce non lethal, multigenerational effects by acting as endocrine disrupting agents. One case is that of the alligator...

  16. An alligator basks in the sun at KSC.

    NASA Technical Reports Server (NTRS)


    On the bank of a levee near Schwartz Rd. at Kennedy Space Center, an alligator suns itself with a wary eye out for trespassers. Nearly 5,000 alligators can be found in canals, ponds, and waterways throughout the Center and the Merritt Island National Wildlife Refuge, which shares a boundary with the Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Wildlife Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  17. 109. Doughton Park Recreation Area. View of alligator back and ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    109. Doughton Park Recreation Area. View of alligator back and the parkway seen from bluff mountain. Looking west. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  18. Persistent Organochlorine Pesticides and their Metabolites in Alligator Livers from Lakes Apopka and Woodruff, Florida, USA

    EPA Science Inventory

    Reproductive disorders in American alligators (Alligator mississippiensis) inhabiting Lake Apopka, Florida, have been observed for several years. Such disorders are hypothesized to be caused by endocrine disrupting contaminants occurring in the Lake due to pesticide spills and ...

  19. Population status of the American alligator on the Savannah River Plant, South Carolina

    SciTech Connect

    Murphy, T.M.


    Estimates are presented of alligator numbers, size distribution, sex ratios, reproductive effort, and population trends for all major components of the entire Savannah River Plant (SRP) alligator population. Savannah River Plant operations have impacted the alligator population in many different ways. The formation of man-made reservoirs has dramatically increased the amount of aquatic habitat available to alligators and has therefore increased the carrying capacity of the SRP site for this species. The thermal alteration of aquatic habitats on the SRP has also impacted the resident alligator population. Temperature elevations of aquatic habitat to greater than 38/sup 0/C result in the loss of this habitat to alligators. Moderate thermal increases on the other hand are responded to by alligator movement. The current information available on the alligators of the SRP suggests the following future trends: low density populations distant from thermally altered areas will continue at a low density with the exception of localized increases.

  20. Ecological studies on the American alligator (Alligator mississippiensis) on the Savannah River Plant. Comprehensive Cooling Water Study: Final report

    SciTech Connect

    Seigel, R.A.; Brandt, L.A.; Knight, J.L.; Novak, S.S.


    The American alligator (Alligator mississippiensis) is the largest vertebrate of the Savannah River Plant (SRP), reaching a maximum length of 3.7 meters (12 feet) and weighing up to 175 kg (385 pounds). Currently, populations in coastal South Carolina are considered Threatened, whereas populations in inland areas (such as the SRP) are still Endangered. Because of their legal status and economic and ecological importance, it is important to determine the environmental impacts of SRP operations on the local alligator population. The major objectives under the Endangered Species Program of the Comprehensive Cooling Water Study (CCWS) were as follows: (1) document and compare the present status and distribution of alligators on the SRP to previous surveys, in order to determine long-term changes in population abundance; (2) establish baseline population and ecological parameters of the Steel Creek population so that the ecological effects of L-Reactor operations can be determined, and (3) conduct ecological research on the immediate impacts of thermal effluents on American alligators. Gladden et al., (1985) summarized data on previous population surveys, temporal changes in the Par Pond population, preliminary results of the Steel Creek surveys and Savannah River Ecology Laboratory (SREL) research on the effects of thermal effluents. This report summarizes the current status of the SRP population, presents data on the abundance, movement patterns and activity cycles of the Steel Creek population, and presents additional data on the effect of cooling water releases on alligator ecology and behavior.

  1. Unidirectional airflow in the lungs of alligators.


    Farmer, C G; Sanders, Kent


    The lungs of birds move air in only one direction during both inspiration and expiration through most of the tubular gas-exchanging bronchi (parabronchi), whereas in the lungs of mammals and presumably other vertebrates, air moves tidally into and out of terminal gas-exchange structures, which are cul-de-sacs. Unidirectional flow purportedly depends on bellowslike ventilation by air sacs and may have evolved to meet the high aerobic demands of sustained flight. Here, we show that air flows unidirectionally through parabronchi in the lungs of the American alligator, an amphibious ectotherm without air sacs, which suggests that this pattern dates back to the basal archosaurs of the Triassic and may have been present in their nondinosaur descendants (phytosaurs, aetosaurs, rauisuchians, crocodylomorphs, and pterosaurs) as well as in dinosaurs. PMID:20075253

  2. Controlling Landscape Weeds.

    ERIC Educational Resources Information Center

    Nuss, James Robert, Jr.

    This agriculture extension service publication from Pennsylvania State University discusses the control of common grass and broadleaf weeds through the use of mulches and herbicides. The section on mulches discusses the different types of mulching materials, their advantages and disadvantages, herbicide-mulch combinations, and lists source of…

  3. A Weed Cantilever

    ERIC Educational Resources Information Center

    Keller, Elhannan L.; Padalino, John


    Describes the Environmental Action Task activity, which may be used as a recreational game or an environmental perception experience, may be conducted indoors or out-of-doors, using weed stems (or spaghetti) and masking tape to construct a cantilever. Small groups of children work together to make the cantilever with the longest arm. Further…

  4. Biotechnology in weed control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biotechnology can be used to enhance the management of weeds in several ways. Crops have been made resistant to herbicides by inserting transgenes that impart herbicide resistance into the plant genome. Glyphosate and glufosinate-resistant crops are commercialized in North America and crops made res...

  5. Weed Research in Mint

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weeds present in peppermint and spearmint reduce mint oil yield and quality. Flumioxazin combinations with clomazone and pendimethalin applied to dormant peppermint controlled prickly lettuce and flixweed without significant injury to the crop. Low rates of flumioxazin and sulfentrazone applied imm...

  6. Ontogenetic development of otoliths in Alligator Gar

    USGS Publications Warehouse

    Long, James M.; Snow, Richard A.


    The Alligator Gar Atractosteus spatula is a species of conservation concern throughout its range, and better definition of otoliths during early development would aid understanding its life history and ecology. We conducted X-ray computed tomography scans, scanning electron microscopy, and light microscopy to examine the three pairs of otoliths and how they developed over time in relation to fish size and age. The sagittae are the largest, possessing distinct dorsal and ventral lobes covered with small otoconia concentrated in the sulcul region. The sagittae exhibited allometric growth, increasing more rapidly in the ventral lobe than in the dorsal. The asterisci were smaller and also exhibited small otoconia on their surface, but much less than the sagittae. The lapilli were oriented laterally, in contrast to the sagittae and asterisci, which were oriented vertically, with a hump on the dorsum and very large otoconia on the lateral surface that appeared to fuse into the main otolith as the fish grew. Based on size measurements and ring counts in all three pairs of otoliths from 101 known-age Alligator Gar sampled weekly through 91 d after hatch, we developed regression models to examine otolith growth and predict age. All relationships were significant and highly explanatory, but the strongest relationships were between otolith and fish size (for measurements from sagittae) and for age predictions from the lapillus. Age prediction models all resulted in a slope near unity, indicating that ring deposition occurred approximately daily. The first ring in sagittae and lapilli corresponded to swim-up, whereas the first ring formed in asterisci approximately 8 d after swim-up. These results fill a gap in knowledge and can aid understanding of evolutionary processes as well as provide useful information for management and conservation.

  7. Weed Identification and Control in Vegetable Crops.

    ERIC Educational Resources Information Center

    Ferretti, Peter A., Comp.

    This agriculture extension service publication from Pennsylvania State University examines weed control and identification in vegetable crops. Contents include: (1) Types of weeds; (2) Reducing losses caused by weeds, general control methods and home garden weed control; (3) How herbicides are used; (4) Specific weeds in vegetable plantings; and…



    Latré, J; Dewitte, K; Derycke, V; De Roo, B; Haesaert, G


    Integrated pest management has been implemented as a general practice by EU legislation. As weed control actually is the most important crop protection measure in maize for Western Europe, the new legislation will have its impact. The question is of course which systems can be successfully implemented in practice with respect to labour efficiency and economical parameters. During 3 successive growing seasons (2007, 2008, 2009) weed control in maize was evaluated, the main focus was put on different techniques of integrated weed control and was compared with chemical weed control. Additionally, during 4 successive growing seasons (2011, 2012, 2013 and 2014) two objects based on integrated weed control and two objects based on mechanical weed control were compared to about twenty different objects of conventional chemical weed control. One of the objects based on mechanical weed control consisted of treatment with the flex-tine harrow before and after emergence in combination with chemical weed control at a reduced rate in 3-4 leave stage. The second one consisted of broadcast mechanical treatments before and after emergence followed by a final in-row application of herbicides and an inter-row cultivation at 6-7(8) leave stage. All trials were conducted on the Experimental farm of Bottelare HoGent-UGent on a sandy loam soil. Maize was growing in 1/3 crop rotation. The effect on weed growth as well as the economic impact of the different applications was evaluated. Combining chemical and mechanical weed control is a possible option in conventional farming but the disadvantages must be taken into account. A better planned weed control based on the real present weed-population in combination with a carefully thought-out choice of herbicides should also be considered as an IPM--approach.



    Latré, J; Dewitte, K; Derycke, V; De Roo, B; Haesaert, G


    Integrated pest management has been implemented as a general practice by EU legislation. As weed control actually is the most important crop protection measure in maize for Western Europe, the new legislation will have its impact. The question is of course which systems can be successfully implemented in practice with respect to labour efficiency and economical parameters. During 3 successive growing seasons (2007, 2008, 2009) weed control in maize was evaluated, the main focus was put on different techniques of integrated weed control and was compared with chemical weed control. Additionally, during 4 successive growing seasons (2011, 2012, 2013 and 2014) two objects based on integrated weed control and two objects based on mechanical weed control were compared to about twenty different objects of conventional chemical weed control. One of the objects based on mechanical weed control consisted of treatment with the flex-tine harrow before and after emergence in combination with chemical weed control at a reduced rate in 3-4 leave stage. The second one consisted of broadcast mechanical treatments before and after emergence followed by a final in-row application of herbicides and an inter-row cultivation at 6-7(8) leave stage. All trials were conducted on the Experimental farm of Bottelare HoGent-UGent on a sandy loam soil. Maize was growing in 1/3 crop rotation. The effect on weed growth as well as the economic impact of the different applications was evaluated. Combining chemical and mechanical weed control is a possible option in conventional farming but the disadvantages must be taken into account. A better planned weed control based on the real present weed-population in combination with a carefully thought-out choice of herbicides should also be considered as an IPM--approach. PMID:27145588

  10. Morphological characteristics regulating phallic glans engorgement in the American alligator.


    Moore, Brandon C; Spears, David; Mascari, Taylor; Kelly, Diane A


    The distal part of the crocodilian phallus consists of a bulbous glans containing well-developed vascular tissues that can inflate before or during sexual activity, enlarging and elaborating the glans into a complex, though still functionally undefined, copulatory structure. An enlarged glans putatively interacts with the female cloaca and may change the shape of her reproductive tract to facilitate insemination and increase the probability of fertilization. Here, we investigated the cellular-level properties of the glans and other inflatable phallic tissues associated with the sperm-conducting sulcus spermaticus in the American alligator (Alligator mississippiensis). Using histochemical staining, we visualized and defined collagen and elastin fiber densities and orientations in these tissues. Extracellular matrix architectures provided insights about phallic glans material properties and how they may affect tissue strength and flexibility during inflation and in response to copulatory forces. We also investigated the potential sources of fluids that induce inflation in alligator phalli. Combining serial sectioning and three-dimensional reconstruction, we identified a pair of supracrucal plexus vascular bodies at the proximal end of the alligator phallus that extend distally adjacent to ventro-medial sulcus tissues. Together, our gross and histological examination of the American alligator phallic glans suggests that its tissues are arranged in a manner that would allow vascular inflation to expand the glans to a specific and repeatable shape, and potentially release secretory products into the female reproductive tract. Both elements could play roles in postcopulatory sexual selection, by mechanically and/or chemically affecting female reproductive physiology.

  11. Estimating sighting proportions of American alligator nests during helicopter survey

    USGS Publications Warehouse

    Rice, Kenneth G.; Percival, H. Franklin; Woodward, Allan R.


    Proportions of American alligator (Alligator mississippiensis) nests sighted during aerial survey in Florida were estimated based upon multiple surveys by different observers. We compared sighting proportions across habitats, nesting seasons, and observer experience levels. The mean sighting proportion across all habitats and years was 0.736 (SE=0.024). Survey counts corrected by the mean sighting proportion reliably predicted total nest counts (7?2=0.933). Sighting proportions did not differ by habitat type (P=0.668) or year P=0.328). Experienced observers detected a greater proportion of nests (P<0.0001) than did either less experienced or inexperienced observers. Reliable estimates of nest abundance can be derived from aerial counts of alligator nests when corrected by the appropriate sighting proportion.

  12. The alligator gut microbiome and implications for archosaur symbioses

    PubMed Central

    Keenan, Sarah W.; Engel, Annette Summers; Elsey, Ruth M.


    Among vertebrate gastrointestinal microbiome studies, complete representation of taxa is limited, particularly among reptiles. Here, we provide evidence for previously unrecognized host-microbiome associations along the gastrointestinal tract from the American alligator, a crown archosaur with shared ancestry to extinct taxa, including dinosaurs. Microbiome compositional variations reveal that the digestive system consists of multiple, longitudinally heterogeneous microbiomes that strongly correlate to specific gastrointestinal tract organs, regardless of rearing histories or feeding status. A core alligator gut microbiome comprised of Fusobacteria, but depleted in Bacteroidetes and Proteobacteria common to mammalians, is compositionally unique from other vertebrate gut microbiomes, including other reptiles, fish, and herbivorous and carnivorous mammals. As such, modern alligator gut microbiomes advance our understanding of archosaur gut microbiome evolution, particularly if conserved host ecology has retained archosaur-specific symbioses over geologic time. PMID:24096888

  13. The alligator gut microbiome and implications for archosaur symbioses.


    Keenan, Sarah W; Engel, Annette Summers; Elsey, Ruth M


    Among vertebrate gastrointestinal microbiome studies, complete representation of taxa is limited, particularly among reptiles. Here, we provide evidence for previously unrecognized host-microbiome associations along the gastrointestinal tract from the American alligator, a crown archosaur with shared ancestry to extinct taxa, including dinosaurs. Microbiome compositional variations reveal that the digestive system consists of multiple, longitudinally heterogeneous microbiomes that strongly correlate to specific gastrointestinal tract organs, regardless of rearing histories or feeding status. A core alligator gut microbiome comprised of Fusobacteria, but depleted in Bacteroidetes and Proteobacteria common to mammalians, is compositionally unique from other vertebrate gut microbiomes, including other reptiles, fish, and herbivorous and carnivorous mammals. As such, modern alligator gut microbiomes advance our understanding of archosaur gut microbiome evolution, particularly if conserved host ecology has retained archosaur-specific symbioses over geologic time.

  14. An examination of the sensory structures in the oral cavity of the American alligator (Alligator mississippiensis).


    Rehorek, Susan J; Duffy, Michael; Zacherl, Janelle R; Anand, Kusuma; Elsey, Ruth M; Smith, Timothy S


    The location and distribution of mucosal sensory structures of the crocodilian oral cavity are poorly understood. Although there are several descriptions of these structures in adults, nothing is known about their development. The purpose of this study was to document location, morphology, and relative abundance of these mucosal sensory structures in both hatchling and subadult alligators. Numerous mucosal sensory structures and pale staining dome-shaped papillae were observed only in the upper palate and tongue. In hatchlings, these papillae, which house either mechanoreceptive or chemosensory (taste buds) structures, were larger and more prevalent on the tongue than the upper palate. In the subadult, however, these papillae housed primarily mechanoreceptive structures and possibly degenerate taste buds. Although the presence of the mechanoreceptive structures in the palates of the suabadult alligator are to be expected, the loss of most taste buds is hitherto undocumented. Thus, there is morphological support for an ontogenetic shift in the role of the sensory palate, from a prey detection gustatory sensory system in hatchlings to a prey-manipulative mechanoreceptive system in subadults.

  15. A preliminary evaluation of antihyperglycemic and analgesic activity of Alternanthera sessilis aerial parts

    PubMed Central


    Background Alternanthera sessilis is used by folk medicinal practitioners of Bangladesh for alleviation of severe pain. The objective of this study was to scientifically analyze the analgesic (non-narcotic) property of aerial parts of the plant along with antihyperglycemic activity. Methods Antihyperglycemic activity was measured by oral glucose tolerance tests. Analgesic (non-narcotic) activity was determined by observed decreases in abdominal writhings in intraperitoneally administered acetic acid-induced pain model in mice. Results Administration of methanol extract of aerial parts led to dose-dependent and significant reductions in blood glucose levels in glucose-loaded mice. At doses of 50, 100, 200 and 400 mg per kg body weight, the extract reduced blood sugar levels by 22.9, 30.7, 45.4 and 46.1%, respectively compared to control animals. By comparison, a standard antihyperglycemic drug, glibenclamide, when administered at a dose of 10 mg per kg body weight, reduced blood glucose level by 48.9%. In analgesic activity tests, the extract at the above four doses reduced the number of abdominal writhings by 27.6, 37.9, 41.4, and 44.8%, respectively. A standard analgesic drug, aspirin, reduced the number of writhings by 31.0 and 51.7%, respectively, when administered at doses of 200 and 400 mg per kg body weight. Conclusion The results validate the folk medicinal use of the plant to alleviate pain. At the same time, the antihyperglycemic activity result suggests that the plant may be a potential source for blood sugar lowering drug(s). PMID:24885344

  16. Potential molecular wires and molecular alligator clips

    NASA Astrophysics Data System (ADS)

    Schumm, Jeffry S.; Pearson, Darren L.; Jones, LeRoy, II; Hara, Ryuichiro; Tour, James M.


    The synthesis of oligo(2-ethylphenylene-ethynylene)s, oligo(2-(0957-4484/7/4/023/img1-ethylheptyl)phenylene-ethynylene)s, and oligo(3-ethylthiophene-ethynylene)s is described via an iterative divergent convergent approach. Synthesized were the monomer, dimer, tetramer, octamer and 16-mer of the oligo(3-ethylthiophene-ethynylene)s and oligo(2-0957-4484/7/4/023/img1-ethylheptyl)phenylene-ethynylene)s. The 16-mers are 100 Å and 128 Å long, respectively. At each stage in the iteration, the length of the framework doubles. Only three sets of reaction conditions are needed for the entire iterative synthetic sequence; an iodination, a protodesilylation, and a Pd/Cu-catalyzed cross coupling. The oligomers were characterized spectroscopically and by mass spectrometry. The optical properties are presented which show the stage of optical absorbance saturation. The size exclusion chromatography values for the number average weights, relative to polystyrene, illustrate the tremendous differences in the hydrodynamic volume of these rigid rod oligomers versus the random coils of polystyrene. These differences become quite apparent at the octamer stage. The preparation of thiol-protected end groups is described. These may serve as molecular alligator clips for adhesion to gold surfaces. These oligomers may act as molecular wires in molecular electronic devices and they also serve as useful models for understanding related bulk polymers.

  17. An urban Northeastern United States alligator bite.


    Shepherd, Suzanne Moore; Shoff, William H


    Individuals who live and work in the Southeastern coastal range of the 3 US crocodilian carnivores, American alligators, American crocodiles, and caiman, understand the risks of reptile-human encounters. Individuals who live in other parts of the country maybe exposed through contact with exotic pets at private homes, small menageries, or petting zoos or from escaped or abandoned animals. During these encounters, individuals may be severely injured.Emergency medical services, law enforcement, and animal welfare workers in nonhabitat areas are usually not trained in the handling and safe removal of injured individuals from the scene when the reptile is present. The emergency management of large crocodilian injuries is similar to that of other major trauma; however, providers also must take into consideration the significant crush component potentially inflicted by the tremendous bite power and shaking inflicting during attacks by these large reptiles, appropriate antibiotic coverage for less common organisms that inhabit their mouths, and management of possible psychological distress, including posttraumatic stress disorder produced by such an unusual attack. Emergency physicians should support the development of a readily available national database of scientifically collect information on attacks to inform appropriate care and support efforts to explore responsible measures that the USDA Animal and Plant Health Inspection Service and other appropriate local, state, and federal agencies can take to ensure ethical and biologically sustainable management of our large reptiles, which also helps to ensure the safety of the public. PMID:24332253

  18. Seasonal Variation of Total Mercury Burden in the American Alligator (Alligator Mississippiensis) at Merritt Island National Wildlife Refuge (MINWR), Florida

    NASA Technical Reports Server (NTRS)

    Nilsen, Frances M.; Dorsey, Jonathan E.; Long, Stephen E.; Schock, Tracey B.; Bowden, John A.; Lowers, Russell H.; Guillette, Louis J., Jr.


    Seasonal variation of mercury (Hg) is not well studied in free-ranging wildlife. Atmospheric deposition patterns of Hg have been studied in detail and have been modeled for both global and specific locations with great accuracy and correlates to environment impact. However, monitoring these trends in wildlife is complicated due to local environmental parameters (e.g., rainfall, humidity, pH, bacterial composition) that can affect the transformation of atmospheric Hg to the biologically available forms. Here, we utilized an abundant and healthy population of American alligators (Alligator mississippiensis) at Merritt Island National Wildlife Refuge (MINWR), FL, and assessed Hg burden in whole blood samples over a span of 7 years (2007 2014; n 174) in an effort to assess seasonal variation of total [Hg]. While the majority of this population is assumed healthy, 18 individuals with low body mass indices (BMI, defined in this study) were captured throughout the 7 year sampling period. These individual alligators exhibited [Hg] that were not consistent with the observed overall seasonal [Hg] variation, and were statistically different from the healthy population of alligators. The alligators with low BMI had elevated concentrations of Hg compared to their age/sex/season matched counterparts with normal BMI. Statistically significant differences were found between the winter and spring seasons for animals with normal BMI. The data in this report supports the conclusion that organismal total [Hg] do fluctuate directly with seasonal deposition rates as well as other seasonal environmental parameters, such as average rainfall and prevailing wind direction. This study highlights the unique environment of MINWR to permit annual assessment of apex predators, such as the American alligator, to determine detailed environmental impact of contaminants of concern.

  19. Atmospheric oxygen level affects growth trajectory, cardiopulmonary allometry and metabolic rate in the American alligator (Alligator mississippiensis)

    PubMed Central

    Owerkowicz, Tomasz; Elsey, Ruth M.; Hicks, James W.


    Summary Recent palaeoatmospheric models suggest large-scale fluctuations in ambient oxygen level over the past 550 million years. To better understand how global hypoxia and hyperoxia might have affected the growth and physiology of contemporary vertebrates, we incubated eggs and raised hatchlings of the American alligator. Crocodilians are one of few vertebrate taxa that survived these global changes with distinctly conservative morphology. We maintained animals at 30°C under chronic hypoxia (12% O2), normoxia (21% O2) or hyperoxia (30% O2). At hatching, hypoxic animals were significantly smaller than their normoxic and hyperoxic siblings. Over the course of 3 months, post-hatching growth was fastest under hyperoxia and slowest under hypoxia. Hypoxia, but not hyperoxia, caused distinct scaling of major visceral organs–reduction of liver mass, enlargement of the heart and accelerated growth of lungs. When absorptive and post-absorptive metabolic rates were measured in juvenile alligators, the increase in oxygen consumption rate due to digestion/absorption of food was greatest in hyperoxic alligators and smallest in hypoxic ones. Hyperoxic alligators exhibited the lowest breathing rate and highest oxygen consumption per breath. We suggest that, despite compensatory cardiopulmonary remodelling, growth of hypoxic alligators is constrained by low atmospheric oxygen supply, which may limit their food utilisation capacity. Conversely, the combination of elevated metabolism and low cost of breathing in hyperoxic alligators allows for a greater proportion of metabolised energy to be available for growth. This suggests that growth and metabolic patterns of extinct vertebrates would have been significantly affected by changes in the atmospheric oxygen level. PMID:19376944

  20. Weed Identification Field Training Demonstrations.

    ERIC Educational Resources Information Center

    Murdock, Edward C.; And Others


    Reviews efforts undertaken in weed identification field training sessions for agriprofessionals in South Carolina. Data over a four year period (1980-1983) revealed that participants showed significant improvement in their ability to identify weeds. Reaffirms the value of the field demonstration technique. (ML)

  1. Organic weed control in watermelons

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Integrated pest management (IPM) is an essential element for certified organic crop production and producers place weed control as their highest research priority within their IPM programs. The objective of these experiments was to investigate the impact of integrated organic weed control systems o...

  2. Estimating trends in alligator populations from nightlight survey data

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, F.J.; Dorazio, R.M.; Rice, K.G.; Cherkiss, M.; Jeffery, B.


    Nightlight surveys are commonly used to evaluate status and trends of crocodilian populations, but imperfect detection caused by survey- and location-specific factors makes it difficult to draw population inferences accurately from uncorrected data. We used a two-stage hierarchical model comprising population abundance and detection probability to examine recent abundance trends of American alligators (Alligator mississippiensis) in subareas of Everglades wetlands in Florida using nightlight survey data. During 2001-2008, there were declining trends in abundance of small and/or medium sized animals in a majority of subareas, whereas abundance of large sized animals had either demonstrated an increased or unclear trend. For small and large sized class animals, estimated detection probability declined as water depth increased. Detection probability of small animals was much lower than for larger size classes. The declining trend of smaller alligators may reflect a natural population response to the fluctuating environment of Everglades wetlands under modified hydrology. It may have negative implications for the future of alligator populations in this region, particularly if habitat conditions do not favor recruitment of offspring in the near term. Our study provides a foundation to improve inferences made from nightlight surveys of other crocodilian populations. ?? 2011 US Government.

  3. Estimating trends in alligator populations from nightlight survey data

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, Frank J.; Dorazio, Robert M.; Rice, Kenneth G.; Cherkiss, Michael; Jeffery, Brian


    Nightlight surveys are commonly used to evaluate status and trends of crocodilian populations, but imperfect detection caused by survey- and location-specific factors makes it difficult to draw population inferences accurately from uncorrected data. We used a two-stage hierarchical model comprising population abundance and detection probability to examine recent abundance trends of American alligators (Alligator mississippiensis) in subareas of Everglades wetlands in Florida using nightlight survey data. During 2001–2008, there were declining trends in abundance of small and/or medium sized animals in a majority of subareas, whereas abundance of large sized animals had either demonstrated an increased or unclear trend. For small and large sized class animals, estimated detection probability declined as water depth increased. Detection probability of small animals was much lower than for larger size classes. The declining trend of smaller alligators may reflect a natural population response to the fluctuating environment of Everglades wetlands under modified hydrology. It may have negative implications for the future of alligator populations in this region, particularly if habitat conditions do not favor recruitment of offspring in the near term. Our study provides a foundation to improve inferences made from nightlight surveys of other crocodilian populations.

  4. Evaluating recent taxonomic changes for alligator snapping turtles (Testudines: Chelydridae).


    Folt, Brian; Guyer, Craig


    The Alligator Snapping Turtle (Macrochelys temminckii Troost in Harlan 1835, sensu lato) has been historically treated as a single, wide-ranging species, until a recently published paper by Thomas et al. (2014; hereafter Thomas et al.) analyzed variation in morphology and mitochondrial DNA sequence data to describe two new species of Macrochelys: the Apalachicola Alligator Snapping Turtle (Macrochelys apalachicolae Thomas, Granatosky, Bourque, Krysko, Moler, Gamble, Suarez, Leone & Roman 2014) and the Suwannee Alligator Snapping Turtle (Macrochelys suwanniensis Thomas, Granatosky, Bourque, Krysko, Moler, Gamble, Suarez, Leone & Roman 2014). The specific epithet temminckii was retained for populations in drainages from the Yellow River in Alabama and Florida west to the San Antonio River, Texas. Because populations of Macrochelys have been historically exploited by humans (Pritchard 1989) and the life-history strategies of large, long-lived turtles make them susceptible to declines from harvest (Congdon et al. 1994), a sound understanding of species delimitation and richness is critical for the conservation of alligator snapping turtles, especially if the acceptance of a widely distributed species disguises the presence of multiple, smaller-ranged species. PMID:25947748

  5. Alligators and crocodiles as indicators for restoration of Everglades ecosystems

    USGS Publications Warehouse

    Mazzotti, Frank J.; Best, G. Ronnie; Brandt, Laura A.; Cherkiss, Michael S.; Jeffery, Brian M.; Rice, Kenneth G.


    Alligators and crocodiles integrate biological impacts of hydrological operations, affecting them at all life stages through three key aspects of Everglades ecology: (1) food webs, (2) diversity and productivity, and (3) freshwater flow. Responses of crocodilians are directly related to suitability of environmental conditions and hydrologic change. Correlations between biological responses and environmental conditions contribute to an understanding of species' status and trends over time. Positive or negative trends of crocodilian populations relative to hydrologic changes permit assessment of positive or negative trends in restoration. The crocodilian indicator uses monitoring parameters (performance measures) that have been shown to be both effective and efficient in tracking trends. The alligator component uses relative density (reported as an encounter rate), body condition, and occupancy rates of alligator holes; the crocodile component uses juvenile growth and hatchling survival. We hypothesize that these parameters are correlated with hydrologic conditions including depth, duration, timing, spatial extent and water quality. Salinity is a critical parameter in estuarine habitats. Assessments of parameters defined for crocodilian performance measures support these hypotheses. Alligators and crocodiles are the charismatic megafauna of the Everglades. They are both keystone and flagship species to which the public can relate. In addition, the parameters used to track trends are easy to understand. They provide answers to the following questions: How has the number of alligators or crocodiles changed? Are the animals fatter or thinner than they should be? Are the animals in the places (in terms of habitat and geography) where they should be? As surely as there is no other Everglades, no other single species defines the Everglades as does the American alligator. The Everglades is the only place in the world where both alligators and crocodiles exist. Crocodilians

  6. Concentrations of trace elements in American alligators (Alligator mississippiensis) from Florida, USA.


    Horai, Sawako; Itai, Takaaki; Noguchi, Takako; Yasuda, Yusuke; Adachi, Haruki; Hyobu, Yuika; Riyadi, Adi S; Boggs, Ashley S P; Lowers, Russell; Guillette, Louis J; Tanabe, Shinsuke


    Concentrations of 28 trace elements (Li, Mg, Al, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, Mo, Ag, Cd, In, Sn, Sb, Cs, Tl, Hg, Pb, and Bi) in the livers of juvenile and adult American alligators inhabiting two central Florida lakes, Lake Apopka (LA), and Lake Woodruff National Wildlife Refuge (LW) and one lagoon population located in Merritt Island National Wildlife Refuge (MINWR; NASA), were determined. In juveniles from MINWR, concentrations of nine elements (Li, Fe, Ni, Sr, In, Sb, Hg, Pb and Bi) were significantly higher, whereas six elements (V, Fe, As, Sr, Hg and Bi) were elevated in adults (p<0.05) obtained from MINWR. Significant enrichment of some trace elements in adults, relative to juveniles, was observed at all three sampling areas. Specifically, Fe, Pb and Hg were significantly elevated in adults when compared to juveniles, suggesting age-dependent accumulation of these elements. Further, As, Se and Sn showed the same trend but only in animals collected from MINWR. Mean Fe concentrations in the livers of adults from LA, LW and MINWR were 1770 μg g(-1) DW, 3690 μg g(-1) DW and 5250 μg g(-1) DW, respectively. More than half of the adult specimens from LW and MINWR exhibited elevated hepatic Fe concentrations that exceed the threshold value for toxic effects in donkey, red deer and human. These results prompted us to express our concern on possible exposure and health effects in American alligators by some trace elements derived from NASA activities. PMID:24698170

  7. Ultrastructure of spermiogenesis in the American alligator, Alligator mississippiensis (Reptilia, Crocodylia, Alligatoridae).


    Gribbins, Kevin M; Siegel, Dustin S; Anzalone, Marla L; Jackson, Daniel P; Venable, Katherine J; Rheubert, Justin L; Elsey, Ruth M


    Testicular samples were collected to describe the ultrastructure of spermiogenisis in Alligator mississipiensis (American Alligator). Spermiogenesis commences with an acrosome vesicle forming from Golgi transport vesicles. An acrosome granule forms during vesicle contact with the nucleus, and remains posterior until mid to late elongation when it diffuses uniformly throughout the acrosomal lumen. The nucleus has uniform diffuse chromatin with small indices of heterochromatin, and the condensation of DNA is granular. The subacrosome space develops early, enlarges during elongation, and accumulates a thick layer of dark staining granules. Once the acrosome has completed its development, the nucleus of the early elongating spermatid becomes associated with the cell membrane flattening the acrosome vesicle on the apical surface of the nucleus, which aids in the migration of the acrosomal shoulders laterally. One endonuclear canal is present where the perforatorium resides. A prominent longitudinal manchette is associated with the nuclei of late elongating spermatids, and less numerous circular microtubules are observed close to the acrosome complex. The microtubule doublets of the midpiece axoneme are surrounded by a layer of dense staining granular material. The mitochondria of the midpiece abut the proximal centriole resulting in a very short neck region, and possess tubular cristae internally and concentric layers of cristae superficially. A fibrous sheath surrounds only the axoneme of the principal piece. Characters not previously described during spermiogenesis in any other amniote are observed and include (1) an endoplasmic reticulum cap during early acrosome development, (2) a concentric ring of endoplasmic reticulum around the nucleus of early to middle elongating spermatids, (3) a band of endoplasmic reticulum around the acrosome complex of late developing elongate spermatids, and (4) midpiece mitochondria that have both tubular and concentric layers of

  8. Concentrations of trace elements in American alligators (Alligator mississippiensis) from Florida, USA.


    Horai, Sawako; Itai, Takaaki; Noguchi, Takako; Yasuda, Yusuke; Adachi, Haruki; Hyobu, Yuika; Riyadi, Adi S; Boggs, Ashley S P; Lowers, Russell; Guillette, Louis J; Tanabe, Shinsuke


    Concentrations of 28 trace elements (Li, Mg, Al, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, Mo, Ag, Cd, In, Sn, Sb, Cs, Tl, Hg, Pb, and Bi) in the livers of juvenile and adult American alligators inhabiting two central Florida lakes, Lake Apopka (LA), and Lake Woodruff National Wildlife Refuge (LW) and one lagoon population located in Merritt Island National Wildlife Refuge (MINWR; NASA), were determined. In juveniles from MINWR, concentrations of nine elements (Li, Fe, Ni, Sr, In, Sb, Hg, Pb and Bi) were significantly higher, whereas six elements (V, Fe, As, Sr, Hg and Bi) were elevated in adults (p<0.05) obtained from MINWR. Significant enrichment of some trace elements in adults, relative to juveniles, was observed at all three sampling areas. Specifically, Fe, Pb and Hg were significantly elevated in adults when compared to juveniles, suggesting age-dependent accumulation of these elements. Further, As, Se and Sn showed the same trend but only in animals collected from MINWR. Mean Fe concentrations in the livers of adults from LA, LW and MINWR were 1770 μg g(-1) DW, 3690 μg g(-1) DW and 5250 μg g(-1) DW, respectively. More than half of the adult specimens from LW and MINWR exhibited elevated hepatic Fe concentrations that exceed the threshold value for toxic effects in donkey, red deer and human. These results prompted us to express our concern on possible exposure and health effects in American alligators by some trace elements derived from NASA activities.

  9. 7 CFR 201.15 - Weed seeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  10. 7 CFR 201.15 - Weed seeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  11. 7 CFR 201.15 - Weed seeds.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  12. Weeding the School Library Media Collection.

    ERIC Educational Resources Information Center

    School Library Media Quarterly, 1984


    This document prepared by Calgary Board of Education, Calgary, Alberta, Canada, discusses a systematic approach to strengthening the library media collection. A statement of principle, what to weed, specific guides to weeding (by Dewey Decimal classification and type of material), what not to weed, procedures, and weeding follow-up are…

  13. 7 CFR 201.50 - Weed seed.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules...

  14. 7 CFR 201.15 - Weed seeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  15. 7 CFR 201.50 - Weed seed.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules...

  16. Applicator Training Manual for: Aquatic Weed Control.

    ERIC Educational Resources Information Center

    Herron, James W.

    The aquatic weeds discussed in this manual include algae, floating weeds, emersed weeds, and submerged weeds. Specific requirements for pesticide application are given for static water, limited flow, and moving water situations. Secondary effects of improper application rates and faulty application are described. Finally, techniques of limited…

  17. 7 CFR 201.50 - Weed seed.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules...

  18. 7 CFR 201.50 - Weed seed.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules...

  19. 7 CFR 201.50 - Weed seed.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Weed seed. 201.50 Section 201.50 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or tubers) of plants shall be considered weed seeds when recognized as weed seeds by the law or rules...

  20. 7 CFR 201.15 - Weed seeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  1. A new perspective with weed management

    Technology Transfer Automated Retrieval System (TEKTRAN)

    No-till cropping systems are increasing land productivity. Herbicides are a crucial tool for weed management in no-till, but weed resistance is decreasing control efficacy and increasing input costs. Producers are seeking a broader perspective with weed management. One approach is to disrupt weed...

  2. Sex-steroid and thyroid hormone concentrations in juvenile alligators (Alligator mississippiensis) from contaminated and reference lakes in Florida, USA

    USGS Publications Warehouse

    Grain, D.A.; Guillette, L.J.; Pickford, D.B.; Percival, H.F.; Woodward, A.R.


    Sex-steroid and thyroid hormones are critical regulators of growth and reproduction in all vertebrates, and several recent studies suggest that environmental chemicals can alter circulating concentrations of these hormones. This study examines plasma concentrations of estradiol-171?? (E2), testosterone (T), triiodothyronine (T3), and thyroxine (T4) in juvenile alligators (60-140 cm total length) from two contaminated lakes and one reference lake in Florida. First, the data were analyzed by comparing hormone concentrations among males and females from the different lakes. Whereas there were no differences in plasma E2 concentrations among animals of the three lakes, male alligators from the contaminated lakes (Lake Apopka and Lake Okeechobee) had significantly lower plasma T concentrations compared 10 males from the reference take (Lake Woodruff). Concentrations of thyroid hormones also differed in animals of the three lakes, with T4 concentrations being elevated in Lake Okeechobee males compared to Lake Woodruff males. Second, the relationship between body size and hormone concentration was examined using regression analysis. Most notably for steroid hormones, no clear relationship was detected between E2 and total length in Apopka females (r2 0.09, p = 0.54) or between T and total length in Apopka males (r2 = 0.007, p = 0.75). Females from Apopka (r2 = 0.318, p = 0.09) and Okeechobee (r2 = 0.222, p = 0.09) exhibited weak correlations between T3 and total length. Males from Apopka (r2 = 0.015, p = 0.66) and Okeechobee (r2 = 0.128, p = 0.19) showed no correlation between T4 and total length. These results indicate: some of the previously reported abnormalities in steroid hormones of hatchling alligators persist, at least, through the juvenile years; steroid and thyroid hormones are related to body size in juvenile alligators from the reference lake, whereas alligators living in lakes Apopka and Okeechobee experience alterations in circulating thyroid and steroid

  3. Spatial and temporal variability in estuary habitat use by American alligators

    USGS Publications Warehouse

    Fujisaki, Ikuko; Hart, Kristen M.; Cherkiss, Michael S.; Mazzotti, Frank J.; Beauchamp, Jeffrey S.; Jeffery, Brian M.; Brandt, Laura A.


    Estuarine habitat occupied by Alligator mississippiensis, a primarily freshwater species, is spatially and temporally heterogeneous largely due to a salinity gradient that fluctuates. Using long-term night light survey data, we examined seasonal patterns in alligators’ habitat use by size classes in midstream and downstream estuary zones of Shark River, Everglades National Park, in southern Florida. We observed predominantly large-sized alligators (total length ≥ 1.75 m); observations of alligators in the small size classes (0.5 m ≤ total length < 1.25 m) were rare especially in the higher-salinity downstream zone. The density of alligators in the downstream zone was lower than that of the midstream zone during the dry season when salinity increases due to reduced precipitation. Conversely, the density of the large size alligators was higher in the downstream zone than in the midstream zone during the wet season, likely because of reduced salinity. We also found a significant declining trend over time in the number of alligators in the dry season, which coincides with the reported decline in alligator relative density in southern Florida freshwater wetlands. Our results indicated high adaptability of alligators to the fluctuating habitat conditions. Use of estuaries by alligators is likely driven in part by physiology and possibly by reproductive cycle, and our results supported their opportunistic use of estuary habitat and ontogenetic niche shifts.

  4. Biology of weed pollen allergens.


    Gadermaier, Gabriele; Dedic, Azra; Obermeyer, Gerhard; Frank, Susanne; Himly, Martin; Ferreira, Fatima


    Weeds represent a heterogeneous group of plants, usually defined by no commercial or aesthetic value. Important allergenic weeds belong to the plant families Asteraceae, Amaranthaceae, Urticaceae, Euphorbiaceae, and Plantaginaceae. Major allergens from ragweed, mugwort, feverfew, pellitory, goosefoot, Russian thistle, plantain, and Mercurialis pollen have been characterized to varying degrees. Four major families of proteins seem to be the major cause of allergic reactions to weed pollen: the ragweed Amb a 1 family of pectate lyases; the defensin-like Art v 1 family from mugwort, feverfew, and probably also from sunflower; the Ole e 1-like allergens Pla l 1 from plantain and Che a 1 from goosefoot; and the nonspecific lipid transfer proteins Par j 1 and Par j 2 from pellitory. As described for other pollens, weed pollen also contains the panallergens profilin and calcium-binding proteins, which are responsible for extensive cross-reactivity among pollen-sensitized patients.

  5. Green synthesis of silver nanoparticles using Alternanthera dentata leaf extract at room temperature and their antimicrobial activity

    NASA Astrophysics Data System (ADS)

    Kumar, Deenadayalan Ashok; Palanichamy, V.; Roopan, Selvaraj Mohana


    A green rapid biogenic synthesis of silver nanoparticles AgNPs using Alternanthera dentata (A. dentata) aqueous extract was demonstrated in this present study. The formation of silver nanoparticles was confirmed by Surface Plasmon Resonance (SPR) at 430 nm using UV-visible spectrophotometer. The reduction of silver ions to silver nanoparticles by A. dentata extract was completed within 10 min. Synthesized nanoparticles were characterized using UV-visible spectroscopy; Fourier transformed infrared spectroscopy (FT-IR), X-ray diffraction (XRD), scanning electron microscopy and transmission electron microscopy (TEM). The extracellular silver nanoparticles synthesis by aqueous leaf extract demonstrates rapid, simple and inexpensive method comparable to chemical and microbial methods. The colloidal solution of silver nanoparticles were found to exhibit antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumonia and, Enterococcus faecalis.

  6. The growth response of Alternanthera philoxeroides in a simulated post-combustion emission with ultrahigh [CO2] and acidic pollutants.


    Xu, Cheng-Yuan; Griffin, Kevin L; Blazier, John C; Craig, Elizabeth C; Gilbert, Dominique S; Sritrairat, Sanpisa; Anderson, O Roger; Castaldi, Marco J; Beaumont, Larry


    Although post-combustion emissions from power plants are a major source of air pollution, they contain excess CO2 that could be used to fertilize commercial greenhouses and stimulate plant growth. We addressed the combined effects of ultrahigh [CO2] and acidic pollutants in flue gas on the growth of Alternanthera philoxeroides. When acidic pollutants were excluded, the biomass yield of A. philoxeroides saturated near 2000 micromol mol(-1) [CO2] with doubled biomass accumulation relative to the ambient control. The growth enhancement was maintained at 5000 micromol mol(-1) [CO2], but declined when [CO2] rose above 1%, in association with a strong photosynthetic inhibition. Although acidic components (SO2 and NO2) significantly offset the CO2 enhancement, the aboveground yield increased considerably when the concentration of pollutants was moderate (200 times dilution). Our results indicate that using excess CO2 from the power plant emissions to optimize growth in commercial green house could be viable.

  7. Can Global Weed Assemblages Be Used to Predict Future Weeds?

    PubMed Central

    Morin, Louise; Paini, Dean R.; Randall, Roderick P.


