Wang, Lei; Zhou, Yan; Huang, Ya-Xi; Mi, Jin-Xiao
2009-01-01
The title compound, ammonium potassium iron(III) phosphate fluoride, (NH4)0.875K0.125FePO4F, is built from zigzag chains ∞ 1{[FeO4F2]7−}, with Fe3+ in a distorted octahedral coordination, extending along both the [011] and [01] directions. These chains are made up of alternating trans-[FeO4F2] and cis-[FeO4F2] octahedra via shared F-atom corners, and are linked by PO4 tetrahedra, resulting in an open-framework structure with channels along the [010] and [100] directions. There are two crystallographically independent ammonium sites: one in the [010] channels and the other, partially substituted by K+ ions, in the [100] channels. The ammonium in the [010] channels is fixed to the framework via eight hydrogen bonds (six N—H⋯O and two N—H⋯F). PMID:21581466
Preparation of Ti3C2 and Ti2C MXenes by fluoride salts etching and methane adsorptive properties
NASA Astrophysics Data System (ADS)
Liu, Fanfan; Zhou, Aiguo; Chen, Jinfeng; Jia, Jin; Zhou, Weijia; Wang, Libo; Hu, Qianku
2017-09-01
Here we reported the preparation of Ti3C2 MXene and Ti2C MXene by etching Ti3AlC2 and Ti2AlC with various fluoride salts in hydrochloric acid (HCl), including lithium fluoride (LiF), sodium fluoride (NaF), potassium fluoride (KF), and ammonium fluoride (NH4F). As-prepared Ti2C was further delaminated by urea, dimethylsulfoxide or ammonium hydroxide. Based on theoretical calculation and XPS results, the type of positive ions (Li+, Na+, K+, or NH4+) in etchant solution affect the surface structure of prepared MXene, which, in turn, affects the methane adsorption properties of MXene. The highest methane adsorption capacity is 8.5 cm3/g for Ti3C2 and 11.6 cm3/g for Ti2C. MXenes made from LiF and NH4F can absorb methane under high pressure and can keep methane under normal pressure, these MXenes may have important application on capturing methane or other hazardous gas molecules. MXenes made from NaF and KF can absorb methane under high pressure and release methane under low pressure. They can have important application in the adsorb storage of nature gas.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Facteau, T.J.; Rowe, K.E.
1976-06-01
Aqueous ammonium fluoride (NH/sub 4/F) sprays on Early Improved Elberta peaches (Prunus persica (L.) Batsch) resulted in increased O/sub 2/ consumption of suture tissue and inconsistent changes in O/sub 2/ consumption of dorsal tissue as the spray concentration was increased. Flesh firmness on the suture side of treated fruit was less than non-sprayed fruit and decreased as either the NH/sub 4/F spray concentration or number of sprays increased. The effect of spray on the dorsal side differed from year to year. Levels of fluoride (F) in the fruit tissue were associated with F concentration and number of F sprays appliedmore » only within the same year. 3 references, 1 table.« less
NASA Astrophysics Data System (ADS)
Saito, N.; Youda, S.; Hayashi, K.; Sugimura, H.; Takai, O.
2003-06-01
Self-assembled monolayers (SAMs) were prepared on hydrogen-terminated silicon substrates through chemical vapor deposition using 1-hexadecene (HD) as a precursor. The HD-SAMs prepared in an atmosphere under a reduced pressure (≈50 Pa) showed better chemical resistivities to hydrofluoric acid and ammonium fluoride (NH 4F) solutions than that of an organosilane SAM formed on oxide-covered silicon substrates. The surface covered with the HD-SAM was micro-patterned by vacuum ultraviolet photolithography and consequently divided into two areas terminated with HD-SAM or silicon dioxide. This micro-patterned sample was immersed in a 40 vol.% NH 4F aqueous solution. Surface images obtained by an optical microscopy clearly show that the micro-patterns of HD-SAM/silicon dioxide were successfully transferred into the silicon substrate.
Chun, Jinyoung; Jo, Changshin; Sahgong, Sunhye; Kim, Min Gyu; Lim, Eunho; Kim, Dong Hyeon; Hwang, Jongkook; Kang, Eunae; Ryu, Keun Ah; Jung, Yoon Seok; Kim, Youngsik; Lee, Jinwoo
2016-12-28
Metal fluorides (MF x ) are one of the most attractive cathode candidates for Li ion batteries (LIBs) due to their high conversion potentials with large capacities. However, only a limited number of synthetic methods, generally involving highly toxic or inaccessible reagents, currently exist, which has made it difficult to produce well-designed nanostructures suitable for cathodes; consequently, harnessing their potential cathodic properties has been a challenge. Herein, we report a new bottom-up synthetic method utilizing ammonium fluoride (NH 4 F) for the preparation of anhydrous MF x (CuF 2 , FeF 3 , and CoF 2 )/mesoporous carbon (MSU-F-C) nanocomposites, whereby a series of metal precursor nanoparticles preconfined in mesoporous carbon were readily converted to anhydrous MF x through simple heat treatment with NH 4 F under solventless conditions. We demonstrate the versatility, lower toxicity, and efficiency of this synthetic method and, using XRD analysis, propose a mechanism for the reaction. All MF x /MSU-F-C prepared in this study exhibited superior electrochemical performances, through conversion reactions, as the cathode for LIBs. In particular, FeF 3 /MSU-F-C maintained a capacity of 650 mAh g -1 FeF3 across 50 cycles, which is ∼90% of its initial capacity. We expect that this facile synthesis method will trigger further research into the development of various nanostructured MF x for use in energy storage and other applications.
PROCESS FOR THE PRODUCTION OF AMMONIUM URANIUM FLUORIDE
Ellis, A.S.; Mooney, R.B.
1953-08-25
This patent relates to the preparation of ammonium uranium fluoride. The process comprises adding a water soluble fluoride to an aqueous solution of a uranous compound containing an ammonium salt, and isolating the resulting precipitate. This patent relates to the manufacture of uranium tetnafluoride from ammonium uranium fluoride, NH/sub 4/UF/sub 5/. Uranium tetrafluoride is prepared by heating the ammonium uranium fluoride to a temperature at which dissociation occurs with liberation of ammonium fluoride. Preferably the process is carried out under reduced pressure, or in a current of an inert gas.
Multicolor tunability and upconversion enhancement of fluoride nanoparticles by oxygen dopant
NASA Astrophysics Data System (ADS)
Niu, Wenbin; Wu, Suli; Zhang, Shufen; Su, Liap Tat; Tok, Alfred Iing Yoong
2013-08-01
The ability to manipulate the upconversion luminescence of lanthanide-ion doped fluoride upconversion nanoparticles (UCNPs) is particularly important and highly desired due to their wide applications in color displays, multiplexing bioassays and multicolor imaging. Here, we developed a strategy for simultaneously tuning color output and enhancing upconversion emission of Yb/Er doped fluoride UCNPs, based on adjusting the oxygen doping level. The synthesis of multicolored multifunctional NaGdF4:Yb,Er UCNPs was used as the model host system to demonstrate this protocol. Ammonium nitrate (NH4NO3) was used as the oxygen source and added into the reaction system at the beginning stage of nucleation and growth process of fluoride UCNPs, which facilitates the formation of enough oxygen atoms and the diffusion of these into the fluoride host matrix. The results revealed that multicolour output and upconversion enhancement mainly resulted from the variation of phonon energy and crystal field symmetry of the host lattice, respectively. This strategy can be further expanded to other fluoride host matrices. As an example of an application, multicolored UCNPs were used as a color converter in light emitting diodes, which can effectively convert near-infrared light into visible light. It is expected that these multicolored UCNPs will be promising for applications in multiplexing biodetection, bioimaging (optical and magnetic resonance imaging) and other optical technologies, and the present method for the control of O2- doping may also be used in other functional nanomaterials.The ability to manipulate the upconversion luminescence of lanthanide-ion doped fluoride upconversion nanoparticles (UCNPs) is particularly important and highly desired due to their wide applications in color displays, multiplexing bioassays and multicolor imaging. Here, we developed a strategy for simultaneously tuning color output and enhancing upconversion emission of Yb/Er doped fluoride UCNPs, based on adjusting the oxygen doping level. The synthesis of multicolored multifunctional NaGdF4:Yb,Er UCNPs was used as the model host system to demonstrate this protocol. Ammonium nitrate (NH4NO3) was used as the oxygen source and added into the reaction system at the beginning stage of nucleation and growth process of fluoride UCNPs, which facilitates the formation of enough oxygen atoms and the diffusion of these into the fluoride host matrix. The results revealed that multicolour output and upconversion enhancement mainly resulted from the variation of phonon energy and crystal field symmetry of the host lattice, respectively. This strategy can be further expanded to other fluoride host matrices. As an example of an application, multicolored UCNPs were used as a color converter in light emitting diodes, which can effectively convert near-infrared light into visible light. It is expected that these multicolored UCNPs will be promising for applications in multiplexing biodetection, bioimaging (optical and magnetic resonance imaging) and other optical technologies, and the present method for the control of O2- doping may also be used in other functional nanomaterials. Electronic supplementary information (ESI) available: Upconversion spectra of NaYF4:Yb,Er UCNPs prepared with various oxygen sources (trimethylamine N-oxide and ammonium carbonate, Fig. S1) and different addition temperatures of NH4NO3 (Fig. S2), enlarged XRD patterns (Fig. S3), the intensity ratios of green to red emissions of NaGdF4:Yb,Er UCNPs prepared with various amounts of NH4NO3 (Fig. S4), power dependence of upconversion spectra of NaGdF4:Yb,Er UCNPs prepared at 300 °C for 1 h (Fig. S5), upconversion spectra of the product after further reaction between as-prepared NaYF4:Yb,Er and 50 mg of NH4NO3 at 300 °C for 1 h (Fig. S6), XRD patterns of NaYF4:Yb,Er and NaLuF4:Yb,Er UCNPs prepared with various amounts of NH4NO3 (Fig. S7 and S8), the corresponding magnetization curves of NaGdF4:Yb,Er UCNPs (Fig. S9). See DOI: 10.1039/c3nr01612a
Structural study of the ammonium octafluoroneptunate, [NH 4] 4NpF 8
Poineau, Frederic; Silva, Chinthaka M.; Yeamans, Charles B.; ...
2016-04-21
The [NH 4] 4NpF 8 salt was prepared from the solid-state reaction of NpO 2 with NH 4HF 2 and characterized by powder X-ray diffraction and X-ray absorption fine structure spectroscopy. The diffraction results confirm the compound to be isostructural to [NH 4] 4UF 8 with the following lattice parameter (a = 13.054(4) Å, b = 6.681(2) Å, c = 13.676(5) Å, ß = 121.14 Å). For the first time, a Neptunium fluoride complex has been characterized by XAFS spectroscopy. The energy position of the white line and inflection of the XANES spectra of [NH 4] 4NpF 8 are consistentmore » with the presence of Np(IV). Adjustment of the EXAFS spectra indicates that the coordination number (7.4±1.5) and the average Np-F distance (2.26(1) Å) are consistent with the presence of the NpF8 dodecahedron. The average Np-F distance is ~0.02 Å shorter than the U-F distance in [NH 4] 4UF 8 and is a result of the actinide contraction.« less
Ammonium fluoride-activated synthesis of cubic δ-TaN nanoparticles at low temperatures
NASA Astrophysics Data System (ADS)
Lee, Young-Jun; Kim, Dae-Young; Lee, Kap-Ho; Han, Moon-Hee; Kang, Kyoung-Soo; Bae, Ki-Kwang; Lee, Jong-Hyeon
2013-03-01
Cubic delta-tantalum nitride ( δ-TaN) nanoparticles were selectively prepared using a K2TaF7 + (5 + k) NaN3 + kNH4F reactive mixture ( k being the number of moles of NH4F) via a combustion process under a nitrogen pressure of 2.0 MPa. The combustion temperature, when plotted as a function of the number of moles of NH4F used, was in the range of 850°C to 1,170°C. X-ray diffraction patterns revealed the formation of cubic δ-TaN nanoparticles at 850°C to 950°C when NH4F is used in an amount of 2.0 mol (or greater) in the combustion experiment. Phase pure cubic δ-TaN synthesized at k = 4 exhibited a specific surface area of 30.59 m2/g and grain size of 5 to 10 nm, as estimated from the transmission electron microscopy micrograph. The role of NH4F in the formation process of δ-TaN is discussed with regard to a hypothetical reaction mechanism.
Syntheses and characterization of elpasolite-type ammonium alkali metal hexafluorometallates(III)
DOE Office of Scientific and Technical Information (OSTI.GOV)
Mi Jinxiao; Key Laboratory of New Processing Technology for Nonferrous Metals and Materials; Luo Shuming
Crystal structures of three fluorides (NH{sub 4}){sub 2}NaFeF{sub 6}, (Fe), (NH{sub 4}){sub 2}NaGaF{sub 6}, (Ga), and (NH{sub 4}){sub 2}NaCrF{sub 6}, (Cr), as well as a substituted compound [(NH{sub 4}){sub 1-x}K{sub x}]{sub 2}KAlF{sub 6} (x{approx}0.17), (Al), have been refined using single-crystal and powder X-ray diffraction techniques. All these four ammonium hexafluorides have a cubic elpasolite-type structure and crystallize in the space group Fm3-bar m with lattice constants a=8.483(3), 8.450 (3), 8.4472(2) and 8.724(3) A for compounds (Fe), (Ga), (Cr) and (Al), respectively. The effective ionic radius of the ammonium ion calculated from those compounds has a mean value of R=1.729 Amore » for CN=12. An ultraviolet-visible absorption spectrum of (NH{sub 4}){sub 2}NaCrF{sub 6}, measured at room temperature, gives a crystal field (Dq=1575 cm{sup -1}) and Racah parameters (B=758 cm{sup -1} and C=3374 cm{sup -1}). Abnormal anisotropic thermal parameters of fluorine atoms have been observed in the compound (Al), and interpreted to arise from four strong hydrogen bonds (F...H-N) that are distributed in a square form around each fluorine atom. - Graphical abstract: Abnormal anisotropic thermal parameters of fluorine atoms have been observed in the compound [(NH{sub 4}){sub 1-x}K{sub x}]{sub 2}KAlF{sub 6} (x{approx}0.17), and interpreted to arise from four strong hydrogen bonds (F...H-N) that are distributed in a square form around each fluorine atom. The endmembers' phase transitions at low temperature are believed to be caused by them.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Rothman, A.; Graczyk, D.; Chemical Sciences and Engineering Division
In the ammonium diuranate (ADU) process, UF{sub 6} is reacted with water, and the acidic solution of uranyl fluoride is treated with aqueous ammonia to precipitate ammonium polyuranate for subsequent reduction to UO{sub 2} and production of fuel pellets for commercial nuclear reactors. Our experiments simulated adding aqueous ammonia to the reaction products of UF{sub 6} and water in typical ADU processes. Chemical and X-ray diffraction analysis of products from the experiments are consistent with postulated chemical equilibria in which solids with structures close to that of ammonium polyuranate are formed from co-precipitation of the NH{sub 4}{sup +}(aq) cation withmore » (previously unreported) anions of the form UO{sub 2}F{sub 3-x}(OH){sub x}{sup -}(aq). More efficient separations of solid products were obtained at NH{sub 4}OH:UF{sub 6} ratios of 19 or greater, with x closer to the value of 3 for the hypothetical formation of pure ammonium polyuranate. Supplementary experiments in the current study and a previous study in our laboratory indicated that nominal uranium concentrations of 90 mg/l in the filtrate resulting from such separations could be reduced to microgram per liter levels by batch mixing a 1-to-2.5 aqueous diluate of the filtrate with the Diphonix{reg_sign} ion exchange resin. Our study further demonstrated that reaction of the purified NH{sub 4}OH-NH{sub 4}F diluate with aqueous Ca(OH){sub 2} at 80 to 90 C could produce essentially uranium-free CaF{sub 2} and an ammonia distillate, as useful waste-conversion end products from a modified ADU process.« less
Miller, L.G.; Coutlakis, M.D.; Oremland, R.S.; Ward, B.B.
1993-01-01
Methyl fluoride (CH3F) and dimethyl ether (DME) inhibited nitrification in washed-cell suspensions of Nitrosomonas europaea and in a variety of oxygenated soils and sediments. Headspace additions of CH3F (10% [vol/vol]) and DME (25% [vol/vol]) fully inhibited NO2- and N2O production from NH4+ in incubations of N. europaea, while lower concentrations of these gases resulted in partial inhibition. Oxidation of hydroxylamine (NH2OH) by N. europaea and oxidation of NO2- by a Nitrobacter sp. were unaffected by CH3F or DME. In nitrifying soils, CH3F and DME inhibited N2O production. In field experiments with surface flux chambers and intact cores, CH3F reduced the release of N2O from soils to the atmosphere by 20- to 30-fold. Inhibition by CH3F also resulted in decreased NO3- + NO2- levels and increased NH4+ levels in soils. CH3F did not affect patterns of dissimilatory nitrate reduction to ammonia in cell suspensions of a nitrate- respiring bacterium, nor did it affect N2O metabolism in denitrifying soils. CH3F and DME will be useful in discriminating N2O production via nitrification and denitrification when both processes occur and in decoupling these processes by blocking NO2- and NO3- production.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Jayasundera, Anil C.A.; Goff, Richard J.; Li Yang
2010-02-15
The solvothermal syntheses and crystal structures of three indium fluorides are presented. K{sub 5}In{sub 3}F{sub 14} (1) and beta-(NH{sub 4}){sub 3}InF{sub 6} (2) are variants on known inorganic structure types chiolite and cryolite, respectively, with the latter exhibiting a complex and apparently novel structural distortion. [NH{sub 4}]{sub 3}[C{sub 6}H{sub 21}N{sub 4}]{sub 2}[In{sub 4}F{sub 21}] (3) represents a new hybrid composition displaying a unique trimeric metal fluoride building unit. - Graphical abstract: Solvothermal synthesis has been used to prepare three indium fluorides, including a novel hybrid material containing a unique [In{sub 3}F{sub 15}] trimer templated by tren.
NASA Astrophysics Data System (ADS)
Rani, Rozina Abdul; Zoolfakar, Ahmad Sabirin; Alrokayan, Salman; Khan, Haseeb; Rusop, M.
2018-05-01
In this paper, synthesis of the hydrothermal based etching process of niobium oxide (Nb2O5) films and their reflectance properties are presented. The concentration of etching agent, which is ammonium fluoride (NH4F) in the hydrothermal solution as well as the grain size and the annealing condition have significantly affected the reflectance properties of Nb2O5 films. Films that synthesized in 1.65M of NH4F solution showed the lowest percentage of reflectance value of 3.22% at 222 nm. The obtained reflectance results have shown that this kind of Nb2O5 films is very suitable for anti-reflective coating layer and UV sensor application.
NASA Astrophysics Data System (ADS)
Tereshchenko, D. S.; Morozov, I. V.; Boltalin, A. I.; Karpova, E. V.; Glazunova, T. Yu.; Troyanov, S. I.
2013-01-01
A series of fluoro(trifluoroacetato)metallates were synthesized by crystallization from solutions in trifluoroacetic acid containing nickel(II) or cobalt(II) nitrate hydrates and alkali metal or ammonium fluorides: Li[Ni3(μ3-F)(CF3COO)6(CF3COOH)3](CF3COOH)3 ( I), M'[Ni3(μ3-F)(CF3COO)6(CF3COOH)3] ( M' = Na ( II), NH4 ( IV), Rb ( V), and Cs ( VI)), NH4[Co3(μ3-F) (CF3COO)6(CF3COOH)3] ( III), and Cs[Ni3(μ3-F)(CF3COO)6(CF3COOH)3](CF3COOH)0.5 ( VII). The crystal structures of these compounds were determined by single-crystal X-ray diffraction. All structures contain triangular trinuclear complex anions [ M 3″(μ3-F)(CF3COO)6(CF3COOH)3]- ( M″ = Ni, Co) structurally similar to trinuclear 3d metal oxo carboxylate complexes. The three-coordinated F atom is located at the center of the triangle formed by Ni(II) or Co(II) atoms. The metal atoms are linked in pairs by six bridging trifluoroacetate groups located above and below the plane of the [ M″3 F] triangle. The oxygen atoms of the axial CF3COOH molecules complete the coordination environment of M″ atoms to an octahedron.
An easy access to nanocrystalline alkaline earth metal fluorides - just by shaking
NASA Astrophysics Data System (ADS)
Dreger, M.; Scholz, G.; Kemnitz, E.
2012-04-01
High energy ball milling as fast, direct and solvent free method allows an easy access to nanocrystalline alkaline earth metal fluorides MF2 (M: Mg, Ca, Sr, Ba). Comparable metal sources (acetates, carbonates, hydroxides, alkoxides) were used for the reaction with NH4F as fluorinating agent. Even very simple manual shaking experiments between NH4F and the corresponding hydroxides in the stoichiometric ratio (M:F = 1:2, M: Ca, Sr, Ba) give phase pure fluorides. Moreover, comparable classical thermal reactions in closed crucibles at higher temperatures provide phase pure crystalline fluorides in nearly all cases as well.
Fourier transform infrared study of the phase transitions in (NH4)3VO2FO4
NASA Astrophysics Data System (ADS)
de Waal, D.; Heyns, A. M.
1994-01-01
Ammonium oxofluorovanadate compounds are known to show some potential as ferroelectric materials. The whole series of ammonium and sodium oxofluorovanadate compounds including Na3VO2F4 have already been prepared and investigated by means of various techniques including x-ray diffraction, EPR, and vibrational spectroscopy. It was established that the pure ammonium compound shows the two above mentioned transitions from phase A (below 200 K) to phase B (between 200 and 400 K) and phase C (above 400 K) while Na(NH4)2VO2F4 has only one transition from phase A to phase B around 400 K4. In the present study various aspects regarding the nature of the structures of (NH4)3VO2F3 and Na(NH4)2VO2F4 and its influence on the phase transitions have been investigated.
NiCo2O4 particles with diamond-shaped hexahedron structure for high-performance supercapacitors
NASA Astrophysics Data System (ADS)
Li, Yanfang; Hou, Xiaojuan; Zhang, Zengxing; Hai, Zhenyin; Xu, Hongyan; Cui, Danfeng; Zhuiykov, Serge; Xue, Chenyang
2018-04-01
Nickel cobalt oxide (NiCo2O4) particles with a diamond-shaped hexahedral porous sheet structure are successfully synthesized by a facile hydrothermal method, followed by calcination in one step. NiCo2O4-I and NiCo2O4-II particles are prepared using the same method with different contents of urea (CO(NH2)2) and ammonium fluoride (NH4F). The different morphologies of the NiCo2O4-I and NiCo2O4-II particles illustrate that CO(NH2)2 and NH4F play an important role in crystal growth. To verify the influence of NH4F and CO(NH2)2 on the morphology of the NiCo2O4 particles, the theory of crystal growth morphology is analyzed. The electrochemical measurements show that NiCo2O4 particles exhibit a high specific capacitance. At a current density of 1.0 mA cm-2, the mass specific capacitances of the NiCo2O4-I and NiCo2O4-II electrodes are 690.75 and 1710.9 F g-1, respectively, in a 6 M KOH aqueous electrolyte. The specific capacitances of the NiCo2O4-I and NiCo2O4-II electrodes remain ∼95.95% and ∼70.58% of the initial capacitance values after 5000 cycles, respectively. According to the two-electrode test, the NiCo2O4-II//AC asymmetric electrodes exhibited an ultrahigh energy density of 64.67 Wh kg-1 at the power density of 12 kW kg-1, demonstrating its excellent application potential as an electrode material for supercapacitors.
Stability and cellular responses to fluorapatite-collagen composites.
Yoon, Byung-Ho; Kim, Hae-Won; Lee, Su-Hee; Bae, Chang-Jun; Koh, Young-Hag; Kong, Young-Min; Kim, Hyoun-Ee
2005-06-01
Fluorapatite (FA)-collagen composites were synthesized via a biomimetic coprecipitation method in order to improve the structural stability and cellular responses. Different amounts of ammonium fluoride (NH4F), acting as a fluorine source for FA, were added to the precipitation of the composites. The precipitated composites were freeze-dried and isostatically pressed in a dense body. The added fluorine was incorporated nearly fully into the apatite structure (fluoridation), and a near stoichiometric FA-collagen composite was obtained with complete fluoridation. The freeze-dried composites had a typical biomimetic network, consisting of collagen fibers and precipitates of nano-sized apatite crystals. The human osteoblast-like cells on the FA-collagen composites exhibited significantly higher proliferation and differentiation (according to alkaline phosphatase activity) than those on the hydroxyapatite-collagen composite. These enhanced osteoblastic cell responses were attributed to the fluorine release and the reduced dissolution rate.
An effective method for the preparation of high temperature stable anatase TiO2 photocatalysts
NASA Astrophysics Data System (ADS)
Fagan, Rachel; Synnott, Damian W.; McCormack, Declan E.; Pillai, Suresh C.
2016-05-01
An efficient, rapid and straightforward method for the preparation of nitrogen and fluorine (N, F) codoped high temperature stable anatase using a microwave pre-treatment is reported. Using a single source, ammonium fluoride (NH4F) for both nitrogen and fluorine, effective doping of the precursor titanium isopropoxide (TTIP) was possible. These samples were characterised for their structural and optical properties using X-ray diffraction (XRD), Fourier Transform IR (FTIR), Raman spectroscopy and UV-vis spectroscopy. In terms of the anatase to rutile transition enhancement using a novel microwave assisted technique, the sample prepared in a composition of 1:8 TiO2: NH4F at 1200 °C was seen to be most effective, having stable anatase present at 57.1% compared to undoped TiO2 being 100% rutile from 900 °C. This method involves the production of ammonium oxofluorotitanates (NH4TiOF3) at low temperatures. The inclusion of these intermediates greatly reduces the particle size growth and delays the anatase to rutile transition. The photocatalytic activity of these materials was studied by analysing the degradation of an organic dye, rhodamine 6G as a model system and the rate constant was calculated by pseudo-first-order kinetics. These results showed that the doped sample (0.0225 min-1) was three times more active than the undoped sample (0.0076 min-1) and over seven times faster than the commercial TiO2 photocatalyst standard Degussa P-25 calcined at 1200 °C (0.0030 min-1). The formation of intermediate compounds, oxofluorotitanates, was identified as the major reason for a delay in the anatase to rutile transition.
Products and kinetics of the liquid-phase reaction of glyoxal catalyzed by ammonium ions (NH4(+)).
Nozière, Barbara; Dziedzic, Pawel; Córdova, Armando
2009-01-08
Glyoxal, a common atmospheric gas, has been reported to be depleted in some regions of the atmosphere. The corresponding sink could be accounted for by reactions in or at the surface of atmospheric particles, but these reactions were not identified. Recently, we showed that inorganic ammonium ions, NH(4)(+), are efficient catalysts for reactions of carbonyl compounds, including glyoxal, in the liquid phase. To determine whether ammonium-catalyzed reactions can contribute to depletion of glyoxal in the atmosphere, the reactivity of this compound in aqueous solutions containing ammonium salts (ammonium sulfate, chloride, fluoride, and phosphate) at 298 K has been studied. The products identified by LC-HRMS and UV absorption revealed a mechanism involving two distinct pathways: a Bronsted acid pathway and an iminium pathway. The kinetics of the iminium pathway was studied by monitoring formation of a specific product. This pathway was second order in glyoxal in most of the solutions studied and should therefore be second order in most ammonium-containing aerosols in the atmosphere. The corresponding rate constant, k(II) (M(-1) s(-1)), increased strongly with ammonium ion activity, a(NH(4)(+)), and pH: k(II) (M(-1) s(-1)) = (2 +/- 1) x 10(-10) exp((1.5 +/- 0.8)aNH(4)(+)) exp((2.5 +/- 0.2)pH). This iminium pathway is a lower limit for the ammonium-catalyzed consumption of glyoxal, but the contribution of the acid pathway is expected to be small in tropospheric aerosols. With these results the reactive uptake of glyoxal on ammonium-containing aerosols was estimated and shown to be a possible explanation for depletion of this compound in Mexico City.
NASA Astrophysics Data System (ADS)
Li, Shou-Yi; Wang, Jian; Li, Yan
2017-06-01
Highly ordered anodic aluminum oxide (AAO) membranes are fabricated electrochemically in an electrolyte mixture with various concentrations of C2H2O4 or NH4F. Photoluminescence (PL) properties of AAO membranes have been investigated before and after annealing in the range from 300°C to 650°C. X-ray diffraction reveals the amorphous nature of AAO membranes. Energy dispersive spectroscopy indicates the presence of fluorine species incorporated in oxide membranes during the anodizing. PL measurements show a strong PL band in the wavelength range of 350 to 550 nm. With the increase of the concentration of the NH4F or C2H2O4 in the electrolyte mixture, the peak positions of the PL bands have a blueshift or redshift and the intensities have a maximum value. As indicated by the PL excitation spectra, there are two excitation peaks of 285 and 330 nm, which can account for the PL emission band. We have proposed that the PL originates from optical transitions in two kinds of centers that are related to oxygen vacancies, F+ (285 nm) and F (330 nm). This work is not only beneficial to further understanding of the light-emitting property of AAO membranes but also enlarges the application scope.
Li, Long; Ji, Yuzhuo; Tang, Xinjing
2014-10-21
Highly selective and sensitive fluorescent probes with a quaternary ammonium moiety have been rationally designed and developed for fast and sensitive fluorescence detection of fluoride ion (F(-) from NaF, not TBAF) in aqueous solution and living cells. With the sequestration effect of quaternary ammonium, the detection time was less than 2 min and the detection limit of fluoride ion was as low as 0.57 ppm that is among the lowest detection limits in aqueous solutions of many fluoride fluorescence probes in the literature.
Thermal, optical, and dielectric properties of fluoride Rb2TaF7
NASA Astrophysics Data System (ADS)
Pogorel'tsev, E. I.; Mel'nikova, S. V.; Kartashev, A. V.; Gorev, M. V.; Flerov, I. N.; Laptash, N. M.
2017-05-01
The thermal, optical, and dielectric properties of fluoride Rb2TaF7 were investigated. It was observed that the variation in chemical pressure in fluorides A 2 +TaF7 caused by the cation substitution of rubidium for ammonium does not affect the ferroelastic nature of structural distortions, but leads to stabilization of the high- and low-temperature phases and enhancement of birefringence. The entropy of the phase transition P4/nmm ↔ Cmma is typical of the shift transformations, which is consistent with a model of the initial and distorted phase structures. The anisotropy of chemical pressure causes the change of signs of the anomalous strain and baric coefficient dT/ dp of Rb2TaF7 as compared with the values for its ammonium analog.
Gerasimova, Yu V; Oreshonkov, A S; Laptash, N M; Vtyurin, A N; Krylov, A S; Shestakov, N P; Ershov, A A; Kocharova, A G
2017-04-05
Two ammonium oxofluorovanadates, (NH 4 ) 3 VO 2 F 4 and (NH 4 ) 3 VOF 5 , have been investigated by temperature-dependent infrared and Raman spectroscopy methods to determine the nature of phase transitions (PT) in these compounds. Dynamics of quasioctahedral groups was simulated within the framework of semi-empirical approach, which justified the cis-conformation of VO 2 F 4 3- (C 2v ) and the C 4v geometry of VOF 5 3- . The observed infrared and Raman spectra of both compounds at room temperature (RT) revealed the presence at least of two crystallographically independent octahedral groups. The first order PT at elevated temperatures is connected with a complete dynamic disordering of these groups with only single octahedral state. At lower temperatures, the octahedra are ordered and several octahedral states appear. This PT is the most pronounced in the case of (NH 4 ) 3 VOF 5 , when at least seven independent VOF 5 3- octahedra are present in the structure below 50K, in accordance with the Raman spectra. Ammonium groups do not take part in PTs at higher and room temperatures but their reorientational motion freezes at lower temperatures. Copyright © 2017. Published by Elsevier B.V.
Phase transitions in (NH4)2MoO2F4 crystal
NASA Astrophysics Data System (ADS)
Krylov, Alexander; Laptash, Natalia; Vtyurin, Alexander; Krylova, Svetlana
2016-11-01
The mechanisms of temperature and high pressure phase transitions have been studied by Raman spectroscopy. Room temperature (295 K) experiments under high hydrostatic pressure up to 3.6 GPa for (NH4)2 MoO2 F4 have been carried out. Experimental data indicates a phase transition into a new high-pressure phase for (NH4)2 MoO2 F4 at 1.2 GPa. This phase transition is related to the ordering anion octahedron groups [MoO2 F4]2- and is not associated with ammonium group. Raman spectra of small non-oriented crystals ranging from 10 to 350 K have been observed. The experiment shows anion groups [MoO2 F4]2- and ammonium in high temperature phase are disordered. The phase transition at T1 = 269.8 K is of the first-order, close to the tricritical point. The first temperature phase transition is related to the ordering anion octahedron groups [MoO2 F4]2-. Second phase transitions T2 = 180 K are associated with the ordering of ammonium. The data presented within this study demonstrate that 2D correlation analysis combined with traditional Raman spectroscopy are powerful tool to study phase transitions in the crystals.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Sandineni, Prashanth; Yaghoobnejad Asl, Hooman; Choudhury, Amitava, E-mail: choudhurya@mst.edu
Highly crystalline sodium and ammonium Jarosites, NaFe{sub 3}(SO{sub 4}){sub 2}(OH){sub 6} and NH{sub 4}Fe{sub 3}(SO{sub 4}){sub 2}(OH){sub 6}, have been synthesized employing hydrothermal synthesis routes. The structures consist of anionic layers of vertex-sharing FeO{sub 6} octahedra and SO{sub 4} tetrahedral units with interlayer space occupied by Na and ammonium ions, respectively. The corner-sharing FeO{sub 6} octahedral units form six and three rings similar to hexagonal tungsten bronze sheets also known as kagomé lattice. These sodium and ammonium Jarosites are thermally stable up to 400 °C and undergo facile electrochemical lithium insertion through the reduction of Fe{sup 3+} to Fe{sup 2+}.more » Galvanostatic charge–discharge indicates that up to 2.25 and 2 lithium ions per formula unit can be inserted at an average voltage of 2.49 and 2.26 V to the sodium and the ammonium Jarosites, respectively, under slow discharge rate of C/50. The cycle-life and experimental achievable capacity show strong dependence on particle sizes and synthesis conditions. A small amount of fluoride substitution improves both achievable capacity and average voltage. - Graphical abstract: Discharge capacity of jarosite phases as a function of particle size and fluoride substitution. - Highlights: • Synthesis of natro- and ammonium Jarosites. • Jarosites as cathodes for lithium ion batteries. • Li-ion electrochemistry of Jarosites. • Mössbauer spectroscopy of Jarosites.« less
Investigation of the Phase Stabilizing Effect of Potassium Fluoride on Ammonium Nitrate
1989-07-01
fit? FE CP R+bD S&1:,C)4-0i Investigation of the Phase Stabilizing Effect of Potassium Fluoride on Ammonium Nitrate Re-f.-: R& D # 5955-CH-OX...Distribution I Series KF 220988 Humide Amonium Nitrate AvaIldbII~ty Codes Avail arid i or Dist Special 3. DISCUSSION 4. SUMMARY 5. APPENDIX Io. . 1...the participating phases. The system was used to investigate the phase properties of amonium nitrate samples, which were melted with 2 weight % of
Ammonium boranes for the selective complexation of cyanide or fluoride ions in water.