    Predicting which plant taxa are more likely to become weeds in a region presents significant challenges to both researchers and government agencies. Often it is done in a qualitative or semi-quantitative way. In this study, we explored the potential of using the quantitative self-organising map (SOM) approach to analyse global weed assemblages and estimate likelihoods of plant taxa becoming weeds before and after they have been moved to a new region. The SOM approach examines plant taxa associations by analysing where a taxon is recorded as a weed and what other taxa are recorded as weeds in those regions. The dataset analysed was extracted from a pre-existing, extensive worldwide database of plant taxa recorded as weeds or other related status and, following reformatting, included 187 regions and 6690 plant taxa. To assess the value of the SOM approach we selected Australia as a case study. We found that the key and most important limitation in using such analytical approach lies with the dataset used. The classification of a taxon as a weed in the literature is not often based on actual data that document the economic, environmental and/or social impact of the taxon, but mostly based on human perceptions that the taxon is troublesome or simply not wanted in a particular situation. The adoption of consistent and objective criteria that incorporate a standardized approach for impact assessment of plant taxa will be necessary to develop a new global database suitable to make predictions regarding weediness using methods like SOM. It may however, be more realistic to opt for a classification system that focuses on the invasive characteristics of plant taxa without any inference to impacts, which to be defined would require some level of research to avoid bias from human perceptions and value systems. PMID:23393591

  8. Survival of young American alligators on a Florida lake

    USGS Publications Warehouse

    Woodward, A.R.; Hines, T.C.; Abercrombie, C.L.; Nichols, J.D.


    A capture-recapture study was conducted on Orange Lake, Florida, from 1979 through 1984 to estimate survival rates of young in an American alligator (Alligator mississippiensis) populations. Hatchlings remained together in sibling groups (pods) for at least their 1st year and then began to disperse during their 2nd spring and summer. Mortality through mid-November of their 1st year was negligible. Jolly-Seber (JS) survival estimates of hatchlings for 6 and 12 months were 76 and 41%, respectively. The 2-year JS estimate for the 1980 cohort was 8%. Minimum-Known-Alive (MKA) survival values were 72 and 46% of JS estimates for 6 months and 1 year of age. Survival during the 2nd 6 months of life (spring-summer) tended to be lower than survival during the 1st 6 months (fall-winter).

  9. A new alligator-clip compound for molecular electronics

    NASA Astrophysics Data System (ADS)

    Jacob, Timo; Blanco, Mario; Goddard, William A.


    We used the B3LYP flavor of density functional calculations to study new alligator-clip compounds for molecular electronics with platinum electrodes. First, with commonly used S-based linkage molecule 3-methyl-1,2-dithiolane (MDTL) we find that after chemisorption on Pt(1 1 1) the most stable structure is ring-opened with a binding energy of 32.44 kcal/mol. Among several alternative alligator-clip compounds we find that P-based molecules lead to much higher binding energies. For the ring-closed structure of 3-methyl-1,2-diphospholane (MDPL) a binding energy of 47.72 kcal/mol was calculated and even 54.88 kcal/mol for the ring-opened molecule. Thus, MDPL provides a more stable link to the metal surface and might increase the conductance.

  10. Barrier cells in gills of the alligator gar.


    Henderson, V


    Studies of barrier cells in fishes are few and have been restricted primarily to salmonids. Moreover, these studies revealed the presence of barrier cells only in hematopoietic and lymphoid organs. The alligator gar, Lepisosteus spatula, possesses similar tissues within the gills which are readily accessible; therefore, they were the organs of choice. An electron microscopical analysis of the gills was undertaken to determine if barrier cells exist and if they possess an ultrastructural design comparable to their counterparts in the brain and lungs of higher vertebrates and hematopoietic/lymphoid tissues in fishes. The present study revealed that barrier cells were found only within non-hematopoietic/lymphoid areas. Barrier cells surrounded endocrine components, nerves, and sinusoids rather than capillary endothelium or hematopoietic/lymphoid tissues. Barrier cells in the alligator gar displayed a complex envelopment more similar to those found in the blood-cerebrospinal fluid, blood-brain, and blood-gas barriers in higher vertebrates than in salmonids. The barrier in the alligator gar consisted of: (1) an endothelium whose cells displayed tight junctions; (2) a basement membrane; and (3) an outer adventitia composed of fibrocytic cells in syncytium. PMID:18627869

  11. Barrier cells in gills of the alligator gar.


    Henderson, V


    Studies of barrier cells in fishes are few and have been restricted primarily to salmonids. Moreover, these studies revealed the presence of barrier cells only in hematopoietic and lymphoid organs. The alligator gar, Lepisosteus spatula, possesses similar tissues within the gills which are readily accessible; therefore, they were the organs of choice. An electron microscopical analysis of the gills was undertaken to determine if barrier cells exist and if they possess an ultrastructural design comparable to their counterparts in the brain and lungs of higher vertebrates and hematopoietic/lymphoid tissues in fishes. The present study revealed that barrier cells were found only within non-hematopoietic/lymphoid areas. Barrier cells surrounded endocrine components, nerves, and sinusoids rather than capillary endothelium or hematopoietic/lymphoid tissues. Barrier cells in the alligator gar displayed a complex envelopment more similar to those found in the blood-cerebrospinal fluid, blood-brain, and blood-gas barriers in higher vertebrates than in salmonids. The barrier in the alligator gar consisted of: (1) an endothelium whose cells displayed tight junctions; (2) a basement membrane; and (3) an outer adventitia composed of fibrocytic cells in syncytium.

  12. Mathematical models for growth in alligator (Alligator mississippiensis) embryos developing at different incubation temperatures.

    PubMed Central

    Bardsley, W G; Ackerman, R A; Bukhari, N A; Deeming, D C; Ferguson, M W


    A variety of model-based (growth models) and model-free (cubic splines, exponentials) equations were fitted using weighted-nonlinear least squares regression to embryonic growth data from Alligator mississippiensis eggs incubated at 30 and 33 degrees C. Goodness of fit was estimated using a chi 2 on the sum of squared, weighted residuals, and run and sign tests on the residuals. One of the growth models used (Preece & Baines, 1978) was found to be superior to the classical growth models (exponential, monomolecular, logistic, Gompertz, von Bertalanffy) and gave an adequate fit to all longitudinal measures taken from the embryonic body and embryonic mass. However, measurements taken from the head could not be fitted by growth models but were adequately fitted by weighted least squares cubic splines. Data for the stage of development were best fitted by a sum of 2 exponentials with a transition point. Comparison of the maximum growth rates and parameter values, indicated that the growth data at 30 degrees C could be scaled to 33 degrees C to multiplying the time by a scaling factor of 1.2. This is equivalent to a Q10 of about 1.86 or, after solving the Arrhenius equation, an E++ of 46.9 kJmol-1. This may be interpreted as indicating a common rate-limiting step in development at the 2 temperatures. PMID:7591979


    NASA Technical Reports Server (NTRS)


    A 12-foot alligator worked his way up from the turn basin at Press Site 39 to the grandstand seats. The toothy reptile was later wrangled by wildlife trappers who relocated him to a less populated area on KSC. The alligator is one of approximately 4,000 on KSC/Merritt Island National Wildlife Refuge.


    EPA Science Inventory

    Previous studies have reported a number of physiological differences among juvenile alligators from two well-studied populations (Lake Apopka and Lake Woodruff) in north central Florida. These studies obtained alligators of similar size from each lake under the assumption that th...

  15. Biomonitoring Heavy Metal Pollution Using an Aquatic Apex Predator, the American Alligator, and Its Parasites

    PubMed Central

    Tellez, Marisa; Merchant, Mark


    Monitoring the bioaccumulation of chemical elements within various organismal tissues has become a useful tool to survey current or chronic levels of heavy metal exposure within an environment. In this study, we compared the bioaccumulations of As, Cd, Cu, Fe, Pb, Se, and Zn between the American alligator, Alligator mississippiensis, and its parasites in order to establish their use as bioindicators of heavy metal pollution. Concomitant with these results, we were interested to determine if parasites were more sensitive bioindicators of heavy metals relative to alligators. We found parasites collectively accumulated higher levels of As, Cu, Se, and Zn in comparison to their alligator hosts, whereas Fe, Cd, and Pb concentrations were higher in alligators. Interestingly, Fe levels were significantly greater in intestinal trematodes than their alligator hosts when analyzed independently from other parasitic taxa. Further analyses showed alligator intestinal trematodes concentrated As, Cu, Fe, Se, and Zn at significantly higher levels than intestinal nematodes and parasites from other organs. However, pentastomids also employed the role as a good biomagnifier of As. Interestingly, parasitic abundance decreased as levels of As increased. Stomach and intestinal nematodes were the poorest bioaccumulators of metals, yet stomach nematodes showed their ability to concentrate Pb at orders of magnitude higher in comparison to other parasites. Conclusively, we suggest that parasites, particularly intestinal trematodes, are superior biomagnifiers of As, Cu, Se, and Zn, whereas alligators are likely good biological indicators of Fe, Cd, and Pb levels within the environment. PMID:26555363

  16. Biomonitoring Heavy Metal Pollution Using an Aquatic Apex Predator, the American Alligator, and Its Parasites.


    Tellez, Marisa; Merchant, Mark


    Monitoring the bioaccumulation of chemical elements within various organismal tissues has become a useful tool to survey current or chronic levels of heavy metal exposure within an environment. In this study, we compared the bioaccumulations of As, Cd, Cu, Fe, Pb, Se, and Zn between the American alligator, Alligator mississippiensis, and its parasites in order to establish their use as bioindicators of heavy metal pollution. Concomitant with these results, we were interested to determine if parasites were more sensitive bioindicators of heavy metals relative to alligators. We found parasites collectively accumulated higher levels of As, Cu, Se, and Zn in comparison to their alligator hosts, whereas Fe, Cd, and Pb concentrations were higher in alligators. Interestingly, Fe levels were significantly greater in intestinal trematodes than their alligator hosts when analyzed independently from other parasitic taxa. Further analyses showed alligator intestinal trematodes concentrated As, Cu, Fe, Se, and Zn at significantly higher levels than intestinal nematodes and parasites from other organs. However, pentastomids also employed the role as a good biomagnifier of As. Interestingly, parasitic abundance decreased as levels of As increased. Stomach and intestinal nematodes were the poorest bioaccumulators of metals, yet stomach nematodes showed their ability to concentrate Pb at orders of magnitude higher in comparison to other parasites. Conclusively, we suggest that parasites, particularly intestinal trematodes, are superior biomagnifiers of As, Cu, Se, and Zn, whereas alligators are likely good biological indicators of Fe, Cd, and Pb levels within the environment. PMID:26555363

  17. 33 CFR 165.T05-0091 - Safety Zone; Alligator River, NC.

    Code of Federal Regulations, 2010 CFR


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Alligator River, NC... SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS... Safety Zone; Alligator River, NC. (a) Definitions. For the purposes of this section, Captain of the...

  18. Evolutionary-thinking in agricultural weed management.


    Neve, Paul; Vila-Aiub, Martin; Roux, Fabrice


    Agricultural weeds evolve in response to crop cultivation. Nevertheless, the central importance of evolutionary ecology for understanding weed invasion, persistence and management in agroecosystems is not widely acknowledged. This paper calls for more evolutionarily-enlightened weed management, in which management principles are informed by evolutionary biology to prevent or minimize weed adaptation and spread. As a first step, a greater knowledge of the extent, structure and significance of genetic variation within and between weed populations is required to fully assess the potential for weed adaptation. The evolution of resistance to herbicides is a classic example of weed adaptation. Even here, most research focuses on describing the physiological and molecular basis of resistance, rather than conducting studies to better understand the evolutionary dynamics of selection for resistance. We suggest approaches to increase the application of evolutionary-thinking to herbicide resistance research. Weed population dynamics models are increasingly important tools in weed management, yet these models often ignore intrapopulation and interpopulation variability, neglecting the potential for weed adaptation in response to management. Future agricultural weed management can benefit from greater integration of ecological and evolutionary principles to predict the long-term responses of weed populations to changing weed management, agricultural environments and global climate.

  19. Sweet corn hybrid tolerance to weed competition under three weed management levels

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Nearly all commercial sweet corn fields contain weeds that escaped management and often suffer yield loss due to weed competition. Field trials were conducted from 2009 to 2011 near Prosser, WA and Urbana, IL to evaluate weed response and tolerance of four sweet corn hybrids to three levels of weed...

  20. Sex-biased expression of sex-differentiating genes FOXL2 and FGF9 in American alligators, Alligator mississippiensis

    PubMed Central

    Janes, Daniel E.; Elsey, Ruth M.; Langan, Esther M.; Valenzuela, Nicole; Edwards, Scott V.


    Across amniotes, sex-determining mechanisms exhibit great variation yet the genes that govern sexual differentiation are largely conserved. Studies of evolution of sex-determining and sex-differentiating genes require an exhaustive characterization of functions of those genes such as FOXL2 and FGF9. FOXL2 is associated with ovarian development and FGF9 is known to play a role in testicular organogenesis in mammals and other amniotes. As a step toward characterization of the evolutionary history of sexual development, we measured expression of FOXL2 and FGF9 across three developmental stages and eight juvenile tissue types in male and female American alligators, Alligator mississippiensis. We report surprisingly high expression of FOXL2 before the stage of embryonic development when sex is determined in response to temperature and sustained and variable expression of FGF9 in juvenile male but not female tissue types. Novel characterization of gene expression in reptiles with temperature-dependent sex determination such as American alligators may inform the evolution of sex-determining and sex-differentiating gene networks as they suggest alternative functions from which the genes may have been exapted. Future functional profiling of sex-differentiating genes should similarly follow other genes and other species to enable a broad comparison across sex-determining mechanisms. PMID:23689672

  1. Managing weeds with a population dynamics approach

    Technology Transfer Automated Retrieval System (TEKTRAN)

    No-till cropping systems are increasing land productivity. A critical aspect of no-till is controlling weeds. Herbicides are a crucial tool for weed management, but weed resistance is decreasing control efficacy and increasing input costs. Scientists and producers are seeking a broader perspectiv...

  2. Gastric nematode diversity between estuarine and inland freshwater populations of the American alligator (Alligator mississippiensis, daudin 1802), and the prediction of intermediate hosts.


    Tellez, Marisa; Nifong, James


    We examined the variation of stomach nematode intensity and species richness of Alligator mississippiensis from coastal estuarine and inland freshwater habitats in Florida and Georgia, and integrated prey content data to predict possible intermediate hosts. Nematode parasitism within inland freshwater inhabiting populations was found to have a higher intensity and species richness than those inhabiting coastal estuarine systems. This pattern potentially correlates with the difference and diversity of prey available between inland freshwater and coastal estuarine habitats. Increased consumption of a diverse array of prey was also correlated with increased nematode intensity in larger alligators. Parasitic nematodes Dujardinascaris waltoni, Brevimulticaecum tenuicolle, Ortleppascaris antipini, Goezia sp., and Contracaecum sp. were present in alligators from both habitat types. Dujardinascaris waltoni, B. tenuicolle, and O. antipini had a significantly higher abundance among inland inhabiting alligators than hosts from estuarine populations. Our findings also suggest that host specific nematode parasites of alligators may have evolved to infect multiple intermediate hosts, particularly fishes, crabs, and turtles, perhaps in response to the opportunistic predatory behaviors of alligators. PMID:25426417

  3. Gastric nematode diversity between estuarine and inland freshwater populations of the American alligator (Alligator mississippiensis, daudin 1802), and the prediction of intermediate hosts

    PubMed Central

    Tellez, Marisa; Nifong, James


    We examined the variation of stomach nematode intensity and species richness of Alligator mississippiensis from coastal estuarine and inland freshwater habitats in Florida and Georgia, and integrated prey content data to predict possible intermediate hosts. Nematode parasitism within inland freshwater inhabiting populations was found to have a higher intensity and species richness than those inhabiting coastal estuarine systems. This pattern potentially correlates with the difference and diversity of prey available between inland freshwater and coastal estuarine habitats. Increased consumption of a diverse array of prey was also correlated with increased nematode intensity in larger alligators. Parasitic nematodes Dujardinascaris waltoni, Brevimulticaecum tenuicolle, Ortleppascaris antipini, Goezia sp., and Contracaecum sp. were present in alligators from both habitat types. Dujardinascaris waltoni, B. tenuicolle, and O. antipini had a significantly higher abundance among inland inhabiting alligators than hosts from estuarine populations. Our findings also suggest that host specific nematode parasites of alligators may have evolved to infect multiple intermediate hosts, particularly fishes, crabs, and turtles, perhaps in response to the opportunistic predatory behaviors of alligators. PMID:25426417

  4. Using weeds to fight wastes

    SciTech Connect


    Researchers at Los Alamos National Laboratory and New Mexico State University have discovered that jimson weed and wild tomato plants can remove the toxic wastes in wastewater associated with the production of trinitrotoluene (TNT). According to Wolfgang F. Mueller of New Mexico State, tissue-cultured cells of jimson weed rapidly absorb and break down toxic and carcinogenic elements in {open_quotes}pink water,{close_quotes} a by-product of the manufacture of TNT. Mueller and his colleagues have found similar results with the wild tomato plant.

  5. What’s a Weed? Knowledge, Attitude and Behaviour of Park Visitors about Weeds

    PubMed Central

    Ansong, Michael; Pickering, Catherine


    Weeds are a major threat to biodiversity globally degrading natural areas of high conservation value. But what are our attitudes about weeds and their management including weeds in national parks? Do we know what a weed is? Do we consider weeds a problem? Do we support their management? Are we unintentionally spreading weeds in parks? To answer these questions, we surveyed visitors entering a large popular national park near the city of Brisbane, Australia. Park visitors were knowledgeable about weeds; with >75% correctly defining weeds as ‘plants that grow where they are not wanted’. About 10% of the visitors, however, provided their own sophisticated definitions. This capacity to define weeds did not vary with people’s age, sex or level of education. We constructed a scale measuring visitors’ overall concern about weeds in parks using the responses to ten Likert scale statements. Over 85% of visitors were concerned about weeds with older visitors, hikers, and those who could correctly define weeds more concerned than their counterparts. The majority think visitors unintentionally introduce seeds into parks, with many (63%) having found seeds on their own clothing. However, over a third disposed of these seeds in ways that could facilitate weed spread. Therefore, although most visitors were knowledgeable and concerned about weeds, and support their control, there is a clear need for more effective communication regarding the risk of visitors unintentionally dispersing weed seeds in parks. PMID:26252004

  6. What's a Weed? Knowledge, Attitude and Behaviour of Park Visitors about Weeds.


    Ansong, Michael; Pickering, Catherine


    Weeds are a major threat to biodiversity globally degrading natural areas of high conservation value. But what are our attitudes about weeds and their management including weeds in national parks? Do we know what a weed is? Do we consider weeds a problem? Do we support their management? Are we unintentionally spreading weeds in parks? To answer these questions, we surveyed visitors entering a large popular national park near the city of Brisbane, Australia. Park visitors were knowledgeable about weeds; with >75% correctly defining weeds as 'plants that grow where they are not wanted'. About 10% of the visitors, however, provided their own sophisticated definitions. This capacity to define weeds did not vary with people's age, sex or level of education. We constructed a scale measuring visitors' overall concern about weeds in parks using the responses to ten Likert scale statements. Over 85% of visitors were concerned about weeds with older visitors, hikers, and those who could correctly define weeds more concerned than their counterparts. The majority think visitors unintentionally introduce seeds into parks, with many (63%) having found seeds on their own clothing. However, over a third disposed of these seeds in ways that could facilitate weed spread. Therefore, although most visitors were knowledgeable and concerned about weeds, and support their control, there is a clear need for more effective communication regarding the risk of visitors unintentionally dispersing weed seeds in parks.

  7. Dry years decrease abundance of American alligators in the Florida Everglades

    USGS Publications Warehouse

    Waddle, J. Hardin; Brandt, Laura A.; Jeffery, Brian M.; Mazzotti, Frank J.


    The Everglades has been greatly reduced and is threatened by land use change and altered hydrology. The Comprehensive Everglades Restoration Plan calls for monitoring and assessment of key ecosystem attributes, one of which is abundance of American alligators. We examined 10 years of alligator night spotlight counts from Arthur R. Marshall Loxahatchee National Wildlife Refuge along two canals and in the interior marsh to determine trends and how dry years affect alligator abundance. Alligators showed population response to hydrologic conditions. In particular, there were declines in abundance after dry years followed by an apparent recovery in abundance in subsequent years. Increases in abundance were lower in the marsh than L-40 Canal. In addition, there was evidence that intensity of dry events affected population dynamics with greater declines observed in years with drier conditions. Results revealed that overall population of alligators increased from 2004 to 2013, but that increases varied by survey route. These results demonstrate that dry years cause a decline in alligator abundance proportional to the intensity of the dry event, and that it is important to make a distinction between canals and marsh when measuring alligator response to hydrology.

  8. Growth plate formation and development in alligator and mouse metapodials: evolutionary and functional implications.


    Reno, Philip L; Horton, Walter E; Elsey, Ruth M; Lovejoy, C Owen


    Mammalian metapodials (metacarpals and metatarsals), unlike most long bones, form a single growth plate, and undergo longitudinal growth at only one end. The growth dynamics of non-mammalian tetrapod metapodials have not been systematically examined in order to determine if unidirectional growth is unique to mammals. Here we compare murine metapodial ossification in growth stages that parallel those of embryonic, juvenile and subadult American alligators (Alligator mississippiensis). Safranin O staining was used for qualitative histology, and chondrocyte differentiation and proliferation were assessed via immunohistochemistry for type X collagen and proliferative cell nuclear antigen (PCNA). We establish that growth plates form at both ends of alligator metapodials and are maintained in the subadult. PCNA results show that alligators and mice share common patterns of chondrocyte proliferation during growth plate formation. In addition, while alligators and mice differ initially in the degree of organization and pace of chondrocyte differentiation, these parameters are largely similar in established growth plates. However, the replacement of cartilage by bone is highly irregular throughout growth in the alligator, in contrast to the more uniform process in the mouse. These results indicate that while alligators and mammals share common mechanisms of chondrocyte regulation, they differ substantially in their processes of ossification. Phylogenetic analysis indicates that the direct ossification of one epiphysis and reliance on a single growth plate is a derived character (synapomorphy) in therian mammals and likely indicates an adaptation for erect quadrupedal gait. PMID:17285637

  9. Weed biocontrol in landscape restoration

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed biological control programs in natural areas are often undertaken with the goal of restoring native plant communities and/or ecosystem services to a pre-invasion level. These objectives may be achieved in some areas with biological control alone; however, in other sites integration of biologica...

  10. Comparison of metabolic substrates in alligators and several birds of prey.


    Sweazea, Karen L; McMurtry, John P; Elsey, Ruth M; Redig, Patrick; Braun, Eldon J


    On average, avian blood glucose concentrations are 1.5-2 times those of mammals of similar mass and high concentrations of insulin are required to lower blood glucose. Whereas considerable data exist for granivorous species, few data are available for plasma metabolic substrate and glucoregulatory hormone concentrations for carnivorous birds and alligators. Birds and mammals with carnivorous diets have higher metabolic rates than animals consuming diets with less protein whereas alligators have low metabolic rates. Therefore, the present study was designed to compare substrate and glucoregulatory hormone concentrations in several birds of prey and a phylogenetically close relative of birds, the alligator. The hypothesis was that the combination of carnivorous diets and high metabolic rates favored the evolution of greater protein and fatty acid utilization leading to insulin resistance and high plasma glucose concentrations in carnivorous birds. In contrast, it was hypothesized that alligators would have low substrate utilization attributable to a low metabolic rate. Fasting plasma substrate and glucoregulatory hormone concentrations were compared for bald eagles (Haliaeetus leucocephalus), great horned owls (Bubo virginianus), red-tailed hawks (Buteo jamaicensis), and American alligators (Alligator mississippiensis). Avian species had high circulating β-hydroxybutyrate (10-21 mg/dl) compared to alligators (2.81 ± 0.16 mg/dl). In mammals high concentrations of this byproduct of fatty acid utilization are correlated with insulin resistance. Fasting glucose and insulin concentrations were positively correlated in eagles whereas no relationship was found between these variables for owls, hawks or alligators. Additionally, β-hydroxybutyrate concentrations were low in alligators. Similar to carnivorous mammals, ingestion of a high protein diet may have favored the utilization of fatty acids and protein for energy thereby promoting the development of insulin

  11. Comparison of metabolic substrates in alligators and several birds of prey.


    Sweazea, Karen L; McMurtry, John P; Elsey, Ruth M; Redig, Patrick; Braun, Eldon J


    On average, avian blood glucose concentrations are 1.5-2 times those of mammals of similar mass and high concentrations of insulin are required to lower blood glucose. Whereas considerable data exist for granivorous species, few data are available for plasma metabolic substrate and glucoregulatory hormone concentrations for carnivorous birds and alligators. Birds and mammals with carnivorous diets have higher metabolic rates than animals consuming diets with less protein whereas alligators have low metabolic rates. Therefore, the present study was designed to compare substrate and glucoregulatory hormone concentrations in several birds of prey and a phylogenetically close relative of birds, the alligator. The hypothesis was that the combination of carnivorous diets and high metabolic rates favored the evolution of greater protein and fatty acid utilization leading to insulin resistance and high plasma glucose concentrations in carnivorous birds. In contrast, it was hypothesized that alligators would have low substrate utilization attributable to a low metabolic rate. Fasting plasma substrate and glucoregulatory hormone concentrations were compared for bald eagles (Haliaeetus leucocephalus), great horned owls (Bubo virginianus), red-tailed hawks (Buteo jamaicensis), and American alligators (Alligator mississippiensis). Avian species had high circulating β-hydroxybutyrate (10-21 mg/dl) compared to alligators (2.81 ± 0.16 mg/dl). In mammals high concentrations of this byproduct of fatty acid utilization are correlated with insulin resistance. Fasting glucose and insulin concentrations were positively correlated in eagles whereas no relationship was found between these variables for owls, hawks or alligators. Additionally, β-hydroxybutyrate concentrations were low in alligators. Similar to carnivorous mammals, ingestion of a high protein diet may have favored the utilization of fatty acids and protein for energy thereby promoting the development of insulin

  12. Possible generational effects of habitat degradation on alligator reproduction

    USGS Publications Warehouse

    Fujisaki, Ikuko; Rice, K.G.; Woodward, A.R.; Percival, H.F.


    Population decline of the American alligator (Alligator mississippiensis) was observed in Lake Apopka in central Florida, USA, in the early 1980s. This decline was thought to result from adult mortality and nest failure caused by anthropogenic increases in sediment loads, nutrients, and contaminants. Reproductive impairment also was reported. Extensive restoration of marshes associated with Lake Apopka has been conducted, as well as some limited restoration measures on the lake. Monitoring by the Florida Fish and Wildlife Conservation Commission (FFWCC) has indicated that the adult alligator population began increasing in the early 1990s. We expected that the previously reported high proportion of complete nest failure (??0) during the 1980s may have decreased. We collected clutches from alligator nests in Lake Apopka from 1983 to 2003 and from 5 reference areas from 1988 to 1991, and we artificially incubated them. We used a Bayesian framework with Gibbs sampler of Markov chain Monte Carlo simulation to analyze ??0. Estimated ??0was consistently higher in Lake Apopka compared with reference areas, and the difference in ??0 ranged from 0.19 to 0.56. We conducted change point analysis to identify and test the significance of the change point in ??0in Lake Apopka between 1983 and 2003, indicating the point of reproductive recovery. The estimated Bayes factor strongly supported the single change point hypothesis against the no change point hypothesis. The major downward shift in ??0 probably occurred in the mid-1990s, approximately a generation after the major population decline in the 1980s. Furthermore, estimated ??0 values after the change point (0.21) were comparable with those of reference areas (0.07-0.31). These results combined with the monitoring by FFWCC seem to suggest that anthropogenic habitat degradation caused reproductive impairment of adult females and decreases in ??0 occurred with the sexual maturity of a new generation of breeding females. Long

  13. Traumatic Amputation of Finger From an Alligator Snapping Turtle Bite.


    Johnson, Robert D; Nielsen, Cynthia L


    Legend states that the alligator snapping turtle (Macrochelys temminckii) should be handled with extreme caution as it has jaw strength powerful enough to bite a wooden broomstick in half. Tales of bite injuries from what is the largest freshwater turtle in North America exist anecdotally, yet there are few descriptions of medical encounters for such. The risk of infection from reptilian bites to the hand in an aquatic environment warrants thorough antibiotic treatment in conjunction with hand surgery consultation. We present the first case report of a near total amputation of an index finger in an adolescent boy who had been bitten by a wild "gator snapper." PMID:27116923

  14. [Formation of the genome of the alligator gar Lepisosteus osseus (Ganoidomorpha) genome].


    Vladychenskaia, N S; Kedrova, O S; Petrov, N B


    Genome structure of the alligator gar was studied by means of a comparison of reassociation kinetics of short and long DNA fragments, an estimation of hyperchromicity of reassociated repetitive DNA as a function of fragments length, and length estimation of S1-resistant duplexes by gel filtration. It was shown that most of the repeated sequences in the alligator gar DNA are no less than 2000 b.p. long and weakly divergent. Little or no interspersion of unique and short repeated sequences were observed in this genome. No highly divergent repeats were found in the alligator gar genome. PMID:6855762

  15. [Formation of the genome of the alligator gar Lepisosteus osseus (Ganoidomorpha) genome].


    Vladychenskaia, N S; Kedrova, O S; Petrov, N B


    Genome structure of the alligator gar was studied by means of a comparison of reassociation kinetics of short and long DNA fragments, an estimation of hyperchromicity of reassociated repetitive DNA as a function of fragments length, and length estimation of S1-resistant duplexes by gel filtration. It was shown that most of the repeated sequences in the alligator gar DNA are no less than 2000 b.p. long and weakly divergent. Little or no interspersion of unique and short repeated sequences were observed in this genome. No highly divergent repeats were found in the alligator gar genome.

  16. Submergence Causes Similar Carbohydrate Starvation but Faster Post-Stress Recovery than Darkness in Alternanthera philoxeroides Plants

    PubMed Central

    Ye, Xiao qi; Meng, Jin liu; Zeng, Bo; Wu, Ming; Zhang, Ye yi; Zhang, Xiao ping


    Carbon assimilation by submerged plants is greatly reduced due to low light levels. It is hypothesized that submergence reduces carbohydrate contents and that plants recover from submergence in the same way as darkness-treated plants. To test this hypothesis, the responses of plants to submergence and darkness were studied and compared. Plants of a submergence-tolerant species, Alternanthera philoxeroides, were exposed to well drained and illuminated conditions, complete submergence conditions or darkness conditions followed by a recovery growth period in a controlled experiment. The biomass maintenance and accumulation, carbohydrate content dynamics and respiration rate in the plants were assessed to quantify the carbohydrate utilization rate and regrowth. The submerged plants maintained higher chlorophyll contents, more green leaf tissue and more biomass; recovered more quickly; and accumulated more carbohydrates and biomass than darkness-treated plants. The respiration rate was continuously reduced in the same pattern under both stress conditions but was maintained at a significantly lower level in the submerged plants; the total soluble sugar and total fructan contents were decreased at approximately the same rate of decrease, reaching similar low levels, in the two stress treatments. The A. philoxeroides plants were more tolerant of submergence than darkness. The faster recovery of desubmerged plants could not be explained by the similar carbohydrate contents at the start of recovery. Other types of carbon reserves besides carbohydrates or other mechanisms such as higher post-stress photosynthetic performance might be involved. PMID:27776170

  17. Ground-Based Sensing System for Weed Mapping in Cotton

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A ground-based weed mapping system was developed to measure weed intensity and distribution in a cotton field. The weed mapping system includes WeedSeeker® PhD600 sensor modules to indicate the presence of weeds between rows, a GPS receiver to provide spatial information, and a data acquisition and ...

  18. The future for weed control and technology.


    Shaner, Dale L; Beckie, Hugh J


    This review is both a retrospective (what have we missed?) and prospective (where are we going?) examination of weed control and technology, particularly as it applies to herbicide-resistant weed management (RWM). Major obstacles to RWM are discussed, including lack of diversity in weed management, unwillingness of many weed researchers to conduct real integrated weed management research or growers to accept recommendations, influence or role of agrichemical marketing and governmental policy and lack of multidisciplinary research. We then look ahead to new technologies that are needed for future weed control in general and RWM in particular, in areas such as non-chemical and chemical weed management, novel herbicides, site-specific weed management, drones for monitoring large areas, wider application of 'omics' and simulation model development. Finally, we discuss implementation strategies for integrated weed management to achieve RWM, development of RWM for developing countries, a new classification of herbicides based on mode of metabolism to facilitate greater stewardship and greater global exchange of information to focus efforts on areas that maximize progress in weed control and RWM. There is little doubt that new or emerging technologies will provide novel tools for RMW in the future, but will they arrive in time?

  19. Specialized stem cell niche enables repetitive renewal of alligator teeth.


    Wu, Ping; Wu, Xiaoshan; Jiang, Ting-Xin; Elsey, Ruth M; Temple, Bradley L; Divers, Stephen J; Glenn, Travis C; Yuan, Kuo; Chen, Min-Huey; Widelitz, Randall B; Chuong, Cheng-Ming


    Reptiles and fish have robust regenerative powers for tooth renewal. However, extant mammals can either renew their teeth one time (diphyodont dentition) or not at all (monophyodont dentition). Humans replace their milk teeth with permanent teeth and then lose their ability for tooth renewal. Here, we study tooth renewal in a crocodilian model, the American alligator, which has well-organized teeth similar to mammals but can still undergo life-long renewal. Each alligator tooth is a complex family unit composed of the functional tooth, successional tooth, and dental lamina. Using multiple mitotic labeling, we map putative stem cells to the distal enlarged bulge of the dental lamina that contains quiescent odontogenic progenitors that can be activated during physiological exfoliation or artificial extraction. Tooth cycle initiation correlates with β-catenin activation and soluble frizzled-related protein 1 disappearance in the bulge. The dermal niche adjacent to the dermal lamina dynamically expresses neural cell adhesion molecule, tenascin-C, and other molecules. Furthermore, in development, asymmetric β-catenin localization leads to the formation of a heterochronous and complex tooth family unit configuration. Understanding how these signaling molecules interact in tooth development in this model may help us to learn how to stimulate growth of adult teeth in mammals.

  20. A 3D interactive model and atlas of the jaw musculature of Alligator mississippiensis.


    Holliday, Casey M; Tsai, Henry P; Skiljan, Rebecca J; George, Ian D; Pathan, Sami


    Modern imaging and dissemination methods enable morphologists to share complex, three-dimensional (3D) data in ways not previously possible. Here we present a 3D interactive model of the jaw musculature of the American Alligator (Alligator mississippiensis). Alligator and crocodylian jaw musculature is notoriously challenging to inspect and interpret because of the derived nature of the feeding apparatus. Using Iodine-contrast enhanced microCT imaging, a segmented model of jaw muscles, trigeminal nerve, brain and skull are presented as a cross-sectional atlas and 3D, interactive pdf of the rendered model. Modern 3D dissemination methods like this 3D Alligator hold great potential for morphologists to share anatomical information to scientists, educators, and the public in an easily downloadable format. PMID:23762228


    EPA Science Inventory

    Morphological difference in spleen and thymus are closely related to functional immune differences. Hormonal regulation of the immune system has been demonstrated in reptilian splenic and thymic tissue. Spleens and thymus were obtained from juvenile alligators at two reference si...

  2. Concentrations of contaminants in muscle of the American alligator in Florida

    SciTech Connect

    Delany, M.F.; Bell, J.U.; Sundlof, S.F.


    Samples of tail muscle from 32 American alligators (Alligator mississippiensis) in Florida were analyzed for contaminant concentrations to provide preliminary information on the potential public health hazard of meat consumption. Detectable levels were found for eight metals; copper, zinc, iron, chromium, mercury, lead, cadmium and arsenic. Mean residue was highest for mercury (geometric mean = 0.61 ppm). DDE, DDD, DDT, dieldrin, heptachlor epoxide, lindane, and PCB's were found. Mean residue concentrations were compared by lake. Alligators appeared to be suitable monitors of environmental pollution. Concentrations of contaminants found in these animals probably pose little threat to public health. However, recommendations must await analysis of larger sample sizes and information on amount and frequency of meat consumption. Alligators killed for human consumption should continue to be monitored for contaminant residues.

  3. Scale-Dependent Habitat Selection and Size-Based Dominance in Adult Male American Alligators.


    Strickland, Bradley A; Vilella, Francisco J; Belant, Jerrold L


    Habitat selection is an active behavioral process that may vary across spatial and temporal scales. Animals choose an area of primary utilization (i.e., home range) then make decisions focused on resource needs within patches. Dominance may affect the spatial distribution of conspecifics and concomitant habitat selection. Size-dependent social dominance hierarchies have been documented in captive alligators, but evidence is lacking from wild populations. We studied habitat selection for adult male American alligators (Alligator mississippiensis; n = 17) on the Pearl River in central Mississippi, USA, to test whether habitat selection was scale-dependent and individual resource selectivity was a function of conspecific body size. We used K-select analysis to quantify selection at the home range scale and patches within the home range to determine selection congruency and important habitat variables. In addition, we used linear models to determine if body size was related to selection patterns and strengths. Our results indicated habitat selection of adult male alligators was a scale-dependent process. Alligators demonstrated greater overall selection for habitat variables at the patch level and less at the home range level, suggesting resources may not be limited when selecting a home range for animals in our study area. Further, diurnal habitat selection patterns may depend on thermoregulatory needs. There was no relationship between resource selection or home range size and body size, suggesting size-dependent dominance hierarchies may not have influenced alligator resource selection or space use in our sample. Though apparent habitat suitability and low alligator density did not manifest in an observed dominance hierarchy, we hypothesize that a change in either could increase intraspecific interactions, facilitating a dominance hierarchy. Due to the broad and diverse ecological roles of alligators, understanding the factors that influence their social dominance

  4. Scale-Dependent Habitat Selection and Size-Based Dominance in Adult Male American Alligators

    PubMed Central

    Strickland, Bradley A.; Vilella, Francisco J.; Belant, Jerrold L.


    Habitat selection is an active behavioral process that may vary across spatial and temporal scales. Animals choose an area of primary utilization (i.e., home range) then make decisions focused on resource needs within patches. Dominance may affect the spatial distribution of conspecifics and concomitant habitat selection. Size-dependent social dominance hierarchies have been documented in captive alligators, but evidence is lacking from wild populations. We studied habitat selection for adult male American alligators (Alligator mississippiensis; n = 17) on the Pearl River in central Mississippi, USA, to test whether habitat selection was scale-dependent and individual resource selectivity was a function of conspecific body size. We used K-select analysis to quantify selection at the home range scale and patches within the home range to determine selection congruency and important habitat variables. In addition, we used linear models to determine if body size was related to selection patterns and strengths. Our results indicated habitat selection of adult male alligators was a scale-dependent process. Alligators demonstrated greater overall selection for habitat variables at the patch level and less at the home range level, suggesting resources may not be limited when selecting a home range for animals in our study area. Further, diurnal habitat selection patterns may depend on thermoregulatory needs. There was no relationship between resource selection or home range size and body size, suggesting size-dependent dominance hierarchies may not have influenced alligator resource selection or space use in our sample. Though apparent habitat suitability and low alligator density did not manifest in an observed dominance hierarchy, we hypothesize that a change in either could increase intraspecific interactions, facilitating a dominance hierarchy. Due to the broad and diverse ecological roles of alligators, understanding the factors that influence their social dominance


    NASA Technical Reports Server (NTRS)


    Double-parked, an angry alligator straddles two parking spaces outside an office trailer at NASA's Launch Complex 17. Hank Curtin of Pan Am watches from a safe perch as John Tanner gets ready to wrap a rope around the snout of the 10-foot, 9-inch beast. It's all in a day's work for Tanner, who has a contract with the state of Florida to remove nuisance alligators.

  6. The coat protein of Alternanthera mosaic virus is the elicitor of a temperature-sensitive systemic necrosis in Nicotiana benthamiana, and interacts with a host boron transporter protein

    SciTech Connect

    Lim, Hyoun-Sub; Nam, Jiryun; Seo, Eun-Young; Nam, Moon; Vaira, Anna Maria; Bae, Hanhong; Jang, Chan-Yong; Lee, Cheol Ho; Kim, Hong Gi; Roh, Mark; Hammond, John


    Different isolates of Alternanthera mosaic virus (AltMV; Potexvirus), including four infectious clones derived from AltMV-SP, induce distinct systemic symptoms in Nicotiana benthamiana. Virus accumulation was enhanced at 15 °C compared to 25 °C; severe clone AltMV 3-7 induced systemic necrosis (SN) and plant death at 15 °C. No interaction with potexvirus resistance gene Rx was detected, although SN was ablated by silencing of SGT1, as for other cases of potexvirus-induced necrosis. Substitution of AltMV 3-7 coat protein (CP{sub SP}) with that from AltMV-Po (CP{sub Po}) eliminated SN at 15 °C, and ameliorated symptoms in Alternanthera dentata and soybean. Substitution of only two residues from CP{sub Po} [either MN(13,14)ID or LA(76,77)IS] efficiently ablated SN in N. benthamiana. CP{sub SP} but not CP{sub Po} interacted with Arabidopsis boron transporter protein AtBOR1 by yeast two-hybrid assay; N. benthamiana homolog NbBOR1 interacted more strongly with CP{sub SP} than CP{sub Po} in bimolecular fluorescence complementation, and may affect recognition of CP as an elicitor of SN. - Highlights: • Alternanthera mosaic virus CP is an elicitor of systemic necrosis in N. benthamiana. • Virus-induced systemic necrosis is enhanced at 15 °C compared to 25 °C. • Induction of systemic necrosis is dependent on as few as two CP amino acid residues. • These residues are at subunit interfaces within the same turn of the virion helix. • Inducer/non-inducer CPs interact differentially with a boron transporter protein.

  7. Weeding Is Not Just for Gardeners: A Case Study on Weeding a Reference Collection

    ERIC Educational Resources Information Center

    Lee, Marta


    Weeding a reference collection can be time consuming, a thankless job, and an endless task. It is a dusty job and can add to the librarian's workload. Weeding the collection can add to its currency and usability; plus it removes outdated materials. Periodically weeding allows librarians to remember what is in the collection and what can be removed…

  8. Integration of herbicides with manual weeding for controlling the weeds in rice under saline environment.


    Hakim, M A; Juraimi, Abdul Shukor; Hanafi, M M; Rafii, Mohd Y; Ismail, Mohd Razi; Karim, S M Rezaul; Kausar, H


    The pot experiment was conducted to select appropriate integrated weed management method in rice under different salinity levels (0, 4 and 8 dS m(-1)). All the parameters including rice and weed measured were significantly influenced by weed control treatments at all salinity levels. Treatments including weed-free condition, Pretilachlor @0.375 kg ai ha(-1) + hand weeding, Propanil + Thiobencarb @ 0.9 kg ai ha(-1) and 1.8 kg ai ha(-1)+ hand weeding performed better under all salinity levels. Pretilachlor @ 0.375 kg ai ha(-1) with one round of hand weeding and propanil + thiobencarb 0.9 kg ai ha(-1) + 1.8 kg ai ha(-1) with one round of hand weeding were comparable to weed-free yields, and were superior to other treatments under salinity condition. Considering all the parameters, pretilachlor @ 0.375 kg ai ha(-1) + one round of hand weeding (at 65 DAT), propanil + thiobencarb 0.9 kg ai ha(-1) +1.8 kg ai ha(-1) + one round of hand weeding (at 65 DAT) gave the most effective control of weeds in rice under saline environments.