Hudnall, Todd W; Gabbaï, François P
2007-10-03
With the recognition of aqueous fluoride and cyanide ions as an objective, we have investigated the anion binding properties of two isomeric ammonium boranes, namely [p-(Mes2B)C6H4(NMe3)]+ ([1]+) and [o-(Mes2B)C6H4(NMe3)]+ ([2]+). These cationic boranes, which could be obtained by reaction of the known 4- and 2-dimesitylboryl-N,N-dimethylaniline with MeOTf, have been investigated both experimentally and computationally. They both react with fluoride and cyanide ions in organic solvents to afford the corresponding fluoroborate/ or cyanoborate/ammonium zwitterions 1F, 1CN, 2F, and 2CN. In aqueous solution, however, these cationic boranes behave as remarkably selective receptors. Indeed, [1]+ only complexes cyanide ions while [2]+ only complexes fluoride ions. In H2O/DMSO 60:40 vol (HEPES 6 mM, pH 7), the cyanide binding constant of [1]+ and the fluoride binding constant of [2]+ are respectively equal to 3.9 (+/-0.1) x 108 and 910 (+/-50) M-1. Structural and computational studies indicate that both steric and electronic effects contribute to the unusual selectivity displayed by these cationic boranes. Owing to favorable Coulombic effects, the para-derivative [1]+ has a very high affinity for cyanide; yet these effects are not sufficiently intense to allow complexation of the more efficiently hydrated and less basic fluoride anion. In the case of the ortho-derivative [2]+, the proximity of the ammonium moiety leads to an increase in the Lewis acidity of the boron center thus making fluoride binding possible. However, steric effects prevent cyanide coordination to the boron center of [2]+. Finally, cation [1]+ and [2]+ bind their dedicated anions reversibly and show a negligible response in the presence of other common anions including Cl-, Br-, I-, NO3-, OAc-, H2PO4-, and HSO4-.
Nucleophilic fluorination of aromatic compounds
Satyamurthy, Nagichettiar; Barrio, Jorge R
2014-03-18
Iodylbenzene derivatives substituted with electron donating as well as electron withdrawing groups on the aromatic ring are used as precursors in aromatic nucleophilic substitution reactions. The iodyl group (IO.sub.2) is regiospecifically substituted by nucleophilic fluoride to provide the corresponding fluoroaryl derivatives. No-carrier-added [F-18]fluoride ion derived from anhydrous [F-18](F/Kryptofix, [F-18]CsF or a quaternary ammonium fluoride (e.g., Me.sub.4NF, Et.sub.4NF, n-Bu.sub.4NF, (PhCH.sub.2).sub.4NF) exclusively substitutes the iodyl moiety in these derivatives and provides high specific activity F-18 labeled fluoroaryl analogs. Iodyl derivatives of a benzothiazole analog and 6-iodyl-L-dopa derivatives have been synthesized as precursors and have been used in the preparation of no-carrier-added [F-18]fluorobenzothiazole as well as 6-[F-18]fluoro-L-dopa.
The effect of fluoride on the crystallinity and photoactivity of titanium dioxide
NASA Astrophysics Data System (ADS)
Brauer, Jonathan Isaac
This dissertation describes the synthesis and characterization of fluorinated N-doped TiO2 nanoparticles under ambient conditions. Samples were synthesized by sol-gel methods that utilized the controlled hydrolysis of titanium(IV) tetra-isopropoxide in acidic solutions. Nitrogen doping was achieved by two different methods. In one scheme triethylamine (TEA) was added post-synthesis to the nanoparticle formation. In the other scheme, ammonium chloride (NH 4Cl) was added during the acid catalyzed hydrolysis reaction. A freeze-drying process of the sol-gel was used to prevent aggregation during dehydration and was found to retain the high surface area of the powder. Post-synthesis the hydroxyl groups on the surface were exchanged with fluoride by stirring the powders in acidic solution of NaF. Using this synthetic approach the amount of nitrogen and fluoride could be independently controlled. The nanoparticles were characterized by numerous spectroscopic techniques including DRS, FTIR, Raman, and XPS. Vibrational spectroscopy shows that the particles contain significant amounts of organic impurities after doping with TEA. In contrast, particles synthesized with NH4Cl showed much less contamination. XPS analysis revealed that a single nitrogen species with a binding energy of 400.6 eV when using TEA as the N precursor. In contrast, when NH4 Cl was used as the nitrogen precursor two nitrogen species were observed with binding energies at 402.6 and 401.2 eV. These latter peaks are assigned to interstitial nitrogen in the N1+ and N0 oxidation states. The as-synthesized nanoparticles also show a significant differences in their optical properties. In general, the particles doped from TEA and NH4Cl were yellow and white, respectively, despite containing approximately the same amount of nitrogen (~5% with respect to Ti). The difference is attributed to a high fraction of oxygen-vacancies in the TEA doped nanoparticles. XRD and Raman measurements determined that the as-synthesized samples were amorphous, but could be converted to the anatase phase by two different methods. Thermal annealing was shown to convert the amorphous particles to the anatase polymorph. The presence of surface fluoride was found to significantly lower the temperature to observe the amorphous to anatase transition. In the second method, stirring the powders in acidic solutions of NaF at room temperature for 12-168 hours produced the anatase phase with an average crystallite size of 4 nm. It was found that the phase transition only occurs when the pH is below the point of zero charge of the particles. The photoactivity of the nitrogen and nitrogen / fluoride-doped particles was tested for their ability to degrade methylene blue (MB) with visible light (> 400 nm). In general the particles with a surface fluoride were more photoactive that those without. In addition, particles with nitrogen were more photoactive than pure TiO2. By analyzing the decomposition products with electrospray ionization mass spectrometry and UV-Vis spectroscopy, it was possible to elucidate a different decomposition pathway for the nitrogen-doped samples. When TEA was the dopant precursor, MB primarily decomposed by a ring-cleavage pathway using superoxide. In contrast, when NH4Cl was the dopant precursor, MB decomposed through demethylation pathway induced by hydroxyl radicals. The as-synthesized particles were found to be more photoactive those thermally annealed. The loss of photoactivity could be ascribed to two main factors: (1) loss of nitrogen and fluoride and (2) loss of surface area by sintering.
Lin, Kun-Yi Andrew; Liu, Yu-Ting; Chen, Shen-Yi
2016-01-01
To provide safe drinking water, fluoride in water must be removed and adsorption processes appear to be the most widely used method. Metal organic frameworks (MOFs) represent a new class of adsorbents that have been used in various adsorption applications. To study the adsorption mechanism of fluoride to MOFs in water and obtain related adsorption parameters, we synthesized a zirconium-based MOF with a primary amine group on its ligand, named UiO-66-NH2. The kinetics, adsorption isotherm and thermodynamics of fluoride adsorption to UiO-66-NH2 were investigated. The crystalline structure of UiO-66-NH2 remained intact and the local structure of zirconium in UiO-66-NH2 did not change significantly after being exposed to fluoride. The kinetics of the fluoride adsorption in UiO-66-NH2 could be well represented by the pseudo second order rate law. The enthalpy of the adsorption indicates that the F(-) adsorption to UiO-66-NH2 was classified as a physical adsorption. However, the comparison between the adsorption capacities of UiO-66-NH2 and UiO-66 suggests that the fluoride adsorption to UiO-66-NH2 might primarily involve a strong interaction between F(-) and the metal site. The fluoride adsorption capacity of UiO-66-NH2 was found to decrease when pH>7. While the presence of chloride/bromide ions did not noticeably change the adsorption capacity of UiO-66-NH2, the ionic surfactants slightly affected the adsorption capacity of UiO-66-NH2. These findings provide insights to further optimize the adsorption process for removal of fluoride using zirconium-based MOFs. Copyright © 2015 Elsevier Inc. All rights reserved.
URANIUM RECOVERY FROM COMPOSITE UF$sub 4$ REDUCTION BOMB WASTES
DOE Office of Scientific and Technical Information (OSTI.GOV)
Johnson, E R; Doyle, R L; Coleman, J R
1954-01-28
A number of techniques have been investigated on a laboratory-scale for separating uranium from fluorides during the recovery of uranium from UF4 reduction bomb wastes (C-oxide) by an HCl leach - NH4OH precipitation process. Among these are included adsorption of fluorides from filtered leach liquors, fractional precipitation of fluorides and uranium, complexing of fluorides into forms soluble in slightly acid solutions, and fluoride volatilization from the uranium concentrate. Solubility studies of CaF2 and MgF2 in aqueous hydrochloric acid at various acidities and temperatures were also conducted. A description of the production-scale processing of C-oxide in the FMPC scrap plant hasmore » been included.« less
NASA Astrophysics Data System (ADS)
Sahlan, Muhamad; Prakoso, Chandra Dwi; Darwita, Risqa Rina; Hermansyah, Heri
2017-02-01
Topical fluoride is proven to have higher efficacy in preventing dental caries with low production cost and easy to apply. The objective of this research is to formulate alternative agent topical fluoride NH4F 5% mixed with extract ethanol propolis (EEP) in the micro-emulsion system that has high stability, antimicrobial activity, and remineralization capability to arrest teeth caries activity. By using total plate count (TPC) analysis, formulation 2.7% EEP; 6,3% surfactant; and 90,9% NH4F shows good perform to inhibit cariogenic bacteria development around 78-80%. Scanning Electron Microscopy (SEM) and Energy Dispersive X-Ray (EDX) result also showed that sample successfully remineralized enamel surface. In addition, sample showed good pH, flavonoid, and polyphenol stability for 40 days.
NASA Astrophysics Data System (ADS)
Jo, Vinna; Woo Lee, Dong; Koo, Hyun-Joo; Ok, Kang Min
2011-04-01
Three new uni-dimensional alkali metal titanium fluoride materials, A2TiF 5· nH 2O ( A=K, Rb, or Cs; n=0 or 1) have been synthesized by hydrothermal reactions. The structures of A2TiF 5· nH 2O have been determined by single-crystal X-ray diffraction. The Ti 4+ cations have been reduced to Ti 3+ during the synthesis reactions. All three A2TiF 5· nH 2O materials contain novel 1-D chain structures that are composed of the slightly distorted Ti 3+F 6 corner-sharing octahedra attributable to the Jahn-Teller distortion. The coordination environment of the alkali metal cations plays an important role to determine the degree of turning in the chain structures. Complete structural analyses, Infrared and UV-vis diffuse reflectance spectra, and thermal analyses are presented, as are electronic structure calculations.
Yan, Mi; Qi, Zhifu; Yang, Jie; Li, Xiaodong; Ren, Jianli; Xu, Zhang
2014-11-01
The effect of ammonium sulfate ((NH4)2SO4) and urea (CO(NH2)2) on polychlorinated dibenzo-p-dioxin and dibenzofuran (PCDD/F) formation from active carbon was investigated in this study. Both additives could significantly inhibit PCDD/F formation, and PCDD/F (TEQ) generation was reduced to 98.5% (98%) or 64.5% (77.2%) after 5% (NH4)2SO4 or CO(NH2)2 was added into model ash, respectively. The inhibition efficiency of PCDDs was higher than the value of PCDFs, however, the reduction of PCDD/F yield was mainly from PCDFs decreasing. In addition, the solid-phase products were reduced more than the gas-phase compounds by inhibitors. By the measurement of chlorine emission in the phase of ion (Cl[Cl(-)]) and molecule gas (Cl[Cl2]), it was observed that both Cl[Cl(-)] and Cl[Cl2] were reduced after inhibitors were added into ash. Cl[Cl2] was reduced to 51.0% by urea addition, which was supposed as one possible mechanism of PCDD/F inhibition. Copyright © 2014. Published by Elsevier B.V.
NASA Astrophysics Data System (ADS)
Yusuf, Gbadebo; Khalilzadeh-Rezaie, Farnood; Cleary, Justin W.; Oladeji, Isaiah O.; Suu, Koukou; Schoenfeld, Winston V.; Peale, Robert E.; Awodugba, Ayodeji O.
2015-04-01
This work investigated the characteristics of SnO2: F films grown by Streaming Process for Electrodeless Electrochemical Deposition (SPEED). Stannic chloride (SnCl4) and ammonium fluoride (NH4 F) was dissolved in a mixture of deionized water and organic solvents. The preheated substrate temperature was varied between 450 and 530° C. High quality SnO2: F films were grown at all the substrate temperatures studied. The typical film thickness was 250 nm. XRD shows that the grown films are polycrystalline SnO2 with a tetragonal crystal structure. The average optical transmission of the films was around 93% throughout the wavelength of 400 to 1000 nm. The lowest electrical resistivity achieved was 6 x 10-4 Ω cm. The Hall measurements showed that the film is an n-type semiconductor, with the highest carrier mobility of 8.3 cm2/V.s, and concentration of 1 x 1021 cm-3. The direct band gap was determined to be 4 eV from the transmittance spectrum.
“Low Cost” Pore Expanded SBA-15 Functionalized with Amine Groups Applied to CO2 Adsorption
Vilarrasa-García, Enrique; Cecilia, Juan Antonio; Ortigosa Moya, Elisa Maria; Cavalcante, Celio Loureiro; Azevedo, Diana Cristina Silva; Rodríguez-Castellón, Enrique
2015-01-01
The CO2 adsorption capacity of different functionalized mesoporous silicas of the SBA-15 type was investigated and the influence of textural properties and the effect of the silicon source on the CO2 uptake studied. Several adsorbents based on SBA-15 were synthesized using sodium silicate as silicon source, replacing the commonly used tetraethyl orthosilicate (TEOS). Thus, we synthesized three couples of supports, two at room temperature (RT, RT-F), two hydrothermal (HT, HT-F) and two hydrothermal with addition of swelling agent (1,3,5-triisopropylbenzene) (TiPB, TiPB-F). Within each couple, one of the materials was synthesized with ammonium fluoride (NH4F). The supports were functionalized via grafting 3-aminopropyltriethoxysilane (APTES) and via impregnation with polyethylenimine ethylenediamine branched (PEI). The adsorption behavior of the pure materials was described well by the Langmuir model, whereas for the amine-silicas, a Dualsite Langmuir model was applied, which allowed us to qualify and quantify two different adsorption sites. Among the materials synthesized, only the SBA-15 synthesized at room temperatures (RT) improved its properties as an adsorbent with the addition of fluoride when the silicas were functionalized with APTES. The most promising result was the TiPB-F/50PEI silica which at 75 °C and 1 bar CO2 captured 2.21 mmol/g.
NASA Astrophysics Data System (ADS)
Najafi, Navid; Rozati, S. M.
2018-03-01
Fluorine-doped zinc oxide (FZO) (ZnO:F) thin films were manufactured by atmospheric pressure chemical vapor deposition (APCVD) on glass substrates using zinc acetate dihydrate [C4H6O4Zn·2H2O, ZnAc] and ammonium fluoride (NH4F) as the source of fluorine with deposition duration of only 120 s for each sample. The effects of different amounts of fluorine as the dopant on the structural, electrical and optical properties of FZO thin films were investigated. The results show a polycrystalline structure at higher temperatures compared to amorphous structure at lower temperatures. The x-ray diffraction patterns of the polycrystalline films were identified as a hexagonal wurtzite structure of zinc oxide (ZnO) with the (002) preferred orientation. Also, the sheet resistance decreased from 17.8 MΩ/□ to 28.9 KΩ/□ for temperatures 325°C to 450°C, respectively. In order to further decrease the sheet resistance of the undoped ZnO thin films, fluorine was added using NH4F as the precursor, and again a drastic change in sheet resistance of only 17.7 Ω/□ was obtained. Based on the field emission scanning electron microscopy images, the fluorine concentration in CVD source is an important factor affecting the grain size and modifies electrical parameters. Ultraviolet-visible measurements revealed reduction of transparency of the layers with increasing fluorine as the dopant.
Inelastic Neutron Scattering Study of the Specific Features of the Phase Transitions in (NH4)2WO2F4
DOE Office of Scientific and Technical Information (OSTI.GOV)
Smirnov, Lev S; Kolesnikov, Alexander I; Flerov, I. N.
2009-01-01
Oxyfluoride (NH4)2WO2F4 has been studied by the inelastic neutron scattering method over a wide temperature range 10 300 K at two initial neutron energies of 15 and 60 meV. The role of tetrahedral ammonium groups in the mechanism of sequential phase transitions at T1 = 201 K and T2 = 160 K has been discussed.
Chromium chains as polydentate fluoride ligands for actinides and group IV metals.
Leng, Ji-Dong; Kostopoulos, Andreas K; Isherwood, Liam H; Ariciu, Ana-Maria; Tuna, Floriana; Vitórica-Yrezábal, Iñigo J; Pritchard, Robin G; Whitehead, George F S; Timco, Grigore A; Mills, David P; Winpenny, Richard E P
2018-05-08
The reactions of {Cr6} horseshoe chains {[nPr2NH2]3[Cr6F11(O2CtBu)10]}2, 1 and precursors of actinides and group IV metals led to a series of ring complexes [nPr2NH2][Cr7TiF6O2(O2CtBu)16], 2, [nPr2NH2][Cr6Ti2F5O3(O2CtBu)16], 3, [Cr6ThF7(O2CtBu)15 (Me2SO)], 4, [(nPr2NH2)2(Cr6Th2F12(O2CtBu)16)], 5 and [nPr2NH2][Cr6U2O2F8(O2CtBu)16(Me2SO)], 6. X-ray structure studies indicate that the {Cr6} chains maintain their structures in these complexes, acting as polydentate fluoride ligands. Their static magnetic properties were measured and fitted by isotropic exchange Hamiltonian. In accordance with 1, the magnetic exchanges between CrIII are antiferromagnetic, while the exchange interactions can be modified by the tetravalent metals. For compound 6, ferromagnetic exchanges JCr-U and JU-U are obtained. EPR spectra of compounds 2-5 were measured at Q band and were simulated. The spectrum of 2 has the same profile as {Cr7Cd} and {Cr7Zn} rings with a ground state S = 3/2. 3, 4 and 5 give similar EPR spectra with S = 0 ground states.
Hydroxyapatite electrodeposition on anodized titanium nanotubes for orthopedic applications
NASA Astrophysics Data System (ADS)
Parcharoen, Yardnapar; Kajitvichyanukul, Puangrat; Sirivisoot, Sirinrath; Termsuksawad, Preecha
2014-08-01
Nanotubes modification for orthopedic implants has shown interesting biological performances (such as improving cell adhesion, cell differentiation, and enhancing osseointegration). The purpose of this study is to investigate effect of titanium dioxide (TiO2) nanotube feature on performance of hydroxyapatite-coated titanium (Ti) bone implants. TiO2 nanotubes were prepared by anodization using ammonium fluoride electrolyte (NH4F) with and without modifiers (PEG400 and Glycerol) at various potential forms, and times. After anodization, the nanotubes were subsequently annealed. TiO2 nanotubes were characterized by scanning electron microscope and X-ray diffractometer. The amorphous to anatase transformation due to annealing was observed. Smooth and highly organized TiO2 nanotubes were found when high viscous electrolyte, NH4F in glycerol, was used. Negative voltage (-4 V) during anodization was confirmed to increase nanotube thickness. Length of the TiO2 nanotubes was significantly increased by times. The TiO2 nanotube was electrodeposited with hydroxyapatite (HA) and its adhesion was estimated by adhesive tape test. The result showed that nanotubes with the tube length of 560 nm showed excellent adhesion. The coated HA were tested for biological test by live/dead cell straining. HA coated on TiO2 nanotubes showed higher cells density, higher live cells, and more spreading of MC3T3-E1 cells than that growing on titanium plate surface.
Swift adsorptive removal of Congo red from aqueous solution by K1.33Mn8O16 nanowires.
Wu, Junshu; Li, Hongyi; Wang, Jinshu; Li, Zhifei
2013-08-01
A swift and efficient approach to converting organic dye effluents into fresh water could be of substantial benefit. In this study, we presented facile hydrothermal synthesis of K1.33Mn8O16 nanowires in ammonium fluoride (NH4F) aqueous solution. The crystallization process of K1.33Mn8O16 nanowires was investigated. The as-obtained K1.33Mn8O16 nanowires were used for swift adsorptive removal of Congo red from aqueous solution without adjusting pH value at room temperature. Adsorption kinetic experimental data are well described by pseudo-second-order rate kinetic model, and the adsorption isotherm fits Langmuir isotherm model. The present investigation provides an efficient approach to designing and fabricating manganese-based nanomaterials for environmental remediation.
Gao, Wanlin; Wang, Qiang; Umar, Ahmad
2018-01-01
In this paper, we systematically investigated the influence of fluoride on the morphology and electrochemical property of Co3O4 nanostructures for hydrazine detection. The results showed that with the introduction of NH4F during the synthesis process of Co3O4, both Co(CO3)0.5(OH)·0.11H2O and Co(OH)F precursors would be generated. To understand the influence of F on the morphology and electrochemical property of Co3O4, three Co3O4 nanostructures that were respectively obtained from bare Co(CO3)0.5(OH)·0.11H2O, Co(OH)F and Co(CO3)0.5(OH)·0.11H2O mixtures and bare Co(OH)F were successfully synthesized. The electrochemical tests revealed the sensing performance of prepared Co3O4 nanostructures decreased with the increase in the fluoride contents of precursors. The more that dosages of NH4F were used, the higher crystallinity and smaller specific surface area of Co3O4 was gained. Among these three Co3O4 nanostructures, the Co3O4 that was obtained from bare Co(CO3)0.5(OH)·0.11H2O-based hydrazine sensor displayed the best performances, which exhibited a great sensitivity (32.42 μA·mM−1), a low detection limit (9.7 μΜ), and a wide linear range (0.010–2.380 mM), together with good selectivity, great reproducibility and longtime stability. To the best of our knowledge, it was revealed for the first time that the sensing performance of prepared Co3O4 nanostructures decreased with the increase in fluoride contents of precursors. PMID:29382161
Chen, Zhang-Gai; Huang, Xia; Zhuang, Rong-Chuan; Zhang, Yu; Liu, Xin; Shi, Tao; Wang, Shuai-Hua; Wu, Shao-Fan; Mi, Jin-Xiao; Huang, Ya-Xi
2017-09-12
Germanophosphates, in comparison with other metal phosphates, have been less studied but potentially exhibit more diverse structural chemistry with wide applications. Herein we applied a hydro-/solvo-fluorothermal route to make use of both the "tailor effect" of fluoride for the formation of low dimensional anionic clusters and the presence of alkali cations of different sizes to align the anionic clusters to control the overall crystal symmetries of germanophosphates. The synergetic effects of fluoride and alkali cations led to structural changes from chain-like structures to layered structures in a series of five novel fluorogermanophosphates: A 2 [GeF 2 (HPO 4 ) 2 ] (A = Na, K, Rb, NH 4 , and Cs, denoted as Na, K, Rb, NH4, and Cs). Although these fluorogermanophosphates have stoichiometrically equivalent formulas, they feature different anionic clusters, diverse structural dimensionalities, and contrasting crystal symmetries. Chain-like structures were observed for the compounds with the smaller sized alkali ions (Na + , K + , and Rb + ), whereas layered structures were found for those containing the larger sized cations ((NH 4 ) + and Cs + ). Specifically, monoclinic space groups were observed for the Na, K, Rb, and NH4 compounds, whereas a tetragonal space group P4/mbm was found for the Cs compound. These compounds provide new insights into the effects of cation sizes on the anionic clusters built from GeO 4 F 2 octahedra and HPO 4 tetrahedra as well as their influences on the overall structural symmetries in germanophosphates. Further characterization including IR spectroscopy and thermal analyses for all five compounds is also presented.
SEPARATION OF TRANSURANIC ELEMENTS FROM RARE EARTH COMPOUNDS
Kohman, T.P.
1961-11-21
A process of separating neptunium and plutonium values from rare earths and alkaline earth fission products present on a solid mixed actinide carrier (Th or U(IV) oxalate or fluoride) --fission product carrier (LaF/sub 3/, CeF/sub 3/, SrF/sub 2/, CaF/sub 2/, YF/sub 3/, La oxalate, cerous oxalate, Sr oxalate, Ca oxalate or Y oxalate) by extraction of the actinides at elevated temperature with a solution of ammonium fluoride and/or ammonium oxalate is described. Separation of the fission-product-containing carriers from the actinide solution formed and precipitation of the neptunium and plutonium from the solution with mineral acid are also accomplished. (AEC)
Udovenko, Anatoly; Laptash, Natalia
2015-08-01
Single crystals of tungsten double salt (NH4)3WO2F5 = (NH4)3[WO2F4]F have been synthesized by solid-state reaction or from fluoride solution and its crystal structures at 296 and 193 K were determined by X-ray diffraction. At room temperature, the crystal structure of the compound is dynamically disordered with the ligand atoms statistically distributed on two positions (6e and 24m) of the Pm3m unit cell [a = 6.0298 (1) Å], and the tungsten atom dynamically disordered on 12 orientations forming a spatial cuboctahedron [W12] that enables the real geometry of cis-WO2F4 octahedron to be determined with two short W-O distances. On cooling, the compound undergoes a first-order phase transition with the symmetry change Pm3m → Pa3 and a doubling of the unit-cell parameter [a = 11.9635 (7) Å]. The ligand F(O) atoms statistically occupy two general 24d sites and form W1X6 and W2X6 octahedra, in which the O and F atoms are not crystallographically different that means a static orientational disorder of (NH4)3WO2F5.
NASA Astrophysics Data System (ADS)
Kim, Eun-ah; Lee, Dong Woo; Ok, Kang Min
2012-11-01
The syntheses, structures, and characterization of organically templated zero-dimensional titanium fluoride materials, A2TiF6 (A[N(CH3)4] or [C(NH2)3]), are reported. Phase pure samples of A2TiF6 were synthesized by either solvothermal reaction method or a simple mixing method. While [N(CH3)4]2TiF6 crystallizes in a centrosymmetric space group, R-3, [C(NH2)3]2TiF6 crystallizes in a noncentrosymmetric polar space group, Cm. The asymmetric out-of-center distortion of TiF6 octahedra in polar [C(NH2)3]2TiF6 are attributable to the hydrogen-bonding interactions between the fluorine atoms in TiF6 octahedra and the nitrogen atoms in the [C(NH2)3]+ cation. Powder second-harmonic generation (SHG) measurements on the [C(NH2)3]2TiF6, using 1064 nm radiation, indicate the material has SHG efficiency of 25× that of α-SiO2, which indicates an average nonlinear optical susceptibility,
Ma, Xiaoling; Zhu, Changhua; Yang, Na; Gan, Lijun; Xia, Kai
2016-12-01
Excessive use of nitrogen (N) fertilizer has increased ammonium (NH 4 + ) accumulation in many paddy soils to levels that reduce rice vegetative biomass and yield. Based on studies of NH 4 + toxicity in rice (Oryza sativa, Nanjing 44) seedlings cultured in agar medium, we found that NH 4 + concentrations above 0.75 mM inhibited the growth of rice and caused NH 4 + accumulation in both shoots and roots. Use of excessive NH 4 + also induced rhizosphere acidification and inhibited the absorption of K, Ca, Mg, Fe and Zn in rice seedlings. Under excessive NH 4 + conditions, exogenous γ-aminobutyric acid (GABA) treatment limited NH 4 + accumulation in rice seedlings, reduced NH 4 + toxicity symptoms and promoted plant growth. GABA addition also reduced rhizosphere acidification and alleviated the inhibition of Ca, Mg, Fe and Zn absorption caused by excessive NH 4 + . Furthermore, we found that the activity of glutamine synthetase/NADH-glutamate synthase (GS; EC 6.3.1.2/NADH-GOGAT; EC1.4.1.14) in root increased gradually as the NH 4 + concentration increased. However, when the concentration of NH 4 + is more than 3 mM, GABA treatment inhibited NH 4 + -induced increases in GS/NADH-GOGAT activity. The inhibition of ammonium assimilation may restore the elongation of seminal rice roots repressed by high NH 4 + . These results suggest that mitigation of ammonium accumulation and assimilation is essential for GABA-dependent alleviation of ammonium toxicity in rice seedlings. © 2016 Scandinavian Plant Physiology Society.
NASA Astrophysics Data System (ADS)
Loan Nguyen, Thu; Dieu Thuy Ung, Thi; Liem Nguyen, Quang
2014-06-01
This paper reports on the fabrication of non-chapped, vertically well aligned titanium dioxide nanotubes (TONTs) by using electrochemical etching method and further heat treatment. Very highly ordered metallic titanium nanotubes (TNTs) were formed by directly anodizing titanium foil at room temperature in an electrolyte composed of ammonium fluoride (NH4F), ethylene glycol (EG), and water. The morphology of as-formed TNTs is greatly dependent on the applied voltage, NH4F content and etching time. Particularly, we have found two interesting points related to the formation of TNTs: (i) the smooth surface without chaps of the largely etched area was dependent on the crystalline orientation of the titanium foil; and (ii) by increasing the anodizing potential from 15 V to 20 V, the internal diameter of TNT was increased from about 50 nm to 60 nm and the tube density decreased from 403 tubes μm-2 down to 339 tubes μm-2, respectively. For the anodizing duration from 1 h to 5 h, the internal diameter of each TNT was increased from ˜30 nm to 60 nm and the tube density decreased from 496 tubes μm-2 down to 403 tubes μm-2. After annealing at 400 °C in open air for 1 h, the TNTs were transformed into TONTs in anatase structure; further annealing at 600 °C showed the structural transformation from anatase to rutile as determined by Raman scattering spectroscopy.
Response of biofilms-leaves of two submerged macrophytes to high ammonium.
Gong, Lixue; Zhang, Songhe; Chen, Deqiang; Liu, Kaihui; Lu, Jian
2018-02-01
Submerged macrophytes can provide attached surface for biofilms (known as periphyton) growth. In the present study, the alterations in biofilms formation, and chemical compositions and physiological responses were investigated on leaves of Vallisneria asiatica and Hydrilla verticillata exposed to 0.1 mg L -1 (control) or with 10 mg L -1 NH 4 + -N for 13 days. Results from physiological and biochemical indices (content of H 2 O 2 , malondialdehyde, total chlorophyll and activity of superoxide dismutase, catalase and peroxidase) showed that high ammonium caused oxidative damage to leaves of two species of plant. Multifractal analysis (based on scanning electron microscope images) showed that for the same plant, the values of width △α (△α = α max -α min ) of the f(α) and Δf (Δf = f(α min )-f(α max )) were smaller on leaves surface of two species of plant treated with 10 mg L -1 NH 4 + -N for 13 days than their controls, suggesting high ammonium treatments reduced morphological heterogeneity of leaf surface and enhanced area of the colony-like biofilms. X-ray photoelectron spectroscopy analysis showed that C, O, N and P were dominant elements on leaves surface of two species of plant and ammonium application increased the percentage of C but decreased that of O. High ammonium increased C1 (C-C or C-H) percentage but decreased C2 (C-O) and C3 (O-C-O or C=O) percentage on leaves surface of two species of plant, indicating that ammonium stress changed the surface chemical states and thus might reduce the capacity of leaves to adsorb nutrients from water column. Our results provided useful information to understand ammonium induced toxicity to submerged macrophytes. Copyright © 2017 Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Wang, Guangmei; Valldor, Martin; Mallick, Bert
Four open-framework transition-metal phosphates; (NH4)2Co3(HPO4)2F4 (1), (NH4)Co3(HPO4)2(H2PO4)F2 (2), KCo3(HPO4)2(H2PO4)F2 (3), and KFe3(HPO4)2(H2PO4)F2 (4); are prepared by ionothermal synthesis using pyridinium hexafluorophosphate as the ionic liquid. Single-crystal X-ray diffraction analyses reveal that the four compounds contain cobalt/iron–oxygen/fluoride layers with Kagomé topology composed of interlinked face-sharing MO3F3/MO4F2 octahedra. PO3OH pseudo-tetrahedral groups augment the [M3O6F4] (1)/[M3O8F2] layers on both sides to give M3(HPO4)2F4 (1) and M3(HPO4)2F2 (2–4) layers. These layers are stacked along the a axis in a sequence AA…, resulting in the formation of a layer structure for (NH4)2Co3(HPO4)2F4(1). In NH4Co3(HPO4)2(H2PO4)F2 and KM3(HPO4)2(H2PO4)F2, the M3(HPO4)2F2 layers are stacked along the a axismore » in a sequence AAi… and are connected by [PO3(OH)] tetrahedra, giving rise to a 3-D open framework structure with 10-ring channels along the [001] direction. The negative charges of the inorganic framework are balanced by K+/NH4+ ions located within the channels. The magnetic transition metal cations themselves form layers with stair-case Kagomé topology. Magnetic susceptibility and magnetization measurements reveal that all four compounds exhibit a canted anti-ferromagnetic ground state (Tc = 10 or 13 K for Co and Tc = 27 K for Fe) with different canting angles. The full orbital moment is observed for both Co2+ and Fe2+.« less
Liu, Fupin; Guan, Jian; Wei, Tao; Wang, Song; Jiao, Mingzhi; Yang, Shangfeng
2013-04-01
A series of nitrogen-containing inorganic solid compounds with variable oxidation states of nitrogen and counter ions have been successfully applied as new inorganic solid nitrogen sources toward the synthesis of Sc-based metal nitride clusterfullerenes (Sc-NCFs), including ammonium salts [(NH4)xH(3-x)PO4 (x = 0-2), (NH4)2SO4, (NH4)2CO3, NH4X (X = F, Cl), NH4SCN], thiocyanate (KSCN), nitrates (Cu(NO3)2, NaNO3), and nitrite (NaNO2). Among them, ammonium phosphates ((NH4)xH(3-x)PO4, x = 1-3) and ammonium thiocyanate (NH4SCN) are revealed to behave as better nitrogen sources than others, and the highest yield of Sc-NCFs is achieved when NH4SCN was used as a nitrogen source. The optimum molar ratio of Sc2O3:(NH4)3PO4·3H2O:C and Sc2O3:NH4SCN:C has been determined to be 1:2:15 and 1:3:15, respectively. The thermal decomposition products of these 12 inorganic compounds have been discussed in order to understand their different performances toward the synthesis of Sc-NCFs, and accordingly the dependence of the production yield of Sc-NCFs on the oxidation state of nitrogen and counter ion is interpreted. The yield of Sc3N@C80 (I(h) + D(5h)) per gram Sc2O3 by using the N2-based group of nitrogen sources (thiocyanate, nitrates, and nitrite) is overall much lower than those by using gaseous N2 and NH4SCN, indicating the strong dependence of the yield of Sc-NCFs on the oxidation state of nitrogen, which is attributed to the "in-situ" redox reaction taking place for the N2-based group of nitrogen sources during discharging. For NH3-based group of nitrogen sources (ammonium salts) which exhibits a (-3) oxidation states of nitrogen, their performance as nitrogen sources is found to be sensitively dependent on the anion, and this is understood by considering their difference on the thermal stability and/or decomposition rate. Contrarily, for the N2-based group of nitrogen sources, the formation of Sc-NCFs is independent to both the oxidation state of nitrogen (+3 or +5) and the cation.
Oxidation of ammonium sulfite by a multi-needle-to-plate gas phase pulsed corona discharge reactor
NASA Astrophysics Data System (ADS)
Ren, Hua; Lu, Na; Shang, Kefeng; Li, Jie; Wu, Yan
2013-03-01
The oxidation of ammonium sulfite in the ammonia-based flue gas desulfurization (FGD) process was investigated in a multi-needle-to-plate gas phase pulsed corona discharge reactor in this paper. The effect of several parameters, including capacitance and peak pulse voltage of discharge system, electrode gap and bubbling gas flow rate on the oxidation rate of ammonium sulfite was reviewed. The oxidation rate of ammonium sulfite could reach 47.2% at the capacitance, the peak pulse voltage, electrode gap and bubbling gas flow rate equal to 2 nF, -24.6 k V, 35 mm and 4 L min-1 within treatment time of 40 min The experimental results indicate that the gas phase pulsed discharge system with a multi-needle-to-plate electrode can oxide the ammonium sulfite. The oxidation rate increased with the applied capacitance and peak pulse voltage and decreased with the electrode gap. As the bubbling gas flow rate increased, the oxidation rate increased first and then tended to reach a stationary value. These results would be important for the process optimization of the (NH4)2SO3 to (NH4)2SO4 oxidation.
Morphology and phase control of iron oxide polymorph nanoparticles
NASA Astrophysics Data System (ADS)
Cui, Hongtao; Wang, Li; Shi, Min; Li, Yanhong
2017-04-01
In this work, lepidocrocite (γ-FeOOH) nanobundles were prepared by a facile NH4F assisted epoxide precipitation route. The reactions between epoxide and [Fe(H2O)6]2+ promoted the hydrolysis and condensation of [Fe(H2O)6]2+, resulting in the formation of iron oxyhydroxide. After calcination of γ-FeOOH nanobundles at 400 °C, the produced α-Fe2O3 still kept the bundle morphology. Due to the unique chemistry of epoxide, the morphology and phase of iron oxide polymorph nanoparticles (goethite, akaganeite, lepidocrocite, magnetite) were well-controlled through controlling reaction conditions such as Fe2+ concentration, NH4F additive and reaction temperature. It is particularly interesting that NH4F working as phase controlling agent is able to control the phase development of iron oxyhydroxides. This phase control effect of NH4F is attributed to the promoted reaction rate of epoxide originating from the higher electronegativity of fluoride ions than chloride ions. Based on the results in this work and our other preliminary works, it is considered that this route can be used as a general strategy for controlling the morphology and phase of transition element compounds.
Marciano, Daniele; Goldvaser, Michael; Columbus, Ishay; Zafrani, Yossi
2011-10-21
The catalytic degradation of the nerve agent VX (O-ethyl S-2-(diisopropylamino)ethyl methylphosphonothioate) by water-swelled polymer-supported ammonium fluorides is described. VX (0.06-0.53 mol/mol F(-)) is rapidly degraded (t(1/2) ∼ 10-30 min) to form the "G-analogue" (O-ethyl methylphosphonofluoridate), which hydrolyzes (t(1/2) ∼ 1-1.5 h) to the nontoxic EMPA (ethyl methylphosphonic acid). The toxic desethyl-VX is not formed. The catalytic effect of fluoride is maintained even when 6 equiv of VX are loaded. GB (O-isopropyl methylphosphonofluoridate) and desethyl-VX agents are also degraded under these conditions.
Structural determinants of NH3 and NH4+ transport by mouse Rhbg, a renal Rh glycoprotein.
Abdulnour-Nakhoul, Solange; Le, Trang; Rabon, Edd; Hamm, L Lee; Nakhoul, Nazih L
2016-12-01
Renal Rhbg is localized to the basolateral membrane of intercalated cells and is involved in NH 3 /NH 4 + transport. The structure of Rhbg is not yet resolved; however, a high-resolution crystal structure of AmtB, a bacterial homolog of Rh, has been determined. We aligned the sequence of Rhbg to that of AmtB and identified important sites of Rhbg that may affect transport. Our analysis positioned three conserved amino acids, histidine 183 (H183), histidine 342 (H342), and tryptophan 230 (W230), within the hydrophobic pore where they presumably serve to control NH 3 transport. A fourth residue, phenylalanine 128 (F128) was positioned at the upper vestibule, presumably contributing to recruitment of NH 4 + We generated three mutations each of H183, H342, W230, and F128 and expressed them in frog oocytes. Immunolabeling showed that W230 and F128 mutants were localized to the cell membrane, whereas H183 and H342 staining was diffuse and mostly intracellular. To determine function, we compared measurements of NH 3 /NH 4 + and methyl amine (MA)/methyl ammonium (MA + )-induced currents, intracellular pH, and surface pH (pHs) among oocytes expressing the mutants, Rhbg, or injected with H 2 O. In H183 and W230 mutants, NH 4 + -induced current and intracellular acidification were inhibited compared with that of Rhbg, and MA-induced intracellular alkalinization was completely absent. Expression of H183A or W230A mutants inhibited NH 3 /NH 4 + - and MA/MA + -induced decrease in pHs to the level observed in H 2 O-injected oocytes. Mutations of F128 did not significantly affect transport of NH 3 or NH 4 + These data demonstrated that mutating H183 or W230 caused loss of function but not F128. H183 and H342 may affect membrane expression of the transporter.
Structural determinants of NH3 and NH4+ transport by mouse Rhbg, a renal Rh glycoprotein
Abdulnour-Nakhoul, Solange; Le, Trang; Rabon, Edd; Hamm, L. Lee
2016-01-01
Renal Rhbg is localized to the basolateral membrane of intercalated cells and is involved in NH3/NH4+ transport. The structure of Rhbg is not yet resolved; however, a high-resolution crystal structure of AmtB, a bacterial homolog of Rh, has been determined. We aligned the sequence of Rhbg to that of AmtB and identified important sites of Rhbg that may affect transport. Our analysis positioned three conserved amino acids, histidine 183 (H183), histidine 342 (H342), and tryptophan 230 (W230), within the hydrophobic pore where they presumably serve to control NH3 transport. A fourth residue, phenylalanine 128 (F128) was positioned at the upper vestibule, presumably contributing to recruitment of NH4+. We generated three mutations each of H183, H342, W230, and F128 and expressed them in frog oocytes. Immunolabeling showed that W230 and F128 mutants were localized to the cell membrane, whereas H183 and H342 staining was diffuse and mostly intracellular. To determine function, we compared measurements of NH3/NH4+ and methyl amine (MA)/methyl ammonium (MA+)-induced currents, intracellular pH, and surface pH (pHs) among oocytes expressing the mutants, Rhbg, or injected with H2O. In H183 and W230 mutants, NH4+-induced current and intracellular acidification were inhibited compared with that of Rhbg, and MA-induced intracellular alkalinization was completely absent. Expression of H183A or W230A mutants inhibited NH3/NH4+- and MA/MA+-induced decrease in pHs to the level observed in H2O-injected oocytes. Mutations of F128 did not significantly affect transport of NH3 or NH4+. These data demonstrated that mutating H183 or W230 caused loss of function but not F128. H183 and H342 may affect membrane expression of the transporter. PMID:27681563
Thermal properties and phase transition in the fluoride, (NH{sub 4}){sub 3}SnF{sub 7}
DOE Office of Scientific and Technical Information (OSTI.GOV)
Kartashev, A.V.; Astafijev Krasnoyarsk State Pedagogical University, 660049 Krasnoyarsk; Gorev, M.V.
2016-05-15
Calorimetric, dilatometric and differential thermal analysis studies were performed on (NH{sub 4}){sub 3}SnF{sub 7} for a wide range of temperatures and pressures. Large entropy (δS{sub 0}=22 J/mol K) and elastic deformation (δ(ΔV/V){sub 0}=0.89%) jumps have proven that the Pa-3↔Pm-3m phase transition is a strong first order structural transformation. A total entropy change of ΔS{sub 0}=32.5 J/mol K is characteristic for the order–disorder phase transition, and is equal to the sum of entropy changes in the related material, (NH{sub 4}){sub 3}TiF{sub 7}, undergoing transformation between the two cubic phases through the intermediate phases. Hydrostatic pressure decreases the stability of the highmore » temperature Pm-3m phase in (NH{sub 4}){sub 3}SnF{sub 7}, contrary to (NH{sub 4}){sub 3}TiF{sub 7}, characterised by a negative baric coefficient. The effect of experimental conditions on the chemical stability of (NH{sub 4}){sub 3}SnF{sub 7} was observed. - Graphical abstract: Strong first order structural transformation Pa-3↔Pm-3m in (NH{sub 4}){sub 3}SnF{sub 7} is associated with very large total entropy change of ΔS{sub 0}=32.5 J/mol K characteristic for the ordering processes and equal to the sum of entropy changes in the related (NH{sub 4}){sub 3}TiF{sub 7} undergoing transformation between the same two cubic phases through the intermediate phases. - Highlights: • (NH{sub 4}){sub 3}SnF{sub 7} undergoes strong first order Pa-3↔Pm-3m phase transition. • Anomalous behaviour of ΔC{sub p} and ΔV/V exists far below phase transition temperature. • Structural distortions are accompanied by huge total entropy change ΔS≈Rln50. • High pressure strongly increases the stability of Pa-3 phase in (NH{sub 4}){sub 3}SnF{sub 7}. • Entropy of the Pa-3↔Pm-3m phase transition does not depend on pressure.« less
Effects of high ammonium level on biomass accumulation of common duckweed Lemna minor L.
Wang, Wenguo; Yang, Chuang; Tang, Xiaoyu; Gu, Xinjiao; Zhu, Qili; Pan, Ke; Hu, Qichun; Ma, Danwei
2014-12-01
Growing common duckweed Lemna minor L. in diluted livestock wastewater is an alternative option for pollutants removal and consequently the accumulated duckweed biomass can be used for bioenergy production. However, the biomass accumulation can be inhibited by high level of ammonium (NH4 (+)) in non-diluted livestock wastewater and the mechanism of ammonium inhibition is not fully understood. In this study, the effect of high concentration of NH4 (+) on L. minor biomass accumulation was investigated using NH4 (+) as sole source of nitrogen (N). NH4 (+)-induced toxicity symptoms were observed when L. minor was exposed to high concentrations of ammonium nitrogen (NH4 (+)-N) after a 7-day cultivation. L. minor exposed to the NH4 (+)-N concentration of 840 mg l(-1) exhibited reduced relative growth rate, contents of carbon (C) and photosynthetic pigments, and C/N ratio. Ammonium irons were inhibitory to the synthesis of photosynthetic pigments and caused C/N imbalance in L. minor. These symptoms could further cause premature senescence of the fronds, and restrain their reproduction, growth and biomass accumulation. L. minor could grow at NH4 (+)-N concentrations of 7-84 mg l(-1) and the optimal NH4 (+)-N concentration was 28 mg l(-1).
Tayade, Rajratna P; Sekar, Nagaiyan
2017-05-01
A novel thiazole based carbaldehyde bearing benzimidazole fluorophore as the receptor unit for F - anion was prepared by multi steps synthesis. Density functional theory was used to understand the structural and electronic properties the receptor. The anion sensing activities of receptor 4 were studied for various anions in acetonitrile solvent. The receptor showed fluorescence enhancement in the presence of fluoride anion due to intramolecular charge transfer (ICT) mechanism. No significant changes were observed upon addition of less basic anions such as OAc - , Cl - , Br - , I - , HSO 4 - . After the interaction of fluoride anion with the receptor 4 leads to an 88 nm red shift in emission maxima. [TBA]OH and 1 H NMR titration experiments indicated that deprotonation of N-H in the benzimidazole due to interaction with fluoride anions.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Schuytema, G.S.; Nebeker, A.V.
1999-10-01
The effects of ammonium nitrate, ammonium chloride, ammonium sulfate, and sodium nitrate on survival and growth of Pacific treefrog (Pseudacris regilla [Baird and Girard]) and African clawed frog (Xenopus laevis [Daudin]) tadpoles were determined in static-renewal tests. The 10-d ammonium nitrate and ammonium sulfate LC50s for P. regilla were 55.2 and 89.7 mg/L NH{sub 4}-N, respectively. The 10-d LC50s for X. laevis for the three ammonium compounds ranged from 45 to 64 mg/L NH{sub 4}-N. The 10-d sodium nitrate LC50s were 266.2 mg/L NO{sub 3}-N for P. regilla and 1,236.2 mg/L NO{sub 3}-N for X. laevis. The lowest observed adversemore » effect level (LOAEL) of ammonium compound based on reduced length or weight was 24.6 mg/L NH{sub 4}-N for P. regilla and 99.5 mg/L NH{sub 4}-N for X. laevis. The lowest sodium nitrate LOAELs based on reduced length or weight were {lt}30.1 mg/L NO{sub 3}-N for P. regilla and 126.3 mg/L NO{sub 3}-N for X. laevis. Calculated un-ionized NH{sub 3} comprised 0.3 to 1.0% of measured NH{sub 4}-N concentrations. Potential harm to amphibians could occur if sensitive life stages were impacted by NH{sub 4}-N and NO{sub 3}-N in agricultural runoff or drainage for a sufficiently long period.« less
Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.
2013-01-01
We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451
Podgórska, Anna; Borysiuk, Klaudia; Tarnowska, Agata; Jakubiak, Monika; Burian, Maria; Rasmusson, Allan G.
2018-01-01
Environmental stresses, including ammonium (NH4+) nourishment, can damage key mitochondrial components through the production of surplus reactive oxygen species (ROS) in the mitochondrial electron transport chain. However, alternative electron pathways are significant for efficient reductant dissipation in mitochondria during ammonium nutrition. The aim of this study was to define the role of external NADPH-dehydrogenase (NDB1) during oxidative metabolism of NH4+-fed plants. Most plant species grown with NH4+ as the sole nitrogen source experience a condition known as “ammonium toxicity syndrome”. Surprisingly, transgenic Arabidopsis thaliana plants suppressing NDB1 were more resistant to NH4+ treatment. The NDB1 knock-down line was characterized by milder oxidative stress symptoms in plant tissues when supplied with NH4+. Mitochondrial ROS accumulation, in particular, was attenuated in the NDB1 knock-down plants during NH4+ treatment. Enhanced antioxidant defense, primarily concerning the glutathione pool, may prevent ROS accumulation in NH4+-grown NDB1-suppressing plants. We found that induction of glutathione peroxidase-like enzymes and peroxiredoxins in the NDB1-surpressing line contributed to lower ammonium-toxicity stress. The major conclusion of this study was that NDB1 suppression in plants confers tolerance to changes in redox homeostasis that occur in response to prolonged ammonium nutrition, causing cross tolerance among plants. PMID:29747392
Ammonium hydrosulfide and clouds in the atmospheres of the giant planets.
NASA Astrophysics Data System (ADS)
Ibragimov, K. Yu.; Solodovnik, A. A.
The physicochemical properties of two possible compounds - ammonium hydrosulfide (NH4SH) and ammonium sulfide (NH4)2S - that may be formed in a reaction of ammonia NH3 with hydrogen sulfide H2S are discussed, and the probability of their formation is analyzed on the basis of the Le Chatelier principle. It is shown that the conditions of their formation on the basis of available data on the concentration ratio of the reagents (NH3 and H2S) in the atmospheres of giant planets make the appearance of enough NH4SH for cloud formation highly problematic. Accordingly, the authors propose as an alternative candidate for a cloud-forming role ammonium sulfide (NH4)2S, for whose formation the conditions in the atmospheres of the giant planets are more favorable. The possible spatial localization of (NH4)2S clouds is estimated, and the result is used in an attempt to identify this compound as one of the chromophores.
Mechanochemical synthesis of MgF2 - MF2 composite systems (M = Ca, Sr, Ba)
NASA Astrophysics Data System (ADS)
Scholz, G.; Breitfeld, S.; Krahl, T.; Düvel, A.; Heitjans, P.; Kemnitz, E.
2015-12-01
The capability of mechanochemical synthesis for the formation of MgF2-MF2 (M: Ca, Sr, Ba) composites, solid solutions or well-defined compounds was tested applying a fluorination of different fluorine-free metal sources with NH4F directly at milling. No evidence was found for a substitution of Mg2+ with Ca2+ (Sr2+, Ba2+) ions, or vice versa, in rutile or fluorite structure. However, an equimolar ratio of Mg2+ to the second cation allows the mechanochemical synthesis of tetrafluoromagnesates, MMgF4, which is more and more hampered the smaller the radius of the cation M2+ is. BaMgF4 is formed even phase pure from the acetates, SrMgF4 can only be observed in a mixture accompanied by the binary fluorides. In addition, 19F MAS NMR spectra along with calculations of 19F isotropic chemical shift values according to the superposition model point to the formation of a metastable phase of CaMgF4, which disappears at thermal treatment and decomposes into the binary fluorides CaF2 and MgF2.
Anomalous behaviour of thermodynamic properties at successive phase transitions in (NH4)3GeF7
NASA Astrophysics Data System (ADS)
Bogdanov, Evgeniy V.; Kartashev, Andrey V.; Pogoreltsev, Evgeniy I.; Gorev, Mikhail V.; Laptash, Natalia M.; Flerov, Igor N.
2017-12-01
Heat capacity, thermal dilatation, susceptibility to hydrostatic pressure and dielectric properties associated with succession of three phase transitions below room temperature in double fluoride salt (NH4)3GeF7 were studied. A possible transformation into the parent Pm-3m cubic phase was not observed up to the decomposition of compound. Nonferroelectric nature of structural distortions was confirmed. The DTA under pressure studies revealed a high temperature stability of two phases: P4/mbm and Pbam. The entropies of the phase transitions agree well with the model of structural distortions. Analysis of the thermal properties associated with the individual phase transitions in the framework of thermodynamic equations has shown a high reliability of the data obtained.
Tredwin, Christopher J; Georgiou, George; Kim, Hae-Won; Knowles, Jonathan C
2013-05-01
Hydroxyapatite (HA), fluor-hydroxyapatite (FHA) with varying levels of fluoride ion substitution and fluorapatite (FA) production has been characterised and optimised by the sol-gel method and the dissolution and biological properties of these materials were investigated. It was the objective of this study to investigate the potential bond strength and interaction of these materials with titanium. HA, FHA and FA were synthesised by a sol-gel method. Calcium nitrate and triethyl phosphite were used as precursors under an ethanol-water based solution. Different amounts of ammonium fluoride (NH4F) were incorporated for the preparation of the FHA and FA sol-gels. Using a spin coating technique the sol-gels were coated onto commercially pure titanium disks and crystallised at various temperatures. Using scanning electron microscopy (SEM) and elemental analysis, the surface characteristics, coating thickness and interaction of the Ti substrate and coating were investigated. The bond strengths of the coating to the Ti were investigated using an Instron Universal Load Testing Machine. Statistical analysis was performed with a two-way analysis of variance and post hoc testing with a Bonferroni correction. (1) Coating speed inversely influenced the coating thickness. (2) Increasing fluoride ion substitution and heating temperature significantly increased bond strength and (3) increasing fluoride ion substitution increased the coating thickness. FHA and FA synthesised using the sol-gel technique may offer a superior alternative to coating titanium implants with HA and plasma spraying. HA, FHA and FA materials synthesised by the sol-gel method may also have a use as bone grafting materials. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Novak, D. M.; Smirnov, Lev S; Kolesnikov, Alexander I
2013-01-01
The (NH4)2WO2F4 compound undergoes a series of phase transitions: G0 -> 201 K -> G1 -> 160 K -> G2, with a significant change in entropy ( S1 ~ Rln10 at the G0 -> G1 transition), which indicates significant orientational disordering in the G0 phase and the order disorder type of the phase transition. X-ray diffraction is used to identify the crystal structure of the G0 phase as rhombohedral (sp. gr. Cmcm, Z = 4), determine the lattice parameters and the positions of all atoms (except hydrogen), and show that [WO2F4]2 ions can form a superposition of dynamic and staticmore » orientational disorders in the anionic sublattice. A determination of the orientational position of [NH4]+ ions calls for the combined method of elastic and inelastic neutron scattering. Inelastic neutron scattering is used to determine the state of hindered rotation for ammonium ions in the G0 phase. Powder neutron diffraction shows that the orientational disorder of NH4 ions can adequately be described within the free rotation approximation.« less
NASA Astrophysics Data System (ADS)
Francesconi, M. G.; Slater, P. R.; Hodges, J. P.; Greaves, C.; Edwards, P. P.; Al-Mamouri, M.; Slaski, M.
1998-01-01
The low-temperature fluorination of a range of insulating alkaline earth cuprates Sr2-xAxCuO3(A=Ca (0≤x≤2);A=Ba (0≤x≤0.6)) can result in superconducting oxide fluorides Sr2-xAxCuO2F2+δ. In contrast, conventional high-temperature solid-state reactions produce thermodynamically more stable mixtures of oxides and fluorides. Various soft-chemistry fluorination pathways (utilizing F2gas, NH4F,MF2[M=Cu, Zn, Ni, Ag]) are compared with respect to their efficacy and mechanisms. Attention is also focused on the structural features of the mixed-oxide precursor and the final-oxide fluorides to highlight the remarkable structural rearrangements that occur during the low-temperature fluorination. The effects of fluorination of other Sr-Cu-O systems are used to identify the structural requirements of the precursor oxide in order to achieve such transformations.
Exploring ammonium tolerance in a large panel of Arabidopsis thaliana natural accessions
Sarasketa, Asier; González-Moro, María Begoña; González-Murua, Carmen; Marino, Daniel
2014-01-01
Plants are dependent on exogenous nitrogen (N) supply. Ammonium (NH4 +), together with nitrate (NO3 –), is one of the main nitrogenous compounds available in the soil. Paradoxically, although NH4 + assimilation requires less energy than that of NO3 –, many plants display toxicity symptoms when grown with NH4 + as the sole N source. However, in addition to species-specific ammonium toxicity, intraspecific variability has also been shown. Thus, the aim of this work was to study the intraspecific ammonium tolerance in a large panel of Arabidopsis thaliana natural accessions. Plants were grown with either 1mM NO3 – or NH4 + as the N source, and several parameters related to ammonium tolerance and assimilation were determined. Overall, high variability was observed in A. thaliana shoot growth under both forms of N nutrition. From the parameters determined, tissue ammonium content was the one with the highest impact on shoot biomass, and interestingly this was also the case when N was supplied as NO3 –. Enzymes of nitrogen assimilation did not have an impact on A. thaliana biomass variation, but the N source affected their activity. Glutamate dehydrogenase (GDH) aminating activity was, in general, higher in NH4 +-fed plants. In contrast, GDH deaminating activity was higher in NO3 –-fed plants, suggesting a differential role for this enzyme as a function of the N form supplied. Overall, NH4 + accumulation seems to be an important player in Arabidopsis natural variability in ammonium tolerance rather than the cell NH4 + assimilation capacity. PMID:25205573
Formation and Characterization of Gold Nanoparticles
2013-09-01
nanowires are useful because they can be grown almost dislocation free, due to their nano dimension. The quality of crystalline materials is diminished by...real substrate temperature was obtained from the calibration based on the melting points of indium (In), selenium (Se), cadmium (Cd), and zinc (Zn...hydrogen fluoride In indium MBE molecular beam epitaxy NH3OH ammonium hydroxide RHEED reflection high-energy electron diffraction Se selenium SEM
Nitrogen cycle between surface and mantle (Invited)
NASA Astrophysics Data System (ADS)
Watenphul, A.; Heinrich, W.
2009-12-01
Nitrogen cycling between the surface and the deep Earth occurs mainly through subduction of ammonium-bearing sediments and alterated oceanic crust and nitrogen release via degassing of molecular nitrogen. Whereas in most environments nitrogen is soon released to the surface via arc volcanism [1] or lost during increasing metamorphic grade [2] at cold slab conditions nitrogen remains in the rocks at least down to 90 km and very probably beyond the depth locus of island arc magmatism [3]. In these rocks, nitrogen is initially bound as ammonium, substituting potassium in the relevant K-bearing phases such as clay minerals, micas, and feldspars, due to similarities in the ionic radius and charge. Multi-anvil experiments [4] have shown that at pressures exceeding the upper stability of phengitic mica and feldspar, ammonium is easily incorporated into high-pressure successor K-bearing phases such as K-cymrite, K-Si-wadeite, K-hollandite and to minor amounts also into omphacitic clinopyroxene. This implies that NH4 can probably be transported down to the transition zone and beyond. The global nitrogen input to the mantle as NH4 via cold slab subduction and the global output to the atmosphere as N2 through mid-ocean ridge basalts and volcanic arcs roughly balance each other [3,5] and are estimated to about 3 - 5 × 1010 mol/a N. Because a large portion of the nitrogen release occurs at mid-ocean ridges [1], a nitrogen reservoir in peridotites probably does exist. High-pressure experiments up to 13 GPa, 750 °C have shown that Cr-diopside may store NH4 by up to 500 to 1000 ppm, making clinopyroxene the ideal candidate for nitrogen storage at depth. If so, the nitrogen storage capacity of the upper mantle is roughly estimated at 1012 mol N. This reservoir also contributes to the deep Earth's water budget. The input of NH4 by slab minerals and the output as N2 requires the occurrence of oxidation reactions during the recycling process. Nitrogen speciation in H-N-O fluids is dependent on oxygen fugacity fO2, which changes with depth. At relevant upper mantle conditions with fO2 around ± 2 log units relative to FMQ [6], H-N-O fluids consist of water and molecular nitrogen. With depth fO2 may decrease by several log units [6], so that in H-N-O fluids NH3/NH4+ would predominate at the middle and lower part of the upper mantle. This stabilizes the NH4-component relative to N2 plus water in Cr-diopside and possibly also in other high-pressure phases. This would imply that nitrogen indeed can be stored as ammonium within the mid and lower part of the upper mantle and that towards shallower depths it is lost due to oxidation and degassing. The stability of ammonium as a component in subducted slabs and mantle phases is, therefore, very important for long-time, large-scale recycling of nitrogen and hydrogen between the Earth's crust and the deeper mantle. References: [1] Sano et al. (2001). Chem Geol, 171, 263-271. [2] Sadofsky and Bebout (2000). GCA, 64, 2835-2849. [3] Busigny et al. (2003). EPSL, 215, 27-42. [4] Watenphul et al. (2009). Am Min, 94, 283-292. [5] Hilton et al. (2002). Rev Mineral Geochem, 47, 319-370. [6] Frost and McCammon (2008). Annu Rev Earth Pl Sc, 36, 389-420.
DOE Office of Scientific and Technical Information (OSTI.GOV)
O'Hara, Matthew J.; Kellogg, Cyndi M.; Parker, Cyrena M.
Ammonium bifluoride (ABF, NH4F·HF) is a well-known reagent for converting metal oxides to fluorides and for its applications in breaking down minerals and ores in order to extract useful components. It has been more recently applied to the decomposition of inorganic matrices prior to elemental analysis. Herein, a sample decomposition method that employs molten ABF sample treatment in the initial step is systematically evaluated across a range of inorganic sample types: glass, quartz, zircon, soil, and pitchblende ore. Method performance is evaluated across the two variables: duration of molten ABF treatment and ABF reagent mass to sample mass ratio. Themore » degree of solubilization of these sample classes are compared to the fluoride stoichiometry that is theoretically necessary to enact complete fluorination of the sample types. Finally, the sample decomposition method is performed on several soil and pitchblende ore standard reference materials, after which elemental constituent analysis is performed by ICP-OES and ICP-MS. Elemental recoveries are compared to the certified values; results indicate good to excellent recoveries across a range of alkaline earth, rare earth, transition metal, and actinide elements.« less
NASA Astrophysics Data System (ADS)
Sokol, A. G.; Sokol, E. V.; Kupriyanov, I. N.; Sobolev, N. V.
2018-03-01
The synthesis of NH4-bearing muscovite at P = 6.3 GPa and T = 1000°C in equilibrium with NH3-H2O fluid is performed. It is determined that the newly formed muscovite is enriched in celadonite minal and contains 370 ppm of NH4. The obtained data make it possible to conclude that ammonium-bearing micas have sufficient thermal stability and can transport crustal nitrogen to the mantle in the presence of a reduced water-ammonia fluid at fO2 less than the values of IW + 2 log units even in the regime of "hot" subduction. The key parameter that determines the efficiency of this mechanism for the deep nitrogen cycle is redox stability of NH4-bearing muscovite at the mantle PT-parameters.
NASA Astrophysics Data System (ADS)
Schmidt, Christian; Watenphul, Anke
2010-12-01
The behavior of ammonium, NH 4+, in aqueous systems was studied based on Raman spectroscopic experiments to 600 °C and about 1.3 GPa. Spectra obtained at ambient conditions revealed a strong reduction of the dynamic three-dimensional network of water with addition of ammonium chloride, particularly at small solute concentrations. The differential scattering cross section of the ν 1-NH 4+ Raman band in these solutions was found to be similar to that of salammoniac. The Raman band of silica monomers at ˜780 cm -1 was present in all spectra of the fluid at high temperatures in hydrothermal diamond-anvil cell experiments with H 2O ± NH 4Cl and quartz or the assemblage quartz + kyanite + K-feldspar ± muscovite/tobelite. However, these spectra indicated that dissolved silica is less polymerized in ammonium chloride solutions than in comparable experiments with water. Quantification based on the normalized integrated intensity of the H 4SiO 40 band showed that the silica solubility in experiments with H 2O + NH 4Cl was significantly lower than that in equimolal NaCl solutions. This suggests that ammonium causes a stronger decrease in the activity of water in chloridic solutions than sodium. The Raman spectra of the fluid also showed that a significant fraction of ammonium was converted to ammonia, NH 3, in all experiments at temperatures above 300 °C. This indicates a shift towards acidic conditions for experiments without a buffering mineral assemblage. The estimated pH of the fluid was ˜2 at 600 °C, 0.26 GPa, 6.6 m initial NH 4Cl, based on the ratio of the integrated ν 1-NH 3 and ν 1-NH 4+ intensities and the HCl 0 dissociation constant. The NH 3/NH 4+ ratio increased with temperature and decreased with pressure. This implies that more ammonium should be retained in K-bearing minerals coexisting with chloridic fluids upon high- P low- T metamorphism. At 500 °C, 0.73 GPa, ammonium partitions preferentially into the fluid, as constrained from infrared spectroscopy on the muscovite and from mass balance. The conversion of K-feldspar to muscovite proceeded much faster in experiments with NH 4Cl solutions than in comparable experiments with water. This is interpreted as being caused by enhancement of the rate-limiting alumina solubility, suggesting complexation of Al with NH 4. Nucleation and growth of mica at the expense of K-feldspar and NH 4+/K + exchange between fluid and K-feldspar occurred simultaneously, but incorporation of NH 4+ into K-feldspar was distinctly faster than K-feldspar consumption.
Mechanisms of ammonia and ammonium transport by rhesus-associated glycoproteins
Caner, Tolga; Abdulnour-Nakhoul, Solange; Brown, Karen; Islam, M. Toriqul; Hamm, L. Lee
2015-01-01
In this study we characterized ammonia and ammonium (NH3/NH4+) transport by the rhesus-associated (Rh) glycoproteins RhAG, Rhbg, and Rhcg expressed in Xenopus oocytes. We used ion-selective microelectrodes and two-electrode voltage clamp to measure changes in intracellular pH, surface pH, and whole cell currents induced by NH3/NH4+ and methyl amine/ammonium (MA/MA+). These measurements allowed us to define signal-specific signatures to distinguish NH3 from NH4+ transport and to determine how transport of NH3 and NH4+ differs among RhAG, Rhbg, and Rhcg. Our data indicate that expression of Rh glycoproteins in oocytes generally enhanced NH3/NH4+ transport and that cellular changes induced by transport of MA/MA+ by Rh proteins were different from those induced by transport of NH3/NH4+. Our results support the following conclusions: 1) RhAG and Rhbg transport both the ionic NH4+ and neutral NH3 species; 2) transport of NH4+ is electrogenic; 3) like Rhbg, RhAG transport of NH4+ masks NH3 transport; and 4) Rhcg is likely to be a predominantly NH3 transporter, with no evidence of enhanced NH4+ transport by this transporter. The dual role of Rh proteins as NH3 and NH4+ transporters is a unique property and may be critical in understanding how transepithelial secretion of NH3/NH4+ occurs in the renal collecting duct. PMID:26354748
Determining fluoride ions in ammonium desulfurization slurry using an ion selective electrode method
NASA Astrophysics Data System (ADS)
Luo, Zhengwei; Guo, Mulin; Chen, Huihui; Lian, Zhouyang; Wei, Wuji
2018-02-01
Determining fluoride ions in ammonia desulphurization slurry using a fluoride ion selective electrode (ISE) is investigated. The influence of pH was studied and the appropriate total ionic strength adjustment buffer and its dosage were optimized. The impact of Fe3+ concentration on the detection results was analyzed under preferable conditions, and the error analysis of the ISE method’s accuracy and precision for measuring fluoride ion concentration in the range of 0.5-2000 mg/L was conducted. The quantitative recovery of F- in ammonium sulfate slurry was assessed. The results showed that when pH ranged from 5.5˜6 and the Fe3+ concentration was less than 750 mg/L, the accuracy and precision test results with quantitative recovery rates of 92.0%-104.2% were obtained.