  9. Integration of herbicides with manual weeding for controlling the weeds in rice under saline environment.


    Hakim, M A; Juraimi, Abdul Shukor; Hanafi, M M; Rafii, Mohd Y; Ismail, Mohd Razi; Karim, S M Rezaul; Kausar, H


    The pot experiment was conducted to select appropriate integrated weed management method in rice under different salinity levels (0, 4 and 8 dS m(-1)). All the parameters including rice and weed measured were significantly influenced by weed control treatments at all salinity levels. Treatments including weed-free condition, Pretilachlor @0.375 kg ai ha(-1) + hand weeding, Propanil + Thiobencarb @ 0.9 kg ai ha(-1) and 1.8 kg ai ha(-1)+ hand weeding performed better under all salinity levels. Pretilachlor @ 0.375 kg ai ha(-1) with one round of hand weeding and propanil + thiobencarb 0.9 kg ai ha(-1) + 1.8 kg ai ha(-1) with one round of hand weeding were comparable to weed-free yields, and were superior to other treatments under salinity condition. Considering all the parameters, pretilachlor @ 0.375 kg ai ha(-1) + one round of hand weeding (at 65 DAT), propanil + thiobencarb 0.9 kg ai ha(-1) +1.8 kg ai ha(-1) + one round of hand weeding (at 65 DAT) gave the most effective control of weeds in rice under saline environments. PMID:26688966

  10. The reproductive hormone cycle of adult female American alligators from a barrier island population.


    Hamlin, Heather J; Lowers, Russell H; Kohno, Satomi; Mitsui-Watanabe, Naoko; Amano, Haruna; Hara, Akihiko; Ohta, Yasuhiko; Miyagawa, Shinichi; Iguchi, Taisen; Guillette, Louis J


    Comparatively, little data are available detailing the geographic variation that exists in the reproductive endocrinology of adult alligators, especially those living in barrier islands. The Merritt Island National Wildlife Refuge (MI) is a unique barrier island environment and home to the Kennedy Space Center (FL, USA). Seasonal patterns of sex steroids were assessed in adult female American alligators from MI monthly from 2008 to 2009, with additional samples collected at more random intervals in 2006, 2007, and 2010. Plasma 17β-estradiol and vitellogenin concentrations peaked in April, coincident with courtship and mating, and showed patterns similar to those observed in adult female alligators in other regions. Plasma concentrations of progesterone, however, showed patterns distinctly different than those reported for alligator populations in other regions and remained relatively constant throughout the year. Plasma DHEA peaked in July around the time of oviposition, decreased in August, and then remained constant for the remaining months, except for a moderate increase in October. Circulating concentrations of DHEA have not been previously assessed in a female crocodilian, and plasma concentrations coincident with reproductive activity suggest a reproductive and/or behavioral role. Interestingly, plasma testosterone concentrations peaked in May of 2008, as has been shown in female alligator populations in other regions, but showed no peak in 2009, demonstrating dramatic variability from year to year. Surveys showed 2009 to be particularly depauperate of alligator nests in MI, and it is possible that testosterone could serve as a strong indicator of breeding success.

  11. Relationship between body condition of American alligators and water depth in the Everglades, Florida

    USGS Publications Warehouse

    Fujisaki, Ikuko; Rice, Kenneth G.; Pearlstine, Leonard G.; Mazzotti, Frank J.


    Feeding opportunities of American alligators (Alligator mississippiensis) in freshwater wetlands in south Florida are closely linked to hydrologic conditions. In the Everglades, seasonally and annually fluctuating surface water levels affect populations of aquatic organisms that alligators consume. Since prey becomes more concentrated when water depth decreases, we hypothesized an inverse relationship between body condition and water depth in the Everglades. On average, condition of adult alligators in the dry season was significantly higher than in the wet season, but this was not the case for juveniles/subadults. The correlation between body condition and measured water depth at capture locations was weak; however, there was a significant negative correlation between the condition and predicted water depth prior to capture for all animals except for spring juveniles/subadults which had a weak positive condition-water depth relationship. Overall, a relatively strong inverse correlation occurred at 10-49 days prior to the capture day, suggesting that current body condition of alligators may depend on feeding opportunities during that period. Fitted regression of body condition on water depth (mean depth of 10 days when condition-water depth correlation was greatest) resulted in a significantly negative slope, except for spring adult females and spring juveniles/subadults for which slopes were not significantly different from zero. Our results imply that water management practices may be critical for alligators in the Everglades since water depth can affect animal condition in a relatively short period of time.

  12. Detection of West Nile virus RNA in mosquitoes and identification of mosquito blood meals collected at alligator farms in Louisiana.


    Unlu, Isik; Kramer, Wayne L; Roy, Alma F; Foil, Lane D


    Since 2001, alligator farms in the United States have sustained substantial economic losses because of West Nile virus (WNV) outbreaks in American alligators (Alligator mississippiensis). Once an initial infection is introduced into captive alligators, WNV can spread among animals by contaminative transmission. Some outbreaks have been linked to feeding on infected meat or the introduction of infected hatchlings, but the initial source of WNV infection has been uncertain in other outbreaks. We conducted a study to identify species composition and presence of WNV in mosquito populations associated with alligator farms in Louisiana. A second objective of this study was to identify the origin of mosquito blood meals collected at commercial alligator farms. Mosquitoes were collected from 2004 to 2006, using Centers for Disease Control light traps, gravid traps, backpack aspirators, and resting boxes. We collected a total of 58,975 mosquitoes representing 24 species. WNV was detected in 41 pools of females from 11 mosquito species: Anopheles crucians, Anopheles quadrimaculatus, Coquillettidia perturbans, Culex coronator, Culex erraticus, Culex nigripalpus, Culex quinquefasciatus, Mansonia titillans, Aedes sollicitans, Psorophora columbiae, and Uranotaenia lowii. The blood meal origins of 213 field-collected mosquitoes were identified based on cytochrome B sequence identity. Alligator blood was detected in 21 mosquitoes representing six species of mosquitoes, including Cx. quinquefasciatus and Cx. nigripalpus. Our results showed that mosquitoes of species that are known to be competent vectors of WNV fed regularly on captive alligators. Therefore, mosquitoes probably are important in the role of transmission of WNV at alligator farms.

  13. Use of alligator hole abundance and occupancy rate as indicators for restoration of a human-altered wetland

    USGS Publications Warehouse

    Fujisaki, Ikuko; Mazzotti, Frank J.; Hart, Kristen M.; Rice, Kenneth G.; Ogurcak, Danielle; Rochford, Michael; Jeffery, Brian M.; Brandt, Laura A.; Cherkiss, Michael S.


    Use of indicator species as a measure of ecosystem conditions is an established science application in environmental management. Because of its role in shaping wetland systems, the American alligator (Alligator mississippiensis) is one of the ecological indicators for wetland restoration in south Florida, USA. We conducted landscape-level aerial surveys of alligator holes in two different habitats in a wetland where anthropogenic modification of surface hydrology has altered the natural system. Alligator holes were scarcer in an area where modified hydrology caused draining and frequent dry-downs compared to another area that maintains a functional wetland system. Lower abundance of alligator holes indicates lack of alligator activities, lower overall species diversity, and lack of dry-season aquatic refugia for other organisms. The occupancy rate of alligator holes was lower than the current restoration target for the Everglades, and was variable by size class with large size-class alligators predominantly occupying alligator holes. This may indicate unequal size-class distribution, different habitat selection by size classes, or possibly a lack of recruitment. Our study provides pre-restoration baseline information about one indicator species for the Everglades. Success of the restoration can be assessed via effective synthesis of information derived by collective research efforts on the entire suite of selected ecological indicators.

  14. Nutrient absorbtion of weeds in maize.


    Lehoczky, E; Kismányoky, A; Nagy, P; Németh, T


    Our study was carried out in Hungary at Keszthely, in 2007. The effect of different cultivation methods: no-till drill, disk tillage, conventional tillage (ploughing) and five increasing N doses were studied on the weediness. The bi-factorial trial was arranged in split plot design with four replications. Crop rotation: winter wheat-winter wheat-maize-maize. The seeding of maize was 23rd of April in 2007. The weed survey was made with Balázs-Ujvárosi coenological method on the 17th of May. In the experiment were found 21 weed species. We collected all plants of every weed species by plots. The sample area was 1 m2. Furthermore five maize plants per plot were sampled on the 22nd of May. Maize was at 3-4 leaves stage. For reason of competition studies no herbicides were applied on sampling sites. The aerial parts of weeds and maize plants were collected, and the fresh and dry matter weight was measured. We analyzed in detail, the occurrence of weed species, and the biomass production of weeds in comparison with maize. The effect of different cultivation methods markedly demonstrated the weed cover, the number of perennial and annual weeds and the number of occurring weed species.


    EPA Science Inventory

    We examined variation in plasma thyroxine (T4) in juvenile American alligators (Alligator mississippiensis) collected from three sites within the Kissimmee River drainage basin (FL, USA). Based on historical sediment data, Moonshine Bay served as the low contaminant exposure site...

  16. Phytoremediation of sulfonated Remazol Red dye and textile effluents by Alternanthera philoxeroides: An anatomical, enzymatic and pilot scale study.


    Rane, Niraj R; Chandanshive, Vishal V; Watharkar, Anuprita D; Khandare, Rahul V; Patil, Tejas S; Pawar, Pankaj K; Govindwar, Sanjay P


    Alternanthera philoxeroides Griseb. a macrophyte was found to degrade a highly sulfonated textile dye Remazol Red (RR) completely within 72 h at a concentration of 70 mg L(-1). An induction in the activities of azoreductase and riboflavin reductase was observed in root and stem tissues; while the activities of lignin peroxidase, laccase and DCIP reductase were induced in leaf tissues. Some enzymes namely tyrosinase, veratryl alcohol oxidase, catalase and superoxide dismutase displayed an increase in their activity in all the tissues in response of 72 h exposure to Remazol Red. There was a marginal reduction in contents of chlorophyll a (20%), chlorophyll b (5%) and carotenoids (16%) in the leaves when compared to control plants. A detailed anatomical study of the stem during uptake and treatment revealed a stepwise mechanism of dye degradation. UV-vis spectrophotometric and high performance thin layer chromatographic analyses confirmed the removal of parent dye from solution. Based on the enzymes activities and gas chromatography-mass spectroscopic analysis of degradation products, a possible pathway of phytotransformation of RR was proposed which revealed the formation of 4-(phenylamino)-1,3,5-triazin-2-ol, naphthalene-1-ol and 3-(ethylsulfonyl)phenol. Toxicity study on Devario aequipinnatus fishes showed that the anatomy of gills of fishes exposed to A. philoxeroides treated RR was largely protected. The plants were further explored for rhizofiltration experiments in a pilot scale reactor. A. philoxeroides could decolorize textile industry effluent of varying pH within 96 h of treatment which was evident from the significant reductions in the values of American dye manufacturers' institute color, chemical oxygen demand, biological oxygen demand, total dissolved and total suspended solids.

  17. Phytoremediation of sulfonated Remazol Red dye and textile effluents by Alternanthera philoxeroides: An anatomical, enzymatic and pilot scale study.


    Rane, Niraj R; Chandanshive, Vishal V; Watharkar, Anuprita D; Khandare, Rahul V; Patil, Tejas S; Pawar, Pankaj K; Govindwar, Sanjay P


    Alternanthera philoxeroides Griseb. a macrophyte was found to degrade a highly sulfonated textile dye Remazol Red (RR) completely within 72 h at a concentration of 70 mg L(-1). An induction in the activities of azoreductase and riboflavin reductase was observed in root and stem tissues; while the activities of lignin peroxidase, laccase and DCIP reductase were induced in leaf tissues. Some enzymes namely tyrosinase, veratryl alcohol oxidase, catalase and superoxide dismutase displayed an increase in their activity in all the tissues in response of 72 h exposure to Remazol Red. There was a marginal reduction in contents of chlorophyll a (20%), chlorophyll b (5%) and carotenoids (16%) in the leaves when compared to control plants. A detailed anatomical study of the stem during uptake and treatment revealed a stepwise mechanism of dye degradation. UV-vis spectrophotometric and high performance thin layer chromatographic analyses confirmed the removal of parent dye from solution. Based on the enzymes activities and gas chromatography-mass spectroscopic analysis of degradation products, a possible pathway of phytotransformation of RR was proposed which revealed the formation of 4-(phenylamino)-1,3,5-triazin-2-ol, naphthalene-1-ol and 3-(ethylsulfonyl)phenol. Toxicity study on Devario aequipinnatus fishes showed that the anatomy of gills of fishes exposed to A. philoxeroides treated RR was largely protected. The plants were further explored for rhizofiltration experiments in a pilot scale reactor. A. philoxeroides could decolorize textile industry effluent of varying pH within 96 h of treatment which was evident from the significant reductions in the values of American dye manufacturers' institute color, chemical oxygen demand, biological oxygen demand, total dissolved and total suspended solids. PMID:26164661

  18. Evaluation of antinociceptive and antihyperglycemic activities in methanol extracts of whole plants of Alternanthera philoxeroides (Mart.) Griseb. (Amaranthaceae) in mice.


    Khatun, Fatema; Zaman, Farhana; Mosaiab, Tamim; Mostafa, Fariha; Zaman, Marzia; Rehana, Fatema; Nasrin, Dilruba; Jamal, Farhana; Nahar, Nusratun; Rahmatullah, Mohammed


    The present study evaluated the antinociceptive and antihyperglycemic effects of crude methanol extract of whole plants of Alternanthera philoxeroides (Mart.) Griseb. (Amaranthaceae) in Swiss albino mice. Antin(o)Ciceptive activity was evaluated by attenuation of the number of constrictions in acetic acid-induced gastric pain, while antihyperglycemic activity was evaluated through oral glucose tolerance tests in glucose-loaded mice. Dose-dependent and significant inhibitions in the number of constrictions were seen in mice administered with extract at doses of 50, 100, 200 and 400 mg per kg body weight. At these concentrations, the numbers of constrictions were reduced, respectively, by 31.0, 32.7, 37.9 and 44.8%. In comparison, a standard antinociceptive drug, aspirin reduced the number of constrictions by 37.9 and 67.2%, when administered at doses, respectively, of 200 and 400 mg per kg body weight. The extract also exhibited dose-dependent and significant antihyperglycemic activity when administered to mice at the afore-mentioned four doses. Serum glucose concentrations were reduced, respectively, by 36.3, 58.6, 65.0 and 65.6% at the four doses administered. The results compare favorably with a standard antihyperglycemic drug, glibenclamide, which when administered at a dose of 10 mg per kg body weight reduced serum glucose level by 42.7%. Taken together, the results obtained indicate that the extract merit further scientific studies towards discovery of components, which may prove beneficial in ameliorating pain, as well as high sugar levels of diabetic patients.

  19. Propagule Pressure, Habitat Conditions and Clonal Integration Influence the Establishment and Growth of an Invasive Clonal Plant, Alternanthera philoxeroides

    PubMed Central

    You, Wen-Hua; Han, Cui-Min; Fang, Long-Xiang; Du, Dao-Lin


    Many notorious invasive plants are clonal, spreading mainly by vegetative propagules. Propagule pressure (the number of propagules) may affect the establishment, growth, and thus invasion success of these clonal plants, and such effects may also depend on habitat conditions. To understand how propagule pressure, habitat conditions and clonal integration affect the establishment and growth of the invasive clonal plants, an 8-week greenhouse with an invasive clonal plant, Alternanthera philoxeroides was conducted. High (five fragments) or low (one fragment) propagule pressure was established either in bare soil (open habitat) or dense native vegetation of Jussiaea repens (vegetative habitat), with the stolon connections either severed from or connected to the relatively older ramets. High propagule pressure greatly increased the establishment and growth of A. philoxeroides, especially when it grew in vegetative habitats. Surprisingly, high propagule pressure significantly reduced the growth of individual plants of A. philoxeroides in open habitats, whereas it did not affect the individual growth in vegetative habitats. A shift in the intraspecific interaction on A. philoxeroides from competition in open habitats to facilitation in vegetative habitats may be the main reason. Moreover, clonal integration significantly improved the growth of A. philoxeroides only in open habitats, especially with low propagule pressure, whereas it had no effects on the growth and competitive ability of A. philoxeroides in vegetative habitats, suggesting that clonal integration may be of most important for A. philoxeroides to explore new open space and spread. These findings suggest that propagule pressure may be crucial for the invasion success of A. philoxeroides, and such an effect also depends on habitat conditions. PMID:27200041

  20. Propagule Pressure, Habitat Conditions and Clonal Integration Influence the Establishment and Growth of an Invasive Clonal Plant, Alternanthera philoxeroides.


    You, Wen-Hua; Han, Cui-Min; Fang, Long-Xiang; Du, Dao-Lin


    Many notorious invasive plants are clonal, spreading mainly by vegetative propagules. Propagule pressure (the number of propagules) may affect the establishment, growth, and thus invasion success of these clonal plants, and such effects may also depend on habitat conditions. To understand how propagule pressure, habitat conditions and clonal integration affect the establishment and growth of the invasive clonal plants, an 8-week greenhouse with an invasive clonal plant, Alternanthera philoxeroides was conducted. High (five fragments) or low (one fragment) propagule pressure was established either in bare soil (open habitat) or dense native vegetation of Jussiaea repens (vegetative habitat), with the stolon connections either severed from or connected to the relatively older ramets. High propagule pressure greatly increased the establishment and growth of A. philoxeroides, especially when it grew in vegetative habitats. Surprisingly, high propagule pressure significantly reduced the growth of individual plants of A. philoxeroides in open habitats, whereas it did not affect the individual growth in vegetative habitats. A shift in the intraspecific interaction on A. philoxeroides from competition in open habitats to facilitation in vegetative habitats may be the main reason. Moreover, clonal integration significantly improved the growth of A. philoxeroides only in open habitats, especially with low propagule pressure, whereas it had no effects on the growth and competitive ability of A. philoxeroides in vegetative habitats, suggesting that clonal integration may be of most important for A. philoxeroides to explore new open space and spread. These findings suggest that propagule pressure may be crucial for the invasion success of A. philoxeroides, and such an effect also depends on habitat conditions. PMID:27200041

  1. Isolation and characterization of sulfite oxidase from Alligator mississipiensis

    SciTech Connect

    Robbins, A.; Neame, P.J.; Barber, M.J. )


    Sulfite oxidase has been isolated from fresh alligator liver using ammonium sulfate and acetone fractionation, DEAE chromatography and FPLC on Mono Q. The enzyme is dimeric and exhibits a subunit M. Wt. of approximately 58 kDa, larger than that of chicken SO. EPR spectroscopy of the partially-reduced enzyme revealed a single Mo(V) species while visible spectroscopy revealed the presence of cytochrome b{sub 557}. Maximal activities were obtained at pH 8 and 9, respectively. K{sub m}'s for SO{sub 3}{sup 2 {minus}}, cyt. c and Fe(CN){sub 6}{sup 3 {minus}} were 23.5 uM, 2.9 uM and 8.0 uM, respectively. Sequencing of peptides obtained by endoprotease K digestion indicated regions of extensive sequence similarity to chicken and rat enzymes in both heme and Mo-pterin domains. Regions of sequence dissimilarity were also found.

  2. Alligator rivers analogue project an OECD/NEA international project

    SciTech Connect

    Duerden, P.; Airey, P.; Pescatore, C.


    The Koongarra uranium deposit in the Alligator Rivers Region of the Northern Territory of Australia was studied as a natural analogue of the far field behaviour of high level waste repositories following groundwater ingress. A number of mathematical modelling approaches were developed for processes as diverse as groundwater transport, host rock weathering, radionuclide sorption, evolution of the uranium dispersion fan and the distribution of uranium series nuclides between mineral assemblages in weathered host rock. Some of these models are relevant to performance assessment at the level of individual processes and subsystem performance. Through the project, new insights into the application of the natural analogue approach to the assessment of potential waste repository sites were obtained.



    Horváth, E; Szabó, R


    The experiment was set up in an area of 9 ha that was split into 4 plots: in plot 1 the row spacing was 12 cm and the seeding rate was 10 kg; in plot 2 the row spacing was 24 cm and the seeding rate was 10 kg; in plot 3 the row spacing was 24 cm and the seeding rate was 8 kg; in plot 4 the row spacing was 12 cm and the seeding rate was 8 kg. After the weed surveying, the total weed coverage was established as follows: in plot 1 the total weed coverage was 11.34%, in plot 2 it was 12.3%, in plot 3 it was 18%, and in plot 4 the total weed coverage was 15%. Based on the weed survey, on the test area the following dicotyledon weeds belonging to the T4 Raunkiaer plant life-form category occupied the highest percentage: heal-all, black-bindweed, goosefoot. The proportion of the perennial dicotyledons: field bindweed (G3), tuberous pea (G1), white campion (H3) was negligible. In all four cases the weed control was executed using the same herbicide in the same doses and with regard to the weed species it showed the same level of efficiency. The smaller row spacing and higher seeding rate has a beneficial effect on the weed suppressing capacity of the crop, the crop's weed suppressing capacity is better and the development of the weeds becomes worse.

  4. A Chinese alligator in heliox: formant frequencies in a crocodilian

    PubMed Central

    Reber, Stephan A.; Nishimura, Takeshi; Janisch, Judith; Robertson, Mark; Fitch, W. Tecumseh


    ABSTRACT Crocodilians are among the most vocal non-avian reptiles. Adults of both sexes produce loud vocalizations known as ‘bellows’ year round, with the highest rate during the mating season. Although the specific function of these vocalizations remains unclear, they may advertise the caller's body size, because relative size differences strongly affect courtship and territorial behaviour in crocodilians. In mammals and birds, a common mechanism for producing honest acoustic signals of body size is via formant frequencies (vocal tract resonances). To our knowledge, formants have to date never been documented in any non-avian reptile, and formants do not seem to play a role in the vocalizations of anurans. We tested for formants in crocodilian vocalizations by using playbacks to induce a female Chinese alligator (Alligator sinensis) to bellow in an airtight chamber. During vocalizations, the animal inhaled either normal air or a helium/oxygen mixture (heliox) in which the velocity of sound is increased. Although heliox allows normal respiration, it alters the formant distribution of the sound spectrum. An acoustic analysis of the calls showed that the source signal components remained constant under both conditions, but an upward shift of high-energy frequency bands was observed in heliox. We conclude that these frequency bands represent formants. We suggest that crocodilian vocalizations could thus provide an acoustic indication of body size via formants. Because birds and crocodilians share a common ancestor with all dinosaurs, a better understanding of their vocal production systems may also provide insight into the communication of extinct Archosaurians. PMID:26246611

  5. A Chinese alligator in heliox: formant frequencies in a crocodilian.


    Reber, Stephan A; Nishimura, Takeshi; Janisch, Judith; Robertson, Mark; Fitch, W Tecumseh


    Crocodilians are among the most vocal non-avian reptiles. Adults of both sexes produce loud vocalizations known as 'bellows' year round, with the highest rate during the mating season. Although the specific function of these vocalizations remains unclear, they may advertise the caller's body size, because relative size differences strongly affect courtship and territorial behaviour in crocodilians. In mammals and birds, a common mechanism for producing honest acoustic signals of body size is via formant frequencies (vocal tract resonances). To our knowledge, formants have to date never been documented in any non-avian reptile, and formants do not seem to play a role in the vocalizations of anurans. We tested for formants in crocodilian vocalizations by using playbacks to induce a female Chinese alligator (Alligator sinensis) to bellow in an airtight chamber. During vocalizations, the animal inhaled either normal air or a helium/oxygen mixture (heliox) in which the velocity of sound is increased. Although heliox allows normal respiration, it alters the formant distribution of the sound spectrum. An acoustic analysis of the calls showed that the source signal components remained constant under both conditions, but an upward shift of high-energy frequency bands was observed in heliox. We conclude that these frequency bands represent formants. We suggest that crocodilian vocalizations could thus provide an acoustic indication of body size via formants. Because birds and crocodilians share a common ancestor with all dinosaurs, a better understanding of their vocal production systems may also provide insight into the communication of extinct Archosaurians. PMID:26246611

  6. Post-hatching development of Alligator mississippiensis ovary and testis

    PubMed Central

    Moore, Brandon C.; Hamlin, Heather J.; Botteri, Nicole L.; Lawler, Ashley N.; Mathavan, Ketan K.; Guillette, Louis J.


    We investigated ovary and testis development of Alligator mississippiensis during the first five months post-hatch. To better describe follicle assembly and seminiferous cord development, we employed histochemical techniques to detect carbohydrate-rich extracellular matrix components in one-week, one-month, three-month, and five-month-old gonads. We found profound morphological changes in both ovary and testis. During this time, oogenesis progressed up to diplotene arrest and meiotic germ cells increasingly interacted with follicular cells. Concomitant with follicles becoming invested with full complements of granulosa cells, a periodic acid Schiff’s (PAS)-positive basement membrane formed. As follicles enlarged and thecal layers were observed, basement membranes and thecal compartments gained periodic acid-methionine silver (PAMS)-reactive fibers. The ovarian medulla increased first PAS- and then PAMS-reactivity as it fragmented into wide lacunae lined with low cuboidal to squamous epithelia. During this same period, testicular germ cells found along the tubule margins were observed progressing from spermatogonia to round spermatids located within the center of tubules. Accompanying this meiotic development, interstitial Leydig cell clusters become more visible and testicular capsules thickened. During the observed testis development, the thickening tunica albuginea and widening interstitial tissues showed increasing PAS- and PAMS-reactivity. We observed putative inter-sex structures in both ovary and testis. On the coelomic aspect of testes were cell clusters with germ cell morphology and at the posterior end of ovaries, we observed “medullary rests” resembling immature testis cords. We hypothesize laboratory conditions accelerated gonad maturation due to optimum conditions, including nutrients and temperature. Laboratory alligators grew more rapidly and with increased body conditions compared to previous measured, field-caught animals. Additionally, we

  7. Weed control in herbaceous perennial container production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in container production of herbaceous perennials is difficult due to being grown primarily in enclosed production sites where traditional herbicides cannot be used, and due to sensitivity of these crops to traditional herbicides even when they are grown outdoors. Controlling weeds in h...

  8. Crop/weed discrimination in simulated images

    NASA Astrophysics Data System (ADS)

    Jones, G.; Gée, C.; Truchetet, F.


    In the context of site-specific weed management by vision systems, an efficient image processing for a crop/weed discrimination is required in order to quantify the Weed Infestation Rate (WIR) in an image. This paper presents a modeling of crop field in presence of different Weed Infestation Rates and a set of simulated agronomic images is used to test and validate the effectiveness of a crop/weed discrimination algorithm. For instance, an algorithm has been implemented to firstly detect the crop rows in the field by the use of a Hough Transform and secondly to detect plant areas by a region based-segmentation on binary images. This image processing has been tested on virtual cereal fields of a large field of view with perspective effects. The vegetation in the virtual field is modeled by a sowing pattern for crop plants and the weed spatial distribution is modeled by either a Poisson process or a Neyman-Scott cluster process. For each simulated image, a comparison between the initial and the detected weed infestation rate allows us to assess the accuracy of the algorithm. This comparison demonstrates an accuracy of better than 80% is possible, despite that intrarow weeds can not be detected from this spatial method.

  9. Weeding the Library Media Center Collections.

    ERIC Educational Resources Information Center

    Buckingham, Betty Jo

    These guidelines for weeding library media collections are addressed to elementary and secondary school library media centers and to community college and vocational school library resource centers in Iowa. The publication includes some philosophy about weeding, and specific guidelines are summarized in bold-faced type for ease of use. The…

  10. Thermal acclimation, mitochondrial capacities and organ metabolic profiles in a reptile (Alligator mississippiensis).


    Guderley, Helga; Seebacher, Frank


    Reptiles thermoregulate behaviourally, but change their preferred temperature and the optimal temperature for performance seasonally. We evaluated whether the digestive and locomotor systems of the alligator show parallel metabolic adjustments during thermal acclimation. To this end, we allowed juvenile alligators to grow under thermal conditions typical of winter and summer, providing them with seasonally appropriate basking opportunities. Although mean body temperatures of alligators in these groups differed by approximately 10°C, their growth and final anatomic status was equivalent. While hepatic mitochondria isolated from cold-acclimated alligators had higher oxidative capacities at 30°C than those from warm-acclimated alligators, the capacities did not differ at 20°C. Cold acclimation decreased maximal oxidative capacities of muscle mitochondria. For mitochondria from both organs and acclimation groups, palmitate increased oligomycin-inhibited respiration. GDP addition reduced palmitate-uncoupled rates more in liver mitochondria from warm- than cold-acclimated alligators. In muscle mitochondria, carboxyatractyloside significantly reduced palmitate-uncoupled rates. This effect was not changed by thermal acclimation. The aerobic capacity of liver, skeletal muscle and duodenum, as estimated by activities of cytochrome c oxidase (COX), increased with cold acclimation. At acclimation temperatures, the activities of COX and citrate synthase (CS) in these organs were equivalent. By measuring COX and CS in isolated mitochondria and tissue extracts, we estimated that cold acclimation did not change the mitochondrial content in liver, but increased that of muscle. The thermal compensation of growth rates and of the aerobic capacity of the locomotor and digestive systems suggests that alligators optimised metabolic processes for the seasonally altered, preferred body temperature. The precision of this compensatory response exceeds that typically shown by aquatic

  11. 50 CFR 23.70 - How can I trade internationally in American alligator and other crocodilian skins, parts, and...

    Code of Federal Regulations, 2014 CFR


    ... laws regulating harvest seasons and methods. (iii) Total allowable harvest of the species. (iv..., including harvest of nuisance alligators, methods used to determine harvest levels, demographics of the harvest, and methods used to determine the total number and population trends of alligators in the...

  12. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2012 CFR


    ... 33 Navigation and Navigable Waters 3 2012-07-01 2012-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  13. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2011 CFR


    ... 33 Navigation and Navigable Waters 3 2011-07-01 2011-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  14. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2014 CFR


    ... 33 Navigation and Navigable Waters 3 2014-07-01 2014-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  15. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Code of Federal Regulations, 2013 CFR


    ... 33 Navigation and Navigable Waters 3 2013-07-01 2013-07-01 false Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters...

  16. Chronic Ingestion of Coal Fly-Ash Contaminated Prey and Its Effects on Health and Immune Parameters in Juvenile American Alligators (Alligator mississippiensis).


    Finger, John W; Hamilton, Matthew T; Metts, Brian S; Glenn, Travis C; Tuberville, Tracey D


    Coal-burning power plants supply approximately 37 % of the electricity in the United States. However, incomplete combustion produces ash wastes enriched with toxic trace elements that have historically been disposed of in aquatic basins. Organisms inhabiting such habitats may accumulate these trace elements; however, studies investigating the effects on biota have been primarily restricted to shorter-lived, lower-trophic organisms. The American alligator (Alligator mississippiensis), a long-lived, top-trophic carnivore, has been observed inhabiting these basins, yet the health or immune effects of chronic exposure and possible accumulation remains unknown. In this study, we investigated how chronic dietary ingestion of prey contaminated with coal combustion wastes (CCWs) for 25 months, and subsequent accumulation of trace elements present in CCWs, affected juvenile alligator immune function and health. Alligators were assigned to one of four dietary-treatment groups including controls and those fed prey contaminated with CCWs for one, two, or three times a week. However, no effect of Dietary Treatment (p > 0.05) was observed on any immune parameter or hematological or plasma analyte we tested. Our results suggest that neither exposure to nor accumulation of low doses of CCWs had a negative effect on certain aspects of the immune and hematological system. However, future studies are required to elucidate this further. PMID:27475646

  17. Phase I and II liver enzyme activities in juvenile alligators (Alligator mississippiensis) collected from three sites in the Kissimmee-Everglades drainage, Florida (USA).


    Gunderson, M P; Oberdörster, E; Guillette, L J


    We examined CYP1A (measured using hepatic EROD and MROD activities) and glutathione-S-transferase (GST) activities in juvenile alligators (Alligator mississippiensis) collected from three sites with varying contamination in the Kissimmee-Everglades drainage in south Florida. We hypothesized that contaminants present in areas with intermediate or higher contaminant concentrations would alter hepatic enzyme activities in juvenile alligators from those sites when compared to hepatic enzyme activity in animals from the area with the least contamination. EROD activity was found to be higher in animals from the site with lower reported levels of contamination relative to those from the site with the highest reported contamination suggesting an inhibition of CYP1A expression or activity. No differences among animals from the three sites were observed for hepatic MROD and GST activities. A significant negative relationship between EROD, MROD, and GST activities and body size was exhibited in alligators from the site with the lowest contamination. No relationship between body size and hepatic enzyme activity was found in animals from the sites with intermediate and higher contamination, suggesting that contaminants present at these sites act to alter this relationship. No correlation was observed in this study between plasma steroid concentrations (estradiol-17 beta or testosterone) and hepatic EROD, MROD, or GST activities.

  18. Application of vascular aquatic plants for pollution removal, energy and food production in a biological system

    NASA Technical Reports Server (NTRS)

    Wolverton, B. C.; Barlow, R. M.; Mcdonald, R. C.


    Vascular aquatic plants such as water hyacinths (Eichhornia crassipes) (Mart.) Solms and alligator weeds (Alternanthera philoxeroides) (Mart.) Griesb., when utilized in a controlled biological system (including a regular program of harvesting to achieve maximum growth and pollution removal efficiency), may represent a remarkably efficient and inexpensive filtration and disposal system for toxic materials and sewage released into waters near urban and industrial areas. The harvested and processed plant materials are sources of energy, fertilizer, animal feed, and human food. Such a system has industrial, municipal, and agricultural applications.

  19. 7 CFR 360.200 - Designation of noxious weeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Designation of noxious weeds. 360.200 Section 360.200... SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.200 Designation of noxious weeds. The Administrator has determined that it is necessary to designate the following plants 1 as noxious weeds...

  20. 7 CFR 201.16 - Noxious-weed seeds.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and...

  1. 7 CFR 201.16 - Noxious-weed seeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and...

  2. 7 CFR 360.200 - Designation of noxious weeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Designation of noxious weeds. 360.200 Section 360.200... SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.200 Designation of noxious weeds. The Administrator has determined that it is necessary to designate the following plants 1 as noxious weeds...

  3. 7 CFR 360.200 - Designation of noxious weeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 5 2011-01-01 2011-01-01 false Designation of noxious weeds. 360.200 Section 360.200... SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.200 Designation of noxious weeds. The Administrator has determined that it is necessary to designate the following plants 1 as noxious weeds...

  4. 7 CFR 201.16 - Noxious-weed seeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and...

  5. 7 CFR 360.200 - Designation of noxious weeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Designation of noxious weeds. 360.200 Section 360.200... SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.200 Designation of noxious weeds. The Administrator has determined that it is necessary to designate the following plants 1 as noxious weeds...

  6. Weed Garden: An Effective Tool for Extension Education

    ERIC Educational Resources Information Center

    Beck, Leslie; Patton, Aaron J.


    A weed garden was constructed to quantify and improve identification skills among clientele. The garden was planted with over 100 weed species based on surveys on problematic weeds. The weed garden proved useful for introducing additional hands-on learning activities into traditional lecture-based seminars. Through seminar and field day attendee…

  7. 7 CFR 201.16 - Noxious-weed seeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and...

  8. 7 CFR 201.16 - Noxious-weed seeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and...

  9. Identifying soybean traits of interest for weed competition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Organic soybean producers rely on a variety of tactics for weed management. The use of soybean cultivars with enhanced ability to compete with weeds may increase weed control. Our objective was to identify genetic traits that may enhance soybean’s competitive ability to suppress weeds. Experimental ...

  10. Effects of egg and hatchling harvest on American alligators in Florida

    USGS Publications Warehouse

    Rice, K.G.; Percival, H.F.; Woodward, A.R.; Jennings, Michael L.


    Harvest of crocodilian eggs and young for captive rearing (ranching) has been used worldwide as an option for producing crocodilian skins and meat from wild stock. The long-term effects of harvesting a certain proportion of early age class, wild American alligators (Alligator mississippiensis) without repatriation is unknown. We removed an estimated 50% of annual production of alligators on Lakes Griffin and Jesup in central Florida over an 11-year period and monitored population levels via night-light counts. Densities of the total alligator population increased (P 0.117), and subadult (122-182 cm TL) alligators increased (P < 0.011) on harvest areas. The density of juveniles on the control area increased (P = 0.006), and the density of subadults showed some evidence of increasing (P = 0.088). No changes were detected in size distributions on the treatment areas. Nest production, as observed from aerial helicopter surveys, increased (P < 0.039) on Lake Woodruff NWR and Lake Jesup and showed some evidence of an increase on Lake Griffin (P = 0.098) during 1983-91. A 50% harvest rate of eggs or hatchlings did not adversely affect recruitment into the subadult or adult size classes.

  11. American alligator digestion rate of blue crabs and its implications for stomach contents analysis

    USGS Publications Warehouse

    Nifong, James C.; Rosenblatt, Adam E.; Johnson, Nathan A.; Barichivich, William; Silliman, Brian; Heithaus, Michael R.


    Stomach contents analysis (SCA) provides a snap-shot observation of a consumer's diet. Interpretation of SCA data can be complicated by many factors, including variation in gastric residence times and digestion rates among prey taxa. Although some SCA methods are reported to efficiently remove all stomach contents, the effectiveness of these techniques has rarely been tested for large irregular shaped prey with hard exoskeletons. We used a controlled feeding trial to estimate gastric residency time and decomposition rate of a large crustacean prey item, the Blue Crab (Callinectes sapidus), which is consumed by American Alligators (Alligator mississippiensis), an abundant apex predator in coastal habitats of the southeastern United States. The decomposition rate of C. sapidus in the stomachs of A. mississippiensis followed a predictable pattern, and some crab pieces remained in stomachs for at least 14 days. We also found that certain portions of C. sapidus were prone to becoming caught within the stomach or esophagus, meaning not all crab parts are consistently recovered using gastric lavage techniques. However, because the state of decomposition of crabs was predictable, it is possible to estimate time since consumption for crabs recovered from wild alligators. This information, coupled with a detailed understanding of crab distributions and alligator movement tactics could help elucidate patterns of cross-ecosystem foraging by the American Alligator in coastal habitats

  12. The influence of regional hydrology on nesting behavior and nest fate of the American alligator

    USGS Publications Warehouse

    Ugarte, Cristina A.; Bass, Oron L.; Nuttle, William; Mazzotti, Frank J.; Rice, Kenneth G.; Fujisaki, Ikuko; Whelan, Kevin R.T.


    Hydrologic conditions are critical to the nesting behavior and reproductive success of crocodilians. In South Florida, USA, growing human settlement has led to extensive surface water management and modification of historical water flows in the wetlands, which have affected regional nesting of the American alligator (Alligator mississippiensis). Although both natural and anthropogenic factors are considered to determine hydrologic conditions, the aspects of hydrological patterns that affect alligator nest effort, flooding (partial and complete), and failure (no hatchling) are unclear. We deconstructed annual hydrological patterns using harmonic models that estimated hydrological matrices including mean, amplitude, timing of peak, and periodicity of surface water depth and discharge and examined their effects on alligator nesting using survey data from Shark Slough, Everglades National Park, from 1985 to 2005. Nest effort increased in years with higher mean and lesser periodicity of water depth. A greater proportion of nests were flooded and failed when peak discharge occurred earlier in the year. Also, nest flooding rates were greater in years with greater periodicity of water depth, and nest failure rate was greater when mean discharge was higher. This study guides future water management decisions to mitigate negative impacts on reproduction of alligators and provides wildlife managers with a tool for assessing and modifying annual water management plans to conserve crocodilians and other wetland species.

  13. Body temperatures and behavior of American alligators during cold winter weather

    SciTech Connect

    Brisbin, I.L., Jr.; Standora, E.A.; Vargo, M.J.


    Data from two large (188 and 135 kg) male alligators (Alligator mississippiensis) indicated that 4-5 C seemed to be the lowest body temperatures that they could endure with subsequent recovery. Although one animal in shallow water managed to keep a breathing hole open for several days, in ice that was 1.5 cm thick, it later died following a decrease of its body temperature to 4.0 C. The second alligator which was located in a deeper portion of the reservoir used both terrestrial and aquatic basking behavior to raise its body temperature and level of activity. Except in the case of basking events, there was not clear evidence of significant evaluations of the body temperatures of either the live or dead alligators above those of their adjacent water. When located side-by-side, diurnal cycles of deep body temperatures exceeding adjacent water temperatures to a maximum extent near dawn and usually falling below water temperatures during the afternoon and early evening hours. The physical properties and thermal inertia of the bodies of such large alligators, when placed in appropriate microclimates, may be sufficient in themselves to explain the general patterns and levels of body temperature changes observed at these low temperatures.

  14. The effects of hurricane Rita and subsequent drought on alligators in southwest Louisiana.


    Lance, Valentine A; Elsey, Ruth M; Butterstein, George; Trosclair, Phillip L; Merchant, Mark


    Hurricane Rita struck the coast of southwest Louisiana in September 2005. The storm generated an enormous tidal surge of approximately four meters in height that inundated many thousands of acres of the coastal marsh with full strength seawater. The initial surge resulted in the deaths of a number of alligators and severely stressed those who survived. In addition, a prolonged drought (the lowest rainfall in 111 years of recorded weather data) following the hurricane resulted in highly saline conditions that persisted in the marsh for several months. We had the opportunity to collect 11 blood samples from alligators located on Holly Beach less than a month after the hurricane, but were unable to collect samples from alligators on Rockefeller Wildlife Refuge until February 2006. Conditions at Rockefeller Refuge did not permit systematic sampling, but a total of 201 samples were collected on the refuge up through August 2006. The blood samples were analyzed for sodium, potassium, chloride, osmolality, and corticosterone. Blood samples from alligators sampled on Holly Beach in October 2005, showed a marked elevation in plasma osmolality, sodium, chloride, potassium, corticosterone, and an elevated heterophil/lymphocyte ratio. Blood samples from alligators on Rockefeller Refuge showed increasing levels of corticosterone as the drought persisted and elevated osmolality and electrolytes. After substantial rainfall in July and August, these indices of osmotic stress returned to within normal limits.

  15. Animal-borne imaging reveals novel insights into the foraging behaviors and Diel activity of a large-bodied apex predator, the American alligator (Alligator mississippiensis).


    Nifong, James C; Nifong, Rachel L; Silliman, Brian R; Lowers, Russell H; Guillette, Louis J; Ferguson, Jake M; Welsh, Matthew; Abernathy, Kyler; Marshall, Greg


    Large-bodied, top- and apex predators (e.g., crocodilians, sharks, wolves, killer whales) can exert strong top-down effects within ecological communities through their interactions with prey. Due to inherent difficulties while studying the behavior of these often dangerous predatory species, relatively little is known regarding their feeding behaviors and activity patterns, information that is essential to understanding their role in regulating food web dynamics and ecological processes. Here we use animal-borne imaging systems (Crittercam) to study the foraging behavior and activity patterns of a cryptic, large-bodied predator, the American alligator (Alligator mississippiensis) in two estuaries of coastal Florida, USA. Using retrieved video data we examine the variation in foraging behaviors and activity patterns due to abiotic factors. We found the frequency of prey-attacks (mean = 0.49 prey attacks/hour) as well as the probability of prey-capture success (mean = 0.52 per attack) were significantly affected by time of day. Alligators attempted to capture prey most frequently during the night. Probability of prey-capture success per attack was highest during morning hours and sequentially lower during day, night, and sunset, respectively. Position in the water column also significantly affected prey-capture success, as individuals' experienced two-fold greater success when attacking prey while submerged. These estimates are the first for wild adult American alligators and one of the few examples for any crocodilian species worldwide. More broadly, these results reveal that our understandings of crocodilian foraging behaviors are biased due to previous studies containing limited observations of cryptic and nocturnal foraging interactions. Our results can be used to inform greater understanding regarding the top-down effects of American alligators in estuarine food webs. Additionally, our results highlight the importance and power of using animal-borne imaging when

  16. Molecular cloning, characterization, tissue distribution and mRNA expression changes during the hibernation and reproductive periods of estrogen receptor alpha (ESR1) in Chinese alligator, Alligator sinensis.