Demeestere, K; Smet, E; Van Langenhove, H; Galbacs, Z
2001-12-01
Among the physico-chemical abatement technologies, mainly acid scrubbers have been used to control NH3-emission. The disadvantage of this technique is that it yields waste water, highly concentrated in ammonia. In this report, the applicability of the magnesium ammonium phosphate (MAP) process to regenerate the liquid phase, produced by scrubbing NH3-loaded waste gases, was investigated. In the MAP process, ammonium is precipitated as magnesium ammonium phosphate, which can be used as a slow release fertilizer. The influence of a number of parameters, e.g. pH, kinetics, molar ratio NH(+)4/Mg2+/PO(3-)4 on the efficiency of the formation of MAP and on the ammonium removal efficiency was investigated. In this way, optimal conditions were determined for the precipitation reaction. Next to this, interference caused by other precipitation reactions was studied. At aqueous NH(+)4-concentrations of about 600 mg l(-1), ammonium removal efficiencies of 97% could be obtained at a molar ratio NH(+)4/Mg2+/PO(3-)4 of 1/1.5/1.5. To obtain this result, the pH was continuously adjusted to a value of 9 during the reaction. According to this study, it is obvious that the MAP-precipitation technology offers opportunities for ammonium removal from scrubbing liquids. The practical applicability of the MAP-process in waste gas treatment systems, however, should be the subject for further investigations.
Radiolytic decomposition of ammonium halides
DOE Office of Scientific and Technical Information (OSTI.GOV)
Orlov, S.L.; Gromov, V.V.; Saunin, E.I.
1988-11-01
Chromatographic analyses were made of the gaseous products of the radiolysis of polycrystalline NH/sub 4/F, NH/sub 4/Cl, NH/sub 4/Br, and NH/sub 4/I, of particle size 0.25-0.5 mm. The irradiation was performed with /sup 60/Co ..sigma..-quanta, at room temperature in previously evacuated and sealed glass ampules. Determination was made of the amount of gas liberated into the space of the ampule during the irradiation, and of the amount retained in the crystal matrix and evolved on dissolution of the resulting samples in deaerated water. At the same time quantitative determinations of halogen were made by the thiosulfate method. It was shownmore » that hydrogen and nitrogen were formed in the radiolysis of all the compounds investigated. The yields are listed.« less
NASA Astrophysics Data System (ADS)
Alcañiz-Monge, J.; Trautwein, G.; Román-Martínez, M. Carmen
2011-01-01
Porous ammonium phosphomolybdate ((NH 4) 3[PMo 12O 40]) nanoparticles have been synthesized by the titration method using several ammonium salts. The purpose of this work is to analyze the role of the counteranion in the development of the pore texture. The crystalline structure was quite similar in all the synthesized (NH 4) 3[PMo 12O 40] nanoparticles, as revealed by the similarity of the obtained powder X-ray diffraction patterns and the electron microscopy images. However, adsorption studies have shown pronounced differences in the pore texture of the different (NH 4) 3[PMo 12O 40] nanoparticles prepared. From these studies, it can be deduced that the counteranion of the ammonium salt plays an important role in the development of porosity during the synthesis of (NH 4) 3[PMo 12O 40]. It has been found an effect on both, the specific micropore area and the pore size distribution. The basic character of the counteranion has shown to be the main property affecting the development of mesoporosity in (NH 4) 3[PMo 12O 40] samples. On the other hand, the local concentration of [NH 4] + during the precipitation of (NH 4) 3[PMo 12O 40] seems to promote a higher porosity.
Heterogeneous uptake of ammonia and dimethylamine into sulfuric and oxalic acid particles
NASA Astrophysics Data System (ADS)
Sauerwein, Meike; Keung Chan, Chak
2017-05-01
Heterogeneous uptake is one of the major mechanisms governing the amounts of short-chain alkylamines and ammonia (NH3) in atmospheric particles. Molar ratios of aminium to ammonium ions detected in ambient aerosols often exceed typical gas phase ratios. The present study investigated the simultaneous uptake of dimethylamine (DMA) and NH3 into sulfuric and oxalic acid particles at gaseous DMA / NH3 molar ratios of 0.1 and 0.5 at 10, 50 and 70 % relative humidity (RH). Single-gas uptake and co-uptake were conducted under identical conditions and compared. Results show that the particulate dimethyl-aminium/ammonium molar ratios (DMAH / NH4) changed substantially during the uptake process, which was severely influenced by the extent of neutralisation and the particle phase state. In general, DMA uptake and NH3 uptake into concentrated H2SO4 droplets were initially similarly efficient, yielding DMAH / NH4 ratios that were similar to DMA / NH3 ratios. As the co-uptake continued, the DMAH / NH4 gradually dropped due to a preferential uptake of NH3 into partially neutralised acidic droplets. At 50 % RH, once the sulfate droplets were neutralised, the stronger base DMA displaced some of the ammonium absorbed earlier, leading to DMAH / NH4 ratios up to four times higher than the corresponding gas phase ratios. However, at 10 % RH, crystallisation of partially neutralised sulfate particles prevented further DMA uptake, while NH3 uptake continued and displaced DMAH+, forming almost pure ammonium sulfate. Displacement of DMAH+ by NH3 has also been observed in neutralised, solid oxalate particles. The results can explain why DMAH / NH4 ratios in ambient liquid aerosols can be larger than DMA / NH3, despite an excess of NH3 in the gas phase. An uptake of DMA to aerosols consisting of crystalline ammonium salts, however, is unlikely, even at comparable DMA and NH3 gas phase concentrations.
Ammonia stress on nitrogen metabolism in tolerant aquatic plant-Myriophyllum aquaticum.
Zhou, Qingyang; Gao, Jingqing; Zhang, Ruimin; Zhang, Ruiqin
2017-09-01
Ammonia has been a major reason of macrophyte decline in the water environment, and ammonium ion toxicity should be seen as universal, even in species frequently labeled as "NH 4 + specialists". To study the effects of high NH 4 + -N stress of ammonium ion nitrogen on tolerant submerged macrophytes and investigate the pathways of nitrogen assimilation in different organisms, Myriophyllum aquaticum was selected and treated with various concentrations of ammonium ions at different times. Increasing of ammonium concentration leads to an overall increase in incipient ammonia content in leaves and stems of plants. In middle and later stages, high concentrations of NH 4 + ion nitrogen taken up by M. aquaticum decreased, whereas the content of NO 3 - ion nitrogen increased. Moreover, in M. aquaticum, the activities of the enzymes nitrate reductase, glutamine synthetase and asparagine synthetase changed remarkably in the process of alleviating NH 4 + toxicity and deficiency. The results of the present study may support the studies on detoxification of high ammonium ion content in NH 4 + -tolerant submerged macrophytes and exploration of tissue-specific expression systems. Copyright © 2017. Published by Elsevier Inc.
Kucukyilmaz, Ebru; Savas, Selcuk
2017-01-26
The aim of this study was to investigate the effectiveness of different remineralization agents by quantitative light-induced fluorescence digital BiluminatorTM (QLF-D). Artificial caries lesions were created, and the teeth were divided according to the tested materials: (i) distilled water, (ii) acidulated phosphate fluoride (APF), (iii) Curodont Repair (CR), (iv) ammonium hexafluorosilicate (SiF) and (v) ammonium hexafluorosilicate plus cetylpyridinium chloride (SiF + CPC). After treatment procedures, each of the samples was placed in artificial saliva. After demineralization and 1 and 4 weeks of remineralization procedures, fluorescence loss and lesion areas were measured with QLF-D. Data were statistically analyzed (α = 0.05). The fluorescence values of the demineralized enamel specimens treated with the various agents differed significantly compared with pretreatment values for both 1 and 4 weeks (p<0.05). At 4 weeks, the highest fluorescence gain was calculated in the CR, APF and SiF groups compared with the control (p<0.05). APF, SiF and CR groups yielded greater remineralization ability than SiF + CPC and control groups.
2-Keto-3-fluoroglutarate: a useful mechanistic probe of 2-keto-glutarate-dependent enzyme systems.
Grissom, C B; Cleland, W W
1987-12-18
2-Keto-3-fluoroglutaric acid prepared by acid hydrolysis of its diethyl ester is stable, as the free acid in aqueous solution at pH 2, and can be stored at -20 degrees C for several years. Both enantiomers are reduced by NADH in the presence of glutamate dehydrogenase (EC 1.4.1.2) to the two diastereomers of 3-fluoro-L-glutamate, which are stable at neutral pH and at high pH unless heated. 2-Keto-3-fluoroglutarate exists in solution almost entirely as a hydrate both at low and neutral pH. Both enantiomers of ketofluoroglutarate react with the pyridoxamine forms of aspartate, alanine and 4-aminobutyrate transaminases to give fluoride release. 2 mol of cosubstrate amino acid react for each mol of ketofluoroglutarate (KFG) when starting from the pyridoxamine form of the enzyme: 2 RCHNH2COOH + KFG + H2O----F- + NH4+ + glutamate + 2 RCOCOOH. Both diastereomers of fluoroglutamate are decarboxylated by glutamate decarboxylase (EC 4.1.1.15) with fluoride release: KFG + H2O----CO2 + F- + HCOCH2CH2COOH. By contrast, only one isomer of fluoroglutamate will react with the pyridoxal form of glutamate-oxalacetate transaminase to give fluoride release: HOOCCHNH2CHFCH2COOH + H2O----4F- + NH4+ + HOOCCOCH2CH2COOH. The enzymatic decarboxylation of 3-fluoroisocitrate produces only one enantiomer of ketofluoroglutarate, which is reduced to threo (2R,3R)-3-fluoroglutamate by NADH and glutamate dehydrogenase: [2R,3S]-HOOCCH(OH)CF(COOH)CH2COOH + NADP+----[3R]-KFG + CO2 + NADPH + H+. The proton, 13C, and 19F-NMR parameters of ketofluoroglutarate and the two fluoroglutamate diastereomers are presented. These molecules are useful probes of enzymatic mechanisms thought to involve carbanion intermediates.
Direct observation of electrogenic NH4(+) transport in ammonium transport (Amt) proteins.
Wacker, Tobias; Garcia-Celma, Juan J; Lewe, Philipp; Andrade, Susana L A
2014-07-08
Ammonium transport (Amt) proteins form a ubiquitous family of integral membrane proteins that specifically shuttle ammonium across membranes. In prokaryotes, archaea, and plants, Amts are used as environmental NH4(+) scavengers for uptake and assimilation of nitrogen. In the eukaryotic homologs, the Rhesus proteins, NH4(+)/NH3 transport is used instead in acid-base and pH homeostasis in kidney or NH4(+)/NH3 (and eventually CO2) detoxification in erythrocytes. Crystal structures and variant proteins are available, but the inherent challenges associated with the unambiguous identification of substrate and monitoring of transport events severely inhibit further progress in the field. Here we report a reliable in vitro assay that allows us to quantify the electrogenic capacity of Amt proteins. Using solid-supported membrane (SSM)-based electrophysiology, we have investigated the three Amt orthologs from the euryarchaeon Archaeoglobus fulgidus. Af-Amt1 and Af-Amt3 are electrogenic and transport the ammonium and methylammonium cation with high specificity. Transport is pH-dependent, with a steep decline at pH values of ∼5.0. Despite significant sequence homologies, functional differences between the three proteins became apparent. SSM electrophysiology provides a long-sought-after functional assay for the ubiquitous ammonium transporters.
NASA Astrophysics Data System (ADS)
Heise, M.; Scholz, G.; Düvel, A.; Heitjans, P.; Kemnitz, E.
2018-03-01
The paper deals with the mechanochemical synthesis of lead containing alkaline earth metal fluoride solid solutions MxPb1-xF2 (M = Ca, Sr, Ba) by high-energy ball milling. Several metal precursors and fluorinating agents were tested for synthesizing M0.5Pb0.5F2. Metal acetates and ammonium fluoride as precursors show the most promising results and were therefore used for the formation of MxPb1-xF2 with different metal cationic ratios. The characterization of the local fluorine coordination and the crystal structure was performed by 19F MAS NMR spectroscopy and X-ray diffraction. Additional calculations of 19F chemical shifts using the superposition model allow a deeper insight into the local structure of the compounds. The fluoride ion conductivity was followed by temperature dependent DC conductivity measurements. Significantly higher conductivities were found in comparison with those of the corresponding binary fluorides. The highest values were observed for samples with high lead content M0.25Pb0.75F2, bearing in mind the much higher conductivity of PbF2 compared to MF2.
Temporal and spatial variations in ammonia (NH3) emissions and ammonium (NH4+) concentrations associated with aerosols and volume-weighted NH4+ concentration in precipitation are investigated over the period 1990-1998 in the southeast United States (Alabama, Florida, Georgia, Ken...
Wang, Guangmei; Valldor, Martin; Mallick, Bert
2014-01-01
Four open-framework transition-metal phosphates; (NH4)2Co3(HPO4)2F4 (1), (NH4)Co3(HPO4)2(H2PO4)F2 (2), KCo3(HPO4)2(H2PO4)F2 (3), and KFe3(HPO4)2(H2PO4)F2 (4); are prepared by ionothermal synthesis using pyridinium hexafluorophosphate as the ionic liquid. Single-crystal X-ray diffraction analyses reveal that the four compounds contain cobalt/iron–oxygen/fluoride layers with Kagomé topology composed of interlinked face-sharing MO3F3/MO4F2 octahedra. PO3OH pseudo-tetrahedral groups augment the [M3O6F4] (1)/[M3O8F2] layers on both sides to give M3(HPO4)2F4 (1) and M3(HPO4)2F2 (2–4) layers. These layers are stacked along the a axis in a sequence AA…, resulting in the formation of a layer structure for (NH4)2Co3(HPO4)2F4(1). In NH4Co3(HPO4)2(H2PO4)F2 and KM3(HPO4)2(H2PO4)F2, the M3(HPO4)2F2 layers are stacked along the a axis in a sequence AAi… and are connected by [PO3(OH)] tetrahedra, giving rise to a 3-D open framework structure with 10-ring channels along the [001] direction. The negative charges of the inorganic framework are balanced by K+/NH4 + ions located within the channels. The magnetic transition metal cations themselves form layers with stair-case Kagomé topology. Magnetic susceptibility and magnetization measurements reveal that all four compounds exhibit a canted anti-ferromagnetic ground state (T c = 10 or 13 K for Co and T c = 27 K for Fe) with different canting angles. The full orbital moment is observed for both Co2+ and Fe2+. PMID:25580250
NASA Astrophysics Data System (ADS)
Ruprecht, Heidi; Sigg, Laura
The concentrations of aerosols (NH 4NO 3, (NH 4) 2SO 4 and NH 4Cl) and of gases (HCl (g), HNO 3(g), NH 3(g) were determined by denuder methods under different conditions (in the absence of fog, before, during and after fog events). At this site situated in an urban region, high concentrations of the gaseous strong acids HCl (g) and HNO 3(g) are observed. NH 4Cl and NH 4NO 3 aerosols represent a major fraction of the Cl - and NO 3- aerosols (<2.4 μm)collected by denuders. During a fog event, very high concentrations of SO 42- were found in small aerosols, which are attributed to the aqueous phase oxidation of SO 2 under the influence of high pH due to the presence of NH 3. Differences in SO 42- concentrations measured in aerosols (<2.4 μm) and in fog droplets were probably due to mass-transport limitations of the SO 2 oxidation. Ammonium sulfate aerosols represent in some cases a significant fraction of the total S present (SO 2(g) + SO 42-. Soluble aerosols and gases contribute to the composition of fogwater and are released again after fog dissipation.
Li, Guangjie; Dong, Gangqiang; Li, Baohai; Li, Qing; Kronzucker, Herbert J; Shi, Weiming
2012-02-01
Ammonium (NH(4)(+)) toxicity is a significant agricultural problem globally, compromising crop growth and productivity in many areas. However, the molecular mechanisms of NH(4)(+) toxicity are still poorly understood, in part due to a lack of valuable genetic resources. Here, a novel Arabidopsis mutant, amos2 (ammonium overly sensitive 2), displaying hypersensitivity to NH(4) (+) in both shoots and roots, was isolated. The mutant exhibits the hallmarks of NH(4)(+) toxicity at significantly elevated levels: severely suppressed shoot biomass, increased leaf chlorosis, and inhibition of lateral root formation. Amos2 hypersensitivity is associated with excessive NH(4)(+) accumulation in shoots and a reduction in tissue potassium (K(+)), calcium (Ca(2+)), and magnesium (Mg(2+)). We show that the lesion is specific to the NH(4)(+) ion, is independent of NH(4)(+) metabolism, and can be partially rescued by elevated external K(+). The amos2 lesion was mapped to a 16-cM interval on top of chromosome 1, where no similar mutation has been previously mapped. Our study identifies a novel locus controlling cation homeostasis under NH(4)(+) stress and provides a tool for the future identification of critical genes involved in the development of NH(4)(+) toxicity.
NASA Astrophysics Data System (ADS)
Tang, Xiong; Zhang, Xiaoshan; Ci, Zhijia; Guo, Jia; Wang, Jiaqi
2016-05-01
In the winter and summer of 2013-2014, we used a sampling system, which consists of annular denuder, back-up filter and thermal desorption set-up, to measure the speciation of major inorganic salts in aerosols and the associated trace gases in Beijing. This sampling system can separate volatile ammonium salts (NH4NO3 and NH4Cl) from non-volatile ammonium salts ((NH4)2SO4), as well as the non-volatile nitrate and chloride. The measurement data was used as input of a thermodynamic equilibrium model (ISORROPIA II) to investigate the gas-aerosol equilibrium characteristics. Results show that (NH4)2SO4, NH4NO3 and NH4Cl were the major inorganic salts in aerosols and mainly existed in the fine particles. The sulfate, nitrate and chloride associated with crustal ions were also important in Beijing where mineral dust concentrations were high. About 19% of sulfate in winter and 11% of sulfate in summer were associated with crustal ions and originated from heterogeneous reactions or direct emissions. The non-volatile nitrate contributed about 33% and 15% of nitrate in winter and summer, respectively. Theoretical thermodynamic equilibrium calculations for NH4NO3 and NH4Cl suggest that the gaseous precursors were sufficient to form stable volatile ammonium salts in winter, whereas the internal mixing with sulfate and crustal species were important for the formation of volatile ammonium salts in summer. The results of the thermodynamic equilibrium model reasonably agreed with the measurements of aerosols and gases, but large discrepancy existed in predicting the speciation of inorganic ammonium salts. This indicates that the assumption on crustal species in the model was important for obtaining better understanding on gas-aerosol partitioning and improving the model prediction.
Partitioning of mercury in aqueous biphasic systems and on ABEC resins.
Rogers, R D; Griffin, S T
1998-06-26
Poly(ethylene glycol)-based aqueous biphasic systems (PEG-ABS) can be utilized to separate and recover metal ions in environmental and hydrometallurgical applications. A concurrent study was conducted comparing the partitioning of mercury between aqueous layers in an ABS [Me-PEG-5000/(NH4)2SO4] and partitioning of mercury from aqueous solutions to aqueous biphasic extraction chromatographic (ABEC-5000) resins. In ammonium sulfate solutions, mercury partitions to the salt-rich phase in ABS, but by using halide ion extractants, mercury will partition to the PEG-rich phase after formation of a chloro, bromo or iodo complex. The efficacy of the extractant increases in the order Cl-
USDA-ARS?s Scientific Manuscript database
Ammonium nitrate (NH4NO3) fertilizer is an ingredient in explosives. NH4NO3 encapsulated with coal combustion byproducts [class C fly ash (FAC) and flue gas desulfurization-gypsum (FGDG)] reduces the explosiveness of NH4NO3. A two-year field study was conducted to determine the effects of encapsula...
Yin, Guoyu; Hou, Lijun; Liu, Min; Liu, Zhanfei; Gardner, Wayne S
2014-08-19
Nitrogen (N) pollution in aquatic ecosystems has attracted much attention over the past decades, but the dynamics of this bioreactive element are difficult to measure in aquatic oxygen-transition environments. Nitrogen-transformation experiments often require measurement of (15)N-ammonium ((15)NH4(+)) ratios in small-volume (15)N-enriched samples. Published methods to determine N isotope ratios of dissolved ammonium require large samples and/or costly equipment and effort. We present a novel ("OX/MIMS") method to determine N isotope ratios for (15)NH4(+) in experimental waters previously enriched with (15)N compounds. Dissolved reduced (15)N (dominated by (15)NH4(+)) is oxidized with hypobromite iodine to nitrogen gas ((29)N2 and/or (30)N2) and analyzed by membrane inlet mass spectrometry (MIMS) to quantify (15)NH4(+) concentrations. The N isotope ratios, obtained by comparing the (15)NH4(+) to total ammonium (via autoanalyzer) concentrations, are compared to the ratios of prepared standards. The OX/MIMS method requires only small sample volumes of water (ca. 12 mL) or sediment slurries and is rapid, convenient, accurate, and precise (R(2) = 0.9994, p < 0.0001) over a range of salinities and (15)N/(14)N ratios. It can provide data needed to quantify rates of ammonium regeneration, potential ammonium uptake, and dissimilatory nitrate reduction to ammonium (DNRA). Isotope ratio results agreed closely (R = 0.998, P = 0.001) with those determined independently by isotope ratio mass spectrometry for DNRA measurements or by ammonium isotope retention time shift liquid chromatography for water-column N-cycling experiments. Application of OX/MIMS should simplify experimental approaches and improve understanding of N-cycling rates and fate in a variety of freshwater and marine environments.
Direct observation of electrogenic NH4+ transport in ammonium transport (Amt) proteins
Wacker, Tobias; Garcia-Celma, Juan J.; Lewe, Philipp; Andrade, Susana L. A.
2014-01-01
Ammonium transport (Amt) proteins form a ubiquitous family of integral membrane proteins that specifically shuttle ammonium across membranes. In prokaryotes, archaea, and plants, Amts are used as environmental NH4+ scavengers for uptake and assimilation of nitrogen. In the eukaryotic homologs, the Rhesus proteins, NH4+/NH3 transport is used instead in acid–base and pH homeostasis in kidney or NH4+/NH3 (and eventually CO2) detoxification in erythrocytes. Crystal structures and variant proteins are available, but the inherent challenges associated with the unambiguous identification of substrate and monitoring of transport events severely inhibit further progress in the field. Here we report a reliable in vitro assay that allows us to quantify the electrogenic capacity of Amt proteins. Using solid-supported membrane (SSM)-based electrophysiology, we have investigated the three Amt orthologs from the euryarchaeon Archaeoglobus fulgidus. Af-Amt1 and Af-Amt3 are electrogenic and transport the ammonium and methylammonium cation with high specificity. Transport is pH-dependent, with a steep decline at pH values of ∼5.0. Despite significant sequence homologies, functional differences between the three proteins became apparent. SSM electrophysiology provides a long-sought-after functional assay for the ubiquitous ammonium transporters. PMID:24958855
Neiner, Doinita; Sevryugina, Yulia V; Schubert, David M
2016-09-06
The compound known since the 19th century as ammonium octaborate was structurally characterized revealing the ammonium salt of the ribbon isomer of the heptaborate anion, [B7O9(OH)5](2-), with boric acid and water molecules. Of composition (NH4)2B7.75O12.63·4.88H2O, it approximates the classical ammonium octaborate composition (NH4)2B8O13·6H2O and has the structural formula {(NH4)2[B7O9(OH)5]}4·3B(OH)3·5H2O. It spontaneously forms at room temperature in solid-state mixtures of ammonium tetraborate and ammonium pentaborate. It crystallizes in the monoclinic space group P21/c with a = 11.4137(2) Å, b = 11.8877(2) Å, c = 23.4459(3) Å, β = 90.092(1)°, V = 3181.19(8) Å(3), and Z = 2 and contains well-ordered ammonium cations and [B7O9(OH)5](2-) anions and disordered B(OH)3 and H2O molecules linked by extensive H bonding. Expeditious solid-state formation of the heptaborate anion under ambient conditions has important implications for development of practical syntheses of industrially useful borates.
Hydrogen Activation by Biomimetic [NiFe]-Hydrogenase Model Containing Protected Cyanide Cofactors
Manor, Brian C.; Rauchfuss, Thomas B.
2013-01-01
Described are experiments that allow incorporation of cyanide cofactors and hydride substrate into active site models [NiFe]-hydrogenases (H2ases). Complexes of the type (CO)2(CN)2Fe(pdt)Ni(dxpe), (dxpe = dppe, 1; dxpe = dcpe, 2) bind the Lewis acid B(C6F5)3 (BArF3) to give the adducts (CO)2(CNBArF3)2Fe(pdt)Ni(dxpe), (1(BArF3)2, 2(BArF3)2). Upon decarbonylation using amine oxides, these adducts react with H2 to give hydrido derivatives Et4N[(CO)(CNBArF3)2Fe(H)(pdt)Ni(dxpe)], (dxpe = dppe, Et4N[H3(BArF3)2]; dxpe = dcpe, Et4N[H4(BArF3)2]). Crystallographic analysis shows that Et4N[H3(BArF3)2] generally resembles the active site of the enzyme in the reduced, hydride-containing states (Ni-C/R). The Fe-H…Ni center is unsymmetrical with rFe-H = 1.51(3) and rNi-H = 1.71(3) Å. Both crystallographic and 19F NMR analysis show that the CNBArF3− ligands occupy basal and apical sites. Unlike cationic Ni-Fe hydrides, [H3(BArF3)2]− and [H4(BArF3)2]− oxidize at mild potentials, near the Fc+/0 couple. Electrochemical measurements indicate that in the presence of base, [H3(BArF3)2]− catalyzes the oxidation of H2. NMR evidence indicates dihydrogen bonding between these anionic hydrides and ammonium salts, which is relevant to the mechanism of hydrogenogenesis. In the case of Et4N[H3(BArF3)2], strong acids such as HCl induce H2 release to give the chloride Et4N[(CO)(CNBArF3)2Fe(pdt)(Cl)Ni(dppe)]. PMID:23899049
Infrared spectra of the ammonium ion in ammonium metavanadate NH 4VO 3
NASA Astrophysics Data System (ADS)
de Waal, D.; Heyns, A. M.; Range, K.-J.; Eglmeier, C.
The ND stretching modes of isotopically dilute NH 3D + ions in NH 4VO 3 are in agreement with the predicted splitting into C s, C s and C1(2) components under C s site symmetry for the NH +4 ion. The three bands observed represent the three NH bonding distances in the crystal, and the position, shape and low temperature behaviour of each band confirms the existence of two types of hydrogen bonding in NH 4VO 3. The low temperature infrared modes of NH +4 and ND +4 in NH 4VO 3 and ND 4VO 3, respectively, can be assigned under space group Pbcm. Temperature dependence of these modes also reflects the presence of both normal and bifurcated hydrogen bonds in NH 4VO 3.
Is electronegativity a useful descriptor for the pseudo-alkali metal NH4?
Whiteside, Alexander; Xantheas, Sotiris S; Gutowski, Maciej
2011-11-18
Molecular ions in the form of "pseudo-atoms" are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined one such property--the electronegativity--for the "pseudo-alkali metal" ammonium (NH(4)), and evaluated its reliability as a descriptor versus the electronegativities of the alkali metals. The computed properties of ammonium's binary complexes with astatine and of selected borohydrides confirm the similarity of NH(4) to the alkali metal atoms, although the electronegativity of NH(4) is relatively large in comparison to its cationic radius. We have paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation and reactivity), which can cause deviations from the behaviour expected of a conceptual "true alkali metal" with this electronegativity. These deviations allow for the discrimination of effects associated with the molecular nature of NH(4). Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Fluorographene based Ultrasensitive Ammonia Sensor
Tadi, Kiran Kumar; Pal, Shubhadeep; Narayanan, Tharangattu N.
2016-01-01
Single molecule detection using graphene can be brought by tuning the interactions via specific dopants. Electrostatic interaction between the most electronegative element fluorine (F) and hydrogen (H) is one of the strong interactions in hydrogen bonding, and here we report the selective binding of ammonia/ammonium with F in fluorographene (FG) resulting to a change in the impedance of the system. Very low limit of detection value of ~0.44 pM with linearity over wide range of concentrations (1 pM–0.1 μM) is achieved using the FG based impedance sensor, andthisscreen printed FG sensor works in both ionized (ammonium) and un-ionized ammonia sensing platforms. The interaction energies of FG and NH3/NH4+ are evaluated using density functional theory calculations and the interactions are mapped. Here FGs with two different amounts of fluorinecontents −~5 atomic% (C39H16F2) and ~24 atomic% (C39H16F12) - are theoretically and experimentally studied for selective, high sensitive and ultra-low level detection of ammonia. Fast responding, high sensitive, large area patternable FG based sensor platform demonstrated here can open new avenues for the development of point-of-care devices and clinical sensors. PMID:27142522
Chiasson, David M.; Loughlin, Patrick C.; Mazurkiewicz, Danielle; Mohammadidehcheshmeh, Manijeh; Fedorova, Elena E.; Okamoto, Mamoru; McLean, Elizabeth; Glass, Anthony D. M.; Smith, Sally E.; Bisseling, Ton; Tyerman, Stephen D.; Day, David A.; Kaiser, Brent N.
2014-01-01
Glycine max symbiotic ammonium transporter 1 was first documented as a putative ammonium (NH4+) channel localized to the symbiosome membrane of soybean root nodules. We show that Glycine max symbiotic ammonium transporter 1 is actually a membrane-localized basic helix–loop–helix (bHLH) DNA-binding transcription factor now renamed Glycine max bHLH membrane 1 (GmbHLHm1). In yeast, GmbHLHm1 enters the nucleus and transcriptionally activates a unique plasma membrane NH4+ channel Saccharomyces cerevisiae ammonium facilitator 1. Ammonium facilitator 1 homologs are present in soybean and other plant species, where they often share chromosomal microsynteny with bHLHm1 loci. GmbHLHm1 is important to the soybean rhizobium symbiosis because loss of activity results in a reduction of nodule fitness and growth. Transcriptional changes in nodules highlight downstream signaling pathways involving circadian clock regulation, nutrient transport, hormone signaling, and cell wall modification. Collectively, these results show that GmbHLHm1 influences nodule development and activity and is linked to a novel mechanism for NH4+ transport common to both yeast and plants. PMID:24707045
Chiasson, David M; Loughlin, Patrick C; Mazurkiewicz, Danielle; Mohammadidehcheshmeh, Manijeh; Fedorova, Elena E; Okamoto, Mamoru; McLean, Elizabeth; Glass, Anthony D M; Smith, Sally E; Bisseling, Ton; Tyerman, Stephen D; Day, David A; Kaiser, Brent N
2014-04-01
Glycine max symbiotic ammonium transporter 1 was first documented as a putative ammonium (NH4(+)) channel localized to the symbiosome membrane of soybean root nodules. We show that Glycine max symbiotic ammonium transporter 1 is actually a membrane-localized basic helix-loop-helix (bHLH) DNA-binding transcription factor now renamed Glycine max bHLH membrane 1 (GmbHLHm1). In yeast, GmbHLHm1 enters the nucleus and transcriptionally activates a unique plasma membrane NH4(+) channel Saccharomyces cerevisiae ammonium facilitator 1. Ammonium facilitator 1 homologs are present in soybean and other plant species, where they often share chromosomal microsynteny with bHLHm1 loci. GmbHLHm1 is important to the soybean rhizobium symbiosis because loss of activity results in a reduction of nodule fitness and growth. Transcriptional changes in nodules highlight downstream signaling pathways involving circadian clock regulation, nutrient transport, hormone signaling, and cell wall modification. Collectively, these results show that GmbHLHm1 influences nodule development and activity and is linked to a novel mechanism for NH4(+) transport common to both yeast and plants.
Tredwin, Christopher J; Young, Anne M; Georgiou, George; Shin, Song-Hee; Kim, Hae-Won; Knowles, Jonathan C
2013-02-01
Currently, most titanium implant coatings are made using hydroxyapatite and a plasma spraying technique. There are however limitations associated with plasma spraying processes including poor adherence, high porosity and cost. An alternative method utilising the sol-gel technique offers many potential advantages but is currently lacking research data for this application. It was the objective of this study to characterise and optimise the production of Hydroxyapatite (HA), fluorhydroxyapatite (FHA) and fluorapatite (FA) using a sol-gel technique and assess the rheological properties of these materials. HA, FHA and FA were synthesised by a sol-gel method. Calcium nitrate and triethylphosphite were used as precursors under an ethanol-water based solution. Different amounts of ammonium fluoride (NH4F) were incorporated for the preparation of the sol-gel derived FHA and FA. Optimisation of the chemistry and subsequent characterisation of the sol-gel derived materials was carried out using X-ray Diffraction (XRD) and Differential Thermal Analysis (DTA). Rheology of the sol-gels was investigated using a viscometer and contact angle measurement. A protocol was established that allowed synthesis of HA, FHA and FA that were at least 99% phase pure. The more fluoride incorporated into the apatite structure; the lower the crystallisation temperature, the smaller the unit cell size (changes in the a-axis), the higher the viscosity and contact angle of the sol-gel derived apatite. A technique has been developed for the production of HA, FHA and FA by the sol-gel technique. Increasing fluoride substitution in the apatite structure alters the potential coating properties. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Nagai, Tsukasa; Japan Society for the Promotion of Science, 1-8 Chiyoda-ku, Tokyo 102-8472; Tamura, Shinji
2010-07-15
Rare-earth ammonium sulfate octahydrates of R{sub 2}(SO{sub 4}){sub 3}.(NH{sub 4}){sub 2}SO{sub 4}.8H{sub 2}O (R=Pr, Nd, Sm, and Eu) were synthesized by a wet process, and the stable temperature region for the anhydrous R{sub 2}(SO{sub 4}){sub 3}.(NH{sub 4}){sub 2}SO{sub 4} form was clarified by thermogravimetry/differential thermal analysis, infrared, Raman, and electrical conductivity measurements. Detailed characterization of these double salts demonstrated that the thermal stability of anhydrous R{sub 2}(SO{sub 4}){sub 3}.(NH{sub 4}){sub 2}SO{sub 4} is different between the Pr, Nd salts and the Sm, Eu salts, and the thermal decomposition behavior of these salts was quite different from the previous reports. -more » Graphical abstract: Stable temperature range of anhydrous rare-earth ammonium sulfate R{sub 2}(SO{sub 4}){sub 3}.(NH{sub 4}){sub 2}SO{sub 4} was clarified by thermogravimetry/differential thermal analysis, infrared, Raman, and electrical conductivity measurements. Since the previous reports were based only on thermal analysis, the present work has more accurately determined the exact thermal stability of rare-earth ammonium sulfate solids.« less
Veillette, Marc; Avalos Ramirez, Antonio; Heitz, Michèle
2012-01-01
An evaluation of the effect of ammonium on the performance of two up-flow inorganic packed bed biofilters treating methane was conducted. The air flow rate was set to 3.0 L min(-1) for an empty bed residence time of 6.0 min. The biofilter was fed with a methane concentration of 0.30% (v/v). The ammonium concentration in the nutrient solution was increased by small increments (from 0.01 to 0.025 gN-NH(4) (+) L(-1)) for one biofilter and by large increments of 0.05 gN-NH(4) (+) L(-1) in the other biofilter. The total concentration of nitrogen was kept constant at 0.5 gN-NH(4) (+) L(-1) throughout the experiment by balancing ammonium with nitrate. For both biofilters, the methane elimination capacity, carbon dioxide production, nitrogen bed retention and biomass content decreased with the ammonium concentration in the nutrient solution. The biofilter with smaller ammonium increments featured a higher elimination capacity and carbon dioxide production rate, which varied from 4.9 to 14.3 g m(-3) h(-1) and from 11.5 to 30 g m(-3) h(-1), respectively. Denitrification was observed as some values of the nitrate production rate were negative for ammonium concentrations below 0.2 gN-NH(4) (+) L(-1). A Michalelis-Menten-type model fitted the ammonium elimination rate and the nitrate production rate.