    Zhang, Ruidong; Hu, Yuehong; Wang, Huan; Yan, Peng; Zhou, Yongkang; Wu, Rong; Wu, Xiaobing


    Chinese alligator, Alligator sinensis, is a critically endangered reptile species unique to China. Little is known about the mechanism of growth- and reproduction-related hormones gene expression in Chinese alligator. Estrogens play important roles in regulating multiple reproduction- and non-reproduction-related functions by binding to their corresponding receptors. Here, the full-length cDNA of estrogen receptor alpha (ERα/ESR1) was cloned and sequenced from Chinese alligator for the first time, which comprises 1764bp nucleotides and encodes a predicted protein of 587 amino acids. Phylogenetic analysis of ESR1 showed that crocodilians and turtles were the sister-group of birds. The results of real-time quantitative PCR indicated that the ESR1 mRNA was widely expressed in the brain and peripheral tissues. In the brain and pituitary gland, ESR1 was most highly transcribed in the cerebellum. But in other peripheral tissues, ESR1 mRNA expression level was the highest in the ovary. Compared with hibernation period, ESR1 mRNA expression levels were increased significantly in the reproductive period (P<0.05) in cerebellum, pituitary gland, liver, spleen, lung, kidney and ovary, while no significant change in other examined tissues (P>0.05). The ESR1 mRNA expression levels changes during the two periods of different tissues suggested that ESR1 might play an important role in mediation of estrogenic multiple reproductive effects in Chinese alligator. Furthermore, it was the first time to quantify ESR1 mRNA level in the brain of crocodilians, and the distribution and expression of ESR1 mRNA in the midbrain, cerebellum and medulla oblongata was also reported for the first time in reptiles. PMID:27212643

  17. Animal-Borne Imaging Reveals Novel Insights into the Foraging Behaviors and Diel Activity of a Large-Bodied Apex Predator, the American Alligator (Alligator mississippiensis)

    PubMed Central

    Nifong, James C.; Nifong, Rachel L.; Silliman, Brian R.; Lowers, Russell H.; Guillette, Louis J.; Ferguson, Jake M.; Welsh, Matthew; Abernathy, Kyler; Marshall, Greg


    Large-bodied, top- and apex predators (e.g., crocodilians, sharks, wolves, killer whales) can exert strong top-down effects within ecological communities through their interactions with prey. Due to inherent difficulties while studying the behavior of these often dangerous predatory species, relatively little is known regarding their feeding behaviors and activity patterns, information that is essential to understanding their role in regulating food web dynamics and ecological processes. Here we use animal-borne imaging systems (Crittercam) to study the foraging behavior and activity patterns of a cryptic, large-bodied predator, the American alligator (Alligator mississippiensis) in two estuaries of coastal Florida, USA. Using retrieved video data we examine the variation in foraging behaviors and activity patterns due to abiotic factors. We found the frequency of prey-attacks (mean = 0.49 prey attacks/hour) as well as the probability of prey-capture success (mean = 0.52 per attack) were significantly affected by time of day. Alligators attempted to capture prey most frequently during the night. Probability of prey-capture success per attack was highest during morning hours and sequentially lower during day, night, and sunset, respectively. Position in the water column also significantly affected prey-capture success, as individuals’ experienced two-fold greater success when attacking prey while submerged. These estimates are the first for wild adult American alligators and one of the few examples for any crocodilian species worldwide. More broadly, these results reveal that our understandings of crocodilian foraging behaviors are biased due to previous studies containing limited observations of cryptic and nocturnal foraging interactions. Our results can be used to inform greater understanding regarding the top-down effects of American alligators in estuarine food webs. Additionally, our results highlight the importance and power of using animal

  18. Weed seeds on clothing: a global review.


    Ansong, Michael; Pickering, Catherine


    Weeds are a major threat to biodiversity including in areas of high conservation value. Unfortunately, people may be unintentionally introducing and dispersing weed seeds on their clothing when they visit these areas. To inform the management of these areas, we conducted a systematic quantitative literature review to determine the diversity and characteristics of species with seeds that can attach and be dispersed from clothing. Across 21 studies identified from systematic literature searches on this topic, seeds from 449 species have been recorded on clothing, more than double the diversity found in a previous review. Nearly all of them, 391 species, are listed weeds in one or more countries, with 58 classified as internationally-recognised environmental weeds. When our database was compared with weed lists from different countries and continents we found that clothing can carry the seeds of important regional weeds. A total of 287 of the species are listed as aliens in one or more countries in Europe, 156 are invasive species/noxious weeds in North America, 211 are naturalized alien plants in Australia, 97 are alien species in India, 33 are invasive species in China and 5 are declared weeds/invaders in South Africa. Seeds on the clothing of hikers can be carried to an average distance of 13 km, and where people travel in cars, trains, planes and boats, the seeds on their clothing can be carried much further. Factors that affect this type of seed dispersal include the type of clothing, the type of material the clothing is made from, the number and location of the seeds on plants, and seed traits such as adhesive and attachment structures. With increasing use of protected areas by tourists, including in remote regions, popular protected areas may be at great risk of biological invasions by weeds with seeds carried on clothing.

  19. Coplanar PCB distribution between chorioallantoic membranes and eggs of alligators and Loggerhead sea turtles

    SciTech Connect

    Bargar, T.A.; Cobb, G.P.


    The relative distribution of coplanar polychlorinated biphenyls (PCBs) between chorioallantoic membranes (CAMS) and eggs was investigated in inviable American alligator (Alligator mississippiensis) and Loggerhead sea turtle (Caretta caretra) eggs. Cam and egg extracts were fractionated by HPLC using a porous graphitic column (PGC) and an in line switching valve to separate coplanar from non-coplanar PCBs. The fractions were collected, concentrated by nitrogen evaporation, and injected on GC-ECD (60M DB-5 capillary column) for quantification. Alligator and Loggerhead sea turtle eggs contain toxicologically significant coplanar PCBs. Mono-ortho substituted PCBs were present with greater frequency relative to non-ortho substituted PCBs in both eggs and CAMS. The presence of coplanar PCBs in eggs appears to be correlated to coplanar PCB presence in CAMS. The chorioallantoic membrane could serve as a biomarker of embryo exposure to coplanar PCBs.

  20. American alligator proximal pedal phalanges resemble human finger bones: Diagnostic criteria for forensic investigators.


    Ferraro, Joseph V; Binetti, Katie M


    A scientific approach to bone and tooth identification requires analysts to pursue the goal of empirical falsification. That is, they may attribute a questioned specimen to element and taxon only after having ruled out all other possible attributions. This requires analysts to possess a thorough understanding of both human and non-human osteology, particularly so for remains that may be morphologically similar across taxa. To date, forensic anthropologists have identified several potential 'mimics' for human skeletal remains, including pig teeth and bear paws. Here we document another possible mimic for isolated human skeletal elements--the proximal pedal phalanges of American alligators (Alligator mississippiensis) closely resemble the proximal and intermediate hand phalanges of adult humans. We detail morphological similarities and differences between these elements, with the goal of providing sufficient information for investigators to confidently falsify the hypothesis that a questioned phalanx is derived from an American alligator.

  1. [Comparison of the genome of the alligator gar with the genomes of several other fish].


    Kedrova, O S; Vladychenskaia, N S; Antonov, A S


    Hybridization of alligator gar (Lepisosteus osseus, Lepisosteiformes, Ganoidomorpha) [125I]- or [3H]DNA fractions with DNAs of more or less phylogenetically related fishes was studied. Almost all of the repeated and unique sequences of alligator gar DNA and DNA of the spotted gar (from the same genus) are highly homologous (1-2% of nucleotide substitutions). The degrees of homology between repeated and unique sequences of alligator gar DNA and DNAs of the representatives of Acipenseriformes (the same super-order Ganoidomorpha), Latimeria chalumnae (another subclass, Sarcopterygii) and a shark (another class, Chondrichthyes) are of the same order, and the levels of divergency of their DNAs sequences are similar. These results demonstrate, that the joining of Lepisosteiformes and Acipenseriformes in one and the same group of Ganoidomorpha is artificial, and that the superclass of fishes, Pisces, includes more taxons of the class rank then it has been taken in theory. PMID:6855763

  2. [Comparison of the genome of the alligator gar with the genomes of several other fish].


    Kedrova, O S; Vladychenskaia, N S; Antonov, A S


    Hybridization of alligator gar (Lepisosteus osseus, Lepisosteiformes, Ganoidomorpha) [125I]- or [3H]DNA fractions with DNAs of more or less phylogenetically related fishes was studied. Almost all of the repeated and unique sequences of alligator gar DNA and DNA of the spotted gar (from the same genus) are highly homologous (1-2% of nucleotide substitutions). The degrees of homology between repeated and unique sequences of alligator gar DNA and DNAs of the representatives of Acipenseriformes (the same super-order Ganoidomorpha), Latimeria chalumnae (another subclass, Sarcopterygii) and a shark (another class, Chondrichthyes) are of the same order, and the levels of divergency of their DNAs sequences are similar. These results demonstrate, that the joining of Lepisosteiformes and Acipenseriformes in one and the same group of Ganoidomorpha is artificial, and that the superclass of fishes, Pisces, includes more taxons of the class rank then it has been taken in theory.

  3. Using Weeds and Wildflowers to Study Plants.

    ERIC Educational Resources Information Center

    Nowak, Nancy


    Offers suggestions for activities in which local weeds and wildflowers are used to study a variety of topics. These topics include classification, ecological succession, and mapping. Also lists the types of experiments students can perform with these plants. (JN)

  4. Dujardinascaris gigantea sp. n. (Nematoda: Ascaridida) from the critically endangered crocodile Alligator sinensis Fauvel (Reptilia: Crocodylia).


    Zhao, Jin-Hong; Li, Liang; Guo, Yan-Ning; Zhang, Lu-Ping


    The Chinese alligator Alligator sinensis Fauvel (Reptilia: Crocodylia) is considered as one of the most critically endangered species of the 23 extant crocodiles. However, our knowledge of the helminth parasites of this rare animal is completely lacking. During a helminthological survey of reptiles in China, we found a new ascaridoid nematode, Dujardinascaris gigantea sp. n. from A. sinensis. The morphology of D. gigantea sp. n. was studied using light and scanning electron microscopy. The new species was also characterised using molecular methods by sequencing and analysing the small ribosomal DNA (18S) and the second internal transcribed spacer (ITS-2).

  5. Patterns of sexual dimorphism in Mexican alligator lizards, Barisia imbricata

    PubMed Central

    Dashevsky, Daniel; Meik, Jesse M; Mociño-Deloya, Estrella; Setser, Kirk; Schaack, Sarah


    We compare morphological characteristics of male and female Barisia imbricata, Mexican alligator lizards, and find that mass, head length, coloration, incidence of scars from conspecifics, tail loss, and frequency of bearing the color/pattern of the opposite sex are all sexually dimorphic traits. Overall size (measured as snout–vent length), on the other hand, is not different between the two sexes. We use data on bite scar frequency and fecundity to evaluate competing hypotheses regarding the selective forces driving these patterns. We contend that sexual selection, acting through male-male competition, may favor larger mass and head size in males, whereas large females are likely favored by natural selection for greater fecundity. In addition, the frequency of opposite-sex patterning in males versus females may indicate that the costs of agonistic interactions among males are severe enough to allow for an alternative mating strategy. Finally, we discuss how sexual and natural selective forces may interact to drive or mask the evolution of sexually dimorphic traits. PMID:23467394

  6. Global perspective of herbicide-resistant weeds.


    Heap, Ian


    Two hundred and twenty weed species have evolved resistance to one or more herbicides, and there are now 404 unique cases (species × site of action) of herbicide-resistant weeds globally. ALS inhibitor-resistant weeds account for about a third of all cases (133/404) and are particularly troublesome in rice and cereals. Although 71 weed species have been identified with triazine resistance, their importance has dwindled with the shift towards Roundup Ready® crops in the USA and the reduction of triazine usage in Europe. Forty-three grasses have evolved resistance to ACCase inhibitors, with the most serious cases being Avena spp., Lolium spp., Phalaris spp., Setaria spp. and Alopecurus myosuroides, infesting more than 25 million hectares of cereal production globally. Of the 24 weed species with glyphosate resistance, 16 have been found in Roundup Ready® cropping systems. Although Conyza canadensis is the most widespread glyphosate-resistant weed, Amaranthus palmeri and Amaranthus tuberculartus are the two most economically important glyphosate-resistant weeds because of the area they infest and the fact that these species have evolved resistance to numerous other herbicide sites of action, leaving growers with few herbicidal options for their control. The agricultural chemical industry has not brought any new herbicides with novel sites of action to market in over 30 years, making growers reliant on using existing herbicides in new ways. In addition, tougher registration and environmental regulations on herbicides have resulted in a loss of some herbicides, particularly in Europe. The lack of novel herbicide chemistries being brought to market combined with the rapid increase in multiple resistance in weeds threatens crop production worldwide.

  7. Combining a weed traits database with a population dynamics model predicts shifts in weed communities

    PubMed Central

    Storkey, J; Holst, N; Bøjer, O Q; Bigongiali, F; Bocci, G; Colbach, N; Dorner, Z; Riemens, M M; Sartorato, I; Sønderskov, M; Verschwele, A


    A functional approach to predicting shifts in weed floras in response to management or environmental change requires the combination of data on weed traits with analytical frameworks that capture the filtering effect of selection pressures on traits. A weed traits database (WTDB) was designed, populated and analysed, initially using data for 19 common European weeds, to begin to consolidate trait data in a single repository. The initial choice of traits was driven by the requirements of empirical models of weed population dynamics to identify correlations between traits and model parameters. These relationships were used to build a generic model, operating at the level of functional traits, to simulate the impact of increasing herbicide and fertiliser use on virtual weeds along gradients of seed weight and maximum height. The model generated ‘fitness contours’ (defined as population growth rates) within this trait space in different scenarios, onto which two sets of weed species, defined as common or declining in the UK, were mapped. The effect of increasing inputs on the weed flora was successfully simulated; 77% of common species were predicted to have stable or increasing populations under high fertiliser and herbicide use, in contrast with only 29% of the species that have declined. Future development of the WTDB will aim to increase the number of species covered, incorporate a wider range of traits and analyse intraspecific variability under contrasting management and environments. PMID:26190870

  8. Weed escapes and delayed weed emergence in glyphosate-resistant soybean

    Technology Transfer Automated Retrieval System (TEKTRAN)

    During 2001 and 2002, field experiments were conducted in soybean crops at four Minnesota locations with the aim of studying the effects of different glyphosate treatments (one-pass glyphosate, two-pass glyphosate) on weed control and weed community composition by focusing on the identity and abunda...

  9. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser.


    Hamilton, Matthew T; Finger, John W; Winzeler, Megan E; Tuberville, Tracey D


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3 (-)), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F 2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. Lastly, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood. PMID:27382469

  10. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser

    SciTech Connect

    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3₋), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. In conclusion, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood.

  11. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser


    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressuremore » of carbon dioxide (PCO2), bicarbonate (HCO3₋), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. In conclusion, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood.« less

  12. Evaluating the effect of sample type on American alligator (Alligator mississippiensis) analyte values in a point-of-care blood analyser

    PubMed Central

    Hamilton, Matthew T.; Finger, John W.; Winzeler, Megan E.; Tuberville, Tracey D.


    The assessment of wildlife health has been enhanced by the ability of point-of-care (POC) blood analysers to provide biochemical analyses of non-domesticated animals in the field. However, environmental limitations (e.g. temperature, atmospheric humidity and rain) and lack of reference values may inhibit researchers from using such a device with certain wildlife species. Evaluating the use of alternative sample types, such as plasma, in a POC device may afford researchers the opportunity to delay sample analysis and the ability to use banked samples. In this study, we examined fresh whole blood, fresh plasma and frozen plasma (sample type) pH, partial pressure of carbon dioxide (PCO2), bicarbonate (HCO3−), total carbon dioxide (TCO2), base excess (BE), partial pressure of oxygen (PO2), oxygen saturation (sO2) and lactate concentrations in 23 juvenile American alligators (Alligator mississippiensis) using an i-STAT CG4+ cartridge. Our results indicate that sample type had no effect on lactate concentration values (F2,65 = 0.37, P = 0.963), suggesting that the i-STAT analyser can be used reliably to quantify lactate concentrations in fresh and frozen plasma samples. In contrast, the other seven blood parameters measured by the CG4+ cartridge were significantly affected by sample type. Lastly, we were able to collect blood samples from all alligators within 2 min of capture to establish preliminary reference ranges for juvenile alligators based on values obtained using fresh whole blood. PMID:27382469

  13. Follicle-stimulating hormone receptor (FSHR) in Chinese alligator, Alligator sinensis: molecular characterization, tissue distribution and mRNA expression changes during the female reproductive cycle.


    Zhang, Rui; Zhang, Shengzhou; Zhu, Xue; Zhou, Yongkang; Wu, Xiaobing


    The follicle-stimulating hormone (FSH) plays a central role in vertebrate reproduction, with the actions of FSH mediated by FSH receptors (FSHRs) on the granulosa cells of the ovary. The present study reports the cloning and characterization of FSHR in Chinese alligator, Alligator sinensis (caFSHR), and its tissue distribution and mRNA expression changes during the reproductive cycle. The mature protein of caFSHR displays typical features of the glycoprotein hormone receptor family, but also contains some remarkable differences when compared with other vertebrate FSHRs. The deduced amino acid sequence of the caFSHR shares identity of 85% with Chinese softshell turtle, 84-87% with birds, 77-78% with mammals, 67-73% with amphibians and 51-58% with fishes. Phylogenetic tree analysis of the FSHR amino acid sequence indicated that alligators cluster into the bird branch. Tissue expression analysis showed that caFSHR was not only expressed in the ovary, but also in the stomach, intestine, pancreas liver and oviduct at similar levels, while it was not detectable in heart, thymus or thyroid. Expression of caFSHR in the ovary is high in May (breeding prophase) and peaks in July during the breeding period, where it is maintained at high levels through September (breeding anaphase). Expression decreases significantly in November (hibernating period) and then remains relatively low from January to March (hibernating period). These temporal changes in FSHR expression suggest that it plays an important role in promoting ovarian development during the female reproductive cycle of Chinese alligator. PMID:25765682

  14. Ecological Intensification Through Pesticide Reduction: Weed Control, Weed Biodiversity and Sustainability in Arable Farming

    NASA Astrophysics Data System (ADS)

    Petit, Sandrine; Munier-Jolain, Nicolas; Bretagnolle, Vincent; Bockstaller, Christian; Gaba, Sabrina; Cordeau, Stéphane; Lechenet, Martin; Mézière, Delphine; Colbach, Nathalie


    Amongst the biodiversity components of agriculture, weeds are an interesting model for exploring management options relying on the principle of ecological intensification in arable farming. Weeds can cause severe crop yield losses, contribute to farmland functional biodiversity and are strongly associated with the generic issue of pesticide use. In this paper, we address the impacts of herbicide reduction following a causal framework starting with herbicide reduction and triggering changes in (i) the management options required to control weeds, (ii) the weed communities and functions they provide and (iii) the overall performance and sustainability of the implemented land management options. The three components of this framework were analysed in a multidisciplinary project that was conducted on 55 experimental and farmer's fields that included conventional, integrated and organic cropping systems. Our results indicate that the reduction of herbicide use is not antagonistic with crop production, provided that alternative practices are put into place. Herbicide reduction and associated land management modified the composition of in-field weed communities and thus the functions of weeds related to biodiversity and production. Through a long-term simulation of weed communities based on alternative (?) cropping systems, some specific management pathways were identified that delivered high biodiversity gains and limited the negative impacts of weeds on crop production. Finally, the multi-criteria assessment of the environmental, economic and societal sustainability of the 55 systems suggests that integrated weed management systems fared better than their conventional and organic counterparts. These outcomes suggest that sustainable management could possibly be achieved through changes in weed management, along a pathway starting with herbicide reduction.

  15. Ecological Intensification Through Pesticide Reduction: Weed Control, Weed Biodiversity and Sustainability in Arable Farming.


    Petit, Sandrine; Munier-Jolain, Nicolas; Bretagnolle, Vincent; Bockstaller, Christian; Gaba, Sabrina; Cordeau, Stéphane; Lechenet, Martin; Mézière, Delphine; Colbach, Nathalie


    Amongst the biodiversity components of agriculture, weeds are an interesting model for exploring management options relying on the principle of ecological intensification in arable farming. Weeds can cause severe crop yield losses, contribute to farmland functional biodiversity and are strongly associated with the generic issue of pesticide use. In this paper, we address the impacts of herbicide reduction following a causal framework starting with herbicide reduction and triggering changes in (i) the management options required to control weeds, (ii) the weed communities and functions they provide and (iii) the overall performance and sustainability of the implemented land management options. The three components of this framework were analysed in a multidisciplinary project that was conducted on 55 experimental and farmer's fields that included conventional, integrated and organic cropping systems. Our results indicate that the reduction of herbicide use is not antagonistic with crop production, provided that alternative practices are put into place. Herbicide reduction and associated land management modified the composition of in-field weed communities and thus the functions of weeds related to biodiversity and production. Through a long-term simulation of weed communities based on alternative (?) cropping systems, some specific management pathways were identified that delivered high biodiversity gains and limited the negative impacts of weeds on crop production. Finally, the multi-criteria assessment of the environmental, economic and societal sustainability of the 55 systems suggests that integrated weed management systems fared better than their conventional and organic counterparts. These outcomes suggest that sustainable management could possibly be achieved through changes in weed management, along a pathway starting with herbicide reduction.

  16. Ecological Intensification Through Pesticide Reduction: Weed Control, Weed Biodiversity and Sustainability in Arable Farming.


    Petit, Sandrine; Munier-Jolain, Nicolas; Bretagnolle, Vincent; Bockstaller, Christian; Gaba, Sabrina; Cordeau, Stéphane; Lechenet, Martin; Mézière, Delphine; Colbach, Nathalie


    Amongst the biodiversity components of agriculture, weeds are an interesting model for exploring management options relying on the principle of ecological intensification in arable farming. Weeds can cause severe crop yield losses, contribute to farmland functional biodiversity and are strongly associated with the generic issue of pesticide use. In this paper, we address the impacts of herbicide reduction following a causal framework starting with herbicide reduction and triggering changes in (i) the management options required to control weeds, (ii) the weed communities and functions they provide and (iii) the overall performance and sustainability of the implemented land management options. The three components of this framework were analysed in a multidisciplinary project that was conducted on 55 experimental and farmer's fields that included conventional, integrated and organic cropping systems. Our results indicate that the reduction of herbicide use is not antagonistic with crop production, provided that alternative practices are put into place. Herbicide reduction and associated land management modified the composition of in-field weed communities and thus the functions of weeds related to biodiversity and production. Through a long-term simulation of weed communities based on alternative (?) cropping systems, some specific management pathways were identified that delivered high biodiversity gains and limited the negative impacts of weeds on crop production. Finally, the multi-criteria assessment of the environmental, economic and societal sustainability of the 55 systems suggests that integrated weed management systems fared better than their conventional and organic counterparts. These outcomes suggest that sustainable management could possibly be achieved through changes in weed management, along a pathway starting with herbicide reduction. PMID:26071767

  17. The Relative Importance of Genetic Diversity and Phenotypic Plasticity in Determining Invasion Success of a Clonal Weed in the USA and China.


    Geng, Yupeng; van Klinken, Rieks D; Sosa, Alejandro; Li, Bo; Chen, Jiakuan; Xu, Cheng-Yuan


    Phenotypic plasticity has been proposed as an important adaptive strategy for clonal plants in heterogeneous habitats. Increased phenotypic plasticity can be especially beneficial for invasive clonal plants, allowing them to colonize new environments even when genetic diversity is low. However, the relative importance of genetic diversity and phenotypic plasticity for invasion success remains largely unknown. Here, we performed molecular marker analyses and a common garden experiment to investigate the genetic diversity and phenotypic plasticity of the globally important weed Alternanthera philoxeroides in response to different water availability (terrestrial vs. aquatic habitats). This species relies predominantly on clonal propagation in introduced ranges. We therefore expected genetic diversity to be restricted in the two sampled introduced ranges (the USA and China) when compared to the native range (Argentina), but that phenotypic plasticity may allow the species' full niche range to nonetheless be exploited. We found clones from China had very low genetic diversity in terms of both marker diversity and quantitative variation when compared with those from the USA and Argentina, probably reflecting different introduction histories. In contrast, similar patterns of phenotypic plasticity were found for clones from all three regions. Furthermore, despite the different levels of genetic diversity, bioclimatic modeling suggested that the full potential bioclimatic distribution had been invaded in both China and USA. Phenotypic plasticity, not genetic diversity, was therefore critical in allowing A. philoxeroides to invade diverse habitats across broad geographic areas.

  18. The Relative Importance of Genetic Diversity and Phenotypic Plasticity in Determining Invasion Success of a Clonal Weed in the USA and China

    PubMed Central

    Geng, Yupeng; van Klinken, Rieks D.; Sosa, Alejandro; Li, Bo; Chen, Jiakuan; Xu, Cheng-Yuan


    Phenotypic plasticity has been proposed as an important adaptive strategy for clonal plants in heterogeneous habitats. Increased phenotypic plasticity can be especially beneficial for invasive clonal plants, allowing them to colonize new environments even when genetic diversity is low. However, the relative importance of genetic diversity and phenotypic plasticity for invasion success remains largely unknown. Here, we performed molecular marker analyses and a common garden experiment to investigate the genetic diversity and phenotypic plasticity of the globally important weed Alternanthera philoxeroides in response to different water availability (terrestrial vs. aquatic habitats). This species relies predominantly on clonal propagation in introduced ranges. We therefore expected genetic diversity to be restricted in the two sampled introduced ranges (the USA and China) when compared to the native range (Argentina), but that phenotypic plasticity may allow the species' full niche range to nonetheless be exploited. We found clones from China had very low genetic diversity in terms of both marker diversity and quantitative variation when compared with those from the USA and Argentina, probably reflecting different introduction histories. In contrast, similar patterns of phenotypic plasticity were found for clones from all three regions. Furthermore, despite the different levels of genetic diversity, bioclimatic modeling suggested that the full potential bioclimatic distribution had been invaded in both China and USA. Phenotypic plasticity, not genetic diversity, was therefore critical in allowing A. philoxeroides to invade diverse habitats across broad geographic areas. PMID:26941769

  19. The Relative Importance of Genetic Diversity and Phenotypic Plasticity in Determining Invasion Success of a Clonal Weed in the USA and China.


    Geng, Yupeng; van Klinken, Rieks D; Sosa, Alejandro; Li, Bo; Chen, Jiakuan; Xu, Cheng-Yuan


    Phenotypic plasticity has been proposed as an important adaptive strategy for clonal plants in heterogeneous habitats. Increased phenotypic plasticity can be especially beneficial for invasive clonal plants, allowing them to colonize new environments even when genetic diversity is low. However, the relative importance of genetic diversity and phenotypic plasticity for invasion success remains largely unknown. Here, we performed molecular marker analyses and a common garden experiment to investigate the genetic diversity and phenotypic plasticity of the globally important weed Alternanthera philoxeroides in response to different water availability (terrestrial vs. aquatic habitats). This species relies predominantly on clonal propagation in introduced ranges. We therefore expected genetic diversity to be restricted in the two sampled introduced ranges (the USA and China) when compared to the native range (Argentina), but that phenotypic plasticity may allow the species' full niche range to nonetheless be exploited. We found clones from China had very low genetic diversity in terms of both marker diversity and quantitative variation when compared with those from the USA and Argentina, probably reflecting different introduction histories. In contrast, similar patterns of phenotypic plasticity were found for clones from all three regions. Furthermore, despite the different levels of genetic diversity, bioclimatic modeling suggested that the full potential bioclimatic distribution had been invaded in both China and USA. Phenotypic plasticity, not genetic diversity, was therefore critical in allowing A. philoxeroides to invade diverse habitats across broad geographic areas. PMID:26941769

  20. A group of alligators basks in the sun and rest in the water at KSC.

    NASA Technical Reports Server (NTRS)


    This pond near Schwartz Rd. at Kennedy Space Center is host to a least the nine alligators shown on the banks and in the water. Nearly 5,000 alligators can be found in canals, ponds, and waterways throughout the Center and the Merritt Island National Wildlife Refuge, which shares a boundary with the Center. American alligators feed and rest in the water, and lay their eggs in dens they dig into the banks. The young alligators spend their first several weeks in these dens. The Wildlife Refuge encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

  1. TRPV4 associates environmental temperature and sex determination in the American alligator

    PubMed Central

    Yatsu, Ryohei; Miyagawa, Shinichi; Kohno, Satomi; Saito, Shigeru; Lowers, Russell H.; Ogino, Yukiko; Fukuta, Naomi; Katsu, Yoshinao; Ohta, Yasuhiko; Tominaga, Makoto; Guillette Jr, Louis J.; Iguchi, Taisen


    Temperature-dependent sex determination (TSD), commonly found among reptiles, is a sex determination mode in which the incubation temperature during a critical temperature sensitive period (TSP) determines sexual fate of the individual rather than the individual’s genotypic background. In the American alligator (Alligator mississippiensis), eggs incubated during the TSP at 33 °C (male producing temperature: MPT) yields male offspring, whereas incubation temperatures below 30 °C (female producing temperature: FPT) lead to female offspring. However, many of the details of the underlying molecular mechanism remains elusive, and the molecular link between environmental temperature and sex determination pathway is yet to be elucidated. Here we show the alligator TRPV4 ortholog (AmTRPV4) to be activated at temperatures proximate to the TSD-related temperature in alligators, and using pharmacological exposure, we show that AmTRPV4 channel activity affects gene expression patterns associated with male differentiation. This is the first experimental demonstration of a link between a well-described thermo-sensory mechanism, TRPV4 channel, and its potential role in regulation of TSD in vertebrates, shedding unique new light on the elusive TSD molecular mechanism. PMID:26677944

  2. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula.


    Schwarz, Daniel E; Allen, Peter J


    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth rates and ionic and osmoregulation, juvenile alligator gar (330 days after hatch; 185 g) were exposed to 4 different salinities (0, 8, 16, and 24 ppt) for a 30-day period. Specific growth rate, plasma osmolality and ion concentrations, gill and gastrointestinal tract Na(+), K(+)-ATPase activities, and drinking rate were compared. Juvenile alligator gar were able to tolerate hyperosmotic salinities up to 24 ppt for a 30 day period, albeit with decreased growth resulting largely from decreased food consumption. Plasma osmolality and ionic concentrations were elevated in hyperosmotic salinities, and drinking rates and gastrointestinal tract Na(+), K(+)-ATPase activities increased, particularly in the pyloric caeca, presumably the primary location of water absorption. Therefore, juvenile alligator gar<1 year of age are capable of prolonged exposure to hyperosmotic salinities, but, based on the inference of these data, require access to lower salinities for long-term survival. PMID:24368134

  3. Achieving environmentally relevant organochlorine pesticide concentrations in eggs through maternal exposure in Alligator mississippiensis

    USGS Publications Warehouse

    Rauschenberger, R.H.; Wiebe, J.J.; Buckland, J.E.; Smith, Joe T.; Sepulveda, M.S.; Gross, T.S.


    Alligator mississippiensis eggs from organochlorine pesticide (OCP) contaminated sites in Florida exhibit high rates of embryonic mortality compared to reference sites (p<0.05). The objective of the present study was to use captive adult alligators to test the hypotheses that maternal exposure to OCPs results in increased OCP concentrations in eggs, and that increased exposure is associated with increased embryonic mortality. A total of 24 adult alligators (8 males and 16 females) were housed in eight pens. Eight females in four pens were dosed with a mixture of p,p'-DDE, toxaphene, dieldrin, and chlordane at a rate of 0.2 ? 0.01 mg/kg/day for 274 ? 8 days. Treated females produced eggs containing higher OCP concentrations (12,814 ? 813 ng/g yolk) than controls (38 ? 4 ng/g yolk). Eggs of treated females exhibited decreased viability (13 ? 22%) as compared to controls (45 ? 20%). Results indicated that 0.6% of administered OCPs were maternally transferred to the eggs of American alligators, and that maternal exposure is associated with decreased egg/embryo viability in this species.

  4. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth ra...

  5. TRPV4 associates environmental temperature and sex determination in the American alligator.


    Yatsu, Ryohei; Miyagawa, Shinichi; Kohno, Satomi; Saito, Shigeru; Lowers, Russell H; Ogino, Yukiko; Fukuta, Naomi; Katsu, Yoshinao; Ohta, Yasuhiko; Tominaga, Makoto; Guillette, Louis J; Iguchi, Taisen


    Temperature-dependent sex determination (TSD), commonly found among reptiles, is a sex determination mode in which the incubation temperature during a critical temperature sensitive period (TSP) determines sexual fate of the individual rather than the individual's genotypic background. In the American alligator (Alligator mississippiensis), eggs incubated during the TSP at 33 °C (male producing temperature: MPT) yields male offspring, whereas incubation temperatures below 30 °C (female producing temperature: FPT) lead to female offspring. However, many of the details of the underlying molecular mechanism remains elusive, and the molecular link between environmental temperature and sex determination pathway is yet to be elucidated. Here we show the alligator TRPV4 ortholog (AmTRPV4) to be activated at temperatures proximate to the TSD-related temperature in alligators, and using pharmacological exposure, we show that AmTRPV4 channel activity affects gene expression patterns associated with male differentiation. This is the first experimental demonstration of a link between a well-described thermo-sensory mechanism, TRPV4 channel, and its potential role in regulation of TSD in vertebrates, shedding unique new light on the elusive TSD molecular mechanism. PMID:26677944

  6. Effects of salinity on growth and ion regulation of juvenile alligator gar Atractosteus spatula.


    Schwarz, Daniel E; Allen, Peter J


    The alligator gar (Atractosteus spatula) is a primitive euryhaline fish, found primarily in estuaries and freshwater drainages associated with the northern Gulf of Mexico. The extent of its hypo-osmotic regulatory abilities is not well understood. In order to determine how salinity affects growth rates and ionic and osmoregulation, juvenile alligator gar (330 days after hatch; 185 g) were exposed to 4 different salinities (0, 8, 16, and 24 ppt) for a 30-day period. Specific growth rate, plasma osmolality and ion concentrations, gill and gastrointestinal tract Na(+), K(+)-ATPase activities, and drinking rate were compared. Juvenile alligator gar were able to tolerate hyperosmotic salinities up to 24 ppt for a 30 day period, albeit with decreased growth resulting largely from decreased food consumption. Plasma osmolality and ionic concentrations were elevated in hyperosmotic salinities, and drinking rates and gastrointestinal tract Na(+), K(+)-ATPase activities increased, particularly in the pyloric caeca, presumably the primary location of water absorption. Therefore, juvenile alligator gar<1 year of age are capable of prolonged exposure to hyperosmotic salinities, but, based on the inference of these data, require access to lower salinities for long-term survival.

  7. Simple solar technology saves money for alligator farms

    SciTech Connect

    Goldman, A.


    In 1990, a high-volume solar thermal water-heating system in Florida was installed in Okeechobee County by Solar Development, Inc. (SDI). The system is designed to provide large quantities of hot water for commercial use and heat water to as high as 140[degrees]F. The design in Florida is known as a Shallow Solar Pond (SSP). It was completed with the help of the Florida Alligator Farmers Association, the Florida Energy Office, Foster Farms, and SDI. The SSP is a modular system built on site and modified to meet the specific needs of each application. The tank and the collector are the same unit, which keeps the system cost very low. The typical SSP module is 16 feet wide and up to 200 feet long. The module contains one or two reinforced-rubber flat water bags similar to a water bed. The bags rest on a layer of insulation or sand inside concrete or fiberglass curbs. In the Foster Farms SSP, the insulation was omitted and the water bags are placed on sand. The bag is protected against damage and heat loss by greenhouse-type glazing. At Foster Farms there are 3 SSPs, set in approximately 8,000 square feet, with two 5,000-gallon bags per unit. In addition, there is a pressurizing pump/tank system. Every morning, the heated water from the bags drains into a sump tank. While the bags are emptied into the backup system, well water is pumped in and the solar heating process starts all over again.

  8. Genome analysis and signature discovery for diving and sensory properties of the endangered Chinese alligator

    PubMed Central

    Wan, Qiu-Hong; Pan, Sheng-Kai; Hu, Li; Zhu, Ying; Xu, Peng-Wei; Xia, Jin-Quan; Chen, Hui; He, Gen-Yun; He, Jing; Ni, Xiao-Wei; Hou, Hao-Long; Liao, Sheng-Guang; Yang, Hai-Qiong; Chen, Ying; Gao, Shu-Kun; Ge, Yun-Fa; Cao, Chang-Chang; Li, Peng-Fei; Fang, Li-Ming; Liao, Li; Zhang, Shu; Wang, Meng-Zhen; Dong, Wei; Fang, Sheng-Guo


    Crocodilians are diving reptiles that can hold their breath under water for long periods of time and are crepuscular animals with excellent sensory abilities. They comprise a sister lineage of birds and have no sex chromosome. Here we report the genome sequence of the endangered Chinese alligator (Alligator sinensis) and describe its unique features. The next-generation sequencing generated 314 Gb of raw sequence, yielding a genome size of 2.3 Gb. A total of 22 200 genes were predicted in Alligator sinensis using a de novo, homology- and RNA-based combined model. The genetic basis of long-diving behavior includes duplication of the bicarbonate-binding hemoglobin gene, co-functioning of routine phosphate-binding and special bicarbonate-binding oxygen transport, and positively selected energy metabolism, ammonium bicarbonate excretion and cardiac muscle contraction. Further, we elucidated the robust Alligator sinensis sensory system, including a significantly expanded olfactory receptor repertoire, rapidly evolving nerve-related cellular components and visual perception, and positive selection of the night vision-related opsin and sound detection-associated otopetrin. We also discovered a well-developed immune system with a considerable number of lineage-specific antigen-presentation genes for adaptive immunity as well as expansion of the tripartite motif-containing C-type lectin and butyrophilin genes for innate immunity and expression of antibacterial peptides. Multifluorescence in situ hybridization showed that alligator chromosome 3, which encodes DMRT1, exhibits significant synteny with chicken chromosome Z. Finally, population history analysis indicated population admixture 0.60-1.05 million years ago, when the Qinghai-Tibetan Plateau was uplifted. PMID:23917531

  9. The Good, the Bad, and the Unknown: Microbial Symbioses of the American Alligator.


    Keenan, Sarah W; Elsey, Ruth M


    Vertebrates coexist with microorganisms in diverse symbiotic associations that range from beneficial to detrimental to the host. Most research has aimed at deciphering the nature of the composite microbial assemblage's genome, or microbiome, from the gastrointestinal (GI) tract and skin of mammals (i.e., humans). In mammals, the GI tract's microbiome aids digestion, enhances uptake of nutrients, and prevents the establishment of pathogenic microorganisms. However, because the GI tract microbiome of the American alligator (Alligator mississippiensis) is distinct from that of all other vertebrates studied to date, being comprised of Fusobacteria in the lower GI tract with lesser abundances of Firmicutes, Proteobacteria, and Bacteroidetes, the function of these assemblages is largely unknown. This review provides a synthesis of our current understanding of the composition of alligators' microbiomes, highlights the potential role of microbiome members in alligators' health (the good), and presents a brief summary of microorganisms detrimental to alligators' health (the bad) including Salmonella spp. and others. Microbial assemblages of the GI tract have co-evolved with their vertebrate host over geologic time, which means that evolutionary hypotheses can be tested using information about the microbiome. For reptiles and amphibians, the number of taxa studied at present is limited, thereby restricting evolutionary insights. Nevertheless, we present a compilation of our current understanding of reptiles' and amphibians' microbiomes, and highlight future avenues of research (the unknown). As in humans, composition of microbiome assemblages provides a promising tool for assessing hosts' health or disease. By further exploring present-day associations between symbiotic microorganisms in the microbiomes of reptiles and amphibians, we can better identify good (beneficial) and bad (detrimental) microorganisms, and unravel the evolutionary history of the acquisition of

  10. The oldest record of Alligator sinensis from the Late Pliocene of Western Japan, and its biogeographic implication

    NASA Astrophysics Data System (ADS)

    Iijima, Masaya; Takahashi, Keiichi; Kobayashi, Yoshitsugu


    The late Cenozoic fossil record of alligators in East Asia is crucial in understanding the origin and past distribution of Asian alligators that are now represented by a single species, Alligator sinensis. This study reports a partial skeleton of A. sinensis from the Late Pliocene (approximately 3.0 Ma) of western Japan. This Japanese A. sinensis is large in size (>200 cm total length), comparable to the maximum size of extant individuals. It demonstrates the oldest record of A. sinensis and wider distribution of this species in the past. Tectonic and geographic history of East Asia suggests that alligators presumably dispersed into Japan before 25 Ma or after 10 Ma, yet finally were wiped out from Japan due to the semi-isolated condition of the Japanese island arc and the deteriorated climate during the Plio-Pleistocene.

  11. An ultrasonic system for weed detection in cereal crops.


    Andújar, Dionisio; Weis, Martin; Gerhards, Roland


    Site-specific weed management requires sensing of the actual weed infestation levels in agricultural fields to adapt the management accordingly. However, sophisticated sensor systems are not yet in wider practical use, since they are not easily available for the farmers and their handling as well as the management practice requires additional efforts. A new sensor-based weed detection method is presented in this paper and its applicability to cereal crops is evaluated. An ultrasonic distance sensor for the determination of plant heights was used for weed detection. It was hypothesised that the weed infested zones have a higher amount of biomass than non-infested areas and that this can be determined by plant height measurements. Ultrasonic distance measurements were taken in a winter wheat field infested by grass weeds and broad-leaved weeds. A total of 80 and 40 circular-shaped samples of different weed densities and compositions were assessed at two different dates. The sensor was pointed directly to the ground for height determination. In the following, weeds were counted and then removed from the sample locations. Grass weeds and broad-leaved weeds were separately removed. Differences between weed infested and weed-free measurements were determined. Dry-matter of weeds and crop was assessed and evaluated together with the sensor measurements. RGB images were taken prior and after weed removal to determine the coverage percentages of weeds and crop per sampling point. Image processing steps included EGI (excess green index) computation and thresholding to separate plants and background. The relationship between ultrasonic readings and the corresponding coverage of the crop and weeds were assessed using multiple regression analysis. Results revealed a height difference between infested and non-infested sample locations. Density and biomass of weeds present in the sample influenced the ultrasonic readings. The possibilities of weed group discrimination were

  12. An Ultrasonic System for Weed Detection in Cereal Crops

    PubMed Central

    Andújar, Dionisio; Weis, Martin; Gerhards, Roland


    Site-specific weed management requires sensing of the actual weed infestation levels in agricultural fields to adapt the management accordingly. However, sophisticated sensor systems are not yet in wider practical use, since they are not easily available for the farmers and their handling as well as the management practice requires additional efforts. A new sensor-based weed detection method is presented in this paper and its applicability to cereal crops is evaluated. An ultrasonic distance sensor for the determination of plant heights was used for weed detection. It was hypothesised that the weed infested zones have a higher amount of biomass than non-infested areas and that this can be determined by plant height measurements. Ultrasonic distance measurements were taken in a winter wheat field infested by grass weeds and broad-leaved weeds. A total of 80 and 40 circular-shaped samples of different weed densities and compositions were assessed at two different dates. The sensor was pointed directly to the ground for height determination. In the following, weeds were counted and then removed from the sample locations. Grass weeds and broad-leaved weeds were separately removed. Differences between weed infested and weed-free measurements were determined. Dry-matter of weeds and crop was assessed and evaluated together with the sensor measurements. RGB images were taken prior and after weed removal to determine the coverage percentages of weeds and crop per sampling point. Image processing steps included EGI (excess green index) computation and thresholding to separate plants and background. The relationship between ultrasonic readings and the corresponding coverage of the crop and weeds were assessed using multiple regression analysis. Results revealed a height difference between infested and non-infested sample locations. Density and biomass of weeds present in the sample influenced the ultrasonic readings. The possibilities of weed group discrimination were

  13. Guidelines for management of noxious weeds at Hanford

    SciTech Connect

    Roos, R.C.; Malady, M.B.


    Integrated Pest Management Services is responsible for management and control of noxious weeds on the Hanford Site. Weed species and populations are prioritized and objective defined, according to potential site and regional impact. Population controls are implemented according to priority. An integrated approach is planned for noxious weed control in which several management options are considered and implemented separately or in coordination to best meet management objectives. Noxious weeds are inventories and monitored to provide information for planning and program review.

  14. Weed Community Response to No-Till in North America

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Scientists and producers in Ukraine are interested in no-till crop production, but are concerned about weed management. In North America, producers have used no-till systems for several decades without increasing weed community density in croplands. Initially, weed density escalated with no-till, ...

  15. Onion and weed response to mustard (Sinapis alba) seed meal

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in organic onion production is often difficult and expensive, requiring numerous cultivations and extensive hand-weeding. Onion safety and weed control with mustard seed meal (MSM) derived from Sinapis alba was evaluated in greenhouse and field trials. MSM applied at 110, 220, and 440 g...

  16. 7 CFR 361.6 - Noxious weed seeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 5 2011-01-01 2011-01-01 false Noxious weed seeds. 361.6 Section 361.6 Agriculture..., DEPARTMENT OF AGRICULTURE IMPORTATION OF SEED AND SCREENINGS UNDER THE FEDERAL SEED ACT § 361.6 Noxious weed... considered noxious weed seeds. (1) Seeds with no tolerances applicable to their introduction: Acacia...

  17. 7 CFR 360.200 - Designation of noxious weeds.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Designation of noxious weeds. 360.200 Section 360.200... SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.200 Designation of noxious weeds. As... determined that the following plants 1 or plant products fall within the definition of “noxious weed”...

  18. 7 CFR 201.52 - Noxious-weed seeds.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  19. 7 CFR 361.6 - Noxious weed seeds.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Noxious weed seeds. 361.6 Section 361.6 Agriculture..., DEPARTMENT OF AGRICULTURE IMPORTATION OF SEED AND SCREENINGS UNDER THE FEDERAL SEED ACT § 361.6 Noxious weed... considered noxious weed seeds. (1) Seeds with no tolerances applicable to their introduction: Aeginetia...

  20. 7 CFR 361.6 - Noxious weed seeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Noxious weed seeds. 361.6 Section 361.6 Agriculture..., DEPARTMENT OF AGRICULTURE IMPORTATION OF SEED AND SCREENINGS UNDER THE FEDERAL SEED ACT § 361.6 Noxious weed... considered noxious weed seeds. (1) Seeds with no tolerances applicable to their introduction: Acacia...

  1. 7 CFR 201.52 - Noxious-weed seeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  2. 7 CFR 361.6 - Noxious weed seeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Noxious weed seeds. 361.6 Section 361.6 Agriculture..., DEPARTMENT OF AGRICULTURE IMPORTATION OF SEED AND SCREENINGS UNDER THE FEDERAL SEED ACT § 361.6 Noxious weed... considered noxious weed seeds. (1) Seeds with no tolerances applicable to their introduction: Acacia...

  3. 7 CFR 201.52 - Noxious-weed seeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  4. 7 CFR 201.52 - Noxious-weed seeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  5. 7 CFR 201.52 - Noxious-weed seeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  6. 7 CFR 361.6 - Noxious weed seeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Noxious weed seeds. 361.6 Section 361.6 Agriculture..., DEPARTMENT OF AGRICULTURE IMPORTATION OF SEED AND SCREENINGS UNDER THE FEDERAL SEED ACT § 361.6 Noxious weed... considered noxious weed seeds. (1) Seeds with no tolerances applicable to their introduction: Acacia...

  7. Pest Control in Corn and Soybeans: Weeds - Insects - Diseases.

    ERIC Educational Resources Information Center

    Doersch, R. E.; And Others

    This document gives the characteristics and application rates for herbicides used to control annual weeds in corn, annual and perennial broadleaf weeds in corn, quackgrass and yellow nutsedge in corn, and annual weeds in soybeans. It also gives insecticide use information for corn and soybeans. A brief discussion of disease control in corn and…

  8. New approaches to understanding weed seed predation in agroecosystems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Postdispersal predation of weed seeds in arable systems can be a valuable ecosystem service, with the potential to support ecological approaches to weed management by reducing inputs to the soil seed bank. Scientific understanding of factors regulating weed seed predation rates is still insufficient...

  9. Allelopathic weed suppression through the use of cover crops

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ensuring sufficient food and fiber production for future generations can be hampered by limited options for weed control, particularly in developing countries where yields are reduced by up to 25% by weed species. Identifying and detailing sustainable weed control measures that can be implemented t...

  10. Agricultural weed research: a critique and two proposals

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Two broad aims drive weed science research: improved management and improved understanding of weed biology and ecology. In recent years, agricultural weed research addressing these two aims has effectively split into separate sub-disciplines despite repeated calls for greater integration. While some...

  11. [Control effects of rice-duck farming and other weed management strategies on weed communities in paddy fields].


    Wei, Shouhui; Qiang, Sheng; Ma, Bo; Wei, Jiguang; Chen, Jianwei; Wu, Jianqiang; Xie, Tongzhou; Shen, Xiaokun


    By the methods of community ecology, field studies were conducted to evaluate the control effects of three weed management strategies, i. e., rice-duck farming (RD), manual weeding (MW) and chemical weeding (CW), on the weed communities in paddy fields. The results showed that under rice-duck farming, the weed density in paddy fields decreased significantly, and the control effects on dominant weed species such as Monochoria vaginalis, Cyperus difformis, Sagittaria pygmaea were all above 95%, with an overall effect higher than CW and MW. Under RD, the species richness and Shannon-Wiener diversity indices decreased slightly, while Pielou community evenness indices increased markedly, indicating that the species composition of weed community was greatly improved, and the infestation of former dominant weed species was reduced. The structure of weed communities in paddy fields varied with different weed management strategies, e. g., under RD, Lindernia procumbens, Cyperus difformis and Fimbristylis miliacea constituted the major weed community, and the Whittaker index was significant higher than that of CW, MW and CK, which indicated that rice-duck farming had a greater effect on the structure of the weed communities. The same conclusion could be drawn from Sorensen's similarity indices and cluster analysis with Sorensen's index as the distance measurement.

  12. EAARL coastal topography--Alligator Point, Louisiana, 2010

    USGS Publications Warehouse

    Nayegandhi, Amar; Bonisteel-Cormier, J.M.; Wright, C.W.; Brock, J.C.; Nagle, D.B.; Vivekanandan, Saisudha; Fredericks, Xan; Barras, J.A.


    This project provides highly detailed and accurate datasets of a portion of Alligator Point, Louisiana, acquired on March 5 and 6, 2010. The datasets are made available for use as a management tool to research scientists and natural-resource managers. An innovative airborne lidar instrument originally developed at the National Aeronautics and Space Administration (NASA) Wallops Flight Facility, and known as the Experimental Advanced Airborne Research Lidar (EAARL), was used during data acquisition. The EAARL system is a raster-scanning, waveform-resolving, green-wavelength (532-nanometer) lidar designed to map near-shore bathymetry, topography, and vegetation structure simultaneously. The EAARL sensor suite includes the raster-scanning, water-penetrating full-waveform adaptive lidar, a down-looking red-green-blue (RGB) digital camera, a high-resolution multispectral color-infrared (CIR) camera, two precision dual-frequency kinematic carrier-phase GPS receivers, and an integrated miniature digital inertial measurement unit, which provide for sub-meter georeferencing of each laser sample. The nominal EAARL platform is a twin-engine aircraft, but the instrument was deployed on a Pilatus PC-6. A single pilot, a lidar operator, and a data analyst constitute the crew for most survey operations. This sensor has the potential to make significant contributions in measuring sub-aerial and submarine coastal topography within cross-environmental surveys. Elevation measurements were collected over the survey area using the EAARL system, and the resulting data were then processed using the Airborne Lidar Processing System (ALPS), a custom-built processing system developed in a NASA-USGS collaboration. ALPS supports the exploration and processing of lidar data in an interactive or batch mode. Modules for presurvey flight-line definition, flight-path plotting, lidar raster and waveform investigation, and digital camera image playback have been developed. Processing algorithms have

  13. Herpetofaunal diversity of Alligator River National Wildlife Refuge, North Carolina

    USGS Publications Warehouse

    Meyers, J.M.; Pike, D.A.


    In the past century, habitat alteration and fragmentation have increased dramatically, which increases the need for improving our understanding of how species and biological communities react to these modifications. A national strategy on biological diversity has focused attention on how these habitat modifications affect species, especially herpetofauna (i.e., changes in species richness, community evenness and similarity, and dominant/rare species). As part of this strategy, we surveyed Alligator River National Wildlife Refuge, a coastal, mixed second-growth forested swamp (MFS) and pocosin wetland (PW), in North Carolina for amphibians and reptiles from September 2000 to August 2001. We randomly selected three sites (3 x 3 km) in two major habitat types (MFS, PW) and completed random surveys and trapping using transects, quadrats, nighttime aural road surveys, drift fences, canal transects, coverboards, incidental captures, and evening road surveys. We also collected herpetofauna opportunistically throughout the refuge to establish an updated species list. For analysis, we used Shannon-Weiner species diversity (H'), evenness (1'), species richness and species detectability (COMDYN4), and community percent similarity index to determine herpetofaunal community differences. We estimated 39 species in MFS and 32 species in PW (P < 0.10). Species detectability was similar between habitats (0.84 to 0.86). More reptilian species (+ 31 %) inhabited MFS than PW, but estimated amphibian species richness was identical (17 spp.). H' was higher (P < 0.000 I) for PW (2.6680) than for MFS (2.1535) because of lower J' in the latter (0.6214 vs. 0.8010). Dominance of three Rana species caused lower J' and H' in MFS. Similarity between the communities was 56.6%; we estimated 22-24 species in common for each habitat (95% CI = 18 to 31 spp.). We verified 49 of the 52 herpetofaunal species on the refuge that were known to exist in the area. Restoration of natural water flows may

  14. Detecting Weed Infestations in Soybean Using Remote Sensing.

    NASA Astrophysics Data System (ADS)

    Clay, S. A.; Chang, J.; Clay, D. E.; Dalsted, K.; Reese, C.


    Can weed distribution maps be developed from remote sensed reflectance data? When are the appropriate times to collect these data during the season? What wavebands can be used to distinguish weedy from weed- free areas? This research examined if and when reflectance could be used to distinguish between weed-free and weed-infested (mixed species) areas in soybean and to determine the most useful wavebands to separate crop, weed, and soil reflectance differences. Treatments in the two-year study included no vegetation (bare soil), weed-free soybean, and weed-infested soybean and, in one year, 80% corn residue cover. Reflectance was measured at several sampling times from May through September in 2001 and 2002 using a hand-held multispectral radiometer equipped with band-limited optical interference filters (460 - 1650 nm). Pixel resolution was 0.8-m. Reflectance in the visible spectral range (460 to 700 nm) generally was similar among treatments. In the near-infrared (NIR) range (>700 to 1650 nm), differences among treatments were observed from soybean growth stage V-3 (about 4 weeks after planting) until mid-July to early August depending on crop vigor and canopy closure (76 cm row spacing in 2001 and 19 cm row spacing in 2002). Reflectance rankings in the NIR range when treatments could be differentiated were consistent between years and, from lowest to highest reflectance, were soil < weed-free < weed-infested areas. Increased reflectance from weed-infested areas was most likely due to increased biomass and canopy cover. Residue masked differences between weed-free and weed- infested areas during the early stages of growth due to high reflectance from the residue and reduced weed numbers in these areas. These results suggest that NIR spectral reflectance collected prior to canopy closure can be used to distinguish weed-infested from weed-free areas.

  15. Virus infection of a weed increases vector attraction to and vector fitness on the weed

    PubMed Central

    Chen, Gong; Pan, Huipeng; Xie, Wen; Wang, Shaoli; Wu, Qingjun; Fang, Yong; Shi, Xiaobin; Zhang, Youjun


    Weeds are important in the ecology of field crops, and when crops are harvested, weeds often become the main hosts for plant viruses and their insect vectors. Few studies, however, have examined the relationships between plant viruses, vectors, and weeds. Here, we investigated how infection of the weed Datura stramonium L. by tomato yellow leaf curl virus (TYLCV) affects the host preference and performance of the TYLCV vector, Bemisia tabaci (Gennadius) Q. The results of a choice experiment indicated that B. tabaci Q preferentially settled and oviposited on TYLCV-infected plants rather than on healthy plants. In addition, B. tabaci Q performed better on TYLCV-infected plants than on healthy plants. These results demonstrate that TYLCV is indirectly mutualistic to B. tabaci Q. The mutually beneficial interaction between TYLCV and B. tabaci Q may help explain the concurrent outbreaks of TYLCV and B. tabaci Q in China. PMID:23872717

  16. Virus infection of a weed increases vector attraction to and vector fitness on the weed.


    Chen, Gong; Pan, Huipeng; Xie, Wen; Wang, Shaoli; Wu, Qingjun; Fang, Yong; Shi, Xiaobin; Zhang, Youjun


    Weeds are important in the ecology of field crops, and when crops are harvested, weeds often become the main hosts for plant viruses and their insect vectors. Few studies, however, have examined the relationships between plant viruses, vectors, and weeds. Here, we investigated how infection of the weed Datura stramonium L. by tomato yellow leaf curl virus (TYLCV) affects the host preference and performance of the TYLCV vector, Bemisia tabaci (Gennadius) Q. The results of a choice experiment indicated that B. tabaci Q preferentially settled and oviposited on TYLCV-infected plants rather than on healthy plants. In addition, B. tabaci Q performed better on TYLCV-infected plants than on healthy plants. These results demonstrate that TYLCV is indirectly mutualistic to B. tabaci Q. The mutually beneficial interaction between TYLCV and B. tabaci Q may help explain the concurrent outbreaks of TYLCV and B. tabaci Q in China. PMID:23872717

  17. Seasonal acclimatisation of muscle metabolic enzymes in a reptile (Alligator mississippiensis).


    Seebacher, Frank; Guderley, Helga; Elsey, Ruth M; Trosclair, Phillip L


    Reptiles living in heterogeneous thermal environments are often thought to show behavioural thermoregulation or to become inactive when environmental conditions prevent the achievement of preferred body temperatures. By contrast, thermally homogeneous environments preclude behavioural thermoregulation, and ectotherms inhabiting these environments (particularly fish in which branchial respiration requires body temperature to follow water temperature) modify their biochemical capacities in response to long-term seasonal temperature fluctuations. Reptiles may also be active at seasonally varying body temperatures and could, therefore, gain selective advantages from regulating biochemical capacities. Hence, we tested the hypothesis that a reptile (the American alligator Alligator mississippiensis) that experiences pronounced seasonal fluctuations in body temperature will show seasonal acclimatisation in the activity of its metabolic enzymes. We measured body temperatures of alligators in the wild in winter and summer (N=7 alligators in each season), and we collected muscle samples from wild alligators (N=31 in each season) for analysis of metabolic enzyme activity (lactate dehydrogenase, citrate synthase and cytochrome c oxidase). There were significant differences in mean daily body temperatures between winter (15.66+/-0.43 degrees C; mean +/- S.E.M.) and summer (29.34+/-0.21 degrees C), and daily body temperatures fluctuated significantly more in winter compared with summer. Alligators compensated for lower winter temperatures by increasing enzyme activities, and the activities of cytochrome c oxidase and lactate dehydrogenase were significantly greater in winter compared with summer at all assay temperatures. The activity of citrate synthase was significantly greater in the winter samples at the winter body temperature (15 degrees C) but not at the summer body temperature (30 degrees C). The thermal sensitivity (Q(10)) of mitochondrial enzymes decreased

  18. Weed hosts of cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae).


    Vennila, S; Prasad, Y G; Prabhakar, M; Agarwal, Meenu; Sreedevi, G; Bambawale, O M


    The exotic cotton mealybug, Phenacoccus solenopsis Tinsley (Hemiptera: Pseudococcidae) invaded India during 2006, and caused widespread infestation across all nine cotton growing states. P. solenopsis also infested weeds that aided its faster spread and increased severity across cotton fields. Two year survey carried out to document host plants of P. solenopsis between 2008 and 2010 revealed 27, 83, 59 and 108 weeds belonging to 8, 18, 10 and 32 families serving as alternate hosts at North, Central, South and All India cotton growing zones, respectively. Plant species of four families viz., Asteraceae, Amaranthaceae, Malvaceae and Lamiaceae constituted almost 50% of the weed hosts. While 39 weed species supported P. solenopsis multiplication during the cotton season, 37 were hosts during off season. Higher number of weeds as off season hosts (17) outnumbering cotton season (13) at Central over other zones indicated the strong carryover of the pest aided by weeds between two cotton seasons. Six, two and seven weed hosts had the extreme severity of Grade 4 during cotton, off and cotton + off seasons, respectively. Higher number of weed hosts of P. solenopsis were located at roadside: South (12) > Central (8) > North (3) zones. Commonality of weed hosts was higher between C+S zones, while no weed host was common between N+S zones. Paper furnishes the wide range of weed hosts of P. solenopsis, discusses their significance, and formulated general and specific cultural management strategies for nationwide implementation to prevent its outbreaks.

  19. Jimson "Loco" Weed Abuse in Adolescents.

    ERIC Educational Resources Information Center

    Shervette, Robert E., III; And Others


    Over a 3-year period, 29 adolescent patients were hospitalized because of intentional Jimson weed ingestion. Their records were reviewed for the presence of signs and symptoms of atropine/scopolamine toxicity, clinical course, treatment, and outcome. Journal availability: Arthur Retlaw and Associates, Inc., Suite 2080, 1603 Orrington Avenue,…

  20. Weed Science and Technology. MP-17.

    ERIC Educational Resources Information Center

    Alley, Harold P.; Lee, Gary A.

    This document is one in a series distributed by the Agricultural Extension Service of the University of Wyoming-Laramie. It presents the principles and methods of weed control especially as it relates to the use of herbicides. The factors influencing the effectiveness of both foliar-applied and soil-applied herbicides are discussed. A listing of…

  1. Acetic acid and weed control in onions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control is a major challenge in conventional and organic production systems, especially for organically produced sweet onion (Allium cepa L.). Although corn gluten meal shows great promise as an organic preemergent herbicide for onions, research has shown the need for supplemental, postemergen...

  2. Weed Research in Alfalfa Seed Production 2007

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in alfalfa seed production is important to produce high quality and high yield of alfalfa seed. Herbicides were tested on a commercial field of alfalfa seed in central Washington in 2007. Flumioxzin slightly injured alfalfa when applied at 0.125 and 0.25 lb ai/a. to dormant alfalfa in M...

  3. RNAseq reveals weed-induced PIF3-like as a candidate target to manipulate weed stress response in soybean.


    Horvath, David P; Hansen, Stephanie A; Moriles-Miller, Janet P; Pierik, Ronald; Yan, Changhui; Clay, David E; Scheffler, Brian; Clay, Sharon A


    Weeds reduce yield in soybeans (Glycine max) through incompletely defined mechanisms. The effects of weeds on the soybean transcriptome were evaluated in field conditions during four separate growing seasons. RNASeq data were collected from six biological samples of soybeans growing with or without weeds. Weed species and the methods to maintain weed-free controls varied between years to mitigate treatment effects, and to allow detection of general soybean weed responses. Soybean plants were not visibly nutrient- or water-stressed. We identified 55 consistently downregulated genes in weedy plots. Many of the downregulated genes were heat shock genes. Fourteen genes were consistently upregulated. Several transcription factors including a PHYTOCHROME INTERACTING FACTOR 3-like gene (PIF3) were included among the upregulated genes. Gene set enrichment analysis indicated roles for increased oxidative stress and jasmonic acid signaling responses during weed stress. The relationship of this weed-induced PIF3 gene to genes involved in shade avoidance responses in Arabidopsis provide evidence that this gene may be important in the response of soybean to weeds. These results suggest that the weed-induced PIF3 gene will be a target for manipulating weed tolerance in soybean.

  4. Contaminants in American alligator eggs from Lake Apopka, Lake Griffin, and Lake Okeechobee, Florida

    USGS Publications Warehouse

    Heinz, G.H.; Percival, H.F.; Jennings, Michael L.


    Residues of organochlorine pesticides, polychlorinated biphenyls (PCBs), and 16 elements were measured in American alligator (Alligator mississippiensis) eggs collected in 1984 from Lakes Apopka, Griffin, and Okeechobee in central and south Florida. Organochlorine pesticides were highest in eggs from Lake Apopka. None of the elements appeared to be present at harmful concentrations in eggs from any of the lakes. A larger sample of eggs was collected in 1985, but only from Lakes Griffin, a lake where eggs were relatively clean, and Apopka, where eggs were most contaminated. In 1985, hatching success of artificially incubated eggs was lower for Lake Apopka, and several organochlorine pesticides were higher than in eggs from Lake Griffin. However, within Lake Apopka, higher levels of pesticides in chemically analyzed eggs were not associated with reduced hatching success of the remaining eggs in the clutch. Therefore, it did not appear that any of the pesticides we measured were responsible for the reduced hatching of Lake Apopka eggs.

  5. Regulatory peptides in the gastrointestinal tract of Alligator mississipiensis. An immunocytochemical study.


    Buchan, A M; Lance, V; Polak, J M


    The gastrointestinal tract of the alligator Alligator mississipiensis has been investigated for the presence of immunoreactivity to fourteen regulatory peptides all known to occur in the mammalian gut system. Mucosal endocrine cells reacting specifically with the antisera to neurotensin, C-terminal gastrin, somatostatin, bombesin, secretin, pancreatic glucagon and enteroglucagon were detectable, the distribution of these cells being, in general, similar to the mammalian pattern. Peripheral nerve cell bodies and nerve fibres were detected with the antisera to vasoactive intestinal polypeptide, substance P, bombesin and somatostatin again with a distribution similar to that seen in mammals. No immunoreactivity was observed with the available antisera to glicentin, motilin, gastric inhibitory polypeptide, gastrin 34, cholecystokinin 9-20 and met-enkephalin.

  6. Hydrodynamic analysis, performance assessment, and actuator design of a flexible tail propulsor in an artificial alligator

    NASA Astrophysics Data System (ADS)

    Philen, Michael; Neu, Wayne


    The overall objective of this research is to develop analysis tools for determining actuator requirements and assessing viable actuator technology for design of a flexible tail propulsor in an artificial alligator. A simple hydrodynamic model that includes both reactive and resistive forces along the tail is proposed and the calculated mean thrust agrees well with conventional estimates of drag. Using the hydrodynamic model forces as an input, studies are performed for an alligator ranging in size from 1 cm to 2 m at swimming speeds of 0.3-1.8 body lengths per second containing five antagonistic pairs of actuators distributed along the length of the tail. Several smart materials are considered for the actuation system, and preliminary analysis results indicate that the acrylic electroactive polymer and the flexible matrix composite actuators are potential artificial muscle technologies for the system.

  7. Determining the size of American alligators using hind-foot track length

    USGS Publications Warehouse

    Wilkinson, Philip M.; Rice, Kenneth G.


    Size distribution information is useful for crocodilian management, but can be hard to obtain. Indirect and less costly demographic inferences made from track measurements may be valuable for management decisions. We related hind-foot lengths (HF) with total length (TL) to determine if we could indirectly assess alligator size using track length. Regression showed that HF was an excellent predictor (F1,246= 15722.9, R2=0.98, P<0.01) of TL and track length was an exceptional predictor of HF (F1,14=7520.3, R2= 1.00, P<0.01). The correlation between track length and HF length also was significant (N= 15, r=0.99, P <0.01). Thus, alligator size can be accurately estimated from measures of track length at sites where capture and direct measurement is impractical.

  8. Functional morphology of the Alligator mississippiensis larynx with implications for vocal production.


    Riede, Tobias; Li, Zhiheng; Tokuda, Isao T; Farmer, Colleen G


    Sauropsid vocalization is mediated by the syrinx in birds and the larynx in extant reptiles; but whereas avian vocal production has received much attention, the vocal mechanism of basal reptilians is poorly understood. The American alligator (Alligator mississippiensis) displays a large vocal repertoire during mating and in parent-offspring interactions. Although vocal outputs of these behaviors have received some attention, the underlying mechanism of sound production remains speculative. Here, we investigate the laryngeal anatomy of juvenile and adult animals by macroscopic and histological methods. Observations of the cartilaginous framework and associated muscles largely corroborate earlier findings, but one muscle, the cricoarytenoideus, exhibits a heretofore unknown extrinsic insertion that has important implications for effective regulation of vocal fold length and tension. Histological investigation of the larynx revealed a layered vocal fold morphology. The thick lamina propria consists of non-homogenous extracellular matrix containing collagen fibers that are tightly packed below the epithelium but loosely organized deep inside the vocal fold. We found few elastic fibers but comparatively high proportions of hyaluronan. Similar organizational complexity is also seen in mammalian vocal folds and the labia of the avian syrinx: convergent morphologies that suggest analogous mechanisms for sound production. In tensile tests, alligator vocal folds demonstrated a linear stress-strain behavior in the low strain region and nonlinear stress responses at strains larger than 15%, which is similar to mammalian vocal fold tissue. We have integrated morphological and physiological data in a two-mass vocal fold model, providing a systematic description of the possible acoustic space that could be available to an alligator larynx. Mapping actual call production onto possible acoustic space validates the model's predictions.

  9. Nutrient and organochlorine pesticide concentrations in American alligator eggs and their associations with clutch viability.


    Rauschenberger, R Heath; Sepúlveda, Maria S; Wiebe, Jon J; Wiebe, Janet E; Honeyfield, Dale C; Gross, Timothy S


    Since the early 1900s, the lakes of the Ocklawaha basin in central Florida have experienced ecological degradation due to anthropogenic development. One species affected by this degradation is the American alligator Alligator mississippiensis, which has suffered from poor clutch viability and embryo mortality. Although some studies indicate that organochlorine pesticides (OCPs) may be involved, OCPs do not account for all of the variation seen in hatch rates. Indeed, nutrition and non-OCP contaminants have been associated with developmental problems in fish and birds. Our study evaluated embryo mortality in alligators at reference and OCP-contaminated sites as a function of exposure to OCPs, polychlorinated biphenyls (PCBs), and polyaromatic hydrocarbons (PAHs), along with egg nutrients (Zn, Se, and vitamins A, E, and B1). The four-pronged study consisted of a case-control cohort study, an expanded field study, a topical egg treatment thiamine amelioration experiment, and a topical egg treatment thiamine antagonist experiment. The results from the two field studies suggested that the total thiamine levels in the eggs were positively associated with clutch viability and negatively associated with the lipid content and certain OCPs measured in egg yolks. In addition, PCBs, PAHs, Zn, Se, and vitamins A and E were not found to be associated with the observed clutch viability defects. The thiamine levels in the eggs explained 38% of the variation in clutch survival in the case-control cohort study and 27% in the expanded field study. The topical egg treatment experiments were successful in elevating the thiamine concentrations in the albumin but not the yolk. No significant differences were noted among treatment groups in either egg treatment experiment with respect to clutch survival. In summary, thiamine egg concentrations explain some of the variation in the clutch viability of free-ranging alligators, but the cause-effect relationships are still unclear. PMID


    NASA Technical Reports Server (NTRS)


    A big, toothy saurian grin is flashed by this alligator in the pond in front of the KSC Headquarters Building. And wy not? After years of namelessness, he [or she] has a name. The 'gator was dubbed Kasey following a ''Name the Gator'' contest in which scores of Spaceport employees submitted name suggestions. Kasey is one of two 'gators placed in the pond in an attempt to restore its natural ecology.

  11. Incubation history prior to the canonical thermosensitive period determines sex in the American alligator.


    McCoy, Jessica A; Parrott, Benjamin B; Rainwater, Thomas R; Wilkinson, Phillip M; Guillette, Louis J


    Despite the widespread occurrence of environmental sex determination (ESD) among vertebrates, our knowledge of the temporal dynamics by which environmental factors act on this process remains limited. In many reptiles, incubation temperature determines sex during a discrete developmental window just prior to and coincident with the differentiation of the gonads. Yet, there is substantial variation in sex ratios among different clutches of eggs incubated at identical temperatures during this period. Here, we test the hypothesis that temperatures experienced prior to the reported thermosensitive period for alligators (Alligator mississippiensis) can impact how the sex determination system responds to thermal cues later in development. Temperature shift experiments on eggs collected from the field within 24  h of oviposition were employed to decouple various maternal influences from thermal effects, and results demonstrate a previously undefined window of thermosensitivity occurring by stage 15 of embryonic development, six stages earlier than previously reported. We also examine the intrasexual expression of several male- and female-biased genes and show that while male-biased genes display no intrasexual differences, ovarian CYP19A1 (aromatase) transcript abundance differs by approximately twofold depending on thermal exposures experienced at early stages of embryonic development. These findings expand our understanding of the ESD in the alligator and provide the rationale for reevaluation of the temporal dynamics of sex determination in other crocodilians. PMID:26183894

  12. Do egg-laying crocodilian (Alligator mississippiensis) archosaurs form medullary bone?


    Schweitzer, M H; Elsey, R M; Dacke, C G; Horner, J R; Lamm, E-T


    It is beyond question that Mesozoic dinosaurs, like Aves and Crocodylia, are archosaurs. However, within the archosaurian clade, the origin and distribution of some major features are less clear, particularly with respect to reproductive physiology. Medullary bone, a highly mineralized, bony reproductive tissue present in the endosteal cavities of all extant egg-laying birds thus far examined, has recently been reported in Tyrannosaurus rex. Its presence or absence in extant crocodilians, therefore, may shed light on the timing of its evolutionary appearance. If medullary bone is present in all three taxa, it arose before the three lineages diverged. However, if medullary bone arose after this divergence, it may be present in both extinct dinosaurs and birds, or in birds only. If present in extinct dinosaurs and birds, but not crocodilians, it would indicate that it arose in the common ancestor of this clade, thus adding support to the closer phylogenetic relationship of dinosaurs and birds relative to crocodilians. Thus, the question of whether the crocodilian Alligator mississippiensis forms medullary bone during the production of eggs has important evolutionary significance. Our examination of long bones from several alligators (two alligators with eggs in the oviducts, one that had produced eggs in the past but was not currently in reproductive phase, an immature female and an adult male) shows no differences on the endosteal surfaces of the long bones, and no evidence of medullary bone, supporting the hypothesis that medullary bone first evolved in the dinosaur-bird line, after the divergence of crocodilians from this lineage.

  13. Analysis of the landsat remote sensing images of the types of habitats of Yangtze alligators

    NASA Astrophysics Data System (ADS)

    Huang, Zhujian; Lin, Hengzhang; Zhang, Shengkai


    The Chinese “Yangtze” alligator is a rare reptile that has been listed as an “endangered species” by the United Nations, so its preservation has become an urgent task. A study of its habitats through analysis of their Landsat images will provide a scientific basis for the government departments concerned to select the best locations for its breeding. The Chinese alligator is a subtropical reptile of freshwater rivers, lakes and ponds. Found only in China, it is now distributed only in the border region between the three provinces of Anhui, Zhejiang and Jiangsu. On the basis of previous investigations by Chinese scientists, and from an analysis and interpretation of their Landsat images, we made a special study, review, and classification of the natural environment of the alligator’s present habitats (and the modern changes in the natural background of these hatitats) so that the government departments concerned with the preservation of the reptiles may have a scientific basis for determining the best locations for the breeding and propagation of the alligator.

  14. Estimating spawning times of Alligator Gar (Atractosteus spatula) in Lake Texoma, Oklahoma

    USGS Publications Warehouse

    Snow, Richard A.; Long, James M.


    In 2013, juvenile Alligator Gar were sampled in the reservoir-river interface of the Red River arm of Lake Texoma. The Red River, which flows 860 km along Oklahoma’s border with Texas, is the primary in-flow source of Lake Texoma, and is impounded by Denison Dam. Minifyke nets were deployed using an adaptive random cluster sampling design, which has been used to effectively sample rare species. Lapilli otoliths (one of the three pair of ear stones found within the inner ear of fish) were removed from juvenile Alligator Gar collected in July of 2013. Daily ages were estimated by counting the number of rings present, and spawn dates were back-calculated from date of capture and subtracting 8 days (3 days from spawn to hatch and 5 days from hatch to swimup when the first ring forms). Alligator Gar daily age estimation ranged from 50 to 63 days old since swim-up. Spawn dates corresponded to rising pool elevations of Lake Texoma and water pulses of tributaries.

  15. Health assessment of free-ranging alligator snapping turtles (Macrochelys temminckii) in Georgia and Florida.


    Chaffin, Kristen; Norton, Terry M; Gilardi, Kirsten; Poppenga, Robert; Jensen, John B; Moler, Paul; Cray, Carolyn; Dierenfeld, Ellen S; Chen, Tai; Oliva, Marcie; Origgi, Francesco C; Gibbs, Samantha; Mazzaro, Lisa; Mazet, Jonna


    The Alligator Snapping Turtle (Macrochelys temminckii) is a large freshwater turtle endemic to river systems that drain into the Gulf of Mexico. Turtle populations were sharply reduced by commercial harvest in the 1970s and 1980s; however, the species has yet to be protected under the Endangered Species Act. While anthropogenic stressors such as habitat fragmentation and degradation and illegal capture continue to threaten populations, the degree to which disease may be contributing to any decline of the Alligator Snapping Turtle is unknown. Data were collected from 97 free-ranging Alligator Snapping Turtles in nine waterways in Florida and Georgia from 2001 to 2006. Eleven turtles were captured more than once, resulting in a total sample pool of 123. Reference ranges were established for complete blood count, plasma biochemistry values, trace metals (mercury, zinc, copper, lead, and arsenic), and nutrient parameters (vitamins A, E, D, and selenium). Variations by capture location, sex, and season were detected and likely resulted from external factors such as habitat and diet. Turtles sampled in one location were positive for tortoise herpesviral antibodies. Blood mercury values also differed among populations. This study provides justification for the use of these long-lived aquatic turtles as biologic monitors of the health of local freshwater ecosystems. PMID:18689653

  16. Weed management practice selection among Midwest U.S. organic growers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Organic agricultural systems increase the complexity of weed management, leading organic farmers to cite weeds as the greatest barrier to organic production. Integrated Weed Management (IWM) systems have been developed to address the ecological implications of weeds and weed management in cropping s...

  17. A non-chemical system for online weed control.


    Rueda-Ayala, Victor; Peteinatos, Gerassimos; Gerhards, Roland; Andújar, Dionisio


    Non-chemical weed control methods need to be directed towards a site-specific weeding approach, in order to be able to compete the conventional herbicide equivalents. A system for online weed control was developed. It automatically adjusts the tine angle of a harrow and creates different levels of intensity: from gentle to aggressive. Two experimental plots in a maize field were harrowed with two consecutive passes. The plots presented from low to high weed infestation levels. Discriminant capabilities of an ultrasonic sensor were used to determine the crop and weed variability of the field. A controlling unit used ultrasonic readings to adjust the tine angle, producing an appropriate harrowing intensity. Thus, areas with high crop and weed densities were more aggressively harrowed, while areas with lower densities were cultivated with a gentler treatment; areas with very low densities or without weeds were not treated. Although the weed development was relatively advanced and the soil surface was hard, the weed control achieved by the system reached an average of 51% (20%-91%), without causing significant crop damage as a result of harrowing. This system is proposed as a relatively low cost, online, and real-time automatic harrow that improves the weed control efficacy, reduces energy consumption, and avoids the usage of herbicide.

  18. A Non-Chemical System for Online Weed Control

    PubMed Central

    Rueda-Ayala, Victor; Peteinatos, Gerassimos; Gerhards, Roland; Andújar, Dionisio


    Non-chemical weed control methods need to be directed towards a site-specific weeding approach, in order to be able to compete the conventional herbicide equivalents. A system for online weed control was developed. It automatically adjusts the tine angle of a harrow and creates different levels of intensity: from gentle to aggressive. Two experimental plots in a maize field were harrowed with two consecutive passes. The plots presented from low to high weed infestation levels. Discriminant capabilities of an ultrasonic sensor were used to determine the crop and weed variability of the field. A controlling unit used ultrasonic readings to adjust the tine angle, producing an appropriate harrowing intensity. Thus, areas with high crop and weed densities were more aggressively harrowed, while areas with lower densities were cultivated with a gentler treatment; areas with very low densities or without weeds were not treated. Although the weed development was relatively advanced and the soil surface was hard, the weed control achieved by the system reached an average of 51% (20%–91%), without causing significant crop damage as a result of harrowing. This system is proposed as a relatively low cost, online, and real-time automatic harrow that improves the weed control efficacy, reduces energy consumption, and avoids the usage of herbicide. PMID:25831085

  19. A non-chemical system for online weed control.


    Rueda-Ayala, Victor; Peteinatos, Gerassimos; Gerhards, Roland; Andújar, Dionisio


    Non-chemical weed control methods need to be directed towards a site-specific weeding approach, in order to be able to compete the conventional herbicide equivalents. A system for online weed control was developed. It automatically adjusts the tine angle of a harrow and creates different levels of intensity: from gentle to aggressive. Two experimental plots in a maize field were harrowed with two consecutive passes. The plots presented from low to high weed infestation levels. Discriminant capabilities of an ultrasonic sensor were used to determine the crop and weed variability of the field. A controlling unit used ultrasonic readings to adjust the tine angle, producing an appropriate harrowing intensity. Thus, areas with high crop and weed densities were more aggressively harrowed, while areas with lower densities were cultivated with a gentler treatment; areas with very low densities or without weeds were not treated. Although the weed development was relatively advanced and the soil surface was hard, the weed control achieved by the system reached an average of 51% (20%-91%), without causing significant crop damage as a result of harrowing. This system is proposed as a relatively low cost, online, and real-time automatic harrow that improves the weed control efficacy, reduces energy consumption, and avoids the usage of herbicide. PMID:25831085

  20. Hepatic and renal trace element concentrations in American alligators (Alligator mississippiensis) following chronic dietary exposure to coal fly ash contaminated prey.


    Tuberville, Tracey D; Scott, David E; Metts, Brian S; Finger, John W; Hamilton, Matthew T


    Little is known about the propensity of crocodilians to bioaccumulate trace elements as a result of chronic dietary exposure. We exposed 36 juvenile alligators (Alligator mississippiensis) to one of four dietary treatments that varied in the relative frequency of meals containing prey from coal combustion waste (CCW)-contaminated habitats vs. prey from uncontaminated sites, and evaluated tissue residues and growth rates after 12 mo and 25 mo of exposure. Hepatic and renal concentrations of arsenic (As), cadmium (Cd) and selenium (Se) varied significantly among dietary treatment groups in a dose-dependent manner and were higher in kidneys than in livers. Exposure period did not affect Se or As levels but Cd levels were significantly higher after 25 mo than 12 mo of exposure. Kidney As and Se levels were negatively correlated with body size but neither growth rates nor body condition varied significantly among dietary treatment groups. Our study is among the first to experimentally examine bioaccumulation of trace element contaminants in crocodilians as a result of chronic dietary exposure. A combination of field surveys and laboratory experiments will be required to understand the effects of different exposure scenarios on tissue residues, and ultimately link these concentrations with effects on individual health. PMID:27149145

  1. Can Arbuscular Mycorrhizal Fungi Reduce the Growth of Agricultural Weeds?

    PubMed Central

    Veiga, Rita S. L.; Jansa, Jan; Frossard, Emmanuel; van der Heijden, Marcel G. A.


    Background Arbuscular mycorrhizal fungi (AMF) are known for their beneficial effects on plants. However, there is increasing evidence that some ruderal plants, including several agricultural weeds, respond negatively to AMF colonization. Here, we investigated the effect of AMF on the growth of individual weed species and on weed-crop interactions. Methodology/Principal Findings First, under controlled glasshouse conditions, we screened growth responses of nine weed species and three crops to a widespread AMF, Glomus intraradices. None of the weeds screened showed a significant positive mycorrhizal growth response and four weed species were significantly reduced by the AMF (growth responses between −22 and −35%). In a subsequent experiment, we selected three of the negatively responding weed species – Echinochloa crus-galli, Setaria viridis and Solanum nigrum – and analyzed their responses to a combination of three AMF (Glomus intraradices, Glomus mosseae and Glomus claroideum). Finally, we tested whether the presence of a crop (maize) enhanced the suppressive effect of AMF on weeds. We found that the growth of the three selected weed species was also reduced by a combination of AMF and that the presence of maize amplified the negative effect of AMF on the growth of E. crus-galli. Conclusions/Significance Our results show that AMF can negatively influence the growth of some weed species indicating that AMF have the potential to act as determinants of weed community structure. Furthermore, mycorrhizal weed growth reductions can be amplified in the presence of a crop. Previous studies have shown that AMF provide a number of beneficial ecosystem services. Taken together with our current results, the maintenance and promotion of AMF activity may thereby contribute to sustainable management of agroecosystems. However, in order to further the practical and ecological relevance of our findings, additional experiments should be performed under field conditions. PMID

  2. Herbicide-resistant weed management: focus on glyphosate.


    Beckie, Hugh J


    This review focuses on proactive and reactive management of glyphosate-resistant (GR) weeds. Glyphosate resistance in weeds has evolved under recurrent glyphosate usage, with little or no diversity in weed management practices. The main herbicide strategy for proactively or reactively managing GR weeds is to supplement glyphosate with herbicides of alternative modes of action and with soil-residual activity. These herbicides can be applied in sequences or mixtures. Proactive or reactive GR weed management can be aided by crop cultivars with alternative single or stacked herbicide-resistance traits, which will become increasingly available to growers in the future. Many growers with GR weeds continue to use glyphosate because of its economical broad-spectrum weed control. Government farm policies, pesticide regulatory policies and industry actions should encourage growers to adopt a more proactive approach to GR weed management by providing the best information and training on management practices, information on the benefits of proactive management and voluntary incentives, as appropriate. Results from recent surveys in the United States indicate that such a change in grower attitudes may be occurring because of enhanced awareness of the benefits of proactive management and the relative cost of the reactive management of GR weeds.

  3. Critical period of weed control in aerobic rice.


    Anwar, M P; Juraimi, A S; Samedani, B; Puteh, A; Man, A


    Critical period of weed control is the foundation of integrated weed management and, hence, can be considered the first step to design weed control strategy. To determine critical period of weed control of aerobic rice, field trials were conducted during 2010/2011 at Universiti Putra Malaysia. A quantitative series of treatments comprising two components, (a) increasing duration of weed interference and (b) increasing length of weed-free period, were imposed. Critical period was determined through Logistic and Gompertz equations. Critical period varied between seasons; in main season, it started earlier and lasted longer, as compared to off-season. The onset of the critical period was found relatively stable between seasons, while the end was more variable. Critical period was determined as 7-49 days after seeding in off-season and 7-53 days in main season to achieve 95% of weed-free yield, and 23-40 days in off-season and 21-43 days in main season to achieve 90% of weed-free yield. Since 5% yield loss level is not practical from economic view point, a 10% yield loss may be considered excellent from economic view point. Therefore, aerobic rice should be kept weed-free during 21-43 days for better yield and higher economic return.

  4. Herbicide-resistant weed management: focus on glyphosate.


    Beckie, Hugh J


    This review focuses on proactive and reactive management of glyphosate-resistant (GR) weeds. Glyphosate resistance in weeds has evolved under recurrent glyphosate usage, with little or no diversity in weed management practices. The main herbicide strategy for proactively or reactively managing GR weeds is to supplement glyphosate with herbicides of alternative modes of action and with soil-residual activity. These herbicides can be applied in sequences or mixtures. Proactive or reactive GR weed management can be aided by crop cultivars with alternative single or stacked herbicide-resistance traits, which will become increasingly available to growers in the future. Many growers with GR weeds continue to use glyphosate because of its economical broad-spectrum weed control. Government farm policies, pesticide regulatory policies and industry actions should encourage growers to adopt a more proactive approach to GR weed management by providing the best information and training on management practices, information on the benefits of proactive management and voluntary incentives, as appropriate. Results from recent surveys in the United States indicate that such a change in grower attitudes may be occurring because of enhanced awareness of the benefits of proactive management and the relative cost of the reactive management of GR weeds. PMID:21548004

  5. Laser ablation ICP-MS analysis of the radial distribution of lead in the femur of Alligator mississippiensis.


    Seltzer, Michael D; Lance, Valentine A; Elsey, Ruth M


    A laser ablation ICP-MS technique has been used to examine the radial distribution of lead in transverse sections of alligator femur. Annual bone growth in the femur results in the deposition of incremental layers of calcified tissue at the periphery of existing bone. Patterns of lead concentration within these layers provide a record of time-dependent accumulation from which exposure history can potentially be deduced. Femur specimens obtained from captive-reared alligators exhibited levels of lead accumulation that were entirely consistent with previously documented clinical signs of lead intoxication. In contrast, femurs obtained from wild alligators contained only minor amounts of lead that were likely accumulated as a result of incidental exposure.