Ranathunge, Kosala; Schreiber, Lukas; Bi, Yong-Mei; Rothstein, Steven J
2016-01-01
Non-optimal ammonium levels significantly alter root architecture, anatomy and root permeabilities for water and nutrient ions. Higher ammonium levels induced strong apoplastic barriers whereas it was opposite for lower levels. Application of nitrogen fertilizer increases crop productivity. However, non-optimal applications can have negative effects on plant growth and development. In this study, we investigated how different levels of ammonium (NH4 (+)) [low (30 or 100 μM) or optimum (300 μM) or high (1000 or 3000 μM)] affect physio-chemical properties of 1-month-old, hydroponically grown rice roots. Different NH4 (+) treatments markedly altered the root architecture and anatomy. Plants grown in low NH4 (+) had the longest roots with a weak deposition of suberised and lignified apoplastic barriers, and it was opposite for plants grown in high NH4 (+). The relative expression levels of selected suberin and lignin biosynthesis candidate genes, determined using qRT-PCR, were lowest in the roots from low NH4 (+), whereas, they were highest for those grown in high NH4 (+). This was reflected by the suberin and lignin contents, and was significantly lower in roots from low NH4 (+) resulting in greater hydraulic conductivity (Lp r) and solute permeability (P sr) than roots from optimum NH4 (+). In contrast, roots grown at high NH4 (+) had markedly greater suberin and lignin contents, which were reflected by strong barriers. These barriers significantly decreased the P sr of roots but failed to reduce the Lp r below those of roots grown in optimum NH4 (+), which can be explained in terms of the physical properties of the molecules used and the size of pores in the apoplast. It is concluded that, in rice, non-optimal NH4 (+) levels differentially affected root properties including Lp r and P sr to successfully adapt to the changing root environment.
Acid-catalyzed oxidation of 2,4-dichlorophenoxyacetic acid by ammonium nitrate in aqueous solution
DOE Office of Scientific and Technical Information (OSTI.GOV)
Leavitt, D.D.; Abraham, M.A.
1990-04-01
2,4-Dichlorophenoxyacetic acid (2,4-D) was oxidized to CO{sub 2} and water by homogeneous, liquid-phase reaction with ammonium nitrate at temperatures between 250 and 450{degree}F and pressures below 100 psi. N{sub 2} and N{sub 2}O were produced from the thermal decomposition of the ammonium nitrate oxidant. An unexpected maximum in conversion was observed at an intermediate reaction temperature, which was consistent with rapid thermal decomposition of the NH{sub 4}NO{sub 3} oxidant. Postulated reaction pathways consisting of simultaneous oxidation of 2,4-D and decomposition of the oxidant allowed estimation of kinetic constants from best-fit analysis of the data. The proposed reaction model provided amore » mathematical description of 2,4-D conversion, which allowed extrapolation of the results to reaction conditions and reactor configurations that were not experimentally investigated.« less
Effects of Remineralization Agents on Artificial Carious Lesions.
Savas, Selcuk; Kucukyilmaz, Ebru; Celik, Esra Uzer
2016-11-15
The purpose of this study was to evaluate the remineralization potentials of different agents on demineralized enamel surfaces. Four hundred and sixty extracted human molars with artificial carious lesions were divided into six groups: (1) control; (2) acidulated phosphate fluoride (APF); (3) Curodont Repair (CR); (4) silver diamine fluoride (SDF); (5) ammonium hexafluorosilicate (SiF); and (6) SiF plus cetylpiridinium chloride (SiF+CPC). They were subdivided according to immersion periods (seven out of 30 days). After demineralization and remineralization procedures, microhardness test (VHN), energy-dispersive X-ray spectroscopy analysis, and confocal laser scanning microscopy evaluation were performed. The data were statistically analyzed. By the 30-day remineralization, the mean differences in VHN values were ranked as follows, in order: (1) CR; (2) APF; (3) SiF; (4) SiF+CPC; (5) SDF; and (6) control (P<0.05). The calcium (Ca) content and calcium/phosphate ratio for all groups were significantly higher after 30 days (P<0.05). The greatest lesion depth changes were observed in the CR, APF, SiF, and SDF groups (P<0.05), while the greatest fluorescence changes were observed in the APF, SiF, and CR groups (P<0.05). The remineralization was most successful in the CR, APF, and SiF groups, with higher values than for those of the other treatments.
NASA Astrophysics Data System (ADS)
Makrlík, Emanuel; Sýkora, David; Böhm, Stanislav; Kvíčalová, Magdalena; Vaňura, Petr
2018-05-01
By means of electrospray ionisation mass spectrometry, it was evidenced experimentally that the ammonium cation (NH4+) reacts with the electroneutral [2.2.2]paracyclophane ligand (C24H24) to form the cationic complex [NH4(C24H24)]+. Moreover, applying quantum chemical calculations, the most probable conformation of the proven [NH4(C24H24)]+ complex was solved. In the complex [NH4(C24H24)]+ having a symmetry very close to C3, the 'central' cation NH4+ is coordinated by three strong bifurcated intramolecular hydrogen bonds to the corresponding six carbon atoms from the three benzene rings of [2.2.2]paracyclophane via cation-π interaction. Finally, the interaction energy, E(int), of the considered complex [NH4(C24H24)]+ was evaluated as -625.8 kJ/mol, confirming the formation of this fascinating complex species as well. It means that the [2.2.2]paracyclophane ligand can be considered as an effective receptor for the ammonium cation in the gas phase.
NASA Astrophysics Data System (ADS)
Vishwakarma, Siddharth; Kumar, Ajit; Pandey, Abha; Upadhyay, K. K.
2017-01-01
A chromogenic fluoride probe bearing bis imine groups having dual -NH functionality (BSB) has been designed, synthesised and structurally characterized by its single crystal X-ray diffraction studies. The BSB could visually and spectroscopically recognise F- with high selectivity over other anions by exhibiting intense chromogenic response (from colourless to red) for F- in acetonitrile solution. The UV-visible titration and 1H NMR titration experiments indicated that the observed changes occur via a combined process including hydrogen bonding and deprotonation between the BSB and F-. Moreover theoretical calculations at the Density Functional Theory (DFT) level shed further light upon probe design strategy and the nature of interactions between BSB and F-. The limit of detection and binding constant of BSB towards F- were found to be 6.9 × 10- 7 M and 1.42 ± 0.069 × 108 M- 2 respectively. Finally, by using F- and H+ as chemical inputs and the absorbance as output, a INHIBIT logic gate was constructed, which exhibits "Multi-write" ability without obvious degradation in its optical output.
Integration of CO2 Capture and Mineral Carbonation by Using Recyclable Ammonium Salts
Wang, Xiaolong; Maroto-Valer, M Mercedes
2011-01-01
A new approach to capture and store CO2 by mineral carbonation using recyclable ammonium salts was studied. This process integrates CO2 capture with mineral carbonation by employing NH3, NH4HSO4, and NH4HCO3 in the capture, mineral dissolution, and carbonation steps, respectively. NH4HSO4 and NH3 can then be regenerated by thermal decomposition of (NH4)2SO4. The use of NH4HCO3 as the source of CO2 can avoid desorption and compression of CO2. The mass ratio of Mg/NH4HCO3/NH3 is the key factor controlling carbonation and the optimum ratio of 1:4:2 gives a conversion of Mg ions to hydromagnesite of 95.5 %. Thermogravimetric analysis studies indicated that the regeneration efficiency of NH4HSO4 and NH3 in this process is 95 %. The mass balance of the process shows that about 2.63 tonnes of serpentine, 0.12 tonnes of NH4HSO4, 7.48 tonnes of NH4HCO3, and 0.04 tonnes of NH3 are required to sequester 1 tonne of CO2 as hydromagnesite. PMID:21732542
Ammonium affects cell viability to inhibit root growth in Arabidopsis * #
Qin, Cheng; Yi, Ke-ke; Wu, Ping
2011-01-01
Ammonium (NH4 +) is an important form of nitrogen nutrient for most plants, yet is also a stressor for many of them. However, the primary events of NH4 + toxicity at the cellular level are still unclear. Here, we showed that NH4 + toxicity can induce the root cell death in a temporal pattern which primarily occurs in the cells of root maturation and elongation zones, and then spreads to the cells in the meristem and root cap. The results from the NH4 +-hypersensitive mutant hsn1 further confirmed our findings. Taken together, NH4 + toxicity inhibits primary root growth by inhibiting cell elongation and division and inducing root cell death. PMID:21634041
Ammonium removal from high-strength aqueous solutions by Australian zeolite.
Wijesinghe, D Thushari N; Dassanayake, Kithsiri B; Sommer, Sven G; Jayasinghe, Guttila Y; J Scales, Peter; Chen, Deli
2016-07-02
Removal of ammonium nitrogen (NH4(+)-N) particularly from sources which are highly rich in nitrogen is important for addressing environmental pollution. Zeolites, aluminosilicate minerals, are commonly used as commercial adsorbents and ion-exchange medium in number of commercial applications due to its high adsorption capacity of ammonium (NH4(+)). However, detailed investigations on NH4(+) adsorption and ion exchange capacities of Australian natural zeolites are rare, particularly under higher NH4(+) concentrations in the medium. Therefore, this study was conducted to determine NH4(+) adsorption characteristics of Australian natural zeolites at high NH4(+) concentrations with and without other chemical compounds in an aqueous solution. Results showed that initial NH4(+) concentration, temperature, reaction time, and pH of the solution had significant effects on NH4(+) adsorption capacity of zeolite. Increased retention time and temperature generally had a positive impact on adsorption. Freundlich model fitted well with adsorption process of Australian natural zeolites; however, Langmuir model had best fitted for the adsorption process of sodium (Na(+)) treated zeolites. NaCl treatment increased the NH4(+) adsorption capacity of Australian zeolites by 25% at 1000 mg-N, NH4(+) solution. The maximum adsorption capacity of both natural Australian zeolites and Na(+) treated zeolites were estimated as 9.48 and 11.83 mg-N/g, respectively, which is lower than many zeolites from other sources. Compared to the NH4(+) only medium, presence of other competitive ions and acetic acid in the medium (resembling composition in digested swine manure slurries) reduced NH4(+) removal of natural and Na(+) treated zeolites by 44% and 57%, respectively. This suggests detailed investigations are required to determine practically achievable NH4(+) -N removal potential of zeolites for applications in complex mediums such as animal manure slurries.
Benz, R.
1964-03-01
A process for preparing pure plutonium trifluoride is described in which a refractory plutonium compound is contacted with ammonium fluoride in a closed container at a pressure of at least 10 atmospheres and a temperature of about 550 deg C. (AEC)
Parsons, Matthew T; Riffell, Jenna L; Bertram, Allan K
2006-07-06
Using an electrodynamic balance, we determined the relative humidity (RH) at which aqueous inorganic-malonic acid particles crystallized, with ammonium sulfate ((NH(4))(2)SO(4)), letovicite ((NH(4))(3)H(SO(4))(2)), or ammonium bisulfate (NH(4)HSO(4)) as the inorganic component. The results for (NH(4))(2)SO(4)-malonic acid particles and (NH(4))(3)H(SO(4))(2)-malonic acid particles show that malonic acid decreases the crystallization RH of the inorganic particles by less than 7% RH when the dry malonic acid mole fraction is less than 0.25. At a dry malonic acid mole fraction of about 0.5, the presence of malonic acid can decrease the crystallization RH of the inorganic particles by up to 35% RH. For the NH(4)HSO(4)-malonic acid particles, the presence of malonic acid does not significantly modify the crystallization RH of the inorganic particles for the entire range of dry malonic acid mole fractions studied; in all cases, either the particles did not crystallize or the crystallization RH was close to 0% RH. Size dependent measurements show that the crystallization RH of aqueous (NH(4))(2)SO(4) particles is not a strong function of particle volume. However, for aqueous (NH(4))(2)SO(4)-malonic acid particles (with dry malonic acid mole fraction = 0.36), the crystallization RH is a stronger function of particle volume, with the crystallization RH decreasing by 6 +/- 3% RH when the particle volume decreases by an order of magnitude. To our knowledge, these are the first size dependent measurements of the crystallization RH of atmospherically relevant inorganic-organic particles. These results suggest that for certain organic mole fractions the particle size and observation time need to be considered when extrapolating laboratory crystallization results to atmospheric scenarios. For aqueous (NH(4))(2)SO(4) particles, the homogeneous nucleation rate data are a strong function of RH, but for aqueous (NH(4))(2)SO(4)-malonic acid particles (with dry organic mole fraction = 0.36), the rates are not as dependent on RH. The homogeneous nucleation rates for aqueous (NH(4))(2)SO(4) particles were parametrized using classical nucleation theory, and from this analysis we determined that the interfacial surface tension between the crystalline ammonium sulfate critical nucleus and an aqueous ammonium sulfate solution is between 0.053 and 0.070 J m(-2).
Near infrared detection of ammonium minerals.
Krohn, M.D.; Altaner, S.P.
1987-01-01
Diagnostic near-infrared spectral features have been identified for minerals with ammonium (NH4+) bound in the crystal structure. Near-infrared detection of NH4-bearing minerals may provide useful information for prospecting for certain ore deposits and may provide a better understanding of the nitrogen cycle within geologic environments.-from Authors
Kelly, Victoria R; Lovett, Gary M; Weathers, Kathleen C; Likens, Gene E
2005-06-01
Ammonium (NH(4)(+)) concentrations in air and precipitation at the Institute of Ecosystem Studies (IES) in southeastern New York, USA declined over an 11-year period from 1988 to 1999, but increased from 1999 to 2001. These trends in particulate NH(4)(+) correlated well with trends in particulate SO(4)(2-) over the 1988-2001 period. The NH(4)(+) trends were not as well correlated with local cattle and milk production, which declined continuously throughout the period. This suggests that regional transport of SO(4)(2-) may have a greater impact on concentrations of NH(4)(+) and subsequent deposition than local agricultural emissions of NH(3). Ammonium concentrations in precipitation correlated significantly with precipitation SO(4)(2-) concentrations for the 1984-2001 period although NH(4)(+) in precipitation increased after 1999 and SO(4)(2-) in precipitation continued to decline after 1999. The correlation between NH(4)(+) and SO(4)(2-) was stronger for particulates than for precipitation. Particulate NH(4)(+) concentrations were also correlated with particulate SO(4)(2-) concentrations at 31 of 35 eastern U.S. CASTNet sites that had at least 10 years of data. Air concentrations of NH(4)(+) and SO(4)(2-) were more strongly correlated at the sites that were located within an agricultural landscape than in forested sites. At most of the sites there was either no trend or a decrease in NH(4)(+) dry deposition during the 1988-2001 period. The sites that showed an increasing trend in NH(4)(+) dry deposition were generally located in the southeastern U.S. The results of this study suggest that, in the northeastern U.S., air concentrations of NH(4)(+) and subsequent deposition may be more closely linked to SO(4)(2-) and thus SO(2) emissions than with NH(3) emissions. These results also suggest that reductions in S emissions have reduced NH(4)(+) transport to and NH(4)(+)-N deposition in the Northeast.
NASA Technical Reports Server (NTRS)
Rideout, J. W.; Raper, C. D. Jr; Raper CD, J. r. (Principal Investigator)
1994-01-01
While it is known that superoptimal concentrations of the nitrate (NO3-) ion in solution culture do not increase NO3- uptake or dry matter accumulation, the same is not known for the ammonium (NH4+) ion. An experiment was conducted utilizing flowing solution culture with pH control to investigate the influence of superoptimal NH4+ concentrations on dry matter, nitrogen (N), potassium (K), calcium (Ca), and magnesium (Mg) accumulation by nonnodulated soybean plants. Increasing the NH4+ concentration in solution from 1 to 10 mM did not affect dry matter or N accumulation. Accumulations of K, Ca, and Mg were slightly decreased with increased NH4+ concentration. The NH4+ uptake system, which is saturated at less than 1mM NH4+, is able to regulate uptake of NH4+ at concentrations as high as 10 mM.
Impact of Ammonium on Syntrophic Organohalide-Respiring and Fermenting Microbial Communities
Fajardo-Williams, Devyn; Kegerreis, Kylie L.; Parameswaran, Prathap
2016-01-01
ABSTRACT Syntrophic interactions between organohalide-respiring and fermentative microorganisms are critical for effective bioremediation of halogenated compounds. This work investigated the effect of ammonium concentration (up to 4 g liter−1 NH4+-N) on trichloroethene-reducing Dehalococcoides mccartyi and Geobacteraceae in microbial communities fed lactate and methanol. We found that production of ethene by D. mccartyi occurred in mineral medium containing ≤2 g liter−1 NH4+-N and in landfill leachate. For the partial reduction of trichloroethene (TCE) to cis-dichloroethene (cis-DCE) at ≥1 g liter−1 NH4+-N, organohalide-respiring dynamics shifted from D. mccartyi and Geobacteraceae to mainly D. mccartyi. An increasing concentration of ammonium was coupled to lower metabolic rates, longer lag times, and lower gene abundances for all microbial processes studied. The methanol fermentation pathway to acetate and H2 was conserved, regardless of the ammonium concentration provided. However, lactate fermentation shifted from propionic to acetogenic at concentrations of ≥2 g liter−1 NH4+-N. Our study findings strongly support a tolerance of D. mccartyi to high ammonium concentrations, highlighting the feasibility of organohalide respiration in ammonium-contaminated subsurface environments. IMPORTANCE Contamination with ammonium and chlorinated solvents has been reported in numerous subsurface environments, and these chemicals bring significant challenges for in situ bioremediation. Dehalococcoides mccartyi is able to reduce the chlorinated solvent trichloroethene to the nontoxic end product ethene. Fermentative bacteria are of central importance for organohalide respiration and bioremediation to provide D. mccartyi with H2, their electron donor, acetate, their carbon source, and other micronutrients. In this study, we found that high concentrations of ammonium negatively correlated with rates of trichloroethene reductive dehalogenation and fermentation. However, detoxification of trichloroethene to nontoxic ethene occurred even at ammonium concentrations typical of those found in animal waste (up to 2 g liter−1 NH4+-N). To date, hundreds of subsurface environments have been bioremediated through the unique metabolic capability of D. mccartyi. These findings extend our knowledge of D. mccartyi and provide insight for bioremediation of sites contaminated with chlorinated solvents and ammonium. PMID:27303735
Process for synthesis of ammonia borane for bulk hydrogen storage
Autrey, S Thomas [West Richland, WA; Heldebrant, David J [Richland, WA; Linehan, John C [Richland, WA; Karkamkar, Abhijeet J [Richland, WA; Zheng, Feng [Richland, WA
2011-03-01
The present invention discloses new methods for synthesizing ammonia borane (NH.sub.3BH.sub.3, or AB). Ammonium borohydride (NH.sub.4BH.sub.4) is formed from the reaction of borohydride salts and ammonium salts in liquid ammonia. Ammonium borohydride is decomposed in an ether-based solvent that yields AB at a near quantitative yield. The AB product shows promise as a chemical hydrogen storage material for fuel cell powered applications.
Rocking-Chair Ammonium-Ion Battery: A Highly Reversible Aqueous Energy Storage System.
Wu, Xianyong; Qi, Yitong; Hong, Jessica J; Li, Zhifei; Hernandez, Alexandre S; Ji, Xiulei
2017-10-09
Aqueous rechargeable batteries are promising solutions for large-scale energy storage. Such batteries have the merit of low cost, innate safety, and environmental friendliness. To date, most known aqueous ion batteries employ metal cation charge carriers. Here, we report the first "rocking-chair" NH 4 -ion battery of the full-cell configuration by employing an ammonium Prussian white analogue, (NH 4 ) 1.47 Ni[Fe(CN) 6 ] 0.88 , as the cathode, an organic solid, 3,4,9,10-perylenetetracarboxylic diimide (PTCDI), as the anode, and 1.0 m aqueous (NH 4 ) 2 SO 4 as the electrolyte. This novel aqueous ammonium-ion battery demonstrates encouraging electrochemical performance: an average operation voltage of ca. 1.0 V, an attractive energy density of ca. 43 Wh kg -1 based on both electrodes' active mass, and excellent cycle life over 1000 cycles with 67 % capacity retention. Importantly, the topochemistry results of NH 4 + in these electrodes point to a new paradigm of NH 4 + -based energy storage. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Infrared spectra of the ammonium ion in ammonium hexavanadate (NH 4) 2V 6O 16
NASA Astrophysics Data System (ADS)
de Waal, D.; Heyns, A. M.; Range, K.-J.; Eglmeier, C.
The infrared bands of the NH +4 and ND +4 groups in (NH 4) 2V 6O 16 and its deuterated analogue can be assigned with a fair amount of certainty at 90 K under the space group P2 1/ m( C22 h). The ND stretching modes of isotopically dilute NH 3D + ions in the crystal are in agreement with the predicted splitting into Cs, Cs and C1(2) components. The frequencies, shapes and temperature dependence of these modes suggest that both normal and bifurcated hydrogen bonds are formed. The latter closely resembles corresponding bonds in NH 4VO 3, but the normal hydrogen bonds are not as strong as the similar bonds in NH 4VO 3. This can be expected as NH +4 ions are dynamic in character in (NH 4) 2V 6O 16 and remain so down to temperatures of 90 K.
Bai, Ling; Ma, Xiaonan; Zhang, Guozeng; Song, Shufei; Zhou, Yun; Gao, Lijie; Miao, Yuchen; Song, Chun-Peng
2014-01-01
Ammonium (NH4+) is both a necessary nutrient and an important signal in plants, but can be toxic in excess. Ammonium sensing and regulatory mechanisms in plant cells have not been fully elucidated. To decipher the complex network of NH4+ signaling, we analyzed [Ca2+]cyt-associated protein kinase (CAP) genes, which encode signaling components that undergo marked changes in transcription levels in response to various stressors. We demonstrated that CAP1, a tonoplast-localized receptor-like kinase, regulates root hair tip growth by maintaining cytoplasmic Ca2+ gradients. A CAP1 knockout mutant (cap1-1) produced elevated levels of cytoplasmic NH4+. Furthermore, root hair growth of cap1-1 was inhibited on Murashige and Skoog medium, but NH4+ depletion reestablished the Ca2+ gradient necessary for normal growth. The lower net NH4+ influx across the vacuolar membrane and relatively alkaline cytosolic pH of cap1-1 root hairs implied that mutation of CAP1 increased NH4+ accumulation in the cytoplasm. Furthermore, CAP1 functionally complemented the npr1 (nitrogen permease reactivator protein) kinase yeast mutant, which is defective in high-affinity NH4+ uptake via MEP2 (methylammonium permease 2), distinguishing CAP1 as a cytosolic modulator of NH4+ levels that participates in NH4+ homeostasis-regulated root hair growth by modulating tip-focused cytoplasmic Ca2+ gradients. PMID:24769480
Fabrication of thin film TiO2 nanotube arrays on Co-28Cr-6Mo alloy by anodization.
Ni, Jiahua; Frandsen, Christine J; Noh, Kunbae; Johnston, Gary W; He, Guo; Tang, Tingting; Jin, Sungho
2013-04-01
Titanium oxide (TiO2) nanotube arrays were prepared by anodization of Ti/Au/Ti trilayer thin film DC sputtered onto forged and cast Co-28Cr-6Mo alloy substrate at 400 °C. Two different types of deposited film structures (Ti/Au/Ti trilayer and Ti monolayer), and two deposition temperatures (room temperature and 400 °C) were compared in this work. The concentrations of ammonium fluoride (NH4F) and H2O in glycerol electrolyte were varied to study their effect on the formation of TiO2 nanotube arrays on a forged and cast Co-28Cr-6Mo alloy. The results show that Ti/Au/Ti trilayer thin film and elevated temperature sputtered films are favorable for the formation of well-ordered nanotube arrays. The optimized electrolyte concentration for the growth of TiO2 nanotube arrays on forged and cast Co-28Cr-6Mo alloy was obtained. This work contains meaningful results for the application of a TiO2 nanotube coating to a CoCr alloy implant for potential next-generation orthopedic implant surface coatings with improved osseointegrative capabilities. Copyright © 2013 Elsevier B.V. All rights reserved.
Effect of Ti Substrate Ion Implantation on the Physical Properties of Anodic TiO2 Nanotubes
NASA Astrophysics Data System (ADS)
Jedi-Soltanabadi, Zahra; Ghoranneviss, Mahmood; Ghorannevis, Zohreh; Akbari, Hossein
2018-03-01
The influence of nitrogen-ion implantation on the titanium (Ti) surface is studied. The nontreated Ti and the Ti treated with ion implantation were anodized in an ethylene-glycol-based electrolyte solution containing 0.3 wt% ammonium fluoride (NH4F) and 3 vol% deionized (DI) water at a potential of 60 V for 1 h at room temperature. The current density during the growth of the TiO2 nanotubes was monitored in-situ. The surface roughnesses of the Ti substrates before and after the ion implantation were investigated with atomic force microscopy (AFM). The surface roughness was lower for the treated Ti substrate. The morphology of the anodic TiO2 nanotubes was studied by using field-emission scanning electron microscopy (FESEM). Clearly, the titanium nanotubes grown on the treated substrate were longer. In addition, some ribs were observed on their walls. The optical band gap of the anodic TiO2 nanotubes was characterized by using a diffuse reflection spectral (DRS) analysis. The anodic TiO2 nanotubes grown on the treated Ti substrate revealed a band gap energy of approximately 3.02 eV.
Bose, Purnandhu; Ahamed, B Nisar; Ghosh, Pradyut
2011-03-21
A series of new symmetrically functionalized guanidinium chlorides (S1-S10) are synthesized in good yields and their sensing ability toward anions is studied in MeCN-DMF (24 : 1) (v/v). The absorption bands of these molecules in the presence of anions are tuned by varying the functional groups attached to the guanidinium moiety (which resembles urea) with respect to (i) aromaticity (S1-S4), (ii) electron induction effect (S1, S5-S9), (iii) positional isomeric effect (S7-S9), (iv) indole functionality (S10) of the conjugated aryl units. Anions that are above Cl(-) in the Hofmeister series (F(-), AcO(-), H(2)PO(4)(-)) are eligible as an analyte in this series of molecules whereas less basic anions than Cl(-) do not cause any interference. Thus, this series of molecules are suitable for the detection of anions in the narrow window of the Hofmeister series. Out of all the anions, only fluoride causes vivid colour changes from yellow to red to reddish orange and finally to blue, irrespective of the increasing aromaticity, induction and positional isomeric effect of the substituent that is attached to the guanidinium moiety. Interestingly, S9 has shown the ability to sense distinctly both F(-) and AcO(-) colourimetrically. Further S10, a sensor attached with indole functionality shows selective sensing of F(-) colourimetrically with a NIR signature at ∼930 nm though both these outputs are very unstable in nature. Stability constants for complex formation of S1-S10 (except S5) with F(-), AcO(-) are calculated by UV-vis titration experiments. Finally single crystal X-ray structural studies on the species 1 formed upon treating S6 with sodium fluoride confirms -NH deprotonation, whereas the reaction of S6 and S2 with sodium benzoate shows 1:1 host:guest binding that results in complexes 2 and 3 respectively.
Ammonium salt corrosion in hydrotreating unit stripper column overhead systems
DOE Office of Scientific and Technical Information (OSTI.GOV)
Shargay, C.A.; Jacobs, G.E.; Price, M.D.
In the past, the presence of ammonium bisulfide (NH{sub 4}HS) or ammonium chloride (NH{sub 4}Cl) in hydrotreater stripper overheads was relatively rare. However, designs of newer units and revamps to older units, are resulting in corrosive levels of NH{sub 4}HS or NH{sub 4}Cl in overhead systems. This is primarily due to the addition of a hot high pressure separator (HHPS) with the bottoms going directly (or through another separator) to the stripper. This paper presents data on one corrosion case history in detail, a summary of another case history reported in Retln-Cor 3.0 and the results of a brief surveymore » targeted to units with HHPS designs. Some correlations of the process conditions to the severity of corrosion are made based on the survey results, and recommended materials selection and other corrosion control methods to minimize the risk of this problem are given.« less
Release Of Gaseous NH(3) From NH(4)CIO(4) By HTPB-Bonding Agents
NASA Technical Reports Server (NTRS)
Mccomb, James C.
1993-01-01
Report describes experimental study of rate of generation of ammonia and total amount of ammonia generated by chemical reactions between bonding agents and grains of ammonium perchlorate in solid rocket propellants. Also provides insight into mechanisms of chemical reactions between several types of organic amines with solid ammonium perchlorate.
AMBIENT AMMONIA AND AMMONIUM AEROSOL ACROSS A REGION OF VARIABLE AMMONIA EMISSION DENSITY
The paper presents one year of ambient ammonia (NH3), ammonium (NH4+), hydrochloric acid (HCI), chloride (CI¯), nitric acid (HNO3), nitrate (NO3¯), nitrous acid (HONO), sulfur dioxide (SO2), and sulfate (SO4
USDA-ARS?s Scientific Manuscript database
Soil drought, that can be enhanced by global warming increases ammonia (NH3) volatilization. This laboratory study was conducted with two soils: Krome Gravelly Loam (KGL) from Florida and Warden Silt Loam (WSL) from Washington State and two fertilizers: Ammonium sulfate [(NH4)2SO4] or ammonium nitra...
In this study, we present approximately 1 year (October 1998 - September 1999) of 12-hour mean ammonia [NH3], ammonium [NH4(+)], hydrochloric acid [HCl], nitrate [NO3(-)], nitric acid [HNO3], nitrous acid [HNO2], sulfate [SO4(- -)], and sulfur dioxide [SO2] concentrations measure...
Determining nitrate and ammonium requirements for optimal in vitro response of diverse pear species
USDA-ARS?s Scientific Manuscript database
Inorganic nitrate (NO3-) and ammonium (NH4+) are the two major components in nitrogen (N) nutrition of typical tissue culture growth media, and the total amounts and ratios influence both shoot induction and differentiation. This study was designed to determine the optimal N requirements and NH4+ to...
Borysiuk, Klaudia; Ostaszewska-Bugajska, Monika; Vaultier, Marie-Noëlle; Hasenfratz-Sauder, Marie-Paule; Szal, Bożena
2018-01-01
Nitrate (NO3–) and ammonium (NH4+) are prevalent nitrogen (N) sources for plants. Although NH4+ should be the preferred form of N from the energetic point of view, ammonium nutrition often exhibits adverse effects on plant physiological functions and induces an important growth-limiting stress referred as ammonium syndrome. The effective incorporation of NH4+ into amino acid structures requires high activity of the mitochondrial tricarboxylic acid cycle and the glycolytic pathway. An unavoidable consequence of glycolytic metabolism is the production of methylglyoxal (MG), which is very toxic and inhibits cell growth in all types of organisms. Here, we aimed to investigate MG metabolism in Arabidopsis thaliana plants grown on NH4+ as a sole N source. We found that changes in activities of glycolytic enzymes enhanced MG production and that markedly elevated MG levels superseded the detoxification capability of the glyoxalase pathway. Consequently, the excessive accumulation of MG was directly involved in the induction of dicarbonyl stress by introducing MG-derived advanced glycation end products (MAGEs) to proteins. The severe damage to proteins was not within the repair capacity of proteolytic enzymes. Collectively, our results suggest the impact of MG (mediated by MAGEs formation in proteins) in the contribution to NH4+ toxicity symptoms in Arabidopsis. PMID:29881392
Wang, Chen; Lei, Ying Duan; Wania, Frank
2016-12-06
Dissolved inorganic salts influence the partitioning of organic compounds into the aqueous phase. This influence is especially significant in atmospheric aerosol, which usually contains large amounts of ions, including sodium, ammonium, chloride, sulfate, and nitrate. However, empirical data on this salt effect are very sparse. Here, the partitioning of numerous organic compounds into solutions of Na 2 SO 4 , NH 4 Cl, and NH 4 NO 3 was measured and compared with existing data for NaCl and (NH 4 ) 2 SO 4 . Salt mixtures were also tested to establish whether the salt effect is additive. In general, the salt effect showed a decreasing trend of Na 2 SO 4 > (NH) 2 SO 4 > NaCl > NH 4 Cl > NH 4 NO 3 for the studied organic compounds, implying the following relative strength of the salt effect of individual anions: SO 4 2- > Cl - > NO 3 - and of cations: Na + > NH 4 + . The salt effect of different salts is moderately correlated. Predictive models for the salt effect were developed based on the experimental data. The experimental data indicate that the salt effect of mixtures may not be entirely additive. However, the deviation from additivity, if it exists, is small. Data of very high quality are required to establish whether the effect of constituent ions or salts is additive or not.