  6. Laser ablation ICP-MS analysis of the radial distribution of lead in the femur of Alligator mississippiensis.


    Seltzer, Michael D; Lance, Valentine A; Elsey, Ruth M


    A laser ablation ICP-MS technique has been used to examine the radial distribution of lead in transverse sections of alligator femur. Annual bone growth in the femur results in the deposition of incremental layers of calcified tissue at the periphery of existing bone. Patterns of lead concentration within these layers provide a record of time-dependent accumulation from which exposure history can potentially be deduced. Femur specimens obtained from captive-reared alligators exhibited levels of lead accumulation that were entirely consistent with previously documented clinical signs of lead intoxication. In contrast, femurs obtained from wild alligators contained only minor amounts of lead that were likely accumulated as a result of incidental exposure. PMID:15982720

  7. Weed-cover versus weed-removal management in olive orchards: influence on the carbon balance at the ecosystem scale

    NASA Astrophysics Data System (ADS)

    Chamizo, Sonia; Serrano-Ortiz, Penélope; Vicente-Vicente, José Luis; Sánchez-Cañete, Enrique P.; López-Ballesteros, Ana; Kowalski, Andrew S.


    Agriculture plays an important role in the C budget at the global scale. Traditional practices based on soil tillage and applying herbicides to remove weeds have caused damage to soils and led to important losses of soil organic C and increased CO2 emissions to the atmosphere. Changing trends from traditional agriculture to conservation agriculture practices may have an important role in both C and water budgets and the transformation of agriculture from C source to C sink. The objective of this study was to analyse the effect of two treatments, weed removal by herbicides versus weed cover conservation, on the C balance in an irrigated olive orchard in SE Spain. Measurements of CO2 exchange were made from October 2014 to September 2015 using two eddy covariance towers, one for each olive crop treatment. Results show that CO2 fluxes at the ecosystem scale were similar in the two treatments during initial conditions, prior to weed growth in the soils without herbicide application (October). During the first week, daily net ecosystem exchange (NEE) was close to zero in both treatments, with values ranging from 1.06 to -0.41 g C m-2 in the weed cover treatment, and from 0.76 to -0.69 g C m-2 in the weed removal treatment. As weed growth increased, higher net CO2 assimilation was found in the treatment with weed cover. In both treatments, maximum net CO2 assimilation was found in March, with a monthly NEE of -72 and -28 g C m-2 in the treatment with and without weed cover, respectively. In May, after the weeds were cut and left on the soil, a strong increase was observed in NEE in the treatment with weed cover due to decreased CO2 assimilation and increased respiration compared to the treatment without weed cover. Therefore, soil chamber measurements showed average respiration rates of 2.57 and 1.57 μmol m-2 s-2 in the weed cover and weed removal treatment, respectively. Finally, the highest monthly NEE was registered during July, with both treatments showing a similar


    PubMed Central

    Rider, Cynthia V.; Hartig, Phillip C.; Cardon, Mary C.; Lambright, Christy R.; Bobseine, Kathy L.; Guillette, Louis J.; Gray, L. Earl; Wilson, Vickie S.


    Reproductive abnormalities in alligators exposed to contaminants in Lake Apopka, Florida, USA represent a clear example of endocrine disruption in wildlife. Several of these contaminants that are not able to bind to mammalian estrogen receptors (such as atrazine and cyanazine) have previously been reported to bind to the alligator estrogen receptor from oviductal tissue. Binding of known Lake Apopka contaminants to full length estrogen receptors alpha from human (hERα) and alligator (aERα) was assessed in a side-by-side comparison within the same assay system. Baculovirus-expressed recombinant hERα and aERα were used in a competitive binding assay. Atrazine and cyanazine were not able to bind to either receptor. p,p′-Dicofol was able to bind to aERα with a concentration inhibiting 50% of binding (IC50) of 4 μM, while only partially displacing 17β-estradiol (E2) from hERα and yielding a projected IC50 of 45 μM. Chemicals that only partially displaced E2 from either receptor, including some dichlorodiphenyltrichloroethane (DDT) metabolites and trans-nonachlor, appeared to have higher affinity for aERα than hERα. p,p′-Dicofol-mediated transcriptional activation through aERα and hERα was assessed to further explore the preferential binding of p,p′-dicofol to aERα over hERα. p,p′-Dicofol was able to stimulate transcriptional activation in a similar manner with both receptors. However, the in vitro results obtained with p,p′-dicofol were not reflected in an in vivo mammalian model, where Kelthane™ (mixed o,p′-and p,p′-dicofol isomers) did not elicit estrogenic effects. In conclusion, although there was no evidence of exclusively species-specific estrogen receptor binders, some xenoestrogens, especially p,p′-dicofol, had a higher affinity for aERα than for hERα. PMID:20821664

  9. Physiological response of alligator gar juveniles (Atractosteus spatula) exposed to sub-lethal doses of pollutants.


    González, Carlos Aguilera; Cruz, Julio; Alfaro, Roberto Mendoza


    Alligator gar populations have declined because of overfishing, habitat loss and pollution. Over time, the exposure to different pollutants have affected these fishes as a consequence of their high trophic level, bottom-dwelling habits and long life span. In order to evaluate the physiological effects of pollutants on alligator gar, juveniles (6, 12 and 24 months) were exposed to sub-lethal doses of diazinon, β-naphthoflavone (BNF) and 17 β-estradiol (E2) by intraperitoneal injection. After 2 days of exposure, liver samples were taken to determine the activities of acetylcholinesterase, butyrylcholinesterase and carboxylesterase; alkaline and acid phosphatases (ALP and ACP); ethoxyresorufin o-deethylase (EROD); glutathione s-transferase (GST); superoxide dismutase (SOD), and vitellogenin (VTG) concentration. Two additional bioassays consisting on the exposure of compounds through water or food were performed and after 4 and 28 days, respectively, biomarkers were determined. All esterases were inhibited in organisms exposed to diazinon as well as in 6-months gar exposed to E2 and BNF. In contrast, ALP activity increased in gar exposed to diazinon and E2, while ACP activity did not show any variations. No EROD activity was registered after exposure to the different pollutants, despite being one of the most sensitive and common detoxification biomarkers used for fishes. GST activity reduction was detected when gar were exposed to E2 and BNF, while SOD activity increased after exposure to diazinon and E2. Finally, VTG levels were higher in animals exposed to E2 compared to other treatments. Overall, these results suggest that alligator gar juveniles have a low biotransformation metabolism and show that they are especially sensitive to those pollutants affecting the nervous system. PMID:25948055

  10. Full-length cDNA cloning and structural characterization of preproinsulin in Alligator sinensis.


    Zhang, R; Zhang, S Z; Li, E; Wang, C; Wang, C L; Wu, X B


    Insulin is an important endocrine hormone that plays a critical physiological role in regulating metabolism and glucostasis in vertebrates. In this study, the complete cDNA of Alligator sinensis preproinsulin gene was cloned for the first time by reverse transcription-polymerase chain reaction and rapid amplification of cDNA ends methods; the amino acid sequence encoded and protein structure were analyzed. The full-length of preproinsulin cDNA sequence consists of 528 base pairs (bp), comprising a 34-bp 5'-untranslated region, a 170-bp 3'-untranslated region and an open reading frame that is 324 bp in length. The open reading frame encodes a 107-amino acid preproinsulin with a molecular weight of approximately 12,153.8 Da, theoretical isoelectric point of 5.68, aliphatic index of 92.06, and grand average of hydropathicity of -0.157, from which a signal peptide, a B-chain, a C-peptide, and an A-chain are derived. Online analysis suggested that the deduced preproinsulin amino acid sequence contains a transmembrane region, and that it has a signal peptide whose cleavage site occurs between alanine 24 and alanine 25. Comparative analysis of preproinsulin amino acid sequences indicated that the A-chain and B-chain sequences of preproinsulins are highly conserved between reptiles and birds, and that the preproinsulin amino acid sequence of Alligator sinensis shares 89% similarity to that of Chelonia mydas, but low similarity of 48-63% to those of mammals and fishes. The phylogenetic tree constructed using the neighbor-joining method revealed that preproinsulin of Alligator sinensis had high homology with reptiles and birds, such as Chelonia mydas, Gallus gallus, and Columba livia. PMID:25366775

  11. Plasma steroid concentrations and male phallus size in juvenile alligators from seven Florida lakes

    USGS Publications Warehouse

    Guillette, L.J.; Woodward, A.R.; Crain, D.A.; Pickford, D.B.; Rooney, A.A.; Percival, H.F.


    Neonatal and juvenile alligators from contaminated Lake Apopka in central Florida exhibit abnormal plasma sex steroid concentrations as well as morphological abnormalities of the gonad and phallus. This study addresses whether similar abnormalities occur in juvenile alligators inhabiting six other lakes in Florida. For analysis, animals were partitioned into two subsets, animals 40-79 cm total length (1-3 years old) and juveniles 80-130 cm total length (3-7 years old). Plasma testosterone (T) concentrations were lower in small males from lakes Apopka, Griffin, and Jessup than from Lake Woodruff National Wildlife Refuge (NWR). Similar differences were observed in the larger juveniles, with males from lakes Jessup, Apopka, and Okeechobee having lower plasma T concentrations than Lake Woodruff males. Plasma estradiol-17?? (E2) concentrations were significantly elevated in larger juvenile males from Lake Apopka compared to Lake Woodruff NWR. When compared to small juvenile females from Lake Woodruff NWR, females from lakes Griffin, Apopka, Orange, and Okeechobee had elevated plasma E2 concentrations. Phallus size was significantly smaller in males from lakes Griffin and Apopka when compared to males from Lake Woodruff NWR. An association existed between body size and phallus size on all lakes except Lake Apopka and between phallus size and plasma T concentration on all lakes except lakes Apopka and Orange. Multiple regression analysis, with body size and plasma T concentration as independent covariables, explained the majority of the variation in phallus size on all lakes. These data suggest that the differences in sex steroids and phallus size observed in alligators from Lake Apopka are not limited to that lake, nor to one with a history of a major pesticide spill. Further work examining the relationship of sex steroids and phallus size with specific biotic and abiotic factors, such as antiandrogenic or estrogenic contaminants, is needed.

  12. Physiological response of alligator gar juveniles (Atractosteus spatula) exposed to sub-lethal doses of pollutants.


    González, Carlos Aguilera; Cruz, Julio; Alfaro, Roberto Mendoza


    Alligator gar populations have declined because of overfishing, habitat loss and pollution. Over time, the exposure to different pollutants have affected these fishes as a consequence of their high trophic level, bottom-dwelling habits and long life span. In order to evaluate the physiological effects of pollutants on alligator gar, juveniles (6, 12 and 24 months) were exposed to sub-lethal doses of diazinon, β-naphthoflavone (BNF) and 17 β-estradiol (E2) by intraperitoneal injection. After 2 days of exposure, liver samples were taken to determine the activities of acetylcholinesterase, butyrylcholinesterase and carboxylesterase; alkaline and acid phosphatases (ALP and ACP); ethoxyresorufin o-deethylase (EROD); glutathione s-transferase (GST); superoxide dismutase (SOD), and vitellogenin (VTG) concentration. Two additional bioassays consisting on the exposure of compounds through water or food were performed and after 4 and 28 days, respectively, biomarkers were determined. All esterases were inhibited in organisms exposed to diazinon as well as in 6-months gar exposed to E2 and BNF. In contrast, ALP activity increased in gar exposed to diazinon and E2, while ACP activity did not show any variations. No EROD activity was registered after exposure to the different pollutants, despite being one of the most sensitive and common detoxification biomarkers used for fishes. GST activity reduction was detected when gar were exposed to E2 and BNF, while SOD activity increased after exposure to diazinon and E2. Finally, VTG levels were higher in animals exposed to E2 compared to other treatments. Overall, these results suggest that alligator gar juveniles have a low biotransformation metabolism and show that they are especially sensitive to those pollutants affecting the nervous system.

  13. Post-hatching development of mitochondrial function, organ mass and metabolic rate in two ectotherms, the American alligator (Alligator mississippiensis) and the common snapping turtle (Chelydra serpentina)

    PubMed Central

    Sirsat, Sarah K. G.; Sirsat, Tushar S.; Price, Edwin R.; Dzialowski, Edward M.


    ABSTRACT The ontogeny of endothermy in birds is associated with disproportionate growth of thermogenic organs and increased mitochondrial oxidative capacity. However, no similar study has been made of the development of these traits in ectotherms. For comparison, we therefore investigated the metabolism, growth and muscle mitochondrial function in hatchlings of a turtle and a crocodilian, two ectotherms that never develop endothermy. Metabolic rate did not increase substantially in either species by 30 days post-hatching. Yolk-free body mass and heart mass did not change through 30 days in alligators and heart mass was a constant proportion of body mass, even after 1 year. Yolk-free body mass and liver mass grew 36% and 27%, respectively, in turtles during the first 30 days post-hatch. The mass-specific oxidative phosphorylation capacity of mitochondria, assessed using permeabilized muscle fibers, increased by a non-significant 47% in alligator thigh and a non-significant 50% in turtle thigh over 30 days, but did not increase in the heart. This developmental trajectory of mitochondrial function is slower and shallower than that previously observed in ducks, which demonstrate a 90% increase in mass-specific oxidative phosphorylation capacity in thigh muscles over just a few days, a 60% increase in mass-specific oxidative phosphorylation capacity of the heart over a few days, and disproportionate growth of the heart and other organs. Our data thus support the hypothesis that these developmental changes in ducks represent mechanistic drivers for attaining endothermy. PMID:26962048

  14. Post-hatching development of mitochondrial function, organ mass and metabolic rate in two ectotherms, the American alligator (Alligator mississippiensis) and the common snapping turtle (Chelydra serpentina).


    Sirsat, Sarah K G; Sirsat, Tushar S; Price, Edwin R; Dzialowski, Edward M


    The ontogeny of endothermy in birds is associated with disproportionate growth of thermogenic organs and increased mitochondrial oxidative capacity. However, no similar study has been made of the development of these traits in ectotherms. For comparison, we therefore investigated the metabolism, growth and muscle mitochondrial function in hatchlings of a turtle and a crocodilian, two ectotherms that never develop endothermy. Metabolic rate did not increase substantially in either species by 30 days post-hatching. Yolk-free body mass and heart mass did not change through 30 days in alligators and heart mass was a constant proportion of body mass, even after 1 year. Yolk-free body mass and liver mass grew 36% and 27%, respectively, in turtles during the first 30 days post-hatch. The mass-specific oxidative phosphorylation capacity of mitochondria, assessed using permeabilized muscle fibers, increased by a non-significant 47% in alligator thigh and a non-significant 50% in turtle thigh over 30 days, but did not increase in the heart. This developmental trajectory of mitochondrial function is slower and shallower than that previously observed in ducks, which demonstrate a 90% increase in mass-specific oxidative phosphorylation capacity in thigh muscles over just a few days, a 60% increase in mass-specific oxidative phosphorylation capacity of the heart over a few days, and disproportionate growth of the heart and other organs. Our data thus support the hypothesis that these developmental changes in ducks represent mechanistic drivers for attaining endothermy. PMID:26962048

  15. Using Mustard Seed Meal and Cover Crops for Weed Control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    There continues to be a steady growth in the use of fall planted brassica cover crops in the Columbia Basin especially prior to potatoes. Several benefits include better water infiltration, reclaiming nitrogen, reduced erosion, and suppression of nematodes, diseases, and weeds. Weed suppression is...

  16. Herbicide-resistant crops, resistant weeds, and herbicide drift

    Technology Transfer Automated Retrieval System (TEKTRAN)

    New herbicide-resistance traits in corn and soybean may bring new management challenges for fruit and vegetable growers in the Mid-Atlantic region. Herbicide-resistant crops are an important weed management technology in row crop agriculture that allow growers to apply an herbicide to control weed...

  17. 'Carolina' session: a major utilities program to manage aquatic weeds

    SciTech Connect

    Schiller, D.H.


    Carolina Power and Light Company has recently experienced aquatic weed problems in two of its impoundments. These problems have impacted power plant operations, water quality, and recreational activities. The Company is actively pursuing a program to deal with these weed problems through education, research, monitoring, and control activities.

  18. Working the Educational Soil and Pulling Up Weeds

    ERIC Educational Resources Information Center

    Riggins-Newby, Cheryl


    The job of an instructional leader, according to former Baltimore principal Deborah Wortham, is to be a gardener. School cultures left unattended, she says, sprout weeds that will eventually overwhelm the research-based programs, practices, and best efforts of teachers and administrators. The most aggressive and harmful educational weeds Wortham…

  19. Biological aspects of weed dynamics in no-till systems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Scientists and producers in the Eurasian steppe are interested in no-till crop production, but are concerned that, without tillage, weed density will escalate in croplands. In the United States, producers have used no-till systems for several decades and weed density has not increased. In this pap...

  20. Weed manipulation for insect pest management in corn

    NASA Astrophysics Data System (ADS)

    Altieri, M. A.; Whitcomb, W. H.


    Populations of insect pests and associated predaceous arthropods were sampled by direct observation and other relative methods in simple and diversified corn habitats at two sites in north Florida during 1978 and 1979. Through various cultural manipulations, characteristic weed communities were established selectively in alternate rows within corn plots. Fall armyworm ( Spodoptera frugiperda J. E. Smith) incidence was consistently higher in the weed-free habitats than in the corn habitats containing natural weed complexes or selected weed associations. Corn earworm ( Heliothis zea Boddie) damage was similar in all weed-free and weedy treatments, suggesting that this insect is not affected greatly by weed diversity. Only the diversification of corn with a strip of soybean significantly reduced corn earworm damage. In one site, distance between plots was reduced. Because predators moved freely between habitats, it was difficult to identify between-treatment differences in the composition of predator communities. In the other site, increased distances between plots minimized such migrations, resulting in greater population densities and diversity of common foliage insect predators in the weed-manipulated corn systems than in the weed-free plots. Trophic relationships in the weedy habitats were more complex than food webs in monocultures. Predator diversity (measured as mean number of species per area) and predator density was higher in com plots surrounded by mature, complex vegetation than at those surrounded by annual crops. This suggests that diverse adjacent areas to crops provide refuge for predators, thus acting as colonization sources.

  1. Weeds of the Midwestern United States and Central Canada

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The book, Weeds of the Central United States and Canada, includes 356 of the most common and/or troublesome weeds of agricultural and natural areas found within the central region of the United States and Canada. The books includes an introduction, a key to plant families contained in the book, glo...

  2. Weed science research and funding: a call to action

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed science has contributed much to agriculture, forestry and natural resource management over its history. However, if it is to remain relevant as a scientific discipline, it is long past time for weed scientists to take a step outside the “herbicide efficacy box” and address system-level issues i...

  3. Spectral reflectance and digital image relations among five aquatic weeds

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This study reports on the use of an artificial quartz halogen lighting source to facilitate the acquisition of spectral light reflectance measurements and digital imaging of invasive aquatic weeds. Spectral leaf or leaf/stem reflectance measurements were made on five aquatic weeds: Eurasian watermil...

  4. How to Identify and Control Water Weeds and Algae.

    ERIC Educational Resources Information Center

    Applied Biochemists, Inc., Mequon, WI.

    Included in this guide to water management are general descriptions of algae, toxic algae, weed problems in lakes, ponds, and canals, and general discussions of mechanical, biological and chemical control methods. In addition, pictures, descriptions, and recommended control methods are given for algae, 6 types of floating weeds, 18 types of…

  5. Weed Suppression by Seven Clover Species

    SciTech Connect

    Ross, Shirley M.; King, Jane R.; Izaurralde, R Cesar C.; O'Donovan, John T.


    Used as cover crops, clover species may differ in their ability to suppress weed growth. Field trials were conducted in Alberta, Canada to measure the growth of brown mustard [Brassica juncea (L.) Czern.], in mowed and nonmowed production, as influenced by alsike (Trifolium hybridum L.), balansa [T. michelianum Savi var. balansae (Boiss.) Azn.], berseem (T. alexandrinum L.), crimson [T. incarnatum (Boiss.) Azn.], berseem (T. alexandrinum L.), crimson (T. incarnatum L.), Persian (T. resupinatum L.), red (T. pratense L.), and white Dutch (T. repens L.) clover and fall rye (Secale cereale L.). In 1997, clovers reduced mustard biomass in nonmowed treatments by 29% on a high- fertility soil (Typic Cryoboroll) at Edmonton and by 57% on a low- fertility soil (Typic Cryoboralf) at Breton. At Edmonton, nonmowed mustard biomass was reduced by alsike and berseem clover in 1996 and by alsike, balansa, berseem, and crimson clover in 1997. At Breton, all seven clover species suppressed weed biomass. A negative correlation was noted among clover and mustard biomass at Edmonton but not at Breton. The effects of mowing varied with location, timing, and species. Mowing was beneficial to crop/weed proportion at Edmonton but not at Breton. Mowing at early flowering of mustard large-seeded legumes and sweetclover (Melilotus offici) produced greater benefit than mowing at late flowering. With early mowing, all clover species suppressed mustard growth at Edmonton. Clovers reduced mustard regrowth (g plant21 ) and the number of mustard plants producing regrowth. The characteristics of berseem clover (upright growth, long stems, high biomass, and late flowering) would support its use as a cover crop or forage in north-central Alberta.

  6. Characterization of microsatellite DNA markers for the alligator snapping turtle, Macrochelys temminckii: Primer note

    USGS Publications Warehouse

    Hackler, J.C.; Van Den Bussche, Ronald A.; Leslie, David M.


    Two trinucleotide and seven tetranucleotide microsatellite loci were isolated from an alligator snapping turtle Macrochelys temminckii. To assess the degree of variability in these nine microsatellite loci, we genotyped 174 individuals collected from eight river drainage basins in the southeastern USA. These markers revealed a moderate degree of allelic diversity (six to 16 alleles per locus) and observed heterozygosity (0.166-0.686). These polymorphic microsatellite loci provide powerful tools for population genetic studies for a species that is afforded some level of conservation protection in every state in which it occurs. ?? 2006 The Authors.

  7. Applying a weed risk assessment approach to GM crops.


    Keese, Paul K; Robold, Andrea V; Myers, Ruth C; Weisman, Sarah; Smith, Joe


    Current approaches to environmental risk assessment of genetically modified (GM) plants are modelled on chemical risk assessment methods, which have a strong focus on toxicity. There are additional types of harms posed by plants that have been extensively studied by weed scientists and incorporated into weed risk assessment methods. Weed risk assessment uses robust, validated methods that are widely applied to regulatory decision-making about potentially problematic plants. They are designed to encompass a broad variety of plant forms and traits in different environments, and can provide reliable conclusions even with limited data. The knowledge and experience that underpin weed risk assessment can be harnessed for environmental risk assessment of GM plants. A case study illustrates the application of the Australian post-border weed risk assessment approach to a representative GM plant. This approach is a valuable tool to identify potential risks from GM plants.

  8. RNAseq reveals weed-induced PIF3-like as a candidate target to manipulate weed stress response in soybean

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Research conducted, including the rationale: Weeds reduce yield in soybeans through incompletely defined mechanisms. The effects of weeds on the soybean transcriptome were evaluated in field conditions during four separate growing seasons. Methods: RNASeq data were collected from 6 biological sam...

  9. Slow isotope turnover rates and low discrimination values in the American alligator: implications for interpretation of ectotherm stable isotope data.


    Rosenblatt, Adam E; Heithaus, Michael R


    Stable isotope analysis has become a standard ecological tool for elucidating feeding relationships of organisms and determining food web structure and connectivity. There remain important questions concerning rates at which stable isotope values are incorporated into tissues (turnover rates) and the change in isotope value between a tissue and a food source (discrimination values). These gaps in our understanding necessitate experimental studies to adequately interpret field data. Tissue turnover rates and discrimination values vary among species and have been investigated in a broad array of taxa. However, little attention has been paid to ectothermic top predators in this regard. We quantified the turnover rates and discrimination values for three tissues (scutes, red blood cells, and plasma) in American alligators (Alligator mississippiensis). Plasma turned over faster than scutes or red blood cells, but turnover rates of all three tissues were very slow in comparison to those in endothermic species. Alligator δ(15)N discrimination values were surprisingly low in comparison to those of other top predators and varied between experimental and control alligators. The variability of δ(15)N discrimination values highlights the difficulties in using δ(15)N to assign absolute and possibly even relative trophic levels in field studies. Our results suggest that interpreting stable isotope data based on parameter estimates from other species can be problematic and that large ectothermic tetrapod tissues may be characterized by unique stable isotope dynamics relative to species occupying lower trophic levels and endothermic tetrapods.

  10. Urinary iodine and stable isotope analysis to examine habitat influences on thyroid hormones among coastal dwelling American alligators.


    Boggs, Ashley S P; Hamlin, Heather J; Nifong, James C; Kassim, Brittany L; Lowers, Russell H; Galligan, Thomas M; Long, Stephen E; Guillette, Louis J


    The American alligator, generally a freshwater species, is known to forage in marine environments despite the lack of a salt secreting gland found in other crocodylids. Estuarine and marine foraging could lead to increased dietary uptake of iodine, a nutrient necessary for the production of thyroid hormones. To explore the influence of dietary iodine on thyroid hormone health of coastal dwelling alligators, we described the seasonal plasma thyroxine and triiodothyronine concentrations measured by radioimmunoassay and urinary iodine (UI) concentrations measured by inductively coupled plasma mass spectrometry. We also analyzed long-term dietary patterns through stable isotope analysis of scute tissue. Snout-to-vent length (SVL) was a significant factor among UI and stable isotope analyses. Large adult males greater than 135cm SVL had the highest UI concentrations but did not display seasonality of thyroid hormones. Alligators under 135 SVL exhibited seasonality in thyroid hormones and a positive relationship between UI and triiodothyronine concentrations. Isotopic signatures provided supporting evidence that large males predominantly feed on marine/estuarine prey whereas females showed reliance on freshwater/terrestrial prey supplemented by marine/estuarine prey. UI measurement provided immediate information that correlated to thyroid hormone concentrations whereas stable isotope analysis described long-term dietary patterns. Both techniques demonstrate that adult alligators in coastal environments are utilizing estuarine/marine habitats, which could alter thyroid hormone physiology.

  11. Nuclear β-catenin localization supports homology of feathers, avian scutate scales, and alligator scales in early development.


    Musser, Jacob M; Wagner, Günter P; Prum, Richard O


    Feathers are an evolutionary novelty found in all extant birds. Despite recent progress investigating feather development and a revolution in dinosaur paleontology, the relationship of feathers to other amniote skin appendages, particularly reptile scales, remains unclear. Disagreement arises primarily from the observation that feathers and avian scutate scales exhibit an anatomical placode-defined as an epidermal thickening-in early development, whereas alligator and other avian scales do not. To investigate the homology of feathers and archosaur scales we examined patterns of nuclear β-catenin localization during early development of feathers and different bird and alligator scales. In birds, nuclear β-catenin is first localized to the feather placode, and then exhibits a dynamic pattern of localization in both epidermis and dermis of the feather bud. We found that asymmetric avian scutate scales and alligator scales share similar patterns of nuclear β-catenin localization with feathers. This supports the hypothesis that feathers, scutate scales, and alligator scales are homologous during early developmental stages, and are derived from early developmental stages of an asymmetric scale present in the archosaur ancestor. Furthermore, given that the earliest stage of β-catenin localization in feathers and archosaur scales is also found in placodes of several mammalian skin appendages, including hair and mammary glands, we hypothesize that a common skin appendage placode originated in the common ancestor of all amniotes. We suggest a skin placode should not be defined by anatomical features, but as a local, organized molecular signaling center from which an epidermal appendage develops.

  12. Cloning of the growth hormone cDNA of alligator gar Atractosteus spatula and its expression through larval development.


    Revol, Agnès; Garza Rodríguez, Maria de Lourdes; Hernández Montenegro, Víctor; Aguilera, Carlos; Barrera Saldaña, Hugo; Mendoza, Roberto


    The alligator gar (Atractosteus spatula) is the largest freshwater fish inhabiting rivers draining into the Gulf of Mexico. This primitive fish shows a fast growth rate since its early larval stages. This is attributed to the action of growth hormone (GH), an anterior pituitary gland hormone responsible for linear growth in vertebrates that can also be expressed in extrapituitary adult tissues and in fish embryos. The present research was aimed at obtaining the GH coding sequence of the alligator gar and studying its expression through larval development. A cDNA was obtained by RT-PCR, cloned and sequenced. The alligator gar GH cDNA sequence shares 98% nucleotide similarity with that reported for Lepisosteus osseus, indicating a very slow evolution of the GH within the primitive fish, in contrast with the burst of changes observed in euteleosts. Using RT-PCR and RNA nuclease protection assays, GH transcripts were detected at very high levels in eggs, embryos and in several larval stages. These data suggest that the GH may play an important role during embryogenesis in fish. The better understanding of alligator gar larval physiology will facilitate the culture of larvae and juvenile gar and consequently may allow the restoration of their natural populations. PMID:15936701

  13. Cloning of the growth hormone cDNA of alligator gar Atractosteus spatula and its expression through larval development.


    Revol, Agnès; Garza Rodríguez, Maria de Lourdes; Hernández Montenegro, Víctor; Aguilera, Carlos; Barrera Saldaña, Hugo; Mendoza, Roberto


    The alligator gar (Atractosteus spatula) is the largest freshwater fish inhabiting rivers draining into the Gulf of Mexico. This primitive fish shows a fast growth rate since its early larval stages. This is attributed to the action of growth hormone (GH), an anterior pituitary gland hormone responsible for linear growth in vertebrates that can also be expressed in extrapituitary adult tissues and in fish embryos. The present research was aimed at obtaining the GH coding sequence of the alligator gar and studying its expression through larval development. A cDNA was obtained by RT-PCR, cloned and sequenced. The alligator gar GH cDNA sequence shares 98% nucleotide similarity with that reported for Lepisosteus osseus, indicating a very slow evolution of the GH within the primitive fish, in contrast with the burst of changes observed in euteleosts. Using RT-PCR and RNA nuclease protection assays, GH transcripts were detected at very high levels in eggs, embryos and in several larval stages. These data suggest that the GH may play an important role during embryogenesis in fish. The better understanding of alligator gar larval physiology will facilitate the culture of larvae and juvenile gar and consequently may allow the restoration of their natural populations.

  14. Urinary iodine and stable isotope analysis to examine habitat influences on thyroid hormones among coastal dwelling American alligators.


    Boggs, Ashley S P; Hamlin, Heather J; Nifong, James C; Kassim, Brittany L; Lowers, Russell H; Galligan, Thomas M; Long, Stephen E; Guillette, Louis J


    The American alligator, generally a freshwater species, is known to forage in marine environments despite the lack of a salt secreting gland found in other crocodylids. Estuarine and marine foraging could lead to increased dietary uptake of iodine, a nutrient necessary for the production of thyroid hormones. To explore the influence of dietary iodine on thyroid hormone health of coastal dwelling alligators, we described the seasonal plasma thyroxine and triiodothyronine concentrations measured by radioimmunoassay and urinary iodine (UI) concentrations measured by inductively coupled plasma mass spectrometry. We also analyzed long-term dietary patterns through stable isotope analysis of scute tissue. Snout-to-vent length (SVL) was a significant factor among UI and stable isotope analyses. Large adult males greater than 135cm SVL had the highest UI concentrations but did not display seasonality of thyroid hormones. Alligators under 135 SVL exhibited seasonality in thyroid hormones and a positive relationship between UI and triiodothyronine concentrations. Isotopic signatures provided supporting evidence that large males predominantly feed on marine/estuarine prey whereas females showed reliance on freshwater/terrestrial prey supplemented by marine/estuarine prey. UI measurement provided immediate information that correlated to thyroid hormone concentrations whereas stable isotope analysis described long-term dietary patterns. Both techniques demonstrate that adult alligators in coastal environments are utilizing estuarine/marine habitats, which could alter thyroid hormone physiology. PMID:26684734

  15. The first fossil skull of Alligator sinensis from the Pleistocene, Taiwan, with a paleogeographic implication of the species

    NASA Astrophysics Data System (ADS)

    Hsi-yin, Shan; Yen-nien, Cheng; Xiao-chun, Wu


    A nearly complete fossil skull of Alligatoridae from the Pleistocene, Penghu Channel, east of Taiwan, is reported. It can be referred to the most latest clade of Alligatorinae, which includes Alligator sinensis, Alligator mississippiensis and Alligator mefferdi, on the basis of the following features: the splenial is excluded from the mandibular symphysis; the anterior tip of the splenial passes dorsal to the Meckelian groove; and the mandible is gently curved between the fourth alveoli and the mid dentary. It differs from A. mississippiensis and A. mefferdi mainly in the following characters: the breadth between the supratemporal fenestrae is approximately equal to the interorbital width, the snout is about half the length of the skull; and the anterior part of the snout is subtriangular in dorsal view. These features suggest that the Penghu alligator is most probably referable to A. sinensis. This is the only fossil skull of A. sinensis known. The discovery of the skull in Penghu Channel not only provides the first solid fossil evidence to indicate that the geological distribution of A. sinensis extended farther southeast than the historical/archeological range of the species but also adds new information on the biodiversity of the Penghu fauna.

  16. Use of weeds as traditional vegetables in Shurugwi District, Zimbabwe

    PubMed Central


    Background Most agricultural weeds are usually regarded as undesirable and targeted for eradication. However, weeds are useful to human beings as food and traditional medicines. Few studies have been done to document the uses of weeds as traditional vegetables. This study was therefore, done to document indigenous knowledge related to the diversity and use of agricultural weeds as traditional vegetables in Shurugwi District, Zimbabwe, emphasizing their role in food security and livelihoods of the local people. Materials and methods Semi-structured interviews, observation and guided field walks with 147 participants were employed between December 2011 and January 2012 to obtain ethnobotanical data on the use of edible weeds as traditional vegetables. Based on ethnobotanical information provided by the participants, botanical specimens were collected, numbered, pressed and dried for identification. Results A total of 21 edible weeds belonging to 11 families and 15 genera, mostly from Amaranthaceae (19%), Asteraceae and Tiliaceae (14.3%), Capparaceae, Cucurbitaceae and Solanaceae (9.5% each) were identified. Of the documented edible weeds, 52.4% are indigenous while 47.6% are exotic to Zimbabwe; either semi-cultivated or growing naturally as agricultural weeds in farmlands, fallow land and home gardens. Among the main uses of edible weeds were leafy vegetables (81%), followed by edible fruits (19%), edible corms (9.5%), edible flowers and seeds (4.8% each). The most important edible weeds were Cleome gynandra, cited by 93.9% of the participants, Cucumis metuliferus (90.5%), Cucumis anguria (87.8%), Corchorus tridens (50.3%) and Amaranthus hybridus (39.5%). All edible weeds were available during rainy and harvest period with Cleome gynandra, Corchorus tridens, Cucumis anguria, Cucumis metuliferus and Moringa oleifera also available during the dry season, enabling households to obtain food outputs in different times of the year. The importance of edible weeds for local

  17. 7 CFR 360.300 - Notice of restrictions on movement of noxious weeds.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Notice of restrictions on movement of noxious weeds... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.300 Notice of restrictions on movement of noxious weeds. No person may move a Federal noxious weed into...

  18. 7 CFR 360.300 - Notice of restrictions on movement of noxious weeds.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Notice of restrictions on movement of noxious weeds... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.300 Notice of restrictions on movement of noxious weeds. No person may move a Federal noxious weed into...

  19. 76 FR 39811 - International Center for Technology Assessment and the Center for Food Safety; Noxious Weed...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Assessment and the Center for Food Safety; Noxious Weed Status of Kentucky Bluegrass Genetically Engineered... engineered for tolerance to the herbicide glyphosate should not be listed as a Federal noxious weed and... noxious weeds. Our decision is based on our analysis of available scientific data, our weed...

  20. 7 CFR 360.305 - Disposal of noxious weeds when permits are canceled.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Disposal of noxious weeds when permits are canceled... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.305 Disposal of noxious weeds when permits are canceled. When a permit for the movement of a noxious weed...

  1. 7 CFR 360.305 - Disposal of noxious weeds when permits are canceled.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 5 2011-01-01 2011-01-01 false Disposal of noxious weeds when permits are canceled... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.305 Disposal of noxious weeds when permits are canceled. When a permit for the movement of a noxious weed...

  2. 7 CFR 360.305 - Disposal of noxious weeds when permits are canceled.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Disposal of noxious weeds when permits are canceled... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.305 Disposal of noxious weeds when permits are canceled. When a permit for the movement of a noxious weed...

  3. 7 CFR 360.300 - Notice of restrictions on movement of noxious weeds.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Notice of restrictions on movement of noxious weeds... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.300 Notice of restrictions on movement of noxious weeds. No person may move a Federal noxious weed into...

  4. Lawn Weeds and Their Control. North Central Regional Extension Publication No. 26.

    ERIC Educational Resources Information Center

    Purdue Univ., Lafayette, IN. Cooperative Extension Service.

    This publication discusses lawn weed control for the twelve state north central region of the country. Written for use by homeowners, the publication focuses on weed identification and proper herbicide selection and application. Identification of weeds and safe and appropriate herbicide use are emphasized. Forty-six weed and turf plants are…

  5. 7 CFR 360.300 - Notice of restrictions on movement of noxious weeds.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 5 2011-01-01 2011-01-01 false Notice of restrictions on movement of noxious weeds... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.300 Notice of restrictions on movement of noxious weeds. No person may move a Federal noxious weed into...

  6. 7 CFR 360.305 - Disposal of noxious weeds when permits are canceled.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Disposal of noxious weeds when permits are canceled... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.305 Disposal of noxious weeds when permits are canceled. When a permit for the movement of a noxious weed...

  7. Economics of supplemental weed control applications on spring-transplanted onions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Field research conducted to determine the relative benefits among alternative herbicides for weed control in onions (Allium cepa L.) measured weed control efficacy, impact of herbicides on crop injury, and the resulting weed competition on crop yields and marketable bulb size. Weed competition produ...

  8. Atropine intoxication from the ingestion and smoking of jimson weed (Datura stramonium).


    Guharoy, S R; Barajas, M


    Anticholinergic effects occur due to jimson weed intoxication. The most common intoxication involves teenagers desiring mind-altering properties from the plant. We report 4 cases of jimson weed intoxication due to ingestion and inhalation (smoking) of jimson weed. Clinicians should be aware of the potential abuse of botanicals such as jimson weed. PMID:1808839

  9. Gonadal steroidogenesis in vitro from juvenile alligators obtained from contaminated or control lakes.

    PubMed Central

    Guillette, L J; Gross, T S; Gross, D A; Rooney, A A; Percival, H F


    The ubiquitous distribution of many contaminants and the nonlethal, multigenerational effects of such contaminants on reproductive, endocrine, and immune systems have led to concerns that wildlife worldwide are affected. Although the causal agents and effects are known for some species, the underlying physiological mechanisms associated with contaminant-induced reproductive modifications are still poorly understood and require extensive research. We describe a study examining the steroidogenic activity of gonads removed from juvenile alligators (Alligator mississippiensis) obtained from contaminated or control lakes in central Florida. Synthesis of estradiol-17 beta (E2) was significantly different when ovaries from the contaminated and control lakes were compared in vitro. Additionally, testes from males obtained from the contaminated lake. Lake Apopka, synthesized significantly higher concentrations of E2 when compared to testes obtained from control males. In contrast, testosterone (T) synthesis from all testes examined in this study displayed a normal pattern and produced concentrations greater than that observed from ovaries obtained from either lake. Interestingly, the pattern of gonadal steroidogenesis differs from previously reported plasma concentrations of these hormones obtained from the same individuals. We suggest that the differences between the in vivo and in vitro patterns are due to modifications in the hepatic degradation of plasma sex steroid hormones. PMID:7556021

  10. In vivo bone strain and finite element modeling of the mandible of Alligator mississippiensis

    PubMed Central

    Porro, Laura B; Metzger, Keith A; Iriarte-Diaz, Jose; Ross, Callum F


    Forces experienced during feeding are thought to strongly influence the morphology of the vertebrate mandible; in vivo strain data are the most direct evidence for deformation of the mandible induced by these loading regimes. Although many studies have documented bone strains in the mammalian mandible, no information is available on strain magnitudes, orientations or patterns in the sauropsid lower jaw during feeding. Furthermore, strain gage experiments record the mechanical response of bone at a few locations, not across the entire mandible. In this paper, we present bone strain data recorded at various sites on the lower jaw of Alligator mississippiensis during in vivo feeding experiments. These data are used to understand how changes in loading regime associated with changes in bite location are related to changes in strain regime on the working and balancing sides of the mandible. Our results suggest that the working side mandible is bent dorsoventrally and twisted about its long-axis during biting, and the balancing side experiences primarily dorsoventral bending. Strain orientations are more variable on the working side than on the balancing side with changes in bite point and between experiments; the balancing side exhibits higher strain magnitudes. In the second part of this paper, we use principal strain orientations and magnitudes recorded in vivo to evaluate a finite element model of the alligator mandible. Our comparison demonstrates that strain orientations and mandibular deformation predicted by the model closely match in vivo results; however, absolute strain magnitudes are lower in the finite element model. PMID:23855772

  11. Spermiogenesis in the imbricate alligator lizard, Barisia imbricata (Reptilia, Squamata, Anguidae).


    Gribbins, Kevin M; Rheubert, Justin L; Touzinsky, Katherine; Hanover, Jessica; Matchett, Caroline L; Granados-González, Gisela; Hernández-Gallegos, Oswaldo


    Although the events of spermiogenesis are commonly studied in amniotes, the amount of research available for Squamata is lacking. Many studies have described the morphological characteristics of mature spermatozoa in squamates, but few detail the ultrastructural changes that occur during spermiogenesis. This study's purpose is to gain a better understanding of the subcellular events of spermatid development within the Imbricate Alligator Lizard, Barisia imbricata. The morphological data presented here represent the first complete ultrastructural study of spermiogenesis within the family Anguidae. Samples of testes from four specimens collected on the northwest side of the Nevado de Toluca, México, were prepared using standard techniques for transmission electron microscopy. Many of the ultrastructural changes occurring during spermiogenesis within B. imbricata are similar to that of other squamates (i.e., early acrosome formation, chromatin condensation, flagella formation, annulus present, and a prominent manchette). However, there are a few unique characteristics within B. imbricata spermatids that to date have not been described during spermiogenesis in other squamates. For example, penetration of the acrosomal granule into the subacrosomal space to form the basal plate of the perforatorium during round spermatid development, the clover-shaped morphology of the developing nuclear fossa of the flagellum, and the bulbous shape to the perforatorium are all unique to the Imbricate Alligator Lizard. These anatomical character differences may be valuable nontraditional data that along with more traditional matrices (such as DNA sequences and gross morphological data) may help elucidate phylogenetic relationships, which are historically considered controversial within Squamata.

  12. Quantification of intraskeletal histovariability in Alligator mississippiensis and implications for vertebrate osteohistology.