Recombination of electrons with NH4/+/-/NH3/n-series ions
NASA Technical Reports Server (NTRS)
Huang, C.-M.; Biondi, M. A.; Johnsen, R.
1976-01-01
The paper examines the recombination of electrons with ammonium-series cluster ions, NH4(+)-(NH3)n, for two reasons: (1) NH4(+) may be a significant ion in the lower atmospheres of the earth and the outer planets, and (2) to investigate the weak temperature dependence of the cluster ion's recombination coefficient. A microwave afterglow mass spectrometer was used to determine the recombination coefficients for the first five members of the ammonium series, (18+) through (86+), at temperatures between 200 and 410 K. The electron temperature dependence of the recombination coefficient was determined for (35+) and (52+), the n = 1 and 2 cluster ions, over the temperature range 300-3000 K.
Ciesielski, Slawomir; Kulikowska, Dorota; Kaczowka, Ewelina; Kowal, Przemysław
2010-07-01
Differences in DNA banding patterns, obtained by ribosomal intergenic spacer analysis (RISA), and nitrification were followed in a moving-bed biofilm reactor (MBBR) receiving municipal landfill leachate. Complete nitrification (> 99%) to nitrate was obtained in the two-stage MBBR system with an ammonium load of 1.09 g N-NH(4)/m(2).d. Increasing the ammonium load to 2.03 g N-NH(4)/m(2).d or more caused a decline in process efficiency to 70-86%. Moreover, at the highest ammonium load (3.76 g N-NH(4)/m(2).d), nitrite was the predominant product of nitrification. Community succession was evident in both compartments in response to changes in ammonium load. Non-metric multidimensional scaling (NMDS) supported by similarity analysis (ANOSIM) showed that microbial biofilm communities differed between compartments. The microbial biofilm was composed mainly of ammonia-oxidizing bacteria (AOB), with Nitrosomonas europeae and N. eutropha being most abundant. These results suggest that high ammonium concentrations select for particular AOB strains.
Hydrometallurgical Separation of Niobium and Tantalum: A Fundamental Approach
NASA Astrophysics Data System (ADS)
Nete, Motlalepula; Purcell, Walter; Nel, Johann T.
2016-02-01
A mixture of pure Ta2O5 and Nb2O5 was dissolved using two different fluxes, namely NH4F·HF and Na2HPO4/NaH2PO4·H2O. Selective precipitation and ion exchange were used as separation techniques. Selective precipitation using p-phenylediamine in a fluoride matrix resulted in the isolation of 73(3)% tantalum accompanied by 23(5)% niobium. A separation factor of 11(4) was obtained. A single solvent extraction step using methyl-isobutyl ketone at a 4 M H2SO4 yielded excellent Ta and Nb separation in the fluoride solution with 80% of the Ta and only 2% Nb recovered in the organic layer. A two-step extraction recovered 100% Ta at 0.5-4 M H2SO4 with a separation factor of ~2000. A study of the extraction mechanism indicated that the stability of the protonated compounds such as H2TaF7/H2NbOF5 is in the extraction and separation determining steps in this process. A K' (double de-protonated constant) of approximately 0.2 was calculated for H2TaF7. Only 91.7% Nb and 73.4% Ta were recovered from anion separation using strong Amberlite resin and 96.1% Nb and 52.3% using the weak Dowex Marathon resin from fluoride dissolution.
GSA-1/ARG1 protects root gravitropism in Arabidopsis under ammonium stress.
Zou, Na; Li, Baohai; Chen, Hao; Su, Yanhua; Kronzucker, Herbert J; Xiong, Liming; Baluška, František; Shi, Weiming
2013-10-01
Gravitropism plays a critical role in plant growth and development, plant stability and acclimation to changes in water and nutrient availability. Ammonium (NH4(+)) is well known to have profound effects on root growth, but its impacts on gravitropism are poorly understood. To determine which genes are essential for the maintenance of root gravitropism under NH4(+) stress, we isolated and identified an NH4 (+)-sensitive mutant, gsa-1 (gravitropism sensitive to ammonium-1), in Arabidopsis thaliana, using an agar plate root reorientation assay. We found that, under NH4(+) stress, gsa-1 displayed increased loss of root gravitropism. Gene cloning and sequencing revealed that gsa-1 contains a G to C transversion mutation at the highly conserved 5'-GT splice position of intron 10 of ARG1 (ALTERED RESPONSE TO GRAVITY1), known to participate in the transduction of the root gravity signal. Genetic complement tests established the locus of GSA-1/ARG1 and its role in resistance to NH4 (+) inhibition on root gravitropism. GSA-1/ARG1 is required for normal AUX1 expression and basipetal auxin transport in root apices. In addition, PIN-FORMED2 (PIN2) is proposed as a target in the reduction of root gravitropism under NH4(+) stress, a response which can be antagonized by the GSA-1/ARG1-dependent pathway. These results suggest that GSA-1/ARG1 protects root gravitropism in Arabidopsis thaliana under ammonium stress. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Qin, Wen; Li, Wei-Guang; Zhang, Duo-Ying; Huang, Xiao-Fei; Song, Yang
2016-03-01
We sought to confirm whether use of Acinetobacter strains Y7 and Y16, both strains of heterotrophic nitrifying bacteria, was practical for removing ammonium (NH4 (+)-N) from drinking water at low temperatures. To test this, ammonium-containing drinking water was treated with strains Y7 and Y16 at 8 and 2 °C. Continuous ammonium treatment was conducted in order to evaluate the performance of three biologically enhanced activated carbon (BEAC) filters in removing ammonium. The three BEAC filters were inoculated with strain Y7, strain Y16, and a mixture of strains Y7 and Y16, respectively. A granular activated carbon (GAC) filter, without inoculation by any strains, was tested in parallel with the BEAC filters as control. The results indicated that NH4 (+)-N removal was significant when a BEAC filter was inoculated with the mixture of strains Y7 and Y16 (BEAC-III filter). Amounts of 0.44 ± 0.05 and 0.25 ± 0.05 mg L(-1) NH4 (+)-N were removed using the BEAC-III filter at 8 and 2 °C, respectively. These values were 2.8-4.0-fold higher than the values of ammonium removal acquired using the GAC filter. The synergistic effect of using strains Y7 and Y16 in concert was the cause of the high-ammonium removal efficiency achieved by using the BEAC-III filter at low temperatures. In addition, a high C/N ratio may promote NH4 (+)-N removal efficiency by improving biomass and microbial activity. This study provides new insight into the use of biofilters to achieve biological removal of ammonium at low temperature.
Lee, Alex K Y; Zhao, Ran; Li, Richard; Liggio, John; Li, Shao-Meng; Abbatt, Jonathan P D
2013-11-19
In the atmosphere, volatile organic compounds such as glyoxal can partition into aqueous droplets containing significant levels of inorganic salts. Upon droplet evaporation, both the organics and inorganic ions become highly concentrated, accelerating reactions between them. To demonstrate this process, we investigated the formation of organo-nitrogen and light absorbing materials in evaporating droplets containing glyoxal and different ammonium salts including (NH4)2SO4, NH4NO3, and NH4Cl. Our results demonstrate that evaporating glyoxal-(NH4)2SO4 droplets produce light absorbing species on a time scale of seconds, which is orders of magnitude faster than observed in bulk solutions. Using aerosol mass spectrometry, we show that particle-phase organics with high N:C ratios were formed when ammonium salts were used, and that the presence of sulfate ions promoted this chemistry. Since sulfate can also significantly enhance the Henry's law partitioning of glyoxal, our results highlight the atmospheric importance of such inorganic-organic interactions in aqueous phase aerosol chemistry.
METHOD OF PRODUCING PLUTONIUM TETRAFLUORIDE
Tolley, W.B.; Smith, R.C.
1959-12-15
A process is presented for preparing plutonium tetrafluoride from plutonium(IV) oxalate. The oxalate is dried and decomposed at about 300 deg C to the dioxide, mixed with ammonium bifluoride, and the mixture is heated to between 50 and 150 deg C whereby ammonium plutonium fluoride is formed. The ammonium plutonium fluoride is then heated to about 300 deg C for volatilization of ammonium fluoride. Both heating steps are preferably carried out in an inert atmosphere.
Generation and collision-induced dissociation of ammonium tetrafluoroborate cluster ions.
Dain, Ryan P; Van Stipdonk, Michael J
2008-07-01
Singly and doubly charged cluster ions of ammonium tetrafluoroborate (NH4BF4) with general formula [(NH4BF4)nNH4]+ and [(NH4BF4)m(NH4)2]2+, respectively, were generated by electrospray ionization (ESI) and their fragmentation examined using collision-induced dissociation (CID) and ion-trap tandem mass spectrometry. CID of [(NH4BF4)nNH4]+ caused the loss of one or more neutral NH4BF4 units. The n = 2 cluster, [(NH4BF4)2NH4]+, was unique in that it also exhibited a dissociation pathway in which HBF4 was eliminated to create [(NH4BF4)(NH3)NH4]+. Dissociation of [(NH4BF4)m(NH4)2]2+ occurred through two general pathways: (a) 'fission' to produce singly charged cluster ions and (b) elimination of one or more neutral NH4BF4 units to leave doubly charged product ions. CID profiles, and measurements of changing precursor and product ion signal intensity as a function of applied collision voltage, were collected for [(NH4BF4)nNH4]+ and compared with those for analogous [(NaBF4)nNa]+ and [(KBF4)nK]+ ions to determine the influence of the cation on the relative stability of cluster ions. In general, the [(NH4BF4)nNH4]+ clusters were found to be easier to dissociate than both the sodium and potassium clusters of comparable size, with [(KBF4)nK]+ ions the most difficult to dissociate.
Anammox-zeolite system acting as buffer to achieve stable effluent nitrogen values.
Yapsakli, Kozet; Aktan, Cigdem Kalkan; Mertoglu, Bulent
2017-02-01
For a successful nitrogen removal, Anammox process needs to be established in line with a stable partial nitritation pretreatment unit since wastewater influent is mostly unsuitable for direct treatment by Anammox. Partial nitritation is, however, a critical bottleneck for the nitrogen removal since it is often difficult to maintain the right proportions of NO 2 -N and NH 4 -N during long periods of time for Anammox process. This study investigated the potential of Anammox-zeolite biofilter to buffer inequalities in nitrite and ammonium nitrogen in the influent feed. Anammox-zeolite biofilter combines the ion-exchange property of zeolite with the biological removal by Anammox process. Continuous-flow biofilter was operated for 570 days to test the response of Anammox-zeolite system for irregular ammonium and nitrite nitrogen entries. The reactor demonstrated stable and high nitrogen removal efficiencies (approximately 95 %) even when the influent NO 2 -N to NH 4 -N ratios were far from the stoichiometric ratio for Anammox reaction (i.e. NO 2 -N to NH 4 -N ranging from 0 to infinity). This is achieved by the sorption of surplus NH 4 -N by zeolite particles in case ammonium rich influent came in excess with respect to Anammox stoichiometry. Similarly, when ammonium-poor influent is fed to the reactor, ammonium desorption took place due to shifts in ion-exchange equilibrium and deficient amount were supplied by previously sorbed NH 4 -N. Here, zeolite acted as a preserving reservoir of ammonium where both sorption and desorption took place when needed and this caused the Anammox-zeolite system to act as a buffer system to generate a stable effluent.
Vishwakarma, Siddharth; Kumar, Ajit; Pandey, Abha; Upadhyay, K K
2017-01-05
A chromogenic fluoride probe bearing bis imine groups having dual -NH functionality (BSB) has been designed, synthesised and structurally characterized by its single crystal X-ray diffraction studies. The BSB could visually and spectroscopically recognise F(-) with high selectivity over other anions by exhibiting intense chromogenic response (from colourless to red) for F(-) in acetonitrile solution. The UV-visible titration and (1)H NMR titration experiments indicated that the observed changes occur via a combined process including hydrogen bonding and deprotonation between the BSB and F(-). Moreover theoretical calculations at the Density Functional Theory (DFT) level shed further light upon probe design strategy and the nature of interactions between BSB and F(-). The limit of detection and binding constant of BSB towards F(-) were found to be 6.9×10(-7)M and 1.42±0.069×10(8)M(-2) respectively. Finally, by using F(-)and H(+) as chemical inputs and the absorbance as output, a INHIBIT logic gate was constructed, which exhibits "Multi-write" ability without obvious degradation in its optical output. Copyright © 2016 Elsevier B.V. All rights reserved.
Cueto-Rojas, Hugo F; Milne, Nicholas; van Helmond, Ward; Pieterse, Mervin M; van Maris, Antonius J A; Daran, Jean-Marc; Wahl, S Aljoscha
2017-04-17
Microbial production of nitrogen containing compounds requires a high uptake flux and assimilation of the N-source (commonly ammonium), which is generally coupled with ATP consumption and negatively influences the product yield. In the industrial workhorse Saccharomyces cerevisiae, ammonium (NH 4 + ) uptake is facilitated by ammonium permeases (Mep1, Mep2 and Mep3), which transport the NH 4 + ion, resulting in ATP expenditure to maintain the intracellular charge balance and pH by proton export using the plasma membrane-bound H + -ATPase. To decrease the ATP costs for nitrogen assimilation, the Mep genes were removed, resulting in a strain unable to uptake the NH 4 + ion. Subsequent analysis revealed that growth of this ∆mep strain was dependent on the extracellular NH 3 concentrations. Metabolomic analysis revealed a significantly higher intracellular NH X concentration (3.3-fold) in the ∆mep strain than in the reference strain. Further proteomic analysis revealed significant up-regulation of vacuolar proteases and genes involved in various stress responses. Our results suggest that the uncharged species, NH 3 , is able to diffuse into the cell. The measured intracellular/extracellular NH X ratios under aerobic nitrogen-limiting conditions were consistent with this hypothesis when NH x compartmentalization was considered. On the other hand, proteomic analysis indicated a more pronounced N-starvation stress response in the ∆mep strain than in the reference strain, which suggests that the lower biomass yield of the ∆mep strain was related to higher turnover rates of biomass components.
Fernandez, Pamela A.; Leal, Pablo P.; Noisette, Fanny; McGraw, Christina M.; Revill, Andrew T.; Hurd, Catriona L.; Kübler, Janet E.
2017-01-01
The responses of macroalgae to ocean acidification could be altered by availability of macronutrients, such as ammonium (NH4+). This study determined how the opportunistic macroalga, Ulva australis responded to simultaneous changes in decreasing pH and NH4+ enrichment. This was investigated in a week-long growth experiment across a range of predicted future pHs with ambient and enriched NH4+ treatments followed by measurements of relative growth rates (RGR), NH4+ uptake rates and pools, total chlorophyll, and tissue carbon and nitrogen content. Rapid light curves (RLCs) were used to measure the maximum relative electron transport rate (rETRmax) and maximum quantum yield of photosystem II (PSII) photochemistry (Fv/Fm). Photosynthetic capacity was derived from the RLCs and included the efficiency of light harvesting (α), slope of photoinhibition (β), and the light saturation point (Ek). The results showed that NH4+ enrichment did not modify the effects of pH on RGRs, NH4+ uptake rates and pools, total chlorophyll, rETRmax, α, β, Fv/Fm, tissue C and N, and the C:N ratio. However, Ek was differentially affected by pH under different NH4+ treatments. Ek increased with decreasing pH in the ambient NH4+ treatment, but not in the enriched NH4+ treatment. NH4+ enrichment increased RGRs, NH4+ pools, total chlorophyll, rETRmax, α, β, Fv/Fm, and tissue N, and decreased NH4+ uptake rates and the C:N ratio. Decreased pH increased total chlorophyll content, rETRmax, Fv/Fm, and tissue N content, and decreased the C:N ratio. Therefore, the results indicate that U. australis growth is increased with NH4+ enrichment and not with decreasing pH. While decreasing pH influenced the carbon and nitrogen metabolisms of U. australis, it did not result in changes in growth. PMID:29176815
NASA Astrophysics Data System (ADS)
Nowak, J. B.; Neuman, J. A.; Bahreini, R.; Middlebrook, A. M.; Holloway, J. S.; McKeen, S. A.; Parrish, D. D.; Ryerson, T. B.; Trainer, M.
2012-04-01
Observations from the NOAA WP-3D aircraft during CalNex in May and June 2010 are used to quantify ammonia (NH3) emissions from automobiles and dairy facilities in the California South Coast Air Basin (SoCAB) and assess their impact on particulate ammonium nitrate (NH4NO3) formation. These airborne measurements in the SoCAB are used to estimate automobile NH3 emissions, 62 ± 24 metric tons day-1, and dairy facility NH3 emissions, 33 ± 16 to 176 ± 88 metric tons day-1. Emission inventories agree with the observed automobile NH3:CO emission ratio, but substantially underpredict dairy facility NH3 emissions. Conditions observed downwind of the dairy facilities were always thermodynamically favorable for NH4NO3 formation due to high NH3 mixing ratios from the concentrated sources. Although automobile emissions generated lower NH3 mixing ratios, they also can thermodynamically favor NH4NO3 formation. As an aerosol control strategy, addressing the dairy NH3 source would have the larger impact on reducing SoCAB NH4NO3 formation.
Accumulation of ammonium in Norway spruce (Picea abies) seedlings measured by in vivo 14N-NMR.
Aarnes, H; Eriksen, A B; Petersen, D; Rise, F
2007-01-01
(14)N-NMR and (31)P-NMR have been used to monitor the in vivo pH in roots, stems, and needles from seedlings of Norway spruce, a typical ammonium-tolerant plant. The vacuolar and cytoplasmic pH measured by (31)P-NMR was found to be c. pH 4.8 and 7.0, respectively, with no significant difference between plants growing with ammonium or nitrate as the N-source. The (1)H-coupled (14) NH 4+ resonance is pH-sensitive: at alkaline pH it is a narrow singlet line and below pH 4 it is an increasing multiplet line with five signals. The pH values in ammonium-containing compartments measured by (14)N-NMR ranged from 3.7 to 3.9, notably lower than the estimated pH values of the P(i) pools. This suggests that, in seedlings of Norway spruce, ammonium is stored in vacuoles with low pH possibly to protect the seedlings against the toxic effects of ammonium ( NH 4+) or ammonia (NH3). It was also found that concentrations of malate were 3-6 times higher in stems than in roots and needles, with nitrate-grown plants containing more malate than plants grown with ammonium.
Role of ambient ammonia in particulate ammonium formation at a rural site in the North China Plain
NASA Astrophysics Data System (ADS)
Meng, Zhaoyang; Xu, Xiaobin; Lin, Weili; Ge, Baozhu; Xie, Yulin; Song, Bo; Jia, Shihui; Zhang, Rui; Peng, Wei; Wang, Ying; Cheng, Hongbing; Yang, Wen; Zhao, Huarong
2018-01-01
The real-time measurements of NH3 and trace gases were conducted, in conjunction with semi-continuous measurements of water-soluble ions in PM2.5 at a rural site in the North China Plain (NCP) from May to September 2013 in order to better understand chemical characteristics of ammonia and the impact of secondary ammonium aerosols on formation in the NCP. Extremely high NH3 and NH4+ concentrations were observed after a precipitation event within 7-10 days following urea application. Elevated NH3 levels coincided with elevated NH4+, indicating that NH3 likely influenced particulate ammonium mass. For the sampling period, the average conversion / oxidation ratios for NH4+ (NHR), SO42- (SOR), and NO3- (NOR) were estimated to be 0.30, 0.64, and 0.24, respectively. The increased NH3 concentrations, mainly from agricultural activities and regional transport, coincided with the prevailing meteorological conditions. The high NH3 level with NHR of about 0.30 indicates that the emission of NH3 in the NCP is much higher than needed for aerosol acid neutralisation, and NH3 plays an important role in the formation of secondary aerosols as a key neutraliser. The hourly data obtained were used to investigate gas-aerosol partitioning characteristics using the thermodynamic equilibrium model ISORROPIA-II. Modelled SO42-, NO3-, and NH3 values agree well with the measurements, while the modelled NH4+ values largely underestimate the measurements. Our observation and modelling results indicate that strong acids in aerosol are completely neutralised. Additional NH4+ exists in aerosol, probably a result of the presence of a substantial amount of oxalic and other diacids.
Ambient Ammonium Contribution to total Nitrogen Deposition
There has been a wealth of evidence over the last decade illustrating the rising importance of reduced inorganic nitrogen (NHx = ammonia gas, NH3, plus particulate ammonium, p-NH4) in the overall atmospheric mass balance and deposition of nitrogen as emissions of oxidized nitrog...
The Spectrum of Jupiter's Great Red Spot: The Case for Ammonium Hydrosulfide (NH4SH)
NASA Technical Reports Server (NTRS)
Loeffler, Mark J.; Hudson, Reggie L.; Chanover, Nancy J.; Simon, Amy A.
2016-01-01
Here we present new ultraviolet-visible spectra of irradiated ammonium hydrosul?de (NH4SH), a reported Jovian atmospheric cloud component, for a range of temperatures and radiation doses and make assignments to the spectral features. We show that the combination of radiolysis and thermal annealing of NH4SH causes the originally featureless ultraviolet-visible re?ectance spectrum to evolve into one that absorbs in the ultraviolet-visible region. Furthermore, we ?nd that our laboratory spectra resemble HST (Hubble Space Telescope) spectra below 500 nanometers, suggesting that the more stable reaction products of NH4SH radiolysis are likely an important component of the Great Red Spot.
The Spectrum of Jupiters Great Red Spot: the Case for Ammonium Hydrosulfide (NH4SH)
NASA Technical Reports Server (NTRS)
Loeffler, Mark J.; Hudson, Reggie L.; Chanover, Nancy J.; Simon, Amy A.
2016-01-01
Here we present new ultraviolet-visible spectra of irradiated ammonium hydrosul?de (NH4SH), a reported Jovian atmospheric cloud component, for a range of temperatures and radiation doses and make assignments to the spectral features. We show that the combination of radiolysis and thermal annealing of NH4SH causes the originally featureless ultraviolet-visible re?ectance spectrum to evolve into one that absorbs in the ultraviolet-visible region. Furthermore, we ?nd that our laboratory spectra resemble HST (Hubble Space Telescope) spectra below 500 nanometers, suggesting that the more stable reaction products of NH4SH radiolysis are likely an important component of the Great Red Spot.
NASA Technical Reports Server (NTRS)
Loeffler, Mark J.; Hudson, Reggie L.; Chanover, Nancy J.; Simon, Amy A.
2015-01-01
Here we present our recent studies of proton-irradiated and unirradiated ammonium hydrosulfide, NH4SH, a compound predicted to be an important tropospheric cloud component of Jupiter and other giant planets. We irradiated both crystalline and amorphous NH4SH at 10-160 K and used IR spectroscopy to observe and identify reaction products in the ice, specifically NH3 and long-chained sulfur-containing ions. Crystalline NH4SH was amorphized during irradiation at all temperatures studied with the rate being the fastest at the lowest temperatures. Irradiation of amorphous NH4SH at approximately 10-75 K showed that 60-80% of the NH4 + remained when equilibrium was reached, and that NH4SH destruction rates were relatively constant within this temperature range. Irradiations at higher temperatures produced different dose dependence and were accompanied by pressure outbursts that, in some cases, fractured the ice. The thermal stability of irradiated NH4SH was found to be greater than that of unirradiated NH4SH, suggesting that an irradiated giant-planet cloud precipitate can exist at temperatures and altitudes not previously considered.
Basheer, Sabeel M; Kumar, Saravana Loganathan Ashok; Kumar, Moorthy Saravana; Sreekanth, Anandaram
2017-03-01
1,5-Bis(2-fluorene)thiocarbohydrazone (FBTC) was designed and synthesized for selective sensing of fluoride and copper ions. The binding constants of FBTC towards fluoride and copper ions have been calculated using the Benesi-Hildebrand equation, and FBTC has more binding affinity towards copper ion than fluoride ion. The 1 H NMR and 13 C NMR titration studies strongly support the deprotonation was taken from the N-H protons followed by the formation of hydrogen bond via N-H … F. To understand the fluoride ion sensing mechanism, theoretical investigation had been carried out using the density functional theory and time-dependent density functional theory. The theoretical data well reproduced the experimental results. The deprotonation process has a moderate transition barrier (481.55kcal/mol). The calculated ΔE and ΔG values (-253.92 and -192.41kcal/mol respectively) suggest the feasibility of sensing process. The potential energy curves give the optimized structures of FBTC-F complex in the ground state and excited state, which states the proton transition occurs at the excited state. The excited state proton transition mechanism was further confirmed with natural bond orbital analysis. The reversibility of the sensor was monitored by the alternate addition of F - and Cu 2+ ions, which was explained with "Read-Erase-Write-Read" behaviour. The multi-ion detection of sensor used to construct the molecular logic gate, such as AND, OR, NOR and INHIBITION logic gates. Copyright © 2016 Elsevier B.V. All rights reserved.
Martínez-Andújar, Cristina; Ghanem, Michel Edmond; Albacete, Alfonso; Pérez-Alfocea, Francisco
2013-05-01
Nitrogen availability is an important limiting factor for plant growth. Although NH4(+) assimilation is energetically more favorable than NO3(-), it is usually toxic for plants. In order to study if an improved ammonium assimilatory metabolism could increase the plant tolerance to ammonium nutrition, tomato (Solanum lycopersicum L. cv P-73) plants were transformed with an NH4(+)-dependent asparagine synthetase (AS-A) gene from Escherichia coli (asnA) under the control of a PCpea promoter (pea isolated constitutive promotor). Homozygous (Hom), azygous (Az) asnA and wild type (WT) plants were grown hydroponically for 6 weeks with normal Hoagland nutrition (NO3(-)/NH4(+)=6/0.5) and high ammonium nutrition (NO3(-)/NH4(+)=3.5/3). Under Hoagland's conditions, Hom plants produced 40-50% less biomass than WT and Az plants. However, under NO3(-)/NH4(+)=3.5/3 the biomass of Hom was not affected while it was reduced by 40-70% in WT and Az plants compared to Hoagland, respectively. The Hom plants accumulated 1.5-4 times more asparagine, glycine, serine and soluble proteins and registered higher glutamine synthetase (GS) and glutamate synthase (GOGAT) activities in the light-adapted leaves than the other genotypes, but had similar NH4(+) and NO3(-) levels in all conditions. In the dark-adapted leaves, a protein catabolism occurred in the Hom plants with a concomitant 25-40% increase in organic acid concentration, while asparagine accumulation registered the highest values. The aforementioned processes might be responsible for a positive energetic balance as regards the futile cycle of the transgenic protein synthesis and catabolism. This explains growth penalty under standard nutrition and growth stability under NO3(-)/NH4(+)=3.5/3, respectively. Copyright © 2013 Elsevier GmbH. All rights reserved.
An Electronic Tongue Designed to Detect Ammonium Nitrate in Aqueous Solutions
Campos, Inmaculada; Pascual, Lluis; Soto, Juan; Gil-Sánchez, Luis; Martínez-Máñez, Ramón
2013-01-01
An electronic tongue has been developed to monitor the presence of ammonium nitrate in water. It is based on pulse voltammetry and consists of an array of eight working electrodes (Au; Pt; Rh; Ir; Cu; Co; Ag and Ni) encapsulated in a stainless steel cylinder. In a first step the electrochemical response of the different electrodes was studied in the presence of ammonium nitrate in water in order to further design the wave form used in the voltammetric tongue. The response of the electronic tongue was then tested in the presence of a set of 15 common inorganic salts; i.e.; NH4NO3; MgSO4; NH4Cl; NaCl; Na2CO3; (NH4)2SO4; MgCl2; Na3PO4; K2SO4; K2CO3; CaCl2; NaH2PO4; KCl; NaNO3; K2HPO4. A PCA plot showed a fairly good discrimination between ammonium nitrate and the remaining salts studied. In addition Fuzzy Art map analyses determined that the best classification was obtained using the Pt; Co; Cu and Ni electrodes. Moreover; PLS regression allowed the creation of a model to correlate the voltammetric response of the electrodes with concentrations of ammonium nitrate in the presence of potential interferents such as ammonium chloride and sodium nitrate. PMID:24145916
NASA Astrophysics Data System (ADS)
Plessen, Birgit; Harlov, Daniel E.; Henry, Darrell; Guidotti, Charles V.
2010-08-01
Ammonium fixed in micas of metamorphic rocks is a sensitive indicator both of organic-inorganic interactions during diagenesis as well as of the devolatilization history and fluid/rock interaction during metamorphism. In this study, a collection of geochemically well-characterized biotite separates from a series of graphite-bearing Paleozoic greenschist- to upper amphibolite-facies metapelites, western Maine, USA, were analyzed for ammonium nitrogen ( NH4+-N) contents and isotopic composition (δ 15N NH4) using the HF-digestion distillation technique followed by the EA-IRMS technique. Biotite separates, sampled from 9 individual metamorphic zones, contain 3000 to 100 ppm NH4+-N with a wide range in δ 15N from +1.6‰ to +9.1‰. Average NH4+-N contents in biotite show a distinct decrease from about 2750 ppm for the lowest metamorphic grade (˜500 °C) down to 218 ppm for the highest metamorphic grade (˜685 °C). Decreasing abundances in NH4+ are inversely correlated in a linear fashion with increasing K + in biotite as a function of metamorphic grade and are interpreted as a devolatilization effect. Despite expected increasing δ 15N NH4 values in biotite with nitrogen loss, a significant decrease from the Garnet Zones to the Staurolite Zones was found, followed by an increase to the Sillimanite Zones. This pattern for δ 15N NH4 values in biotite inversely correlates with Mg/(Mg + Fe) ratios in biotite and is discussed in the framework of isotopic fractionation due to different exchange processes between NH4+-NH or NH4+-N, reflecting devolatilization history and redox conditions during metamorphism.
NASA Astrophysics Data System (ADS)
S., Sr.; Saxena, M., , Dr; Mandal, T. K., , Dr; Kotnala, R. K.; Sharma, S. K., , Dr
2017-12-01
Ambient ammonia, SO2 and NOx are primary precursor gases for the formation of particulate matter (PM2.5) which result in photochemical smog and haze formation specifically in winter season. The ambient ammonia, other trace gases and fine particles were monitored in winter season from Jan 2013 to Dec 2015 at CSIR-NPL, Delhi. The average mixing ratios of ambient NH3, NO, NO2 and SO2 over the entire period of winter season were recorded as 25.3±4.6 (ppb), 21.4±7.2 (ppb), 20.8±5.9 (ppb) and 1.9±0.5 (ppm), respectively. The NH4+ and other ionic species in PM2.5 were also simultaneously observed at the the study site to see the transformation of NH3 and NH4+. The results indicated that the concentration level of NH3 and NH4+/NH3 ratios grew simultaneously with the increase of PM2.5 levels. NH3 enhanced the formation of ammonium sulphate and ammonium nitrate and exert a significant impact on ion chemistry of PM2.5. In the wintertime atmosphere of urban Delhi, NH3 was sufficient in fully neutralizing the fine particulates. The important role of ammonia is recognized in increasing PM2.5 mass concentration as it help in formation of ammonium aerosol due to reaction with acid gases. Keywords: Air quality, Ammonia, Trace Gases, Particulates
Antibacterial Effect of Silver Diamine Fluoride on Cariogenic Organisms.
Lou, Yali; Darvell, Brain W; Botelho, Michael G
2018-05-01
To screen the possible antimicrobial activity of a range of clinically used, silver-based compounds on cariogenic organisms: silver diamine fluoride (SDF), silver fluoride, and silver nitrate. Preliminary screening disk-diffusion susceptibility tests were conducted on Mueller-Hinton agar plates inoculated with Streptococcus mutans, Lactobacillus acidophilus, and Actinomyces naeslundii, organisms known to be cariogenic. In order to identify which component of the silver compounds was responsible for any antibacterial (AB) effect, and to provide controls, the following were also investigated at high and low concentrations: sodium fluoride, ammonium fluoride, ammonium chloride, sodium fluoride, sodium chloride, and sodium nitrate, as well as deionized water as control. A volume of 10 pL of a test solution was dispensed onto a paper disk resting on the inoculated agar surface, and the plate incubated anaerobically at 37°C for 48 hours. The zones of inhibition were then measured. Silver diamine fluoride, silver fluoride, silver nitrate, and ammonium fluoride had significant AB effect (p < 0.05) on all three test organisms, although ammonium fluoride had no effect at low concentration; the remaining other compounds had no effect. Silver ions appear to be the principal AB agent at both high and low concentration; fluoride ions only have an AB effect at high concentration, while ammonium, nitrate, chloride and sodium ions have none. The anticaries effect of topical silver solutions appears restricted to that of the silver ions. Silver compounds, such as SDF, silver fluoride, and silver nitrate have AB effect against cariogenic organisms and these may have clinical impact in arresting or preventing dental decay. Sodium fluoride did not have AB effect under the conditions tested.
NASA Astrophysics Data System (ADS)
Berg, Breanne L.; Cloutis, Edward A.; Beck, Pierre; Vernazza, Pierre; Bishop, Janice L.; Takir, Driss; Reddy, Vishnu; Applin, Daniel; Mann, Paul
2016-02-01
Ammonium-bearing minerals have been suggested to be present on Mars, Ceres, and various asteroids and comets. We undertook a systematic study of the spectral reflectance properties of ammonium-bearing minerals and compounds that have possible planetary relevance (i.e., ammonium carbonates, chlorides, nitrates, oxalates, phosphates, silicates, and sulfates). Various synthetic and natural NH4+-bearing minerals were analyzed using reflectance spectroscopy in the long-wave ultraviolet, visible, near-infrared, and mid-infrared regions (0.35-8 μm) in order to identify spectral features characteristic of the NH4+ molecule, and to evaluate if and how these features vary among different species. Mineral phases were confirmed through structural and compositional analyses using X-ray diffraction, X-ray fluorescence, and elemental combustion analysis. Characteristic absorption features associated with NH4 can be seen in the reflectance spectra at wavelengths as short as ∼1 μm. In the near-infrared region, the most prominent absorption bands are located near 1.6, 2.0, and 2.2 μm. Absorption features characteristic of NH4+ occurred at slightly longer wavelengths in the mineral-bound NH4+ spectra than for free NH4+ for most of the samples. Differences in wavelength position are attributable to various factors, including differences in the type and polarizability of the anion(s) attached to the NH4+, degree and type of hydrogen bonding, molecule symmetry, and cation substitutions. Multiple absorption features, usually three absorption bands, in the mid-infrared region between ∼2.8 and 3.8 μm were seen in all but the most NH4-poor sample spectra, and are attributed to fundamentals, combinations, and overtones of stretching and bending vibrations of the NH4+ molecule. These features appear even in reflectance spectra of water-rich samples which exhibit a strong 3 μm region water absorption feature. While many of the samples examined in this study have NH4 absorption bands at unique wavelength positions, in order to discriminate between different NH4+-bearing phases, absorption features corresponding to molecules other than NH4+ should be included in spectral analysis. A qualitative comparison of the laboratory results to telescopic spectra of Asteroids 1 Ceres, 10 Hygiea, and 324 Bamberga for the 3 μm region demonstrates that a number of NH4-bearing phases are consistent with the observational data in terms of exhibiting an absorption band in the 3.07 μm region.
Berg, Breanne L.; Cloutis, Edward A.; Beck, P.; Vernazza, P.; Bishop, Janice L; Takir, Driss; Reddy, V.; Applin, D.; Mann, Paul
2016-01-01
Ammonium-bearing minerals have been suggested to be present on Mars, Ceres, and various asteroids and comets. We undertook a systematic study of the spectral reflectance properties of ammonium-bearing minerals and compounds that have possible planetary relevance (i.e., ammonium carbonates, chlorides, nitrates, oxalates, phosphates, silicates, and sulfates). Various synthetic and natural NH4+-bearing minerals were analyzed using reflectance spectroscopy in the long-wave ultraviolet, visible, near-infrared, and mid-infrared regions (0.35–8 μm) in order to identify spectral features characteristic of the NH4+ molecule, and to evaluate if and how these features vary among different species. Mineral phases were confirmed through structural and compositional analyses using X-ray diffraction, X-ray fluorescence, and elemental combustion analysis. Characteristic absorption features associated with NH4 can be seen in the reflectance spectra at wavelengths as short as ∼1 μm. In the near-infrared region, the most prominent absorption bands are located near 1.6, 2.0, and 2.2 μm. Absorption features characteristic of NH4+ occurred at slightly longer wavelengths in the mineral-bound NH4+ spectra than for free NH4+ for most of the samples. Differences in wavelength position are attributable to various factors, including differences in the type and polarizability of the anion(s) attached to the NH4+, degree and type of hydrogen bonding, molecule symmetry, and cation substitutions. Multiple absorption features, usually three absorption bands, in the mid-infrared region between ∼2.8 and 3.8 μm were seen in all but the most NH4-poor sample spectra, and are attributed to fundamentals, combinations, and overtones of stretching and bending vibrations of the NH4+ molecule. These features appear even in reflectance spectra of water-rich samples which exhibit a strong 3 μm region water absorption feature. While many of the samples examined in this study have NH4 absorption bands at unique wavelength positions, in order to discriminate between different NH4+-bearing phases, absorption features corresponding to molecules other than NH4+ should be included in spectral analysis. A qualitative comparison of the laboratory results to telescopic spectra of Asteroids 1 Ceres, 10 Hygiea, and 324 Bamberga for the 3 μm region demonstrates that a number of NH4-bearing phases are consistent with the observational data in terms of exhibiting an absorption band in the 3.07 μm region.
Zhu, Qi; Song, Caiyun; Li, Xiaodong; Sun, Xudong; Li, Ji-Guang
2018-04-09
Submicron sized, monodispersed spheres of Mn2+, Yb3+/Er3+ and Mn2+/Yb3+/Er3+ doped α-NaYF4 were easily autoclaved from mixed solutions of the component nitrates and ammonium fluoride (NH4F), in the presence of EDTA-2Na. Detailed characterizations of the resultant phosphors were obtained using XRD, Raman spectroscopy, FE-SEM, HR-TEM, STEM, PLE/PL spectroscopy, and fluorescence decay analysis. Finer structure and better crystal perfection was observed at a higher calcination temperature, and the spherical shape and excellent dispersion of the original particles was retained at temperatures up to 600 °C. Under the 980 nm infrared excitation, the Yb3+/Er3+-doped sample (calcined at 400 °C) exhibits a stronger green emission centered at ∼524 nm (2H11/2 → 4I15/2 transition of Er3+) and a weaker red emission centered at ∼657 nm (4F9/2 → 4I15/2 transition of Er3+). A 200 °C increase in the temperature from 400 °C to 600 °C resulted in the dominant red emission originating from the 4F9/2 → 4I15/2 transition of Er3+, instead of the previously dominant green one. Mn2+ doping induced a remarkable more enhanced intensity at ∼657 nm and ∼667 nm (red emission area) than that at ∼524 nm and ∼546 nm (green emission area), because of the non-radiative energy transfer between Mn2+ and Er3+. However, a poor thermal stability was induced by Mn2+ doping. The observed upconversion luminescence of the samples calcined at 400 °C and 600 °C followed the two photon process and the four photon process, respectively.
Bhat, Haamid R; Jha, Prakash C
2017-05-18
The anion binding selectivity and the recognition mechanism of two isomeric boranes, namely, 4-[bis(2,4,6-trimethylphenyl)boranyl]-N,N,N-trimethylaniline ([p-(Mes 2 B)C 6 H 4 (NMe 3 )] + , 1, where "Mes" represents mesitylene and "Me" represents methyl) and 2-[bis(2,4,6-trimethylphenyl)boranyl]-N,N,N-trimethylaniline ([o-(Mes 2 B)C 6 H 4 (NMe 3 )] + , 2) has been investigated using density functional theory (DFT) and time dependent-density functional theory (TD-DFT) methods. Natural population analysis indicates that the central boron atoms in 1 and 2 are the most active centers for nucleophilic addition of anions. The negative magnitude of free energy changes (ΔG) reveals that out of CN - , F - , Cl - , Br - , NO 3 - , and HSO 4 - only the binding of CN - and F - with 1 and 2 is thermodynamically feasible and spontaneous. In addition, the calculated binding energies reveal that the CN - is showing lesser binding affinity than F - both with 1 and 2, while other ions, viz. NO 3 - , HSO 4 - , Br - , and Cl - , either do not bind at all or show very insignificant binding energy. The first excited states (S 1 ) of 1 and 2 are shown to be the local excited states with π → σ* transition by frontier molecular orbital analysis, whereas fourth excited states (S 4 ) of 4-[bis(2,4,6-trimethylphenyl)boranyl]-N,N,N-trimethylaniline cyanide ([p-(Mes 2 B)C 6 H 4 (NMe 3 )] CN, 1CN, the cyano form of 1) and 4-[bis(2,4,6-trimethylphenyl)boranyl]-N,N,N-trimethylaniline fluoride ([p-(Mes 2 B)C 6 H 4 (NMe 3 )] F, 1F, the fluoro form of 1) and fifth excited state (S 5 ) of 2-[bis(2,4,6-trimethylphenyl)boranyl]-N,N,N-trimethylaniline fluoride ([o-(Mes 2 B)C 6 H 4 (NMe 3 )] F, 2F, the fluoro form of 2) are charge separation states that are found to be responsible for the intramolecular charge transfer (ICT) process. The synergistic effect of ICT and partial configuration changes induce fluorescence quenching in 1CN, 1F, and 2F after a significant internal conversion (IC) from S 4 and S 5 to S 1.
Xu, Xiaoting; Xu, Nan; Cheng, Xueying; Guo, Peng; Chen, Zhigang; Wang, Dongtian
2017-02-01
The widely used artificial nanoparticles (NPs) and the excess of ammonium (NH 4 + ) fertilizers are easily released into the natural environment. So, clarifying the mobility of NPs in the presence of NH 4 + is therefore of great urgency and high priority. Currently, few studies focus on the transport and deposition of nanoparticle titanium dioxide (nTiO 2 ) in single and binary systems containing NH 4 + , especially describing this process by a mathematical model. In this work, the comparison between the transport and retention of rutile nTiO 2 in single and binary electrolyte solutions of NH 4 Cl and/or NaCl (0.5-50 mM) were conducted at pH 6.0 and 8.0 through running the column experiments. Experimental results show that the aggregation and retention of nTiO 2 in solution containing mono-valence cations obeys the order as follows: NH 4 + > Na + > Na + + NH 4 + at the same ion strength (IS). It is attributed to the lower critical coagulation concentration (CCC) of rutile nTiO 2 in NH 4 + than that in Na + solution. In particular, the simultaneous presence of NH 4 + and Na + favors the transportability of nTiO 2 due to the strong competitive adsorption on the surface of NPs. The two-site kinetic retention model provides the good simulation for their transport behavior. The likely mechanism is that the secondary energy minimum of nTiO 2 in NH 4 + system associated with the greater K 2 at surface Site 2 (from model) on sand can be explained for the more reversible deposition. Ammonium leachate associated with NPs can thus be considered a serious concern. Copyright © 2016 Elsevier Ltd. All rights reserved.
Young, J L; Stansfield, D A
1978-09-01
1. Adenylate cyclase activity of the washed 600g sediment of bovine corpus-luteum homogenate was solubilized by Lubrol-PX, Triton X-100 and digitonin. Digitonin was the least destructive of NaF-stimulated activity. 2. NaF, present in the solubilization medium together with MgSO4, increased the percentage yields of soluble activity from untreated 600g sediment and 600g sediment which had been preincubated with p[NH]ppG (guanosine 5'-[betagamma-imido]triphosphate). The stabilizing influence of NaF was most marked with digitonin. However, the highest specific activities of soluble enzyme were obtained with Lubrol-PX as solubilizing agent, since digitonin solubilized more membrane protein than does Lubrol-PX, and less of the activity of the digitonin-dispersed 600g sediment was recovered in the 105000g supernatant. 3. p[NH]ppG also has a stabilizing effect when present during the solubilization, but less so than NaF. 4. Both NaF and MgSO4 alone have a stabilizing effect during solubilization. The greatest amounts of soluble activity were obtained with both agents present in the solubilization medium, there being a synergistic effect.
Young, J L; Stansfield, D A
1978-01-01
1. Adenylate cyclase activity of the washed 600g sediment of bovine corpus-luteum homogenate was solubilized by Lubrol-PX, Triton X-100 and digitonin. Digitonin was the least destructive of NaF-stimulated activity. 2. NaF, present in the solubilization medium together with MgSO4, increased the percentage yields of soluble activity from untreated 600g sediment and 600g sediment which had been preincubated with p[NH]ppG (guanosine 5'-[betagamma-imido]triphosphate). The stabilizing influence of NaF was most marked with digitonin. However, the highest specific activities of soluble enzyme were obtained with Lubrol-PX as solubilizing agent, since digitonin solubilized more membrane protein than does Lubrol-PX, and less of the activity of the digitonin-dispersed 600g sediment was recovered in the 105000g supernatant. 3. p[NH]ppG also has a stabilizing effect when present during the solubilization, but less so than NaF. 4. Both NaF and MgSO4 alone have a stabilizing effect during solubilization. The greatest amounts of soluble activity were obtained with both agents present in the solubilization medium, there being a synergistic effect. PMID:568467
21 CFR 184.1143 - Ammonium sulfate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT... GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS Reg. No. 7783-20-2) occurs...
21 CFR 184.1143 - Ammonium sulfate.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS Reg...
21 CFR 184.1143 - Ammonium sulfate.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS Reg...
New hydrogen-rich ammonium metal borohydrides, NH4[M(BH4)4], M = Y, Sc, Al, as potential H2 sources.
Starobrat, A; Jaroń, T; Grochala, W
2018-03-26
Three metal-ammonium borohydrides, NH4[M(BH4)4] M = Y, Sc, Al, denoted 1, 2, 3, respectively, were prepared via a low temperature mechanochemical synthesis and characterized using PXRD, FTIR and TGA/DSC/MS. The compounds 1 and 2 adopt the P21/c space group while the compound 3 crystallizes in an orthorhombic unit cell (Fddd). The first decomposition step of all three derivatives of ammonium borohydride has the maximum rate at 48 °C, 53 °C and 35 °C for 1, 2 and 3, respectively, which are comparable to that for NH4BH4 (53 °C). The thermal decomposition of these metal-ammonium borohydrides is a multistep process, with predominantly exothermic low-temperature stages. The compound 1 decomposes via known Y(BH4)3, however, some of the solid decomposition products of the other two compounds have not been fully identified. In the system containing compound 2, a new, more dense polymorph of the previously reported LiSc(BH4)4 has been detected as the intermediate of slow decomposition at room temperature.
Crystallization pathways of sulfate-nitrate-ammonium aerosol particles.
Schlenker, Julie C; Martin, Scot T
2005-11-10
Crystallization experiments are conducted for aerosol particles composed of aqueous mixtures of (NH(4))(2)SO(4)(aq) and NH(4)NO(3)(aq), (NH(4))(2)SO(4)(aq) and NH(4)HSO(4)(aq), and NH(4)NO(3)(aq) and NH(4)HSO(4)(aq). Depending on the aqueous composition, crystals of (NH(4))(2)SO(4)(s), (NH(4))(3)H(SO(4))(2)(s), NH(4)HSO(4)(s), NH(4)NO(3)(s), 2NH(4)NO(3) x (NH(4))(2)SO(4)(s), and 3NH(4)NO(3) x (NH(4))(2)SO(4)(s) are formed. Although particles of NH(4)NO(3)(aq) and NH(4)HSO(4)(aq) do not crystallize even at 1% relative humidity, additions of 0.05 mol fraction SO(4)(2-)(aq) or NO(3)(-)(aq) ions promote crystallization, respectively. 2NH(4)NO(3) x (NH(4))(2)SO(4)(s) and (NH(4))(3)H(SO(4))(2)(s) appear to serve as good heterogeneous nuclei for NH(4)NO(3)(s) and NH(4)HSO(4)(s), respectively. 2NH(4)NO(3) x (NH(4))(2)SO(4)(s) crystallizes over a greater range of aqueous compositions than 3NH(4)NO(3) x (NH(4))(2)SO(4)(s). An infrared aerosol spectrum is provided for each solid based upon a linear decomposition analysis of the recorded spectra. Small nonzero residuals occur in the analysis because aerosol spectra depend on particle morphology, which changes slightly across the range of compositions studied. In addition, several of the mixed compositions crystallize with residual aqueous water of up to 5% particle mass. We attribute this water content to enclosed water pockets. The results provide further insights into the nonlinear crystallization pathways of sulfate-nitrate-ammonium aerosol particles.
Li, Jiling; Xu, Xiaoyong; Shao, Xusheng; Li, Zhong
2015-12-01
A novel semi-rigid latent chromophore E1, containing an amide subunit activated by an adjacent semi-rigid intramolecular hydrogen-bonding (IHB) unit, was designed for the detection of fluoride ion by the 'naked-eye' in CH3CN. Comparative studies on structural analogs (E2, E3, and E4) provided significant insight into the structural and functional role of the amide N-H and IHB segment in the selective recognition of fluoride ions. The deprotonation of the amide N-H followed by the enhancement of intramolecular charge transfer (ICT) induced the colorimetric detection of E1 for fluoride ion. Copyright © 2015 John Wiley & Sons, Ltd.
Is Electronegativity a Useful Descriptor for the "Pseudo-Alkali-Metal" NH4?
DOE Office of Scientific and Technical Information (OSTI.GOV)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-11-18
Molecular ions in the form of "pseudo-atoms" are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the "pseudo-alkali metal" ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, andmore » reactivity), which can cause deviations from the behaviour expected of a conceptual "true alkali metal" with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.« less
Removal of oil palm trunk lignin in ammonium hydroxide pretreatment
NASA Astrophysics Data System (ADS)
Az-Zahraa, Balqis; Zakaria, Sarani; Daud, Muhammad F. B.; Jaafar, Sharifah Nabihah Syed
2018-04-01
Alkaline pretreatment using ammonium hydroxide, NH4OH serves as one of a process to remove lignin from lignocellulosic biomass such as oil palm trunk fiber. In this study, the effect of NH4OH pretreatment on removal of oil palm trunk lignin was investigated. The oil palm trunk fiber was dissolved in NH4OH with different concentrations (6, 8 and 10 %), different duration (3, 5 and 7 h) and temperatures (60, 80 and 100 °C). The samples were analyzed by using UV-Vis to estimate the concentration of extracted lignin. The result indicates that the optimum conditions to gain maximum extracted lignin were 8% NH4OH, 100 °C and 5 h with concentration of 64 mgL-1 while the lowest was at 6% NH4OH, 100 °C and 5 h with concentration of 62.5 mgL-1.
21 CFR 184.1135 - Ammonium bicarbonate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium bicarbonate. 184.1135 Section 184.1135... GRAS § 184.1135 Ammonium bicarbonate. (a) Ammonium bicarbonate (NH4HCO3, CAS Reg. No. 1066-33-7) is prepared by reacting gaseous carbon dioxide with aqueous ammonia. Crystals of ammonium bicarbonate are...
Cueto-Rojas, H F; Maleki Seifar, R; Ten Pierick, A; van Helmond, W; Pieterse M, M; Heijnen, J J; Wahl, S A
2016-09-16
Ammonium is the most common N-source for yeast fermentations. Although, its transport and assimilation mechanisms are well documented, there have been only few attempts to measure the in vivo intracellular concentration of ammonium and assess its impact on gene expression. Using an isotope dilution mass spectrometry (IDMS)-based method we were able to measure the intracellular ammonium concentration in N-limited aerobic chemostat cultivations using three different N-sources (ammonium, urea and glutamate) at the same growth rate (0.05 h -1 ). The experimental results suggest that, at this growth rate, a similar concentration of intracellular ammonium, about 3.6 mmol NH 4 + /L IC , is required to supply the reactions in the central N-metabolism independent of the N-source. Based on the experimental results and different assumptions, the vacuolar and cytosolic ammonium concentrations were estimated. Furthermore, we identified a futile cycle caused by NH 3 leakage to the extracellular space, which can cost up to 30% of the ATP production of the cell under N-limited conditions, and a futile redox cycle between reactions Gdh1 and Gdh2. Finally, using shotgun proteomics with labeled reference-relative protein expression, differences between the various environmental conditions were identified and correlated with previously identified N-compound sensing mechanisms. In our work, we study central N-metabolism using quantitative approaches. First, intracellular ammonium was measured under different N-sources. The results suggest that Saccharomyces cerevisiae cells keep a constant NH 4 + concentration (around 3 mmol NH 4 + /L IC ), independent of the applied nitrogen source. We hypothesize that this amount of intracellular ammonium is required to obtain sufficient thermodynamic driving force.Furthermore, our calculations based on thermodynamic analysis of the transport mechanisms of ammonium suggest that ammonium is not equally distributed, indicating a high degree of compartmentalization in the vacuole. Additionally, metabolomic analysis results were used to calculate the thermodynamic driving forces in the central N-metabolism reactions, revealing that the main reactions in the central N-metabolism are far from equilibrium. Using proteomics approaches, we were able to identify major changes, not only in N-metabolism but also C-metabolism and regulation. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Maleki Seifar, R.; ten Pierick, A.; van Helmond, W.; Pieterse, M. M.; Heijnen, J. J.
2016-01-01
ABSTRACT Ammonium is the most common N source for yeast fermentations. Although its transport and assimilation mechanisms are well documented, there have been only a few attempts to measure the in vivo intracellular concentration of ammonium and assess its impact on gene expression. Using an isotope dilution mass spectrometry (IDMS)-based method, we were able to measure the intracellular ammonium concentration in N-limited aerobic chemostat cultivations using three different N sources (ammonium, urea, and glutamate) at the same growth rate (0.05 h−1). The experimental results suggest that, at this growth rate, a similar concentration of intracellular (IC) ammonium, about 3.6 mmol NH4+/literIC, is required to supply the reactions in the central N metabolism, independent of the N source. Based on the experimental results and different assumptions, the vacuolar and cytosolic ammonium concentrations were estimated. Furthermore, we identified a futile cycle caused by NH3 leakage into the extracellular space, which can cost up to 30% of the ATP production of the cell under N-limited conditions, and a futile redox cycle between Gdh1 and Gdh2 reactions. Finally, using shotgun proteomics with protein expression determined relative to a labeled reference, differences between the various environmental conditions were identified and correlated with previously identified N compound-sensing mechanisms. IMPORTANCE In our work, we studied central N metabolism using quantitative approaches. First, intracellular ammonium was measured under different N sources. The results suggest that Saccharomyces cerevisiae cells maintain a constant NH4+ concentration (around 3 mmol NH4+/literIC), independent of the applied nitrogen source. We hypothesize that this amount of intracellular ammonium is required to obtain sufficient thermodynamic driving force. Furthermore, our calculations based on thermodynamic analysis of the transport mechanisms of ammonium suggest that ammonium is not equally distributed, indicating a high degree of compartmentalization in the vacuole. Additionally, metabolomic analysis results were used to calculate the thermodynamic driving forces in the central N metabolism reactions, revealing that the main reactions in the central N metabolism are far from equilibrium. Using proteomics approaches, we were able to identify major changes, not only in N metabolism, but also in C metabolism and regulation. PMID:27637876
Recovery of ammonia from swine manure using gas-permeable membranes: effect of aeration.
García-González, M C; Vanotti, M B; Szogi, A A
2015-04-01
The gas-permeable membrane process can recover ammonia from manure, reducing pollution whilst converting ammonia into an ammonium salt fertilizer. The process involves manure pH control to increase ammonium (NH4(+)) recovery rate that is normally carried out using an alkali. In this study a new strategy to avoid the use of alkali was tested applying low-rate aeration and nitrification inhibition. The wastewater used was raw swine manure with 2390 mg NH4(+)-N/L. Results showed that aeration increased pH above 8.5 allowing quick transformation of NH4(+) into gaseous ammonia (NH3) and efficient recovery by permeation through the submerged membrane. The overall NH4(+) recovery obtained with aeration was 98% and ammonia emissions losses were less than 1.5%. The new approach can substitute large amounts of alkali chemicals needed to obtain high NH4(+) recovery with important economic and environmental savings. Copyright © 2015 Elsevier Ltd. All rights reserved.
Inorganic Salt Interference on CO2+ in Aerodyne AMS and ACSM Organic Aerosol Composition Studies.
Pieber, Simone M; El Haddad, Imad; Slowik, Jay G; Canagaratna, Manjula R; Jayne, John T; Platt, Stephen M; Bozzetti, Carlo; Daellenbach, Kaspar R; Fröhlich, Roman; Vlachou, Athanasia; Klein, Felix; Dommen, Josef; Miljevic, Branka; Jiménez, José L; Worsnop, Douglas R; Baltensperger, Urs; Prévôt, André S H
2016-10-04
Aerodyne aerosol mass spectrometer (AMS) and Aerodyne aerosol chemical speciation monitor (ACSM) mass spectra are widely used to quantify organic aerosol (OA) elemental composition, oxidation state, and major environmental sources. The OA CO 2 + fragment is among the most important measurements for such analyses. Here, we show that a non-OA CO 2 + signal can arise from reactions on the particle vaporizer, ion chamber, or both, induced by thermal decomposition products of inorganic salts. In our tests (eight instruments, n = 29), ammonium nitrate (NH 4 NO 3 ) causes a median CO 2 + interference signal of +3.4% relative to nitrate. This interference is highly variable between instruments and with measurement history (percentiles P 10-90 = +0.4 to +10.2%). Other semi-refractory nitrate salts showed 2-10 times enhanced interference compared to that of NH 4 NO 3 , while the ammonium sulfate ((NH 4 ) 2 SO 4 ) induced interference was 3-10 times lower. Propagation of the CO 2 + interference to other ions during standard AMS and ACSM data analysis affects the calculated OA mass, mass spectra, molecular oxygen-to-carbon ratio (O/C), and f 44 . The resulting bias may be trivial for most ambient data sets but can be significant for aerosol with higher inorganic fractions (>50%), e.g., for low ambient temperatures, or laboratory experiments. The large variation between instruments makes it imperative to regularly quantify this effect on individual AMS and ACSM systems.
NASA Technical Reports Server (NTRS)
Martin, Steven W. (Inventor); Huebsch, Jesse (Inventor)
2001-01-01
A heavy metal fluoride glass composition range (in mol percent) consisting essentially of: (16-30)BaF.sub.2.(8-26)HfF.sub.4.(6-24)InF.sub.3 or GaF.sub.3.(4-16)CdF.sub.2.(6-24)YbF.sub.3.(4-22)ZnF.sub.2. In an alternative embodiment, a heavy metal fluoride glass composition range (in mol percent) comprises (16-30)BaF.sub.2.(8-26)HfF.sub.4.(6-24) of (0-24)InF.sub.3, (0-24)GaF.sub.3 and (0-19)AlF.sub.3.(1-16)CdF.sub.2.(6-24)YbF.sub.3.(4-26)ZnF.sub.2. A preferred heavy metal fluoride glass produced in accordance with the present invention comprises a composition (in mol %) and comprises about 26BaF.sub.2.18HfF.sub.4.7InF.sub.3.5GaF.sub.3.10CdF.sub.2.18YbF.sub.3. 16ZnF.sub.2. A preferred heavy metal fluoride glass has maximum thickness of most preferably about 3 mm. Another preferred heavy metal fluoride glass comprises a composition (in mol %) and comprises about 26BaF.sub.2.18HfF.sub.4.12AlF.sub.3.10CdF.sub.2.18YbF.sub.3.16ZnF.sub.2.
NASA Technical Reports Server (NTRS)
Vessey, J. K.; Raper, C. D. Jr; Henry, L. T.; Raper CD, J. r. (Principal Investigator)
1990-01-01
Tobacco plants (Nicotiana tabacum L. cv NC82) were supplied with (NH4)2SO4 or NH4Cl at root-zone pH of 6.0 and 4.5 in hydroponic culture for 28 days. Dry matter accumulation, total N and C content, and leaf area and number were not affected by the NH4+ source or root-zone pH. Plants supplied with NH4Cl accumulated up to 1.2 mM Cl g DW-1, but accumulated 37% less inorganic H2PO4- and 47% less SO4(2-) than plants supplied with (NH4)2SO4. The large Cl- accumulation resulted in NH4Cl- supplied plants having a 31% higher inorganic anion (NO3-, H2, PO4-, SO4(2-), and Cl-) charge. This higher inorganic anion charge in the NH4Cl-supplied plants was balanced by a similar increase in K+ charge. Plants supplied with NH4Cl accumulated greater concentrations of Cl- in leaves (up to 5.1% of DW) than plants supplied with (NH4)2SO4 (less than -% DW). Despite the high Cl- concentration of leaves in NH4Cl supplied plants, these plants showed no symptoms of Cl- toxicity. This demonstrates that toxicity symptoms are not due solely to an interaction between high Cl- concentration in tissue and NH4+ nutrition. The increase in root-zone acidity to pH 4.5 from 6.0 did not induce toxicity symptoms.
Sensitivity analyses of factors influencing CMAQ performance for fine particulate nitrate.
Shimadera, Hikari; Hayami, Hiroshi; Chatani, Satoru; Morino, Yu; Mori, Yasuaki; Morikawa, Tazuko; Yamaji, Kazuyo; Ohara, Toshimasa
2014-04-01
Improvement of air quality models is required so that they can be utilized to design effective control strategies for fine particulate matter (PM2.5). The Community Multiscale Air Quality modeling system was applied to the Greater Tokyo Area of Japan in winter 2010 and summer 2011. The model results were compared with observed concentrations of PM2.5 sulfate (SO4(2-)), nitrate (NO3(-)) and ammonium, and gaseous nitric acid (HNO3) and ammonia (NH3). The model approximately reproduced PM2.5 SO4(2-) concentration, but clearly overestimated PM2.5 NO3(-) concentration, which was attributed to overestimation of production of ammonium nitrate (NH4NO3). This study conducted sensitivity analyses of factors associated with the model performance for PM2.5 NO3(-) concentration, including temperature and relative humidity, emission of nitrogen oxides, seasonal variation of NH3 emission, HNO3 and NH3 dry deposition velocities, and heterogeneous reaction probability of dinitrogen pentoxide. Change in NH3 emission directly affected NH3 concentration, and substantially affected NH4NO3 concentration. Higher dry deposition velocities of HNO3 and NH3 led to substantial reductions of concentrations of the gaseous species and NH4NO3. Because uncertainties in NH3 emission and dry deposition processes are probably large, these processes may be key factors for improvement of the model performance for PM2.5 NO3(-). The Community Multiscale Air Quality modeling system clearly overestimated the concentration of fine particulate nitrate in the Greater Tokyo Area of Japan, which was attributed to overestimation of production of ammonium nitrate. Sensitivity analyses were conducted for factors associated with the model performance for nitrate. Ammonia emission and dry deposition of nitric acid and ammonia may be key factors for improvement of the model performance.
Quantitative reflectance spectroscopy of buddingtonite from the Cuprite mining district, Nevada
NASA Technical Reports Server (NTRS)
Felzer, Benjamin; Hauff, Phoebe; Goetz, Alexander F. H.
1994-01-01
Buddingtonite, an ammonium-bearing feldspar diagnostic of volcanic-hosted alteration, can be identified and, in some cases, quantitatively measured using short-wave infrared (SWIR) reflectance spectroscopy. In this study over 200 samples from Cuprite, Nevada, were evaluated by X ray diffraction, chemical analysis, scanning electron microscopy, and SWIR reflectance spectroscopy with the objective of developing a quantitative remote-sensing technique for rapid determination of the amount of ammonium or buddingtonite present, and its distribution across the site. Based upon the Hapke theory of radiative transfer from particulate surfaces, spectra from quantitative, physical mixtures were compared with computed mixture spectra. We hypothesized that the concentration of ammonium in each sample is related to the size and shape of the ammonium absorption bands and tested this hypothesis for samples of relatively pure buddingtonite. We found that the band depth of the 2.12-micron NH4 feature is linearly related to the NH4 concentration for the Cuprite buddingtonite, and that the relationship is approximately exponential for a larger range of NH4 concentrations. Associated minerals such as smectite and jarosite suppress the depth of the 2.12-micron NH4 absorption band. Quantitative reflectance spectroscopy is possible when the effects of these associated minerals are also considered.
Investigation into stability of poly(vinyl alcohol)-based Opadry® II films.
Koo, Otilia M Y; Fiske, John D; Yang, Haitao; Nikfar, Faranak; Thakur, Ajit; Scheer, Barry; Adams, Monica L
2011-06-01
Poly(vinyl alcohol) (PVA)-based formulations are used for pharmaceutical tablet coating with numerous advantages. Our objective is to study the stability of PVA-based coating films in the presence of acidic additives, alkaline additives, and various common impurities typically found in tablet formulations. Opadry® II 85F was used as the model PVA-based coating formulation. The additives and impurities were incorporated into the polymer suspension prior to film casting. Control and test films were analyzed before and after exposure to 40°C/75% relative humidity. Tests included film disintegration, size-exclusion chromatography, thermal analysis, and microscopy. Under stressed conditions, acidic additives (hydrochloric acid (HCl) and ammonium bisulfate (NH(4)HSO(4))) negatively impacted Opadry® II 85F film disintegration while NaOH, formaldehyde, and peroxide did not. Absence of PVA species from the disintegration media corresponded to an increase in crystallinity of PVA for reacted films containing HCl. Films with NH(4)HSO(4) exhibited slower rate of reactivity and less elevation in melting temperature with no clear change in melting enthalpy. Acidic additives posed greater risk of compromise in disintegration of PVA-based coatings than alkaline or common impurities. The mechanism of acid-induced reactivity due to the presence of acidic salts (HCl vs. NH(4)HSO(4)) may be different.
NASA Astrophysics Data System (ADS)
Boumaiza, Hella; Coustel, Romain; Despas, Christelle; Ruby, Christian; Bergaoui, Latifa
2018-02-01
The ammonium cation interaction with Na-birnessite in aqueous alkaline medium was studied. Solution and solid analysis give evidence that birnessite is not only acting as a cationic exchanger toward NH4+. The surface analysis performed by XPS showed that N1s spectra are characterized by the existence of two different environments: one assignable to an interlayer NH4+ and the second to a chemisorbed N-species. Structural and chemical transformations were observed on birnessite with nitrogen mass balance deficit. The monitoring of NH4+, Na+, Mn2+, NO3- and NO2- and solid changes (average oxidation state of Mn, cation exchange capacity, solid nitrogen content and symmetry evolution identified by XRD and FTIR) indicate unambiguously that NH4+ reacts chemically with the birnessite.
Das, Piw; Sa, Jae-Hwan; Kim, Ki-Hyun; Jeon, Eui-Chan
2009-07-01
The concentrations of ammonium NH4+, nitrate NO3-, and nitrite NO2- ions were recorded along with ammonia (NH(3)) emission from a fertilized rice field located in the Kwangju province in South Korea over a period of 4 months (June to October 2006). The highest magnitude of NH(3) flux was 20,754 microg m(-2) h(-1), while the average flux value over the entire sampling period was 2,395 microg m(-2) h(-1). The highest ionic concentrations were 1.67, 0.44, and 0.71 ppm for NH4+, NO3-, and NO2- ions, respectively. Possible effects of soil pH on NH(3) fluxes were detected, as they concurrently exhibited a gradual and periodic change during the sampling period. Positive correlations existed between concentrations of NH4+ and NO2- ions and the soil pH. Positive correlations also existed between NH(3) emission flux and ambient (and water) temperatures. Results indicated that fertilizer application to rice can lead to significant emission of NH(3) along with NH4+ and NO3- ions.
Oxidative Pressure Leaching of Silver from Flotation Concentrates with Ammonium Thiocyanate Solution
NASA Astrophysics Data System (ADS)
Yang, Sheng-Hai; Yang, Jian-Guang; Liu, Wei; Chen, Geng-Tao; Tang, Mo-Tang; Qiu, Guan-Zhou
2010-02-01
The thermodynamics and technologies of the selective pressure leaching of silver from flotation concentrates were investigated in an ammonium thiocyanate medium. Thermodynamic analyses, which include silver solubility in NH4SCN solution and Eh-pH diagrams of the Me-MeS-NH4SCN-H2O system at 25 °C, were discussed. The effects of several factors, such as temperature, leaching time, oxidant, pH value, flotation concentrates concentration, surfactant concentration, and so on, on the extraction percentages of silver and zinc were investigated. The following optimal leaching conditions were obtained: NH4SCN concentration 1.5 M, lignin concentration 0.5 g/L, Fe3+ concentration 2 g/L, flotation concentrates addition 200 g/L, and oxygen pressure 1.2 MPa at 130 °C for 3 hours. Under these optimum conditions, the average extraction percentage of silver exceeded 94 pct, whereas the average extraction percentage of zinc was less than 3 pct. Only 7 pct of ammonium thiocyanate was consumed after 4 cycles, which indicated that ammonium thiocyanate hardly was oxidized under these oxidative pressure leaching conditions.