    Woodward, Holly N; Horner, John R; Farlow, James O


    Bone microanalyses of extant vertebrates provide a necessary framework from which to form hypotheses regarding the growth and skeletochronology of extinct taxa. Here, we describe the bone microstructure and quantify the histovariability of appendicular elements and osteoderms from three juvenile American alligators (Alligator mississippiensis) to assess growth mark and tissue organization within and amongst individuals, with the intention of validating paleohistological interpretations. Results confirm previous observations that lamellar and parallel fibered tissue organization are typical of crocodylians, and also that crocodylians are capable of forming woven tissue for brief periods. Tissue organization and growth mark count varies across individual skeletal elements and reveal that the femur, tibia, and humerus had the highest annual apposition rates in each individual. Cyclical growth mark count also varies intraskeletally, but data suggest these inconsistencies are due to differing medullary cavity expansion rates. There was no appreciable difference in either diaphyseal circumference or cyclical growth mark circumferences between left and right element pairs from an individual if diaphyses were sampled from roughly the same location. The considerable intraskeletal data obtained here provide validation for long-held paleohistology assumptions, but because medullary expansion, cyclical growth mark formation, and variable intraskeletal growth rates are skeletal features found in tetrapod taxa living or extinct, the validations presented herein should be considered during any tetrapod bone microanalysis. PMID:24949239

  13. Acanthostomum macroclemidis n. sp. (Digenea: Cryptogonimidae: Acanthostominae) from the alligator snapping turtle, Macroclemys temmincki.


    Tkach, Vasyl V; Snyder, Scott D


    Acanthostomum macroclemidis n. sp. is described from specimens found in the intestine of an alligator snapping turtle Macroclemys temmincki from southern Mississippi. The most important diagnostic features of the new species are the general shape and proportions of the body, the position of the pharynx (relative length of the prepharynx and esophagus), the egg size, the relative length and position of the vitelline fields, and the number, shape, and size of the circumoral spines. The new species has a very elongated body (length-width ratio, 8.9-13.0:1), 26 circumoral spines, which are almost oval in shape, a long prepharynx and a very short (shorter than the pharynx) esophagus, a seminal receptacle situated between the ovary and the anterior testis, a uterus not extending posterior to the anterior margin of the ovary, a long-stemmed and short-armed excretory vesicle, and 2 anal openings. Some features of the external morphology, such as the suckers, circumoral spines, sensory papillae, tegumental spines, and morphology of the posterior end, are examined using scanning electron microscopy. A diagnosis differentiating A. macroclemidis n. sp. from some other acanthostomine digeneans is provided. Acanthostomum macroclemidis n. sp. is the first digenean reported from an alligator snapping turtle and represents the northernmost record of an acanthostomine from turtles. PMID:12659321

  14. Three-dimensional skeletal kinematics of the shoulder girdle and forelimb in walking Alligator

    PubMed Central

    Baier, David B; Gatesy, Stephen M


    Crocodylians occupy a key phylogenetic position for investigations of archosaur locomotor evolution. Compared to the well-studied hindlimb, relatively little is known about the skeletal movements and mechanics of the forelimb. In this study, we employed manual markerless XROMM (X-ray Reconstruction Of Moving Morphology) to measure detailed 3-D kinematics of the shoulder girdle and forelimb bones of American alligators (Alligator mississippiensis) walking on a treadmill. Digital models of the interclavicle, scapulocoracoid, humerus, radius and ulna were created using a 3-D laser scanner. Models were articulated and aligned to simultaneously recorded frames of fluoroscopic and standard light video to reconstruct and measure joint motion. Joint coordinate systems were established for the coracosternal, glenohumeral and elbow joints. Our analysis revealed that the limb joints only account for about half of fore/aft limb excursion; the remaining excursion results from shoulder girdle movements and lateral bending of the vertebral column. Considerable motion of each scapulocoracoid relative to the vertebral column is consistent with coracosternal mobility. The hemisellar design of the glenohumeral joint permits some additional translation, or sliding in the fore-aft plane, but this movement does not have much of an effect on the distal excursion of the bone. PMID:24102540

  15. Abnormal bone composition in female juvenile American alligators from a pesticide-polluted lake (Lake Apopka, Florida).

    PubMed Central

    Lind, P Monica; Milnes, Matthew R; Lundberg, Rebecca; Bermudez, Dieldrich; Orberg, Jan A; Guillette, Louis J


    Reproductive disorders have been found in pesticide-exposed alligators living in Lake Apopka, Florida (USA). These disorders have been hypothesized to be caused by exposure to endocrine- disruptive estrogen-like contaminants. The aim of this study was to expand our analysis beyond previous studies by investigating whether bone tissue, known to be affected by sex steroid hormones, is a potential target of endocrine disruptors. Long bones from 16 juvenile female alligators from Lake Apopka (pesticide-contaminated lake) and Lake Woodruff (control lake) were evaluated by peripheral quantitative computed tomography. We observed significant differences in bone composition, with female alligators from the contaminated lake having greater trabecular bone mineral density (BMD), total BMD, and trabecular mineral content compared with females from the control lake (p < 0.05). Increased trabecular and total BMD measurements suggest that juvenile female alligators from Lake Apopka were exposed to contaminants that created an internal environment more estrogenic than that normally observed. This estrogenic environment could be caused by both natural and anthropogenic compounds. Effects on BMD indicate interference with bone homeostasis. We hypothesize that contaminants present in the lake inhibit the natural and continuous resorption of bone tissue, resulting in increased bone mass. Although this is the only study performed to date examining effects of environmental estrogenic compounds on alligator bones, it supports previous laboratory-based studies in rodents. Further, this study is important in demonstrating that the alterations in morphology and physiology induced in free-ranging individuals living in environments contaminated with endocrine-active compounds are not limited to a few systems or tissues; rather, effects can be observed in many tissues affected by these hormones. PMID:14998753

  16. Developmental abnormalities of the gonad and abnormal sex hormone concentrations in juvenile alligators from contaminated and control lakes in Florida.

    PubMed Central

    Guillette, L J; Gross, T S; Masson, G R; Matter, J M; Percival, H F; Woodward, A R


    The reproductive development of alligators from a contaminated and a control lake in central Florida was examined. Lake Apopka is adjacent to an EPA Superfund site, listed due to an extensive spill of dicofol and DDT or its metabolites. These compounds can act as estrogens. Contaminants in the lake also have been derived from extensive agricultural activities around the lake that continue today and a sewage treatment facility associated with the city of Winter Garden, Florida. We examined the hypothesis that an estrogenic contaminant has caused the current failure in recruitment of alligators on Lake Apopka. Supporting data include the following: At 6 months of age, female alligators from Lake Apopka had plasma estradiol-17 beta concentrations almost two times greater than normal females from the control lake, Lake Woodruff. The Apopka females exhibited abnormal ovarian morphology with large numbers of polyovular follicles and polynuclear oocytes. Male juvenile alligators had significantly depressed plasma testosterone concentrations comparable to levels observed in normal Lake Woodruff females but more than three times lower than normal Lake Woodruff males. Additionally, males from Lake Apopka had poorly organized testes and abnormally small phalli. The differences between lakes and sexes in plasma hormone concentrations of juvenile alligators remain even after stimulation with luteinizing hormone. Our data suggest that the gonads of juveniles from Lake Apopka have been permanently modified in ovo, so that normal steroidogenesis is not possible, and thus normal sexual maturation is unlikely. Images p680-a Figure 1. Figure 2. Figure 3. A Figure 3. B Figure 3. C Figure 4. A Figure 4. B Figure 4. C Figure 4. D Figure 5. A Figure 5. B Figure 5. C PMID:7895709

  17. Study of red-sore disease in alligators. Final report, September 1, 1976-September 3, 1980. [Predisposing factors

    SciTech Connect

    Gorden, R.E.; Esch, G.W.


    Necropsies of eight alligators which died following capture within a thermally-altered reservoir demonstrated the presence of the gram negative, pathogenic bacterium Aeromonas hydrophila, in internal tissues. A study designed to demonstrate whether A. hydrophila were capable of causing infection and death of the ecologically threatened alligator and, if so, the mechanism of exposure and infection in natural habitats was undertaken. The pathology and response to infection were also studied. When juvenile alligators were exposed under experimental conditions to increasing concentrations of A. hydrophila in water, by oral inoculation, or by intramuscular injections at 20/sup 0/, 25/sup 0/, 30/sup 0/, and 35/sup 0/C, they developed external lesions. These lesions were likely to become severe and lead to death of the animal at 30 and 35/sup 0/C. Infected animals produced: (a) increased numbers of white blood cells; (b) increased specific antibody titer; and (c) alpha 2 peaks higher than albumen peaks (except at 35/sup 0/C). Biweekly intraperitoneal injections of live, washed A. hydrophila were apparently more effective in the prevention of infection and of external lesions than were the antibiotics Kanamycin and OTH-Puramycin. Topical applications of Neosporin ointment resulted in the healing of severe lesions on confined animals. Alligators which were shown to be exposed to A. hydrophila in their natural habitats showed no external evidence of infection by the bacteria. It is recommended that exposure to conditions of stress, including water temperatures greater than 30/sup 0/C, be kept to a minimum during the capture, transport, and captivity of alligators. (ERB)


    EPA Science Inventory

    Environmental contaminants can act as stressors, inducing elevated circulating concentrations of stress hormones such as corticosterone and cortisol. Development in contaminated eggs has been reported to modify circulating sex steroid hormone concentrations in alligators (Alligat...


    EPA Science Inventory

    Wild alligators exposed to persistent organochlorine contaminants, municipal waste compounds, and contemporary-use herbicides exhibit reproductive alterations that are thought to be caused by endocrine disruption. This study tests the hypothesis that these alterations, at least i...

  20. Wallowa Canyonlands Weed Partnership : Completion Report November 19, 2009

    SciTech Connect

    Porter, Mark C.; Ketchum, Sarah


    Noxious weeds threaten fish and wildlife habitat by contributing to increased sedimentation rates, diminishing riparian structure and function, and reducing forage quality and quantity. Wallowa Resources Wallowa Canyonlands Partnership (WCP) protects the unique ecological and economic values of the Hells Canyon grasslands along lower Joseph Creek, the lower Grande Ronde and Imnaha Rivers from invasion and degradation by noxious weeds using Integrated Weed Management techniques. Objectives of this grant were to inventory and map high priority weeds, coordinate treatment of those weeds, release and monitor bio-control agents, educate the public as to the dangers of noxious weeds and how to deal with them, and restore lands to productive plant communities after treatment. With collaborative help from partners, WCP inventoried {approx} 215,000 upland acres and 52.2 miles of riparian habitat, released bio-controls at 23 sites, and educated the public through posters, weed profiles, newspaper articles, and radio advertisements. Additionally, WCP used other sources of funding to finance the treatment of 1,802 acres during the course of this grant.

  1. Capabilities of unmanned aircraft vehicles for low altitude weed detection

    NASA Astrophysics Data System (ADS)

    Pflanz, Michael; Nordmeyer, Henning


    Sustainable crop production and food security require a consumer and environmental safe plant protection. It is recently known, that precise weed monitoring approaches could help apply pesticides corresponding to field variability. In this regard the site-specific weed management may contribute to an application of herbicides with higher ecologically aware and economical savings. First attempts of precision agriculture date back to the 1980's. Since that time, remote sensing from satellites or manned aircrafts have been investigated and used in agricultural practice, but are currently inadequate for the separation of weeds in an early growth stage from cultivated plants. In contrast, low-cost image capturing at low altitude from unmanned aircraft vehicles (UAV) provides higher spatial resolution and almost real-time processing. Particularly, rotary-wing aircrafts are suitable for precise path or stationary flight. This minimises motion blur and provides better image overlapping for stitching and mapping procedures. Through improved image analyses and the recent increase in the availability of microcontrollers and powerful batteries for UAVs, it can be expected that the spatial mapping of weeds will be enhanced in the future. A six rotors microcopter was equipped with a modified RGB camera taking images from agricultural fields. The hexacopter operates within predefined pathways at adjusted altitudes (from 5 to 10 m) by using GPS navigation. Different scenarios of optical weed detection have been carried out regarding to variable altitude, image resolution, weed and crop growth stages. Our experiences showed high capabilities for site-specific weed control. Image analyses with regard to recognition of weed patches can be used to adapt herbicide application to varying weed occurrence across a field.

  2. Microbial weeds in hypersaline habitats: the enigma of the weed-like Haloferax mediterranei.


    Oren, Aharon; Hallsworth, John E


    Heterotrophic prokaryotic communities that inhabit saltern crystallizer ponds are typically dominated by two species, the archaeon Haloquadratum walsbyi and the bacterium Salinibacter ruber, regardless of location. These organisms behave as 'microbial weeds' as defined by Cray et al. (Microb Biotechnol 6: 453-492, 2013) that possess the biological traits required to dominate the microbiology of these open habitats. Here, we discuss the enigma of the less abundant Haloferax mediterranei, an archaeon that grows faster than any other, comparable extreme halophile. It has a wide window for salt tolerance, can grow on simple as well as on complex substrates and degrade polymeric substances, has different modes of anaerobic growth, can accumulate storage polymers, produces gas vesicles, and excretes halocins capable of killing other Archaea. Therefore, Hfx. mediterranei is apparently more qualified as a 'microbial weed' than Haloquadratum and Salinibacter. However, the former differs because it produces carotenoid pigments only in the lower salinity range and lacks energy-generating retinal-based, light-driven ion pumps such as bacteriorhodopsin and halorhodopsin. We discuss these observations in relation to microbial weed biology in, and the open-habitat ecology of, hypersaline systems.

  3. Control of aquatic weeds through pollutant reduction and weed utilization: a weed management approach in the lower Kafue River of Zambia

    NASA Astrophysics Data System (ADS)

    Sinkala, Thomson; Mwase, Enala T.; Mwala, Mick

    The aquatic weed situation in the Kafue River in Zambia continues to be a major challenge to the sustainable utilization of the water resources of the river. The general methods for managing the weeds, especially the water hyacinth, include use of bio-agents, chemicals, mechanical and physical approaches. These have had very little impact. This paper reports on a project that is investigating weed management strategies which involve use of cleaner production (CP) approach and the utilization of the weed for economic purposes. In addition, the ecological implications of these methods are being assessed. Effluent assessments indicated that apart from nitrates and phosphates, other effluent parameters met the Environmental Council of Zambia standards. Results further show that all the 24 areas surveyed for CP have uncontrolled socio-economic activities which generate both point and non-point sources of pollution that enter the water bodies. To minimize pollution, efforts include devising policy and technical strategies with the involvement of the affected riparian community. Production of mushroom by the communities using the water hyacinth substrate has been demonstrated. Up to 2.1 kg of mushroom was harvested from a single flush over a period of 4-5 weeks. Vegetables grown on soils treated with water hyacinth manure performed better than those grown using commercial fertiliser. The economics of the production are however, yet to be confirmed. If weed usage is proven economically and ecologically viable, the riverine community is envisaged to play a big role in aquatic weed management. High numbers of invertebrates known to be sensitive to pollution have been recorded in the weed-infested Kafue River implying that the water is of “good” quality for these aquatic invertebrates. This observed quality of water may be due to water hyacinth playing a role by sieving pollutants from the river.

  4. Jimson "loco" weed abuse in adolescents.


    Shervette, R E; Schydlower, M; Lampe, R M; Fearnow, R G


    Over a three-year period, 29 adolescent patients were hospitalized because of intentional Jimson weed ingestion. Their records were reviewed for the presence of signs and symptoms of atropine/scopolamine toxicity clinical course, treatment, and outcome. Twenty-two were male and seven were female. All had mydriasis, hallucinations, and were disoriented. Tachycardia (heart rate greater than 95), dry mucous membranes, and flushed facies were often present. Urinary retention requiring catheterization was present in five patients. Sixty-five percent (17/26) had detectable atropine or scopolamine in their urine. The average length of hospitalization was 1.8 days. No serious complications were encountered during hospitalization and full recovery were noted in all patients. Gastric lavage and hospital admission for close monitoring and medical support are essential phases of management. Physicians who care for adolescents should be aware of this relatively new form of drug abuse and its management. PMID:440859

  5. Weed Control Sprayers: Calibration and Maintenance. Special Circular 81.

    ERIC Educational Resources Information Center

    Myers, Arthur L.

    This manual covers aspects of calibration and maintenance of weed control sprayers including variables affecting application rate, the pre-calibration check, calculations, band spraying, nozzle tip selection, agitation, and cleaning. (BB)

  6. Mapping invasive weeds and their control with spatial information technologies

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We discuss applications of airborne multispectral digital imaging systems, imaging processing techniques, global positioning systems (GPS), and geographic information systems (GIS) for mapping the invasive weeds giant salvinia (Salvinia molesta) and Brazilian pepper (Schinus terebinthifolius) and fo...

  7. The biology of habitat dominance; can microbes behave as weeds?


    Cray, Jonathan A; Bell, Andrew N W; Bhaganna, Prashanth; Mswaka, Allen Y; Timson, David J; Hallsworth, John E


    Competition between microbial species is a product of, yet can lead to a reduction in, the microbial diversity of specific habitats. Microbial habitats can resemble ecological battlefields where microbial cells struggle to dominate and/or annihilate each other and we explore the hypothesis that (like plant weeds) some microbes are genetically hard-wired to behave in a vigorous and ecologically aggressive manner. These 'microbial weeds' are able to dominate the communities that develop in fertile but uncolonized--or at least partially vacant--habitats via traits enabling them to out-grow competitors; robust tolerances to habitat-relevant stress parameters and highly efficient energy-generation systems; avoidance of or resistance to viral infection, predation and grazers; potent antimicrobial systems; and exceptional abilities to sequester and store resources. In addition, those associated with nutritionally complex habitats are extraordinarily versatile in their utilization of diverse substrates. Weed species typically deploy multiple types of antimicrobial including toxins; volatile organic compounds that act as either hydrophobic or highly chaotropic stressors; biosurfactants; organic acids; and moderately chaotropic solutes that are produced in bulk quantities (e.g. acetone, ethanol). Whereas ability to dominate communities is habitat-specific we suggest that some microbial species are archetypal weeds including generalists such as: Pichia anomala, Acinetobacter spp. and Pseudomonas putida; specialists such as Dunaliella salina, Saccharomyces cerevisiae, Lactobacillus spp. and other lactic acid bacteria; freshwater autotrophs Gonyostomum semen and Microcystis aeruginosa; obligate anaerobes such as Clostridium acetobutylicum; facultative pathogens such as Rhodotorula mucilaginosa, Pantoea ananatis and Pseudomonas aeruginosa; and other extremotolerant and extremophilic microbes such as Aspergillus spp., Salinibacter ruber and Haloquadratum walsbyi. Some microbes

  8. The biology of habitat dominance; can microbes behave as weeds?


    Cray, Jonathan A; Bell, Andrew N W; Bhaganna, Prashanth; Mswaka, Allen Y; Timson, David J; Hallsworth, John E


    Competition between microbial species is a product of, yet can lead to a reduction in, the microbial diversity of specific habitats. Microbial habitats can resemble ecological battlefields where microbial cells struggle to dominate and/or annihilate each other and we explore the hypothesis that (like plant weeds) some microbes are genetically hard-wired to behave in a vigorous and ecologically aggressive manner. These 'microbial weeds' are able to dominate the communities that develop in fertile but uncolonized--or at least partially vacant--habitats via traits enabling them to out-grow competitors; robust tolerances to habitat-relevant stress parameters and highly efficient energy-generation systems; avoidance of or resistance to viral infection, predation and grazers; potent antimicrobial systems; and exceptional abilities to sequester and store resources. In addition, those associated with nutritionally complex habitats are extraordinarily versatile in their utilization of diverse substrates. Weed species typically deploy multiple types of antimicrobial including toxins; volatile organic compounds that act as either hydrophobic or highly chaotropic stressors; biosurfactants; organic acids; and moderately chaotropic solutes that are produced in bulk quantities (e.g. acetone, ethanol). Whereas ability to dominate communities is habitat-specific we suggest that some microbial species are archetypal weeds including generalists such as: Pichia anomala, Acinetobacter spp. and Pseudomonas putida; specialists such as Dunaliella salina, Saccharomyces cerevisiae, Lactobacillus spp. and other lactic acid bacteria; freshwater autotrophs Gonyostomum semen and Microcystis aeruginosa; obligate anaerobes such as Clostridium acetobutylicum; facultative pathogens such as Rhodotorula mucilaginosa, Pantoea ananatis and Pseudomonas aeruginosa; and other extremotolerant and extremophilic microbes such as Aspergillus spp., Salinibacter ruber and Haloquadratum walsbyi. Some microbes

  9. Crop performance and weed suppression by weed-suppressive rice cultivars in furrow- and flood-irrigated systems under reduced herbicide inputs

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in rice is challenging, particularly in light of increased resistance to herbicides in weed populations and diminishing availability of irrigation water. Certain indica rice cultivars can produce high yields and suppress weeds in conventional flood-irrigated, drill-seeded systems in the...

  10. [Spatial and temporal dynamics of the weed community in the Zoysia matrella lawn].


    Liu, Jia-Qi; Li, You-Han; Zeng, Ying; Xie, Xin-Ming


    The heterogeneity of species composition is one of the main attributes in weed community dynamics. Based on species frequency and power law, this paper studied the variations of weed community species composition and spatial heterogeneity in a Zoysia matrella lawn in Guangzhou at different time. The results showed that there were 43 weed species belonging to 19 families in the Z. matrella lawn from 2007 to 2009, in which Gramineae, Compositae, Cyperaceae and Rubiaceae had a comparative advantage. Perennial weeds accounted for the largest proportion of weeds and increased gradually in the three years. Weed communities distributed in higher heterogeneity than in a random model. Dominant weeds varied with season and displayed regularity in the order of 'dicotyledon-monocotyledon-dicotyledon weeds' and 'perennial-annual-perennial weeds'. The spatial heterogeneity of weed community in Z. matrella lawn was higher in summer than in winter. The diversity and evenness of weed community were higher in summer and autumn than in winter and spring. The number of weed species with high heterogeneity in summer was higher than in the other seasons. The spatial heterogeneity and diversity of weed community had no significant change in the three years, while the evenness of weed community had the tendency to decline gradually.

  11. Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).


    Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R


    Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

  12. Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.


    Pollock, H G; Kimmel, J R; Hamilton, J W; Rouse, J B; Ebner, K E; Lance, V; Rawitch, A B


    Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV. PMID:3311873

  13. Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.


    Pollock, H G; Kimmel, J R; Hamilton, J W; Rouse, J B; Ebner, K E; Lance, V; Rawitch, A B


    Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV.

  14. Guidelines for choosing molecular "alligator clip" binding motifs in electron transport devices

    NASA Astrophysics Data System (ADS)

    Reuter, Matthew G.; Seideman, Tamar; Ratner, Mark A.


    We employ a one-electron, tight-binding model of an electrode-molecule-electrode junction to explore the fundamental relationship between adsorption geometry and electron transport, producing exact results (within this model). By varying the chemisorption location (e.g., atop a surface atom or in a hollow site between surface atoms) and the molecule-electrode coupling, we find that the largest currents are realized when the molecule (i) is highly coordinated by the surface and (ii) has favorable overlap with electrode states near the Fermi level. We also show the importance of electrode-induced molecular level shifting for certain adsorption geometries, which can cause molecular levels far from the Fermi level to conduct better than those near the Fermi level. Since all of these factors are greatly influenced by the chemical moiety used to link the molecule to an electrode, these results present a set of guidelines to help choose "alligator clips" for molecular electronic devices.

  15. Evolution of corticosteroid specificity for human, chicken, alligator and frog glucocorticoid receptors.


    Katsu, Yoshinao; Kohno, Satomi; Oka, Kaori; Baker, Michael E


    We investigated the evolution of the response of human, chicken, alligator and frog glucocorticoid receptors (GRs) to dexamethasone, cortisol, cortisone, corticosterone, 11-deoxycorticosterone, 11-deoxycortisol and aldosterone. We find significant differences among these vertebrates in the transcriptional activation of their full length GRs by these steroids, indicating that there were changes in the specificity of the GR for steroids during the evolution of terrestrial vertebrates. To begin to study the role of interactions between different domains on the GR in steroid sensitivity and specificity for terrestrial GRs, we investigated transcriptional activation of truncated GRs containing their hinge domain and ligand binding domain (LBD) fused to a GAL4 DNA binding domain (GAL4-DBD). Compared to corresponding full length GRs, transcriptional activation of GAL4-DBD_GR-hinge/LBD constructs required higher steroid concentrations and displayed altered steroid specificity, indicating that interactions between the hinge/LBD and other domains are important in glucocorticoid activation of these terrestrial GRs. PMID:27317937

  16. ALLIGATOR - An apparatus for ion beam assisted deposition with a broad-beam ion source

    NASA Astrophysics Data System (ADS)

    Wituschek, H.; Barth, M.; Ensinger, W.; Frech, G.; Rück, D. M.; Leible, K. D.; Wolf, G. K.


    Ion beam assisted deposition is a versatile technique for preparing thin films and coatings for various applications. Up to now a prototype setup for research purposes has been used in our laboratory. Processing of industrial standard workpieces requires a high current ion source with broad beam and high uniformity for homogeneous bombardment. In this contribution a new apparatus for large area samples will be described. It is named ALLIGATOR (German acronym of facility for ion assisted evaporation on transverse movable or rotary targets). In order to have a wide energy range available two ion sources are used. One delivers a beam energy up to 1.3 keV. The other is suitable for energies from 5 keV up to 40 keV. The ``high-energy'' ion source is a multicusp multiaperture source with 180-mA total current and a beam diameter of 280 mm at the target position.

  17. Ontogeny of the Middle-Ear Air-Sinus System in Alligator mississippiensis (Archosauria: Crocodylia).


    Dufeau, David L; Witmer, Lawrence M


    Modern crocodylians, including Alligator mississippiensis, have a greatly elaborated system of pneumatic sinuses invading the cranium. These sinuses invade nearly all the bones of the chondrocranium and several bony elements of the splanchnocranium, but patterns of postnatal paratympanic sinus development are poorly understood and documented. Much of crocodylomorph--indeed archosaurian--evolution is characterized by the evolution of various paratympanic air sinuses, the homologies of which are poorly understood due in large part to the fact that individual sinuses tend to become confluent in adults, obscuring underlying patterns. This study seeks to explore the ontogeny of these sinuses primarily to clarify the anatomical relations of the individual sinuses before they become confluent and thus to provide the foundation for later studies testing hypotheses of homology across extant and extinct Archosauria. Ontogeny was assessed using computed tomography in a sample of 13 specimens covering an almost 19-fold increase in head size. The paratympanic sinus system comprises two major inflations of evaginated pharyngeal epithelium: the pharyngotympanic sinus, which communicates with the pharynx via the lateral (true) Eustachian tubes and forms the cavum tympanicum proprium, and the median pharyngeal sinus, which communicates with the pharynx via the median pharyngeal tube. Each of these primary inflations gives rise to a number of secondary inflations that further invade the bones of the skull. The primary sinuses and secondary diverticula are well developed in perinatal individuals of Alligator, but during ontogeny the number and relative volumes of the secondary diverticula are reduced. In addition to describing the morphological ontogeny of this sinus system, we provide some preliminary exploratory analyses of sinus function and allometry, rejecting the hypothesis that changes in the volume of the paratympanic sinuses are simply an allometric function of braincase

  18. Plasma catecholamines and plasma corticosterone following restraint stress in juvenile alligators.


    Lance, V A; Elsey, R M


    Ten juvenile alligators, mean body mass 793 g, hatched from artificially incubated eggs and raised under controlled conditions, were held out of water with their jaws held closed for 48 hr. An initial blood sample was taken and further samples collected at 1, 2, 4, 8, 24, and 48 hr. Epinephrine, norepinephrine, and dopamine were measured in plasma aliquots of 1.5 ml using high pressure liquid chromatography with electrochemical detection. Corticosterone was measured by radioimmunoassay. Plasma glucose was measured using the Trinder method and plasma calcium, cholesterol, and triglycerides were measured in an autoanalyzer. Epinephrine was about 4 ng/ml at the initial bleed, but declined steadily to < 0.4 ng/ml by 24 hr. Norepinephrine was also about 4 ng/ml at the initial bleed, but rose to over 8 ng/ml at 1 hr, and then declined to < 0.2 ng/ml at 24 hr. A second, but smaller increase in plasma norepinephrine was seen at 48 hr. Plasma dopamine was low at the initial bleed (< 0.7 ng/ml), rose to over 8 ng/ml at 1 hr, then declined to < 0.2 ng/ml. Plasma corticosterone rose progressively for the first 4 hr, declined at 8 hr and 24 hr, then rose again at 48 hr. Plasma glucose rose significantly by 24 hr and remained elevated for 48 hr. Plasma calcium increased at 1, 2, and 4 hr then returned to levels not significantly different from the initial sample at 24 and 48 hr. The white blood cells showed changes indicating immune system suppression. By the end of the treatment the hetorophil/lymphocyte ratio increased to 4.7. These results suggest that handling alligators, taking multiple blood samples, and keeping them restrained for more than 8 hr is a severe stress to the animals.

  19. Ontogeny of the Middle-Ear Air-Sinus System in Alligator mississippiensis (Archosauria: Crocodylia)

    PubMed Central

    Dufeau, David L.; Witmer, Lawrence M.


    Modern crocodylians, including Alligator mississippiensis, have a greatly elaborated system of pneumatic sinuses invading the cranium. These sinuses invade nearly all the bones of the chondrocranium and several bony elements of the splanchnocranium, but patterns of postnatal paratympanic sinus development are poorly understood and documented. Much of crocodylomorph—indeed archosaurian—evolution is characterized by the evolution of various paratympanic air sinuses, the homologies of which are poorly understood due in large part to the fact that individual sinuses tend to become confluent in adults, obscuring underlying patterns. This study seeks to explore the ontogeny of these sinuses primarily to clarify the anatomical relations of the individual sinuses before they become confluent and thus to provide the foundation for later studies testing hypotheses of homology across extant and extinct Archosauria. Ontogeny was assessed using computed tomography in a sample of 13 specimens covering an almost 19-fold increase in head size. The paratympanic sinus system comprises two major inflations of evaginated pharyngeal epithelium: the pharyngotympanic sinus, which communicates with the pharynx via the lateral (true) Eustachian tubes and forms the cavum tympanicum proprium, and the median pharyngeal sinus, which communicates with the pharynx via the median pharyngeal tube. Each of these primary inflations gives rise to a number of secondary inflations that further invade the bones of the skull. The primary sinuses and secondary diverticula are well developed in perinatal individuals of Alligator, but during ontogeny the number and relative volumes of the secondary diverticula are reduced. In addition to describing the morphological ontogeny of this sinus system, we provide some preliminary exploratory analyses of sinus function and allometry, rejecting the hypothesis that changes in the volume of the paratympanic sinuses are simply an allometric function of braincase

  20. The biology of habitat dominance; can microbes behave as weeds?

    PubMed Central

    Cray, Jonathan A; Bell, Andrew N W; Bhaganna, Prashanth; Mswaka, Allen Y; Timson, David J; Hallsworth, John E


    Summary Competition between microbial species is a product of, yet can lead to a reduction in, the microbial diversity of specific habitats. Microbial habitats can resemble ecological battlefields where microbial cells struggle to dominate and/or annihilate each other and we explore the hypothesis that (like plant weeds) some microbes are genetically hard-wired to behave in a vigorous and ecologically aggressive manner. These ‘microbial weeds’ are able to dominate the communities that develop in fertile but uncolonized – or at least partially vacant – habitats via traits enabling them to out-grow competitors; robust tolerances to habitat-relevant stress parameters and highly efficient energy-generation systems; avoidance of or resistance to viral infection, predation and grazers; potent antimicrobial systems; and exceptional abilities to sequester and store resources. In addition, those associated with nutritionally complex habitats are extraordinarily versatile in their utilization of diverse substrates. Weed species typically deploy multiple types of antimicrobial including toxins; volatile organic compounds that act as either hydrophobic or highly chaotropic stressors; biosurfactants; organic acids; and moderately chaotropic solutes that are produced in bulk quantities (e.g. acetone, ethanol). Whereas ability to dominate communities is habitat-specific we suggest that some microbial species are archetypal weeds including generalists such as: Pichia anomala, Acinetobacter spp. and Pseudomonas putida; specialists such as Dunaliella salina, Saccharomyces cerevisiae, Lactobacillus spp. and other lactic acid bacteria; freshwater autotrophs Gonyostomum semen and Microcystis aeruginosa; obligate anaerobes such as Clostridium acetobutylicum; facultative pathogens such as Rhodotorula mucilaginosa, Pantoea ananatis and Pseudomonas aeruginosa; and other extremotolerant and extremophilic microbes such as Aspergillus spp., Salinibacter ruber and Haloquadratum walsbyi

  1. Interspecific variation in persistence of buried weed seeds follows trade-offs among physiological, chemical and physical seed defences

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Soil seedbanks drive infestations of annual weeds, yet weed management focuses largely on seedling mortality. As weed seedbanks increasingly become reservoirs of herbicide resistance, species-specific seedbank management approaches will be essential. Limited understanding of interspecific variation ...

  2. Necropsy findings in American alligator late-stage embryos and hatchlings from northcentral Florida lakes contaminated with organochlorine pesticides

    USGS Publications Warehouse

    Sepulveda, M.S.; Del, Piero F.; Wiebe, J.J.; Rauschenberger, H.R.; Gross, T.S.


    Increased American alligator (Alligator mississippiensis) embryo and neonatal mortality has been reported from several northcentral Florida lakes contaminated with old-use organochlorine pesticides (OCPs). However, a clear relationship among these contaminants and egg viability has not been established, suggesting the involvement of additional factors in these mortalities. Thus, the main objective of this study was to determine the ultimate cause of mortality of American alligator late-stage embryos and hatchlings through the conduction of detailed pathological examinations, and to evaluate better the role of OCPs in these mortalities. Between 2000 and 2001, 236 dead alligators were necropsied at or near hatching (after ???65 days of artificial incubation and up to 1 mo of age posthatch). Dead animals were collected from 18 clutches ranging in viability from 0% to 95%. Total OCP concentrations in yolk ranged from ???100 to 52,000 ??g/kg, wet weight. The most common gross findings were generalized edema (34%) and organ hyperemia (29%), followed by severe emaciation (14%) and gross deformities (3%). Histopathologic examination revealed lesions in 35% of the animals, with over half of the cases being pneumonia, pulmonary edema, and atelectasis. Within and across clutches, dead embryos and hatchlings compared with their live cohorts were significantly smaller and lighter. Although alterations in growth and development were not related to yolk OCPs, there was an increase in prevalence of histologic lesions in clutches with high OCPs. Overall, these results indicate that general growth retardation and respiratory abnormalities were a major contributing factor in observed mortalities and that contaminants may increase the susceptibility of animals to developing certain pathologic conditions. ?? Wildlife Disease Association 2006.

  3. Nuclear β-catenin localization supports homology of feathers, avian scutate scales, and alligator scales in early development.


    Musser, Jacob M; Wagner, Günter P; Prum, Richard O


    Feathers are an evolutionary novelty found in all extant birds. Despite recent progress investigating feather development and a revolution in dinosaur paleontology, the relationship of feathers to other amniote skin appendages, particularly reptile scales, remains unclear. Disagreement arises primarily from the observation that feathers and avian scutate scales exhibit an anatomical placode-defined as an epidermal thickening-in early development, whereas alligator and other avian scales do not. To investigate the homology of feathers and archosaur scales we examined patterns of nuclear β-catenin localization during early development of feathers and different bird and alligator scales. In birds, nuclear β-catenin is first localized to the feather placode, and then exhibits a dynamic pattern of localization in both epidermis and dermis of the feather bud. We found that asymmetric avian scutate scales and alligator scales share similar patterns of nuclear β-catenin localization with feathers. This supports the hypothesis that feathers, scutate scales, and alligator scales are homologous during early developmental stages, and are derived from early developmental stages of an asymmetric scale present in the archosaur ancestor. Furthermore, given that the earliest stage of β-catenin localization in feathers and archosaur scales is also found in placodes of several mammalian skin appendages, including hair and mammary glands, we hypothesize that a common skin appendage placode originated in the common ancestor of all amniotes. We suggest a skin placode should not be defined by anatomical features, but as a local, organized molecular signaling center from which an epidermal appendage develops. PMID:25963196

  4. Tillage and residue burning affects weed populations and seed banks.


    Narwal, S; Sindel, B M; Jessop, R S


    An integrated weed management approach requires alternative management practices to herbicide use such as tillage, crop rotations and cultural controls to reduce soil weed seed banks. The objective of this study was to examine the value of different tillage practices and stubble burning to exhaust the seed bank of common weeds from the northern grain region of Australia. Five tillage and burning treatments were incorporated in a field experiment, at Armidale (30 degrees 30'S, 151 degrees 40'E), New South Wales, Australia in July 2004 in a randomized block design replicated four times. The trial was continued and treatments repeated in July 2005 with all the mature plants from the first year being allowed to shed seed in their respective treatment plots. The treatments were (i) no tillage (NT), (ii) chisel ploughing (CP), (iii) mould board ploughing (MBP), (iv) wheat straw burning with no tillage (SBNT) and (v) wheat straw burning with chisel ploughing (SBC). Soil samples were collected before applying treatments and before the weeds flowered to establish the seed bank status of the various weeds in the soil. Wheat was sown after the tillage treatments. Burning treatments were only initiated in the second year, one month prior to tillage treatments. The major weeds present in the seed bank before initiating the trial were Polygonum aviculare, Sonchus oleraceus and Avena fatua. Tillage promoted the germination of other weeds like Hibiscus trionum, Medicago sativa, Vicia sp. and Phalaris paradoxa later in the season in 2004 and Convolvulus erubescens emerged as a new weed in 2005. The MBP treatment in 2004 reduced the weed biomass to a significantly lower level of 55 g/m2 than the other treatments of CP (118 g/m2) and NT plots (196 g/m2) (P < 0.05). However, in 2005 SBC and MBP treatments were similar in reducing the weed biomass. In 2004, the grain yield trend of wheat was significantly different between CP and NT, and MBP and NT (P < 0.05) with maximum yield of 5898

  5. Tillage and residue burning affects weed populations and seed banks.


    Narwal, S; Sindel, B M; Jessop, R S


    An integrated weed management approach requires alternative management practices to herbicide use such as tillage, crop rotations and cultural controls to reduce soil weed seed banks. The objective of this study was to examine the value of different tillage practices and stubble burning to exhaust the seed bank of common weeds from the northern grain region of Australia. Five tillage and burning treatments were incorporated in a field experiment, at Armidale (30 degrees 30'S, 151 degrees 40'E), New South Wales, Australia in July 2004 in a randomized block design replicated four times. The trial was continued and treatments repeated in July 2005 with all the mature plants from the first year being allowed to shed seed in their respective treatment plots. The treatments were (i) no tillage (NT), (ii) chisel ploughing (CP), (iii) mould board ploughing (MBP), (iv) wheat straw burning with no tillage (SBNT) and (v) wheat straw burning with chisel ploughing (SBC). Soil samples were collected before applying treatments and before the weeds flowered to establish the seed bank status of the various weeds in the soil. Wheat was sown after the tillage treatments. Burning treatments were only initiated in the second year, one month prior to tillage treatments. The major weeds present in the seed bank before initiating the trial were Polygonum aviculare, Sonchus oleraceus and Avena fatua. Tillage promoted the germination of other weeds like Hibiscus trionum, Medicago sativa, Vicia sp. and Phalaris paradoxa later in the season in 2004 and Convolvulus erubescens emerged as a new weed in 2005. The MBP treatment in 2004 reduced the weed biomass to a significantly lower level of 55 g/m2 than the other treatments of CP (118 g/m2) and NT plots (196 g/m2) (P < 0.05). However, in 2005 SBC and MBP treatments were similar in reducing the weed biomass. In 2004, the grain yield trend of wheat was significantly different between CP and NT, and MBP and NT (P < 0.05) with maximum yield of 5898

  6. Predicting maternal body burdens of organochlorine pesticides from eggs and evidence of maternal transfer in Alligator mississippiensis

    USGS Publications Warehouse

    Rauschenberger, R.H.; Sepulveda, M.S.; Wiebe, J.J.; Szabo, N.J.; Gross, T.S.


    Few data exist regarding maternal-embryonal transfer of organochlorine pesticides (OCPs) in reptiles. The objective of the present study was to evaluate maternal transfer of OCPs in American alligators (Alligator mississippiensis) from low-, intermediate-, and high-OCP-exposure sites. Overall, total OCP burdens ranged from less than 0.8 ppb in blood to more than 44,000 ppb in abdominal adipose tissue (wet wt concentrations). Lipid-adjusted ratios of maternal adipose burdens (total OCPs) to yolk burdens were close to one (0.94 ?? 0.31:1), suggesting that animals were in steady state and that OCPs in eggs originated from adipose lipids. In contrast, lipid-adjusted muscle and liver OCP burdens were greater than yolk OCP burdens, suggesting that lipids in muscle were not utilized during oogenesis and that nonlipid liver tissue sequesters OCPs. Predictive equations were derived for several tissues and several OCP analytes with r2 values ranging from 0.40 to 0.99 (p < 0.05). We suggest that yolk burdens are predictive of maternal tissue burdens for certain tissues and OCPs and that certain OCPs are maternally transferred in the American alligator. Furthermore, we suggest that future studies should investigate the applicability of these predictive equations for assessing maternal exposure in other crocodilian species.

  7. The provenance of alveolar and parabronchial lungs: insights from paleoecology and the discovery of cardiogenic, unidirectional airflow in the American alligator (Alligator mississippiensis).


    Farmer, C G


    Birds and mammals evolved greater aerobic abilities than their common ancestor had. This required expansion of the cardiopulmonary system's capacity for gas exchange, but while directional selection for this expanded capacity resulted in extremely similar avian and mammalian hearts, strikingly different lungs arose, and the reasons for this divergence in lung morphology are not understood. In birds, gas exchange occurs in the lungs as air moves through small tubes (parabronchi) in one direction; in mammals, air flows tidally into and out of the alveoli. Here, I present a scenario for the origin of both the alveolar and parabronchial lungs that explains when and how they could have arisen by a gradual sequence of steps. I argue that (1) the alveolar lung evolved in the late Paleozoic, when high levels of atmospheric oxygen relaxed selection for a thin blood-gas barrier within the lung; (2) unidirectional flow originated in the ectothermic ancestral archosaur, the forerunner of birds and crocodilians, to enable the heart to circulate pulmonary gases during apnea. This hypothesis would be supported by a demonstration of unidirectional flow in the lungs of crocodilians, the extant sister taxon of birds. Airflow in the lungs of juvenile alligators was measured during apnea using dual thermistor flowmeters, and cardiac activity was measured with electrocardiography. Coincident with each heartbeat, a pulse of air flowed in the pulmonary conduit under study with a bias in the direction of movement, yielding a net unidirectional flow. These data suggest the internal structures requisite for unidirectional flow were present in the common ancestors of birds and crocodilians and may have preadapted the lungs of archosaurs to function advantageously during the oxygen-poor period of the early Mesozoic.

  8. The provenance of alveolar and parabronchial lungs: insights from paleoecology and the discovery of cardiogenic, unidirectional airflow in the American alligator (Alligator mississippiensis).


    Farmer, C G


    Birds and mammals evolved greater aerobic abilities than their common ancestor had. This required expansion of the cardiopulmonary system's capacity for gas exchange, but while directional selection for this expanded capacity resulted in extremely similar avian and mammalian hearts, strikingly different lungs arose, and the reasons for this divergence in lung morphology are not understood. In birds, gas exchange occurs in the lungs as air moves through small tubes (parabronchi) in one direction; in mammals, air flows tidally into and out of the alveoli. Here, I present a scenario for the origin of both the alveolar and parabronchial lungs that explains when and how they could have arisen by a gradual sequence of steps. I argue that (1) the alveolar lung evolved in the late Paleozoic, when high levels of atmospheric oxygen relaxed selection for a thin blood-gas barrier within the lung; (2) unidirectional flow originated in the ectothermic ancestral archosaur, the forerunner of birds and crocodilians, to enable the heart to circulate pulmonary gases during apnea. This hypothesis would be supported by a demonstration of unidirectional flow in the lungs of crocodilians, the extant sister taxon of birds. Airflow in the lungs of juvenile alligators was measured during apnea using dual thermistor flowmeters, and cardiac activity was measured with electrocardiography. Coincident with each heartbeat, a pulse of air flowed in the pulmonary conduit under study with a bias in the direction of movement, yielding a net unidirectional flow. These data suggest the internal structures requisite for unidirectional flow were present in the common ancestors of birds and crocodilians and may have preadapted the lungs of archosaurs to function advantageously during the oxygen-poor period of the early Mesozoic. PMID:20377411


    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control provided by alternative fumigants to methyl bromide (MeBr) needs to be tested in perennial crop nurseries in California because MeBr is being phased out in accordance with the Montreal Protocol, few herbicides are registered for perennial nursery use, and costs of other control measures...

  10. Utility of remote sensing for soybean and weed species differentiation

    NASA Astrophysics Data System (ADS)

    Gray, Cody Jack

    Weeds are typically found in aggregated patches within a production area. Remote sensing technologies have been incorporated into agricultural production systems to locate and manage these troublesome areas site-specifically. Correct weed identification is a key component when making proper weed control decisions. Research was implemented to evaluate the use of hyperspectral and multispectral reflectance data for proper weed and crop discrimination. The primary objectives of this research were to evaluate the utility of hyperspectral radiometry and multispectral imagery to differentiate soybean and six weed species commonly found in Mississippi. Additional objectives included evaluating the spectral characteristics of Palmer amaranth and pitted morningglory accessions collected across central and southern United States. Principal component analysis was ineffective in discriminating between species. Best spectral band combination analysis (BSBC) produced the greatest weed classification accuracies when comparing all classification techniques. The BSBC suggested three areas of interest for species discrimination in the short wavelength infrared portion of the electromagnetic spectrum. These areas of interest were located from 1445 to 1475 nm, 2030 to 2090 nm, and 2115 to 2135 nm. Classification accuracies increased for all species when these band regions were added than when using vegetation indices alone, suggesting greater crop and weed species differentiation can be obtained when using sensors that include these regions of the short wavelength infrared portion of the electromagnetic spectrum. Three supervised classification systems were implemented in multispectral imagery classification. The best classification accuracies of 90% or greater were obtained for many of the plant species at 10 and 12 weeks after emergence using either a 2-class or 3-class system. Palmleaf morningglory and pitted morningglory at the highest densities of 6 plants/m2 produced the highest

  11. Controlling weeds with fungi, bacteria and viruses: a review

    PubMed Central

    Harding, Dylan P.; Raizada, Manish N.


    Weeds are a nuisance in a variety of land uses. The increasing prevalence of both herbicide resistant weeds and bans on cosmetic pesticide use has created a strong impetus to develop novel strategies for controlling weeds. The application of bacteria, fungi and viruses to achieving this goal has received increasingly great attention over the last three decades. Proposed benefits to this strategy include reduced environmental impact, increased target specificity, reduced development costs compared to conventional herbicides and the identification of novel herbicidal mechanisms. This review focuses on examples from North America. Among fungi, the prominent genera to receive attention as bioherbicide candidates include Colletotrichum, Phoma, and Sclerotinia. Among bacteria, Xanthomonas and Pseudomonas share this distinction. The available reports on the application of viruses to controlling weeds are also reviewed. Focus is given to the phytotoxic mechanisms associated with bioherbicide candidates. Achieving consistent suppression of weeds in field conditions is a common challenge to this control strategy, as the efficacy of a bioherbicide candidate is generally more sensitive to environmental variation than a conventional herbicide. Common themes and lessons emerging from the available literature in regard to this challenge are presented. Additionally, future directions for this crop protection strategy are suggested. PMID:26379687

  12. Classification of Maize and Weeds by Bayesian Networks

    NASA Astrophysics Data System (ADS)

    Chapron, Michel; Oprea, Alina; Sultana, Bogdan; Assemat, Louis


    Precision Agriculture is concerned with all sorts of within-field variability, spatially and temporally, that reduces the efficacy of agronomic practices applied in a uniform way all over the field. Because of these sources of heterogeneity, uniform management actions strongly reduce the efficiency of the resource input to the crop (i.e. fertilization, water) or for the agrochemicals use for pest control (i.e. herbicide). Moreover, this low efficacy means high environmental cost (pollution) and reduced economic return for the farmer. Weed plants are one of these sources of variability for the crop, as they occur in patches in the field. Detecting the location, size and internal density of these patches, along with identification of main weed species involved, open the way to a site-specific weed control strategy, where only patches of weeds would receive the appropriate herbicide (type and dose). Herein, an automatic recognition method of vegetal species is described. First, the pixels of soil and vegetation are classified in two classes, then the vegetation part of the input image is segmented from the distance image by using the watershed method and finally the leaves of the vegetation are partitioned in two parts maize and weeds thanks to the two Bayesian networks.

  13. Controlling weeds with fungi, bacteria and viruses: a review.


    Harding, Dylan P; Raizada, Manish N


    Weeds are a nuisance in a variety of land uses. The increasing prevalence of both herbicide resistant weeds and bans on cosmetic pesticide use has created a strong impetus to develop novel strategies for controlling weeds. The application of bacteria, fungi and viruses to achieving this goal has received increasingly great attention over the last three decades. Proposed benefits to this strategy include reduced environmental impact, increased target specificity, reduced development costs compared to conventional herbicides and the identification of novel herbicidal mechanisms. This review focuses on examples from North America. Among fungi, the prominent genera to receive attention as bioherbicide candidates include Colletotrichum, Phoma, and Sclerotinia. Among bacteria, Xanthomonas and Pseudomonas share this distinction. The available reports on the application of viruses to controlling weeds are also reviewed. Focus is given to the phytotoxic mechanisms associated with bioherbicide candidates. Achieving consistent suppression of weeds in field conditions is a common challenge to this control strategy, as the efficacy of a bioherbicide candidate is generally more sensitive to environmental variation than a conventional herbicide. Common themes and lessons emerging from the available literature in regard to this challenge are presented. Additionally, future directions for this crop protection strategy are suggested.

  14. Linkages Among Agronomic, Environmental and Weed Management Characteristics in North American Sweet Corn

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Performance of weed management systems varies greatly across the landscape in both growers’ fields and in experimental trials conducted by agricultural scientists. Using agronomic, environmental, and weed management information from growers’ fields and experimental trials, we identified dominant ch...

  15. Smoking the Other: marijuana and counterhegemony in Weeds.


    Lavoie, Dusty


    Subverting suburban modernity, the SHOWTIME television series Weeds invites its audiences to situate their opinions about marijuana amid spheres of bourgeois soccer-moms, class politics, turf wars, raw economics, violent milieux, and multiculti heterogeneity. I argue that Weeds encourages us to "smoke the Other"; that is, to hesitantly accept difference, in line with many drug circles' etiquette. The phrase "smoking the Other" is a critical alteration of bell hooks' (1992, Black looks: Race and representation. Boston: South End Press) conception of whites' ethnic "devouring" as "eating the Other," a rather rigid schematic itself problematized by Weeds' transgressive self-conscious playfulness with stereotyped ethnicities, loopy plotlines, and counterhegemonic dialogue. Cultural/political implications follow. PMID:21599507

  16. Smoking the Other: marijuana and counterhegemony in Weeds.


    Lavoie, Dusty


    Subverting suburban modernity, the SHOWTIME television series Weeds invites its audiences to situate their opinions about marijuana amid spheres of bourgeois soccer-moms, class politics, turf wars, raw economics, violent milieux, and multiculti heterogeneity. I argue that Weeds encourages us to "smoke the Other"; that is, to hesitantly accept difference, in line with many drug circles' etiquette. The phrase "smoking the Other" is a critical alteration of bell hooks' (1992, Black looks: Race and representation. Boston: South End Press) conception of whites' ethnic "devouring" as "eating the Other," a rather rigid schematic itself problematized by Weeds' transgressive self-conscious playfulness with stereotyped ethnicities, loopy plotlines, and counterhegemonic dialogue. Cultural/political implications follow.

  17. Airborne pollen survey for Lincoln, Nebraska. III. Weeds.


    Bolick, M R


    Pollen counts in 1988, 1989, and 1990 revealed 16 weed pollen types. The weed pollination season in Lincoln extends from March through October. Very low amounts of pigweed-type and nettle pollen appear in April. Dock pollination begins in May. June has the greatest diversity of weed types and moderately high total counts (highest total June counts ca. 300 grains/m3). July is low in both diversity and absolute numbers of pollen grains (highest total July counts ca. 35 grains/m3). In early August pollen counts begin to rise with the primary pigweed-type pollination season and the first ragweed pollen. Ragweed pollen peaks in the last week of August and first week of September with more than 460 ragweed grains/m3 and total counts of more than 780 gr/m3.

  18. Genomics of compositae weeds: EST libraries, microarrays, and evidence of introgression

    Technology Transfer Automated Retrieval System (TEKTRAN)

    • Premise of Study: Weeds cause considerable environmental and economic damage. However, genomic characterization of weeds has lagged behind that of model plants and crop species. Here we report on the development of genomic tools and resources for 11 weeds from the Compositae family that can serve ...

  19. 76 FR 70954 - Idaho Panhandle National Forests, Idaho; Idaho Panhandle National Forest Noxious Weed Treatment...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Noxious Weed Treatment Project AGENCY: Forest Service, USDA. ACTION: Notice of intent to prepare... counties in Montana; and Pend Oreille County in Washington. The proposal includes both an Integrated Weed... Weed Treatment Project Team Leader, at the Priest Lake Ranger District, 32203 Highway 57, Priest...

  20. 7 CFR 360.501 - Petitions to remove a taxon from the noxious weed lists.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Petitions to remove a taxon from the noxious weed...) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.501 Petitions to remove a taxon from the noxious weed lists. A person may petition the Administrator to remove...

  1. 7 CFR 360.500 - Petitions to add a taxon to the noxious weed list.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Petitions to add a taxon to the noxious weed list. 360... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.500 Petitions to add a taxon to the noxious weed list. A person may petition the Administrator to have a...

  2. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  3. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  4. 7 CFR 201.65 - Noxious-weed seeds in interstate commerce.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Noxious-weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious-weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  5. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  6. 7 CFR 201.65 - Noxious-weed seeds in interstate commerce.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Noxious-weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious-weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  7. 7 CFR 201.65 - Noxious weed seeds in interstate commerce.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Noxious weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  8. 7 CFR 360.500 - Petitions to add a taxon to the noxious weed list.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 5 2011-01-01 2011-01-01 false Petitions to add a taxon to the noxious weed list. 360... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.500 Petitions to add a taxon to the noxious weed list. A person may petition the Administrator to have a...

  9. 7 CFR 360.302 - Consideration of applications for permits to move noxious weeds.

    Code of Federal Regulations, 2011 CFR


    ... noxious weeds. 360.302 Section 360.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.302 Consideration of applications for permits to move noxious weeds. Upon the receipt of an application made...

  10. 7 CFR 360.302 - Consideration of applications for permits to move noxious weeds.

    Code of Federal Regulations, 2014 CFR


    ... noxious weeds. 360.302 Section 360.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.302 Consideration of applications for permits to move noxious weeds. Upon the receipt of an application made...

  11. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  12. 7 CFR 360.301 - Information required for applications for permits to move noxious weeds.

    Code of Federal Regulations, 2011 CFR


    ... move noxious weeds. 360.301 Section 360.301 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.301 Information required for applications for permits to move noxious weeds. (a) Permit to...

  13. Airborne hyperspectral and LiDAR data integration for weed detection

    NASA Astrophysics Data System (ADS)

    Tamás, János; Lehoczky, Éva; Fehér, János; Fórián, Tünde; Nagy, Attila; Bozsik, Éva; Gálya, Bernadett; Riczu, Péter


    Agriculture uses 70% of global available fresh water. However, ca. 50-70% of water used by cultivated plants, the rest of water transpirated by the weeds. Thus, to define the distribution of weeds is very important in precision agriculture and horticulture as well. To survey weeds on larger fields by traditional methods is often time consuming. Remote sensing instruments are useful to detect weeds in larger area. In our investigation a 3D airborne laser scanner (RIEGL LMS-Q680i) was used in agricultural field near Sopron to scouting weeds. Beside the airborne LiDAR, hyperspectral imaging system (AISA DUAL) and air photos helped to investigate weed coverage. The LiDAR survey was carried out at early April, 2012, before sprouting of cultivated plants. Thus, there could be detected emerging of weeds and direction of cultivation. However airborne LiDAR system was ideal to detect weeds, identification of weeds at species level was infeasible. Higher point density LiDAR - Terrestrial laser scanning - systems are appropriate to distinguish weed species. Based on the results, laser scanner is an effective tool to scouting of weeds. Appropriate weed detection and mapping systems could contribute to elaborate water and herbicide saving management technique. This publication was supported by the OTKA project K 105789.

  14. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  15. 7 CFR 360.301 - Information required for applications for permits to move noxious weeds.

    Code of Federal Regulations, 2014 CFR


    ... move noxious weeds. 360.301 Section 360.301 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.301 Information required for applications for permits to move noxious weeds. (a) Permit to...

  16. Lawn Weed Control with Herbicides. Home and Garden Bulletin No. 123.

    ERIC Educational Resources Information Center

    Agricultural Research Service (USDA), Washington, DC.

    Information and diagrams are given for identification and treatment of weed grasses and broadleaf weeds. Herbicides are suggested for use against each weed and instructions are given for proper application. Information is given for buying herbicides, and applying sprays and cleaning sprayers. (BB)

  17. 7 CFR 201.65 - Noxious weed seeds in interstate commerce.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  18. 7 CFR 201.65 - Noxious-weed seeds in interstate commerce.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Noxious-weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious-weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  19. 7 CFR 360.302 - Consideration of applications for permits to move noxious weeds.

    Code of Federal Regulations, 2012 CFR


    ... noxious weeds. 360.302 Section 360.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.302 Consideration of applications for permits to move noxious weeds. Upon the receipt of an application made...

  20. 7 CFR 360.302 - Consideration of applications for permits to move noxious weeds.

    Code of Federal Regulations, 2013 CFR


    ... noxious weeds. 360.302 Section 360.302 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.302 Consideration of applications for permits to move noxious weeds. Upon the receipt of an application made...

  1. 7 CFR 360.500 - Petitions to add a taxon to the noxious weed list.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Petitions to add a taxon to the noxious weed list. 360... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.500 Petitions to add a taxon to the noxious weed list. A person may petition the Administrator to have a...

  2. 7 CFR 360.501 - Petitions to remove a taxon from the noxious weed lists.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Petitions to remove a taxon from the noxious weed...) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.501 Petitions to remove a taxon from the noxious weed lists. A person may petition the Administrator to remove...

  3. 7 CFR 360.300 - General prohibitions and restrictions on the movement of noxious weeds; permits.

    Code of Federal Regulations, 2010 CFR


    ... of noxious weeds; permits. 360.300 Section 360.300 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.300 General prohibitions and restrictions on the movement of noxious weeds; permits. (a)...

  4. 7 CFR 360.301 - Information required for applications for permits to move noxious weeds.

    Code of Federal Regulations, 2013 CFR


    ... move noxious weeds. 360.301 Section 360.301 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.301 Information required for applications for permits to move noxious weeds. (a) Permit to...

  5. 7 CFR 360.301 - Information required for applications for permits to move noxious weeds.

    Code of Federal Regulations, 2012 CFR


    ... move noxious weeds. 360.301 Section 360.301 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.301 Information required for applications for permits to move noxious weeds. (a) Permit to...

  6. 7 CFR 360.500 - Petitions to add a taxon to the noxious weed list.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Petitions to add a taxon to the noxious weed list. 360... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE NOXIOUS WEED REGULATIONS § 360.500 Petitions to add a taxon to the noxious weed list. A person may petition the Administrator to have a...

  7. Morphological traits associated with weed-suppressive ability of winter wheat against Italian ryegrass

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed-suppressive wheat (Triticum aestivum L.) cultivars have been suggested as a complement to chemical and cultural methods of weed control. The objectives of this study were to assess the range of weed-suppressive ability against Italian ryegrass [Lolium perenne L. ssp. multiflorum (Lam.) Husnot] ...

  8. Weed management practices for organic production of trailing blackberry. I. Plant growth and early fruit production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed management practices were evaluated in a new field of trailing blackberry established in western Oregon. The field was planted in May 2010 and certified organic in May 2012. Treatments included two cultivars, ‘Marion’ and ‘Black Diamond’, grown in 1) non-weeded plots, where weeds were cut to th...

  9. Weed management in transplanted lettuce with Pendimethalin and S-metolachlor

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Few herbicides are available for use in lettuce and hand weeding is required for commercially acceptable weed control. More effective herbicides are needed. Here we report field evaluations of pendimethalin and S-metolachlor for weed control in transplanted lettuce. Pendimethalin was evaluated PRE a...

  10. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Code of Federal Regulations, 2012 CFR


    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1)...

  11. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Code of Federal Regulations, 2010 CFR


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1)...

  12. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Code of Federal Regulations, 2014 CFR


    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1)...

  13. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Code of Federal Regulations, 2013 CFR


    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1)...

  14. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Code of Federal Regulations, 2011 CFR


    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1)...

  15. Chemical and physical defense of weed seeds in relation to soil seedbank persistence

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Persistent soil seedbanks drive the long-term population dynamics of annual weeds of arable fields, yet most weed management tactics are targeted at the seedling stage. Development of effective strategies for weed seedbank management will depend upon better mechanistic understanding of the ecologica...

  16. Economics of weed suppressive rice cultivars in flood- and furrow-irrigated systems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weeds are a major constraint to rice production. In the U.S, weeds in rice are controlled primarily with synthetic herbicides. Intensive herbicide application in rice also has many potential drawbacks, resulting in environmental pollution, human health concerns, and development of weed resistance. B...

  17. Organic Highbush Blueberry Production Systems Research – Management of Plant Nutrition, Irrigation Requirements, and Weeds

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A 0.4 ha planting of blueberry was established in October 2006 to evaluate the effects of cultivar (Duke and Liberty), bed type (flat versus raised beds), weed management (sawdust mulch and hand-weed control; sawdust+compost mulch with acetic acid, flaming, and hand control used as needed; and weed ...

  18. Predicting field weed emergence with empirical models and soft computing techniques

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seedling emergence is the most important phenological process that influences the success of weed species; therefore, predicting weed emergence timing plays a critical role in scheduling weed management measures. Important efforts have been made in the attempt to develop models to predict seedling e...

  19. Sweat, Brain-Power, Horsepower, and Time - The Keys to Controlling Weeds

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in organic crop production is difficult and costly. Early studies on organic weed control in conservation tillage systems were disappointing. Research shifted to organic weed control in conventional tillage systems. Intense cultivation with a tine weeder was the most consistent metho...

  20. Management filters and species traits: Weed community assembly in long-term organic and conventional systems

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Community assembly theory provides a useful framework to assess the response of weed communities to agricultural management systems and to improve the predictive power of weed science. Under this framework, weed community assembly is constrained by abiotic and biotic "filters" that act on species tr...

  1. Phenological observations on shrubs to predict weed emergence in turf

    NASA Astrophysics Data System (ADS)

    Masin, Roberta; Zuin, Maria Clara; Zanin, Giuseppe


    Phenology is the study of periodic biological events. If we can find easily recognizable events in common plants that precede or coincide with weed emergences, these plants could be used as indicators. Weed seedlings are usually difficult to detect in turf, so the use of phenological indicators may provide an alternative approach to predict the time when a weed appears and consequently guide management decisions. A study was undertaken to determine whether the phenological phases of some plants could serve as reliable indicators of time of weed emergence in turf. The phenology of six shrubs (Crataegus monogyna Jacq., Forsythia viridissima Lindl., Sambucus nigra L., Syringa vulgaris L., Rosa multiflora Thunb., Ziziphus jujuba Miller) and a perennial herbaceous plant [Cynodon dactylon (L.) Pers.] was observed and the emergence dynamics of four annual weed species [Digitaria sanguinalis (L.) Scop., Eleusine indica (L.) Gaertner, Setaria glauca (L.) Beauv., Setaria viridis (L.) Beauv.] were studied from 1999 to 2004 in northern Italy. A correlation between certain events and weed emergence was verified. S. vulgaris and F. viridissima appear to be the best indicators: there is a quite close correspondence between the appearance of D. sanguinalis and lilac flowering and between the beginning of emergence of E. indica and the end of lilac flowering; emergences of S. glauca and S. viridis were predicted well in relation to the end of forsythia flowering. Base temperatures and starting dates required to calculate the heat unit sums to reach and complete the flowering phase of the indicators were calculated using two different methods and the resultant cumulative growing degree days were compared.

  2. Image classification approach for automatic identification of grassland weeds

    NASA Astrophysics Data System (ADS)

    Gebhardt, Steffen; Kühbauch, Walter


    The potential of digital image processing for weed mapping in arable crops has widely been investigated in the last decades. In grassland farming these techniques are rarely applied so far. The project presented here focuses on the automatic identification of one of the most invasive and persistent grassland weed species, the broad-leaved dock (Rumex obtusifolius L.) in complex mixtures of grass and herbs. A total of 108 RGB-images were acquired in near range from a field experiment under constant illumination conditions using a commercial digital camera. The objects of interest were separated from the background by transforming the 24 bit RGB-images into 8 bit intensities and then calculating the local homogeneity images. These images were binarised by applying a dynamic grey value threshold. Finally, morphological opening was applied to the binary images. The remaining contiguous regions were considered to be objects. In order to classify these objects into 3 different weed species, a soil and a residue class, a total of 17 object-features related to shape, color and texture of the weeds were extracted. Using MANOVA, 12 of them were identified which contribute to classification. Maximum-likelihood classification was conducted to discriminate the weed species. The total classification rate across all classes ranged from 76 % to 83 %. The classification of Rumex obtusifolius achieved detection rates between 85 % and 93 % by misclassifications below 10 %. Further, Rumex obtusifolius distribution and the density maps were generated based on classification results and transformation of image coordinates into Gauss-Krueger system. These promising results show the high potential of image analysis for weed mapping in grassland and the implementation of site-specific herbicide spraying.

  3. The orientation and navigation of juvenile alligators: evidence of magnetic sensitivity

    USGS Publications Warehouse

    Rodda, Gordon H.


    Displaced juvenile alligators, Alligator mississipiensis, were released on land in a 9 m diameter dodecagonal arena to test their ability to orient in the absence of terrestrial landmarks. Navigational ability seemed to improve with age. When displaced along a fairly direct route yearlings (age 7–14 months) compensated for their displacement, moving in the direction from the arena to their home sites. When displaced by a circuitous route, yearlings failed to compensate for their displacement, exhibiting instead simple compass orientation in a direction that would have returned them to water had they been released on land near the site where they were captured. The older juveniles were oriented in a homeward direction under all displacement and test conditions. The latter animals may have been using geomagnetic map information to select their homeward directions as the errors in their homeward bearings correlated with small deviations in the geomagnetic field's dip angle at the time of the test (1980r s=−0.6047,P=0.0131, all testsr s= −0.4652,P=0.0084). This effect appeared to depend on a very short-term assessment of geomagnetic conditions, as values measured 20 min before or 30 min after the tests began did not correlate with the directions the animals moved. The older juveniles appeared to use magnetically quiet hours on the night of their capture as the baseline from which to measure the geomagnetic deviations that occurred at the time of the arena test. The magnitude of the magnetic effect in the older animals suggests that the geomagnetic information may have been used to perform a ‘map’ step, as small fluctuations in dip angle correlated with much larger deviations in homeward bearings. In addition, the compass-oriented yearlings and the seemingly route-based behavior of the homeward-oriented yearlings did not appear to be influenced by geomagnetic conditions. These findings have many parallels in results obtained from bird orientation studies

  4. Primary alkaline magmas associated with the Quaternary Alligator Lake volcanic complex, Yukon Territory, Canada

    NASA Astrophysics Data System (ADS)

    Eiché, G. E.; Francis, D. M.; Ludden, J. N.


    The Alligator Lake complex is a Quaternary alkaline volcanic center located in the southern Yukon Territory of Canada. It comprises two cinder cones which cap a shield consisting of five distinct lava units of basaltic composition. Units 2 and 3 of this shield are primitive olivine-phyric lavas (13.5 19.5 cation % Mg) which host abundant spinel lherzolite xenoliths, megacrysts, and granitoid fragments. Although the two lava types have erupted coevally from adjacent vents and are petrographically similar, they are chemically distinct. Unit 2 lavas have considerably higher abundances of LREE, LILE, and Fe, but lower HREE, Y, Ca, Si, and Al relative to unit 3 lavas. The 87Sr/86Sr and 143Nd/144Nd isotopic ratios of these two units are, however, indistinguishable. The differences between these two lava types cannot be explained in terms of low pressure olivine fractionation, and the low concentrations of Sr, Nb, P, and Ti in the granitoid xenoliths relative to the primitive lavas discounts differential crustal contamination. The abundance of spinel lherzolite xenoliths and the high Mg contents in the lavas of both units indicates that their compositional differences originated in the upper mantle. The Al and Si systematics of these lavas suggests that, compared to unit 3 magmas, the unit 2 magmas may have segregated at greater depths from a garnet lherzolite mantle. The identical isotopic composition and similar ratios of highly incompatible elements in these two lava units argues against their differences being a consequence of random metasomatism or mantle heterogeneity. The lower Y and HREE contents but higher concentrations of incompatible elements in the unit 2 lavas relative to unit 3 can be most simply explained by differential partial melting of similar garnet-bearing sources. The unit 2 magmas thus appear to have been generated by smaller degrees of melting at a greater depth than the unit 3 magmas. The contemporaneous eruption of two distinct but

  5. Turning crocodilian hearts into bird hearts: growth rates are similar for alligators with and without right-to-left cardiac shunt

    PubMed Central

    Eme, John; Gwalthney, June; Owerkowicz, Tomasz; Blank, Jason M.; Hicks, James W.


    The functional and possible adaptive significance of non-avian reptiles' dual aortic arch system and the ability of all non-avian reptiles to perform central vascular cardiac shunts have been of great interest to comparative physiologists. The unique cardiac anatomy of crocodilians – a four-chambered heart with the dual aortic arch system – allows for only right-to-left (R–L; pulmonary bypass) cardiac shunt and for surgical elimination of this shunt. Surgical removal of the R–L shunt, by occluding the left aorta (LAo) upstream and downstream of the foramen of Panizza, results in a crocodilian with an obligatory, avian/mammalian central circulation. In this study, R–L cardiac shunt was eliminated in age-matched, female American alligators (Alligator mississippiensis; 5–7 months of age). We tested the hypothesis that surgical elimination of R–L cardiac shunt would impair growth (a readily measured proxy for fitness) compared with sham-operated, age-matched controls, especially in animals subjected to exhaustive exercise. While regular exercise caused a decrease in size (snout-to-vent length, head length and body mass), elimination of the capacity for R–L cardiac shunt did not greatly reduce animal growth, despite a chronic ventricular enlargement in surgically altered juvenile alligators. We speculate that, despite being slightly smaller, alligators with an occluded LAo would have reached sexual maturity in the same breeding season as control alligators. This study suggests that crocodilian R–L cardiac shunt does not provide an adaptive advantage for juvenile alligator growth and supports the logic that cardiac shunts persist in crocodilians because they have not been selected against. PMID:20639429

  6. Strategies for non-chemical weed control on public paved areas in Denmark.


    Hansen, Preben K; Kristoffersen, Palle; Kristensen, Kristian


    To be proactive in minimizing pesticide use, the public authorities in Denmark agreed in 1998 to phase out the use of pesticides on publicly owned areas by the end of 2002. A part of the agreement was an increasing focus on research into and development of new methods and implements for non-chemical weed control on paved areas. Due to a large increase in the costs of non-chemical weed control, the park authorities have to put the different types and locations of paved areas in order of priority to optimize the weed control effort. The present authors divided the paved areas into five weed control levels, dependent on placement, quality and use. For the 3 years 1999-2001, experiments with different non-chemical weed control methods were conducted on pavements at six locations in Denmark. The aim was to test the reaction of the weeds to different treatments and strategies. The efficacies of the methods were evaluated by analysis of digital images to estimate the fraction of the paved area covered with green vegetation (weed coverage). The weed coverage was used as the dependent variable in the subsequent statistical analysis. The independent variables in the model were incoming radiation, wear, area of joints in the pavement, the dying process of the weeds and the number of runs/applied energy of the mechanical or thermal weed control methods, respectively. The estimated parameters from the statistical model were used to build a simulation model, which was used to optimise five weed control strategies to fulfil the suggested weed control levels. In the suggested strategy for maximum weed control, 12 thermal weeding applications at 2-week intervals are suggested. The 'clean-up' strategy is based on one weed-brushing in late spring or early autumn.

  7. Analysis of chorioallantoic membranes to assess PCB accumulation in American alligators and Loggerhead sea turtles from the coast of South Carolina

    SciTech Connect

    Cobb, G.P.; Wood, P.D.; O`Quinn, M.


    Investigation of contaminant burdens in threatened and endangered species is difficult due to the small number of samples that can be collected. Many samples can be collected if the sampling methods are non-lethal and more specifically non-invasive. Analysis of chorioallantoic membranes is demonstrated for American alligators and Loggerhead sea turtles. Significant differences were found in PCB, uptake by alligators from the Ashepoo-Combahee-Edisto Basin reference site and a contaminated site in Winyah Bay. Intrasite and intersite differences in uptake and distribution of PCB homologues were noted. These data will be discussed as they relate to egg viability and embryo development.

  8. Weed management, training, and irrigation practices for organic production of trailing blackberry: II. Soil and plant nutrient concentrations

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Organic production of blackberries is increasing, but there is relatively little known about how production practices affect plant and soil nutrient status. The impact of cultivar (‘Black Diamond’ and ‘Marion’), weed management (weed mat, hand weeding, and no weeding), primocane training time (Augus...

  9. Combinations of corn glutel meal, clove oil, and sweep cultivation are ineffective for weed control in organic peanut production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Weed control in organic peanut is difficult and lack of residual weed control complicates weed management efforts. Weed management systems using corn gluten meal in combination with clove oil and sweep cultivation were evaluated in a series of irrigated field trials. Corn gluten meal applied in a ...

  10. Formation and regression of the corpus luteum of the American alligator

    USGS Publications Warehouse

    Guillette, L.J.; Woodward, A.R.; You-Xiang, Q.; Cox, M.C.; Matter, J.H.; Gross, T.S.


    Luteal morphology of the American alligator is unique when compared to other reptiles but is similar to that of its phylogenetic relatives, the birds. The theca is extensively hypertrophied, but the granulosa never fills the cavity formed following the ovulation of the ovum. The formation of the corpus luteum (CL) is correlated with elevated plasma progesterone concentrations, which decline dramatically after oviposition with the onset of luteolysis. Unlike those of most other reptiles, the central luteal cell mass is composed of two cell types; one presumably is derived from the granulosa, whereas the other is from the theca interna. Both cell types are present throughout gravidity but only one cell type is seen during mid to late luteolysis. A significant decline in luteal volume occurs following oviposition and continues throughout the post-oviposition period. The fastest decline in luteal volume occurs in the month immediately after oviposition; this rate then slows. Luteolysis appears to continue for a year or more following oviposition, as distinct structures of luteal origin can still be identified in animals 9 months after oviposition. The size of persistent CL can be used to determine whether a given female oviposited during the previous nesting season. Females with CL having volumes greater than 0.2 cm2 or CL diameters greater than 0.4 cm were active the previous season. 

  11. Microhabitat use, home range, and movements of the alligator snapping turtle, Macrochelys temminckii, in Oklahoma

    USGS Publications Warehouse

    Riedle, J.D.; Shipman, P.A.; Fox, S. F.; Leslie, David M.


    Little is known about the ecology of the alligator snapping turtle, Macrochelys temminckii, particularly dentography and behavior. To learn more about the species in Oklahoma, we conducted a telemetry project on 2 small streams at Sequoyah National Wildlife Refuge, an 8,417.5-ha refuge located in east-central Oklahoma. Between June 1999 and August 2000, we fitted 19 M. temminckii with ultrasonic telemetry tags and studied turtle movements and microhahitat use. Turtles were checked 2 to 3 times weekly in summer and sporadically in winter. Several microhabitat variables were measured at each turtle location and a random location to help quantify microhabitat use vs. availability. We recorded 147 turtle locations. Turtles were always associated with submerged cover with a high percentage of overhead canopy cover. Turtles used deeper depths in late summer (but not deeper depths than random locations) and deeper depths in mid-winter (and deeper depths than random locations) than in early summer. They used shallower depths than random locations in early summer. This seasonal shift in depth use might be thermoregulatory, although evidence for this is indirect. The mean linear home range for all turtles was 777.8 m. Females had larger home ranges than males, and juveniles had larger home ranges than adults, although the latter was not statistically significant. Macrochelys temminckii used submerged structures as a core site, and stayed at each core site for an average of 12.3 d.

  12. Sorption of sulphamethoxazole by the biochars derived from rice straw and alligator flag.


    Li, Tingqiang; Han, Xuan; Liang, Chengfeng; Shohag, M J I; Yang, Xiaoe


    The sorption ability of sulphamethoxazole (SMX) by biochar derived from rice straw (RS) and alligator flag (AF) at 600°C was studied to assess the ability of biochar as adsorbent to remove SMX from aqueous solution. The results indicated that sorption of SMX by biochars was well described using the Langmuir equation (R2>0.94), and the maximum sorption parameter (Q) of RS (3650 mg kg(-1)) was much higher than that of AF (1963 mg kg(-1)). Temperature had no effect on SMX sorption by biochars, while thermodynamics analysis indicated that the sorption of SMX on both biochars was a spontaneous physical process. The d 250 RS (diameter of RS sieved through 250 µm) and d 150 AF (diameter of AF sieved through 150 µm) showed excellent sorption ability for SMX. The sorption amount of RS was larger than that of AF when pH<7, whereas, the sorption amount of AF surpassed RS when pH≥7. The presence of Cu2+ and/or Cd2+ ion at low concentrations (20 mg L(-1)) significantly (P<0.05) increased the sorption of SMX on both RS and AF. Our study confirms that biochar derived from the wetland plants could be used as effective adsorbents to remove SMX from aqueous solution. PMID:25413119

  13. Macroderoides texanus n. sp. (Digenea: Macroderoididae) from alligator gar, Atractosteus spatula in Texas.


    Tkach, Vasyl V; Strand, Eric J; Froese, Leanne


    Macroderoides texanus n. sp. is described based on 16 specimens collected from the intestine of the North American alligator gar, Atractosteus spatula. Of the five established species of Macroderoides, the new species is morphologically most similar to Macroderoides spiniferus and Macroderoides trilobatus. M. texanus n. sp. differs from M. spiniferus by having the ovary situated immediately posterior to the cirrus sac rather than at mid-way between the cirrus sac and anterior testis, the ventral sucker situated further posteriorly, and the vitelline fields extending somewhat posterior to posterior testis rather than to the middle of posterior testis. M. texanus n. sp. differs from M. trilobatus by having the ovary positioned immediately adjacent to, or overlapping the cirrus sac rather than at some distance posterior to it, and by having significantly larger eggs. Additionally, the new species has two distinctive rows of spines on the postero-ventral surface of the oral sucker that are lacking in M. spiniferus and M. trilobatus. Comparison of approximately 2,700-base-pair sequences of nuclear rDNA (partial 18S, complete ITS region and partial 28S) from M. texanus n. sp., M. spiniferus and M. trilobatus, strongly supports the status of M. texanus n. sp. as a new species. PMID:18762983

  14. Structure and fracture resistance of alligator gar (Atractosteus spatula) armored fish scales.


    Yang, Wen; Gludovatz, Bernd; Zimmermann, Elizabeth A; Bale, Hrishikesh A; Ritchie, Robert O; Meyers, Marc A


    The alligator gar is a large fish with flexible armor consisting of ganoid scales. These scales contain a thin layer of ganoine (microhardness ~2.5 GPa) and a bony body (microhardness ~400 MPa), with jagged edges that provide effective protection against predators. We describe here the structure of both ganoine and bony foundation and characterize the mechanical properties and fracture mechanisms. The bony foundation is characterized by two components: a mineralized matrix and parallel arrays of tubules, most of which contain collagen fibers. The spacing of the empty tubules is ~60 μm; the spacing of those filled with collagen fibers is ~7 μm. Using micromechanical testing of such scales in a variable-pressure scanning electron microscope, we identify interactions between propagating cracks and the microstructure, and show that the toughness of the scales increases with crack extension in a classical resistance-curve response from the activation of extrinsic toughening mechanisms. We demonstrate how mechanical damage evolves in these structures, and further identify that the reinforcement of the mineral by the network of collagen fibers is the principal toughening mechanism resisting such damage. Additionally, we define the anisotropy of the toughness of the scales and relate this to the collagen fiber orientation. PMID:23274521

  15. Structure and fracture resistance of alligator gar (Atractosteus spatula) armored fish scales.


    Yang, Wen; Gludovatz, Bernd; Zimmermann, Elizabeth A; Bale, Hrishikesh A; Ritchie, Robert O; Meyers, Marc A


    The alligator gar is a large fish with flexible armor consisting of ganoid scales. These scales contain a thin layer of ganoine (microhardness ~2.5 GPa) and a bony body (microhardness ~400 MPa), with jagged edges that provide effective protection against predators. We describe here the structure of both ganoine and bony foundation and characterize the mechanical properties and fracture mechanisms. The bony foundation is characterized by two components: a mineralized matrix and parallel arrays of tubules, most of which contain collagen fibers. The spacing of the empty tubules is ~60 μm; the spacing of those filled with collagen fibers is ~7 μm. Using micromechanical testing of such scales in a variable-pressure scanning electron microscope, we identify interactions between propagating cracks and the microstructure, and show that the toughness of the scales increases with crack extension in a classical resistance-curve response from the activation of extrinsic toughening mechanisms. We demonstrate how mechanical damage evolves in these structures, and further identify that the reinforcement of the mineral by the network of collagen fibers is the principal toughening mechanism resisting such damage. Additionally, we define the anisotropy of the toughness of the scales and relate this to the collagen fiber orientation.

  16. Macroderoides texanus n. sp. (Digenea: Macroderoididae) from alligator gar, Atractosteus spatula in Texas.


    Tkach, Vasyl V; Strand, Eric J; Froese, Leanne


    Macroderoides texanus n. sp. is described based on 16 specimens collected from the intestine of the North American alligator gar, Atractosteus spatula. Of the five established species of Macroderoides, the new species is morphologically most similar to Macroderoides spiniferus and Macroderoides trilobatus. M. texanus n. sp. differs from M. spiniferus by having the ovary situated immediately posterior to the cirrus sac rather than at mid-way between the cirrus sac and anterior testis, the ventral sucker situated further posteriorly, and the vitelline fields extending somewhat posterior to posterior testis rather than to the middle of posterior testis. M. texanus n. sp. differs from M. trilobatus by having the ovary positioned immediately adjacent to, or overlapping the cirrus sac rather than at some distance posterior to it, and by having significantly larger eggs. Additionally, the new species has two distinctive rows of spines on the postero-ventral surface of the oral sucker that are lacking in M. spiniferus and M. trilobatus. Comparison of approximately 2,700-base-pair sequences of nuclear rDNA (partial 18S, complete ITS region and partial 28S) from M. texanus n. sp., M. spiniferus and M. trilobatus, strongly supports the status of M. texanus n. sp. as a new species.

  17. Sorption of sulphamethoxazole by the biochars derived from rice straw and alligator flag.


    Li, Tingqiang; Han, Xuan; Liang, Chengfeng; Shohag, M J I; Yang, Xiaoe


    The sorption ability of sulphamethoxazole (SMX) by biochar derived from rice straw (RS) and alligator flag (AF) at 600°C was studied to assess the ability of biochar as adsorbent to remove SMX from aqueous solution. The results indicated that sorption of SMX by biochars was well described using the Langmuir equation (R2>0.94), and the maximum sorption parameter (Q) of RS (3650 mg kg(-1)) was much higher than that of AF (1963 mg kg(-1)). Temperature had no effect on SMX sorption by biochars, while thermodynamics analysis indicated that the sorption of SMX on both biochars was a spontaneous physical process. The d 250 RS (diameter of RS sieved through 250 µm) and d 150 AF (diameter of AF sieved through 150 µm) showed excellent sorption ability for SMX. The sorption amount of RS was larger than that of AF when pH<7, whereas, the sorption amount of AF surpassed RS when pH≥7. The presence of Cu2+ and/or Cd2+ ion at low concentrations (20 mg L(-1)) significantly (P<0.05) increased the sorption of SMX on both RS and AF. Our study confirms that biochar derived from the wetland plants could be used as effective adsorbents to remove SMX from aqueous solution.

  18. Thermoluminescence and excess 226Ra decay dating of late Quaternary fluvial sands, East Alligator River, Australia

    NASA Astrophysics Data System (ADS)

    Murray, Andrew; Wohl, Ellen; East, Jon


    Thermoluminescence (TL) dating was applied to seven samples of siliceous fluvial sands from the East Alligator River of Northern Australia, giving ages ranging from modern to 6000 yr B.P. Two methods of estimating the equivalent dose (ED), total bleach and regenerative, were applied to the 90- to 125-μm quartz fraction of the samples in order to determine the reliability and internal consistency of the technique. High-resolution γ and α spectroscopy were used to measure radionuclide contents; these measurements revealed an excess 226Ra activity compared with 230Th. This excess decreased with depth, and was used directly to derive mean sedimentation rates, and thus sediment ages. Both this method and one 14C date confirmed the validity of the TL values, which increased systematically with depth and were consistent with site stratigraphy. TL was of limited use in the dating of these late Holocene deposits because of age uncertainties of 500 to 1600 yr, resulting from a significant residual ED. This residual probably resulted from incomplete bleaching during reworking upstream of the sampling site. For Pleistocene deposits, the residual ED will be less significant because of higher total EDs, and TL dates will be correspondingly more accurate.

  19. Two modes of motion of the alligator lizard cochlea: Measurements and model predictions

    NASA Astrophysics Data System (ADS)

    Aranyosi, A. J.; Freeman, Dennis M.


    Measurements of motion of an in vitro preparation of the alligator lizard basilar papilla in response to sound demonstrate elliptical trajectories. These trajectories are consistent with the presence of both a translational and rotational mode of motion. The translational mode is independent of frequency, and the rotational mode has a displacement peak near 5 kHz. These measurements can be explained by a simple mechanical system in which the basilar papilla is supported asymmetrically on the basilar membrane. In a quantitative model, the translational admittance is compliant while the rotational admittance is second order. Best-fit model parameters are consistent with estimates based on anatomy and predict that fluid flow across hair bundles is a primary source of viscous damping. The model predicts that the rotational mode contributes to the high-frequency slopes of auditory nerve fiber tuning curves, providing a physical explanation for a low-pass filter required in models of this cochlea. The combination of modes makes the sensitivity of hair bundles more uniform with radial position than that which would result from pure rotation. A mechanical analogy with the organ of Corti suggests that these two modes of motion may also be present in the mammalian cochlea.

  20. Herbicide-Resistant Crops: Utilities and Limitations for Herbicide-Resistant Weed Management

    PubMed Central


    Since 1996, genetically modified herbicide-resistant (HR) crops, particularly glyphosate-resistant (GR) crops, have transformed the tactics that corn, soybean, and cotton growers use to manage weeds. The use of GR crops continues to grow, but weeds are adapting to the common practice of using only glyphosate to control weeds. Growers using only a single mode of action to manage weeds need to change to a more diverse array of herbicidal, mechanical, and cultural practices to maintain the effectiveness of glyphosate. Unfortunately, the introduction of GR crops and the high initial efficacy of glyphosate often lead to a decline in the use of other herbicide options and less investment by industry to discover new herbicide active ingredients. With some exceptions, most growers can still manage their weed problems with currently available selective and HR crop-enabled herbicides. However, current crop management systems are in jeopardy given the pace at which weed populations are evolving glyphosate resistance. New HR crop technologies will expand the utility of currently available herbicides and enable new interim solutions for growers to manage HR weeds, but will not replace the long-term need to diversify weed management tactics and discover herbicides with new modes of action. This paper reviews the strengths and weaknesses of anticipated weed management options and the best management practices that growers need to implement in HR crops to maximize the long-term benefits of current technologies and reduce weed shifts to difficult-to-control and HR weeds. PMID:20586458