Garçon, D P; Masui, D C; Mantelatto, F L M; McNamara, J C; Furriel, R P M; Leone, F A
2007-05-01
To better comprehend the mechanisms of ionic regulation, we investigate the modulation by Na+, K+, NH4(+) and ATP of the (Na+, K+)-ATPase in a microsomal fraction from Callinectes ornatus gills. ATP hydrolysis obeyed Michaelis-Menten kinetics with KM=0.61+/-0.03 mmol L(-1) and maximal rate of V=116.3+/-5.4 U mg(-1). Stimulation by Na+ (V=110.6+/-6.1 U mg(-1); K0.5=6.3+/-0.2 mmol L(-1)), Mg2+ (V=111.0+/-4.7 U mg(-1); K0.5=0.53+/-0.03 mmol L(-1)), NH4(+) (V=173.3+/-6.9 U mg(-1); K0.5=5.4+/-0.2 mmol L(-1)) and K+ (V=116.0+/-4.9 U mg(-1); K0.5=1.5+/-0.1 mmol L(-1)) followed a single saturation curve, although revealing site-site interactions. In the absence of NH4(+), ouabain (K(I)=74.5+/-1.2 micromol L(-1)) and orthovanadate inhibited ATPase activity by up to 87%; the inhibition patterns suggest the presence of F0F1 and K+-ATPases but not Na+-, V- or Ca2+-ATPase as contaminants. (Na+, K+)-ATPase activity was synergistically modulated by K+ and NH4(+). At 10 mmol L(-1) K+, increasing NH4(+) concentrations stimulated maximum activity to V=185.9+/-7.4 U mg(-1). However, at saturating NH4(+) (50 mmol L(-1)), increasing K+ concentrations did not stimulate activity further. Our findings provide evidence that the C. ornatus gill (Na+, K+)-ATPase may be particularly well suited for extremely efficient active NH4(+) excretion. At elevated NH4(+) concentrations, the enzyme is fully active, regardless of hemolymph K+ concentration, and K+ cannot displace NH4(+) from its exclusive binding sites. Further, the binding of NH4(+) to its specific sites induces an increase in enzyme apparent affinity for K+, which may contribute to maintaining K+ transport, assuring that exposure to elevated ammonia concentrations does not lead to a decrease in intracellular potassium levels. This is the first report of modulation by ammonium ions of C. ornatus gill (Na+, K+)-ATPase, and should further our understanding of NH4(+) excretion in benthic crabs.
Ceazan, M.L.; Thurman, E.M.; Smith, R.L.
1989-01-01
The role of cation exchange in the retardation of ammonium (NH4+) and potassium (K+) transport in a shallow sand and gravel aquifer was evaluated by use of observed distributions of NH4+ and K+ within a plume of sewage-contaminated groundwater, small-scale tracer injection tests, and batch sorption experiments on aquifer material. Both NH4+ and K+ were transported ???2 km in the 4-km-long contaminant plume (retardation factor, Rf = 2.0). Sediments from the NH4+-containing zone of the plume contained significant quantities of KCl-extractable NH4+ (extraction distribution coefficient, Kd,extr = 0.59-0.87 mL/g of dry sediment), and when added to uncontaminated sediments, NH4+ sorption followed a linear isotherm. Small-scale tracer tests demonstrated that NH4+ and K+ were retarded (Rf =3.5) relative to a nonreactive tracer (Br-). Sorption of dissolved NH4+ was accompanied by concomitant release of calcium (Ca2+), magnesium (Mg2+), and sodium (Na+) from aquifer sediments, suggesting involvement of cation exchange. In contrast, nitrate (NO3-) was not retarded and cleanly separated from NH4+ and K+ in the small-scale tracer tests. This study demonstrates that transport of NH4+ and K+ through a sand and gravel aquifer can be markedly affected by cation-exchange processes even at a clay content less than 0.1%.
Altered Cell Wall Plasticity Can Restrict Plant Growth under Ammonium Nutrition.
Podgórska, Anna; Burian, Maria; Gieczewska, Katarzyna; Ostaszewska-Bugajska, Monika; Zebrowski, Jacek; Solecka, Danuta; Szal, Bożena
2017-01-01
Plants mainly utilize inorganic forms of nitrogen (N), such as nitrate (NO 3 - ) and ammonium (NH 4 + ). However, the composition of the N source is important, because excess of NH 4 + promotes morphological disorders. Plants cultured on NH 4 + as the sole N source exhibit serious growth inhibition, commonly referred to as "ammonium toxicity syndrome." NH 4 + -mediated suppression of growth may be attributable to both repression of cell elongation and reduction of cell division. The precondition for cell enlargement is the expansion of the cell wall, which requires the loosening of the cell wall polymers. Therefore, to understand how NH 4 + nutrition may trigger growth retardation in plants, properties of their cell walls were analyzed. We found that Arabidopsis thaliana using NH 4 + as the sole N source has smaller cells with relatively thicker cell walls. Moreover, cellulose, which is the main load-bearing polysaccharide revealed a denser assembly of microfibrils. Consequently, the leaf blade tissue showed elevated tensile strength and indicated higher cell wall stiffness. These changes might be related to changes in polysaccharide and ion content of cell walls. Further, NH 4 + toxicity was associated with altered activities of cell wall modifying proteins. The lower activity and/or expression of pectin hydrolyzing enzymes and expansins might limit cell wall expansion. Additionally, the higher activity of cell wall peroxidases can lead to higher cross-linking of cell wall polymers. Overall, the NH 4 + -mediated inhibition of growth is related to a more rigid cell wall structure, which limits expansion of cells. The changes in cell wall composition were also indicated by decreased expression of Feronia , a receptor-like kinase involved in the control of cell wall extension.
Altered Cell Wall Plasticity Can Restrict Plant Growth under Ammonium Nutrition
Podgórska, Anna; Burian, Maria; Gieczewska, Katarzyna; Ostaszewska-Bugajska, Monika; Zebrowski, Jacek; Solecka, Danuta; Szal, Bożena
2017-01-01
Plants mainly utilize inorganic forms of nitrogen (N), such as nitrate (NO3–) and ammonium (NH4+). However, the composition of the N source is important, because excess of NH4+ promotes morphological disorders. Plants cultured on NH4+ as the sole N source exhibit serious growth inhibition, commonly referred to as “ammonium toxicity syndrome.” NH4+-mediated suppression of growth may be attributable to both repression of cell elongation and reduction of cell division. The precondition for cell enlargement is the expansion of the cell wall, which requires the loosening of the cell wall polymers. Therefore, to understand how NH4+ nutrition may trigger growth retardation in plants, properties of their cell walls were analyzed. We found that Arabidopsis thaliana using NH4+ as the sole N source has smaller cells with relatively thicker cell walls. Moreover, cellulose, which is the main load-bearing polysaccharide revealed a denser assembly of microfibrils. Consequently, the leaf blade tissue showed elevated tensile strength and indicated higher cell wall stiffness. These changes might be related to changes in polysaccharide and ion content of cell walls. Further, NH4+ toxicity was associated with altered activities of cell wall modifying proteins. The lower activity and/or expression of pectin hydrolyzing enzymes and expansins might limit cell wall expansion. Additionally, the higher activity of cell wall peroxidases can lead to higher cross-linking of cell wall polymers. Overall, the NH4+-mediated inhibition of growth is related to a more rigid cell wall structure, which limits expansion of cells. The changes in cell wall composition were also indicated by decreased expression of Feronia, a receptor-like kinase involved in the control of cell wall extension. PMID:28848567
Su, Yu; Wang, Weidong; Wu, Di; Huang, Wei; Wang, Mengzi; Zhu, Guibing
2018-05-15
An integrated approach to document high ammonium oxidation rate in Guanjinggang constructed wetland (GJG-CW) was performed and the results showed that the substantial ammonium oxidation rate could be obtained by enhancing Ammonia Oxidizing Bacteria (AOB) activity rather than Ammonia Oxidizing Archaea (AOA) activity. In the plant-bed/ditch system, ditch center and plant-bed fringe were two active zones for NH 4 + -N removal with ammonium oxidation rate peaking at 2.98±0.04 and 2.15±0.02mgNkg -1 d -1 , respectively. The enhanced AOB activity were achieved by increasing water level fluctuations, extending hydraulic retention time (HRT) and stimulating substrate availability, which subsequently enhanced NH 4 + -N removal by 34.06% in GJG-CW. However, the high AOB activity was not correlated with high AOB abundance, but was instead mostly determined by specific AOB taxa, particularly Nitrosomonas, which dominated in the active AOB. The increased cell-specific AOA activity and high AOA diversity were also achieved using those engineering measures. Although the AOA activity decreased overall with extended HRT and increased NH 4 + -N contents in GJG-CW, AOA still played a major role on ammonium oxidation in plant-bed soil. The study illustrated that artificially enhancing AOB activity and certain species in anthropogenically polluted water ecosystems would be an effective strategy to improve NH 4 + -N removal. Copyright © 2017 Elsevier B.V. All rights reserved.
21 CFR 184.1137 - Ammonium carbonate.
Code of Federal Regulations, 2011 CFR
2011-04-01
...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...
21 CFR 184.1137 - Ammonium carbonate.
Code of Federal Regulations, 2010 CFR
2010-04-01
...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...
21 CFR 184.1137 - Ammonium carbonate.
Code of Federal Regulations, 2013 CFR
2013-04-01
...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...
21 CFR 184.1138 - Ammonium chloride.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium chloride. 184.1138 Section 184.1138 Food... Specific Substances Affirmed as GRAS § 184.1138 Ammonium chloride. (a) Ammonium chloride (NH4Cl, CAS Reg. No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The...
Removal of ammonium ion from water by Na-rich birnessite: Performance and mechanisms.
Cheng, Ya; Huang, Tinglin; Shi, Xinxin; Wen, Gang; Sun, Yuankui
2017-07-01
Na-rich birnessite (NRB) was synthesized by a simple synthesis method and used as a high-efficiency adsorbent for the removal of ammonium ion (NH 4 + ) from aqueous solution. In order to demonstrate the adsorption performance of the synthesized material, the effects of contact time, pH, initial ammonium ion concentration, and temperature were investigated. Adsorption kinetics showed that the adsorption behavior followed the pseudo second-order kinetic model. The equilibrium adsorption data were fitted to Langmuir and Freundlich adsorption models and the model parameters were evaluated. The monolayer adsorption capacity of the adsorbent, as obtained from the Langmuir isotherm, was 22.61mg NH 4 + -N/g at 283K. Thermodynamic analyses showed that the adsorption was spontaneous and that it was also a physisorption process. Our data revealed that the higher NH 4 + adsorption capacity could be primarily attributed to the water absorption process and electrostatic interaction. Particularly, the high surface hydroxyl-content of NRB enables strong interactions with ammonium ion. The results obtained in this study illustrate that the NRB is expected to be an effective and economically viable adsorbent for ammonium ion removal from aqueous system. Copyright © 2016. Published by Elsevier B.V.
Need-based activation of ammonium uptake in Escherichia coli
Kim, Minsu; Zhang, Zhongge; Okano, Hiroyuki; Yan, Dalai; Groisman, Alexander; Hwa, Terence
2012-01-01
The efficient sequestration of nutrients is vital for the growth and survival of microorganisms. Some nutrients, such as CO2 and NH3, are readily diffusible across the cell membrane. The large membrane permeability of these nutrients obviates the need of transporters when the ambient level is high. When the ambient level is low, however, maintaining a high intracellular nutrient level against passive back diffusion is both challenging and costly. Here, we study the delicate management of ammonium (NH4+/NH3) sequestration by E. coli cells using microfluidic chemostats. We find that as the ambient ammonium concentration is reduced, E. coli cells first maximize their ability to assimilate the gaseous NH3 diffusing into the cytoplasm and then abruptly activate ammonium transport. The onset of transport varies under different growth conditions, but always occurring just as needed to maintain growth. Quantitative modeling of known interactions reveals an integral feedback mechanism by which this need-based uptake strategy is implemented. This novel strategy ensures that the expensive cost of upholding the internal ammonium concentration against back diffusion is kept at a minimum. PMID:23010999
Control of Diapause by Acidic pH and Ammonium Accumulation in the Hemolymph of Antarctic Copepods
Schründer, Sabine; Schnack-Schiel, Sigrid B.; Auel, Holger; Sartoris, Franz Josef
2013-01-01
Life-cycles of polar herbivorous copepods are characterised by seasonal/ontogenetic vertical migrations and diapause to survive periods of food shortage during the long winter season. However, the triggers of vertical migration and diapause are still far from being understood. In this study, we test the hypothesis that acidic pH and the accumulation of ammonium (NH4 +) in the hemolymph contribute to the control of diapause in certain Antarctic copepod species. In a recent study, it was already hypothesized that the replacement of heavy ions by ammonium is necessary for diapausing copepods to achieve neutral buoyancy at overwintering depth. The current article extends the hypothesis of ammonium-aided buoyancy by highlighting recent findings of low pH values in the hemolymph of diapausing copepods with elevated ammonium concentrations. Since ammonia (NH3) is toxic to most organisms, a low hemolymph pH is required to maintain ammonium in the less toxic ionized form (NH4 +). Recognizing that low pH values are a relevant factor reducing metabolic rate in other marine invertebrates, the low pH values found in overwintering copepods might not only be a precondition for ammonium accumulation, but in addition, it may insure metabolic depression throughout diapause. PMID:24143238
Wagner, Florian B; Nielsen, Peter Borch; Boe-Hansen, Rasmus; Albrechtsen, Hans-Jørgen
2018-04-01
Drinking water treatment plants based on groundwater may suffer from incomplete ammonium removal, which deteriorates drinking water quality and constrains water utilities in the operation of their plants. Ammonium is normally removed through nitrification in biological granular media filters, and recent studies have demonstrated that dosing of copper can stimulate the removal of ammonium. Here, we investigated if copper dosing could generically improve ammonium removal of biofilters, at treatment plants with different characteristics. Copper was dosed at ≤1.5 μg Cu/L to biofilters at 10 groundwater treatment plants, all of which had displayed several years of incomplete nitrification. Plants exceeded the Danish national water quality standard of 0.05 mg NH 4 + /L by a factor of 2-12. Within only 2-3 weeks of dosing, ammonium removal rates increased significantly (up to 150%). Nitrification was fully established, with ammonium effluent concentrations of <0.01 mg NH 4 + -N/L at most plants, regardless of the differences in raw water chemistry, ammonium loading rates, filter design and operation, or treatment plant configuration. However, for filters without primary filtration, it took longer time to reach complete ammonium removal than for filters receiving prefiltered water, likely due to sorption of copper to iron oxides, at plants without prefiltration. With complete ammonium removal, we subjected two plants to short-term loading rate upshifts, to examine the filters' ability to cope with loading rate variations. After 2 months of dosing and an average loading rate of 1.0 g NH 4 + -N/m 3 filter material/h, the loading rate was upshifted by 50%. Yet, a filter managed to completely remove all the influent ammonium, showing that with copper dosing the filter had extra capacity to remove ammonium even beyond its normal loading rates. Depth sampling revealed that the ammonium removal rate of the filter's upper 10 cm increased more than 7-fold from 0.67 to 4.90 g NH 4 + -N/m 3 /h, and that nitrite produced from increased ammonium oxidation was completely oxidized further to nitrate. Hence, no problems with nitrite accumulation or breakthrough occurred. Overall, copper dosing generically enhanced nitrification efficiency and allowed a range of quite different plants to meet water quality standards, even at increased loading rates. The capacity increase is highly relevant in practice, as it makes filters more robust towards sudden ammonium loading rate variations. Copyright © 2017 Elsevier Ltd. All rights reserved.
Szczerba, Mark W; Britto, Dev T; Balkos, Konstantine D; Kronzucker, Herbert J
2008-01-01
Futile plasma membrane cycling of ammonium (NH4+) is characteristic of low-affinity NH4+ transport, and has been proposed to be a critical factor in NH4+ toxicity. Using unidirectional flux analysis with the positron-emitting tracer 13N in intact seedlings of barley (Hordeum vulgare L.), it is shown that rapid, futile NH4+ cycling is alleviated by elevated K+ supply, and that low-affinity NH4+ transport is mediated by a K+-sensitive component, and by a second component that is independent of K+. At low external [K+] (0.1 mM), NH4+ influx (at an external [NH4+] of 10 mM) of 92 micromol g(-1) h(-1) was observed, with an efflux:influx ratio of 0.75, indicative of rapid, futile NH4+ cycling. Elevating K+ supply into the low-affinity K+ transport range (1.5-40 mM) reduced both influx and efflux of NH4+ by as much as 75%, and substantially reduced the efflux:influx ratio. The reduction of NH4+ fluxes was achieved rapidly upon exposure to elevated K+, within 1 min for influx and within 5 min for efflux. The channel inhibitor La3+ decreased high-capacity NH4+ influx only at low K+ concentrations, suggesting that the K+-sensitive component of NH4+ influx may be mediated by non-selective cation channels. Using respiratory measurements and current models of ion flux energetics, the energy cost of concomitant NH4+ and K+ transport at the root plasma membrane, and its consequences for plant growth are discussed. The study presents the first demonstration of the parallel operation of K+-sensitive and -insensitive NH4+ flux mechanisms in plants.
Ammonium conversion and its feedback effect on methane oxidation of Methylosinus sporium.
He, Ruo; Chen, Min; Ma, Ruo-Chan; Su, Yao; Zhang, Xuan
2017-04-01
Ammonium (NH 4 + ) is not only nitrogen source that can support methanotrophic growth, but also it can inhibit methane (CH 4 ) oxidation by competing with CH 4 for the active site of methane monooxygenase. NH 4 + conversion and its feedback effect on the growth and activity of methanotrophs were evaluated with Methylosinus sporium used as a model methanotroph. Nitrogen sources could affect the CH 4 -derived carbon distribution, which varied with incubation time and nitrogen concentrations. More CH 4 -derived carbon was incorporated into biomass in the media with NH 4 + -N, compared to nitrate-nitrogen (NO 3 - -N), as sole nitrogen source at the nitrogen concentrations of 10-18 mmol L -1 . Although ammonia (NH 3 ) oxidation activity of methanotrophs was considerably lower, only accounting for 0.01-0.06% of CH 4 oxidation activity in the experimental cultures, NH 4 + conversion could lead to the pH decrease and toxic intermediates accumulation in the their habits. Compared with NH 4 + , nitrite (NO 2 - ) accumulation in the NH 4 + conversion of methanotroph had stronger inhibition on its activity, especially the joint inhibition of NO 2 - accumulation and the pH decrease during the NH 4 + -N conversion. These results suggested that more attention should be paid to the feedback effects of NH 4 + conversion by methanotrophs to understand effects of NH 4 + on CH 4 oxidation in the environments. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Wiebe, M G; Robson, G D; Shuster, J R; Trinci, A P
1999-08-05
Fusarium venenatum (formerly Fusarium graminearum) JeRS 325 produces heterologous glucoamylase (GAM) under the regulation of a Fusarium oxysporum alkaline (trypsin-like) protease promoter. The glucoamylase gene was used as a reporter gene to study the effects of ammonium and pH on GAM production under the control of the alkaline protease promoter. Between pH 4.0 and 5.8, GAM production in glucose-limited chemostat cultures of JeRS 325 grown at a dilution rate of 0.10 h-1 (doubling time, 6.9 h) on (NH4)2SO4 medium increased in a linear manner with increase in pH. However, at pH 4.0 and below GAM production was almost completely repressed in glucose-limited chemostat cultures grown on (NH4)2SO4 or NaNO3 medium. Thus GAM production in JeRS 325 is regulated by culture pH, not by the nature of the nitrogen source in the medium. The difficulty of using unbuffered medium when investigating putative ammonium repression is also shown. The study demonstrates the potential for use of the alkaline protease promoter in F. graminearum for the production of recombinant proteins in a pH dependent man ner. Copyright 1999 John Wiley & Sons, Inc.
Crystal structure of (NH4)2[Fe(II) 5(HPO3)6], a new open-framework phosphite.
Berrocal, Teresa; Mesa, Jose Luis; Larrea, Edurne; Arrieta, Juan Manuel
2014-11-01
Di-ammonium hexa-phosphito-penta-ferrate(II), (NH4)2[Fe5(HPO3)6], was synthesized under mild hydro-thermal conditions and autogeneous pressure, yielding twinned crystals. The crystal structure exhibits an [Fe(II) 5(HPO3)6](2-) open framework with NH4 (+) groups as counter-cations. The anionic skeleton is based on (001) sheets of [FeO6] octa-hedra (one with point-group symmetry 3.. and one with .2.) linked along [001] through [HPO3](2-) oxoanions. Each sheet is constructed from 12-membered rings of edge-sharing [FeO6] octa-hedra, giving rise to channels with a radius of ca 3.1 Å in which the disordered NH4 (+) cations are located. The IR spectrum shows vibrational bands typical for phosphite and ammonium groups.
Öney, S; Tabur, S; Tuna, M
2015-01-01
Effects of ammonium sulphate [(NH4)2SO4] on mitosis, cell cycle and chromosomes in Vicia faba L. seeds exposed to extreme temperatures were investigated using flowcytometric and cytogenetic analysis. Seeds germinated at high and low temperatures showed a signiicant decrease in mitotic index as compared to those of optimum temperature conditions. Application of 50 and 1000 µM (NH4)2SO4 were successful in alleviating the negative effects of low and high temperature on mitotic activity, respectively. 50 µM (NH4)2SO4 showed the most positive effect on cell cycle at the extreme temperatures. This concentration increased the cell division removing or decreasing the negative effects of temperature stress. Namely, the highest G2/M and S phase percentages under stress conditions were obtained with application of 50 µM (NH4)2SO4. Chromosomal aberrations were not observed in cells of seeds germinated in distilled water and also at any temperatures. However, the frequency of chromosomal aberrations increased significantly by increasing (NH4)2SO4 concentration. The highest aberration frequency in all temperature degree tested was found at 1000 µM (NH4)2SO4 concentration.
Simple route to (NH4)xWO3 nanorods for near infrared absorption
NASA Astrophysics Data System (ADS)
Guo, Chongshen; Yin, Shu; Dong, Qiang; Sato, Tsugio
2012-05-01
Described here is how to synthesize one-dimensional ammonium tungsten bronze ((NH4)xWO3) by a facile solvothermal approach in which ethylene glycol and acetic acid were employed as solvents and ammonium paratungstate was used as a starting material, as well as how to develop the near infrared absorption properties of (NH4)xWO3 nanorods for application as a solar light control filter. The as-obtained product was characterized by field emission scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), thermogravimetry (TG), atomic force microscope (AFM) and UV-Vis-NIR spectra. The SEM and TEM images clearly revealed that the obtained sample possessed rod/fiber-like morphologies with diameters around 120 nm. As determined by UV-Vis-NIR optical measurement, the thin film consisted of (NH4)xWO3 nanoparticles, which can selectively transmit most visible lights, but strongly absorb the near-infrared (NIR) lights and ultraviolet rays. These interesting optical properties make the (NH4)xWO3 nanorods suitable for the solar control windows.Described here is how to synthesize one-dimensional ammonium tungsten bronze ((NH4)xWO3) by a facile solvothermal approach in which ethylene glycol and acetic acid were employed as solvents and ammonium paratungstate was used as a starting material, as well as how to develop the near infrared absorption properties of (NH4)xWO3 nanorods for application as a solar light control filter. The as-obtained product was characterized by field emission scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), thermogravimetry (TG), atomic force microscope (AFM) and UV-Vis-NIR spectra. The SEM and TEM images clearly revealed that the obtained sample possessed rod/fiber-like morphologies with diameters around 120 nm. As determined by UV-Vis-NIR optical measurement, the thin film consisted of (NH4)xWO3 nanoparticles, which can selectively transmit most visible lights, but strongly absorb the near-infrared (NIR) lights and ultraviolet rays. These interesting optical properties make the (NH4)xWO3 nanorods suitable for the solar control windows. Electronic supplementary information (ESI) available. See DOI: 10.1039/c2nr30612c
Removal of ammonium from aqueous solutions with volcanic tuff.
Marañón, E; Ulmanu, M; Fernández, Y; Anger, I; Castrillón, L
2006-10-11
This paper presents kinetic and equilibrium data concerning ammonium ion uptake from aqueous solutions using Romanian volcanic tuff. The influence of contact time, pH, ammonium concentration, presence of other cations and anion species is discussed. Equilibrium isotherms adequately fit the Langmuir and Freundlich models. The results showed a contact time of 3h to be sufficient to reach equilibrium and pH of 7 to be the optimum value. Adsorption capacities of 19 mg NH(4)(+)/g were obtained in multicomponent solutions (containing NH(4)(+), Zn(2+), Cd(2+), Ca(2+), Na(2+)). The presence of Zn and Cd at low concentrations did not decrease the ammonium adsorption capacity. Comparison of Romanian volcanic tuff with synthetic zeolites used for ammonium removal (5A, 13X and ZSM-5) was carried out. The removal efficiciency of ammonium by volcanic tuff were similar to those of zeolites 5A and 13X at low initial ammonium concentration, and much higher than those of zeolite ZSM-5.
A kinetic study of the replacement of calcite marble by fluorite
NASA Astrophysics Data System (ADS)
Trindade Pedrosa, Elisabete; Boeck, Lena; Putnis, Christine V.; Putnis, Andrew
2016-04-01
Replacement reactions are relevant in any situation that involves the reequilibration between a solid and an aqueous fluid phase and are commonly controlled by an interface-coupled dissolution-precipitation mechanism (Putnis and Putnis, 2007). These reactions control many large-scale Earth processes whenever aqueous fluids are available, such as during metamorphism, metasomatism, and weathering. An important consequence of coupled dissolution-precipitation is the generation of porosity in the product phase that then allows the infiltration of the fluid within the mineral being replaced. Understanding the mechanism and kinetics of the replacement of carbonates by fluorite has application in earth sciences and engineering. Fluorite (CaF2) occurs in all kinds of rocks (igneous, sedimentary, and metamorphic) and its origin is commonly associated with hydrothermal fluids. Moreover, calcium carbonate has been suggested as a successful seed material for the sequestration of fluoride from contaminated waters (Waghmare and Arfin, 2015). The aim of the present work is to investigate aspects of the replacement of calcium carbonate by fluorite to better understand the mechanism and kinetics of this reaction. Small cubes (˜ 3 × 3 × 3 mm) of Carrara marble (CaCO3 > 99 %) were cut and reacted with a 4 M ammonium fluoride (NH4F) solution for different times (1 to 48 hours) and temperatures (60, 80, 100, and 140 ° C). The microstructure of the product phases was analysed using SEM. The kinetics of replacement was monitored from the Rietveld analysis of X-ray powder diffraction patterns of the products as a function of temperature and reaction time. After reaction, all samples preserved their size and external morphology (a pseudomorphic replacement) and the product phase (fluorite) was highly porous. The activation energy Ea (kJ/mol) of the replacement reaction was empirically determined by both model-fitting and model-free methods. The isoconversional method yielded an empirical activation energy of 41 kJ/mol, and a statistical approach applied to the model-fitting method revealed that the replacement of Carrara marble by fluorite is better fitted to a diffusion-controlled process. This is consistent with ion diffusion through the fluid phase. These results suggest that the replacement reaction is dependent on the fluid migration rate through the newly formed porosity. Putnis, A., Putnis C.V., 2007. The mechanism of reequilibration of solids in the presence of a fluid phase. Journal of Solid State Chemistry, 180, 1783-1786. Waghmare, S.S., Arfin, T. (2015). Fluoride removal from water by calcium materials: A state-of-the-art review. Int. J. Innov. Res. Sci. Eng. Technol. 4, 8090-8102.
21 CFR 184.1137 - Ammonium carbonate.
Code of Federal Regulations, 2014 CFR
2014-04-01
... sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs as a white powder or a hard... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS Reg. No. 8000-73-5) is a...
Graphene templated Directional Growth of an Inorganic Nanowire
2015-03-23
ammonium persulphate, (NH4)2S2O8, at room tempera- ture for 17 h (Fig. 1a). Various types of gold precursor, such as gold nanoparticles or gold...directions and grain boundaries in polycrystalline graphene using TEM or even scanning electron microscopy (SEM), as shown in Fig. 1g, h . Because the...directionGraphene Nanowire Grain boundary Nanowire axis directions g h e f i Figure 1 | Directional growth of inorganic nanowires on graphene. a
Li, H C; Wang, D G; Hu, J H; Chen, C Z
2014-02-01
Two series of Na2O-CaO-SiO2-P2O5 glass-ceramics doped with NH4HF2 (G-NH4HF2) or CaF2 (G-CaF2) have been prepared by sol-gel method. The glass-ceramic phase composition and morphology were characterized by X-ray diffraction (XRD) and scanning electron microscopy coupled with energy dispersive spectroscopy (SEM-EDS). The mechanical properties and thermal expansion coefficient were measured by a microhardness tester, an electronic tensile machine and a thermal expansion coefficient tester. The structure difference between these two glass-ceramics was investigated by Fourier transform infrared spectroscopy (FTIR), and the in vitro bioactivity of the glass-ceramics was determined by in vitro simulated body fluid (SBF) immersion test. The hemolysis test, in vitro cytotoxicity test, systemic toxicity test and the implanted experiment in animals were used to evaluate the biocompatibility of the glass-ceramics. The mechanical properties of sample G-NH4HF2 are lower than that of sample G-CaF2, and the bioactivity of sample G-NH4HF2 is better than that of sample G-CaF2. The thermal expansion coefficients of these two glass-ceramics are all closer to that of Ti6Al4V. After 7 days of SBF immersion, apatites were induced on glass-ceramic surface, indicating that the glass-ceramics have bioactivity. The hemolysis test, in vitro cytotoxicity test and systemic toxicity test demonstrate that the glass-ceramics do not cause hemolysis reaction, and have no toxicity to cell and living animal. The implanted experiment in animals shows that bone tissue can form a good osseointegration with the implant after implantation for two months, indicating that the glass-ceramics are safe to serve as implants. Copyright © 2013 Elsevier B.V. All rights reserved.
Solution equilibrium behind the room-temperature synthesis of nanocrystalline titanium dioxide
NASA Astrophysics Data System (ADS)
Seisenbaeva, Gulaim A.; Daniel, Geoffrey; Nedelec, Jean-Marie; Kessler, Vadim G.
2013-03-01
Formation of nanocrystalline and monodisperse TiO2 from a water soluble and stable precursor, ammonium oxo-lactato-titanate, (NH4)8Ti4O4(Lactate)8.4H2O, often referred to as TiBALDH or TALH, is demonstrated to be due to a coordination equilibrium. This compound, individual in the solid state, exists in solution in equilibrium with ammonium tris-lactato-titanate, (NH4)2Ti(Lactate)3 and uniform crystalline TiO2 nanoparticles (anatase) stabilized by surface-capping with lactate ligands. This equilibrium can be shifted towards nano-TiO2via application of a less polar solvent like methanol or ethanol, dilution of the solution, introduction of salts or raising the temperature, and reverted on addition of polar and strongly solvating media such as dimethyl sulfoxide, according to NMR. Aggregation and precipitation of the particles were followed by DLS and could be achieved by a decrease in their surface charge by adsorption of strongly hydrogen-bonding cations, e.g. in solutions of ammonia, ethanolamine or amino acid arginine or by addition of ethanol. The observed equilibrium may be involved in formation of nano-titania on the surface of plant roots exerting chelating organic carboxylate ligands and thus potentially influencing plant interactions.Formation of nanocrystalline and monodisperse TiO2 from a water soluble and stable precursor, ammonium oxo-lactato-titanate, (NH4)8Ti4O4(Lactate)8.4H2O, often referred to as TiBALDH or TALH, is demonstrated to be due to a coordination equilibrium. This compound, individual in the solid state, exists in solution in equilibrium with ammonium tris-lactato-titanate, (NH4)2Ti(Lactate)3 and uniform crystalline TiO2 nanoparticles (anatase) stabilized by surface-capping with lactate ligands. This equilibrium can be shifted towards nano-TiO2via application of a less polar solvent like methanol or ethanol, dilution of the solution, introduction of salts or raising the temperature, and reverted on addition of polar and strongly solvating media such as dimethyl sulfoxide, according to NMR. Aggregation and precipitation of the particles were followed by DLS and could be achieved by a decrease in their surface charge by adsorption of strongly hydrogen-bonding cations, e.g. in solutions of ammonia, ethanolamine or amino acid arginine or by addition of ethanol. The observed equilibrium may be involved in formation of nano-titania on the surface of plant roots exerting chelating organic carboxylate ligands and thus potentially influencing plant interactions. Electronic supplementary information (ESI) available: Crystallographic data in cif and table format, detailed description of hydrogen bonding in (NH4)2[Ti(l-Lactate)3].3H2O, additional TEM images, DLS data on particle size in solutions and NanoSight data on particle size distribution, photos of produced TiO2 colloids, details of NMR experiments and a real-time movie demonstrating the equilibrium leading to TiO2 formation and re-dissolution in pH-neutral ammonium lactate solutions. CCDC 915222. For ESI and crystallographic data in CIF or other electronic format. see DOI: 10.1039/c3nr34068f
Response of potatoes to nitrogen concentrations differ with nitrogen forms
NASA Technical Reports Server (NTRS)
Cao, W.; Tibbitts, T. W.
1998-01-01
Two separate experiments were conducted to investigate plant growth and mineral composition of potatoes (Solanum tuberosum L.) at varied solution concentrations of nitrate (NO3-) and ammonium (NH4+). Each experiment evaluated five nitrogen (N) concentrations of 0.5, 2, 4, 8, and 12 mM, which were maintained with a non-recirculating nutrient film system in controlled environment. Plants were harvested on day 42 with NO3-; and day 35 with NH4+ after transplanting of tissue culture plantlets, and growth measurements were taken as leaf area, tuber number, and dry weights of different parts. With NO3-, plant growth was greatest and similar at 2, 4, and 8 mM of N whereas with NH4+, plant growth was best only at 2 and 4 mM of N. At 12 mM of N, plants exhibited interveinal ammonium toxicity with NH4+ nutrition, but healthy growth appearance with NO3- nutrition. With either N form, total N concentrations in tissues tended to increase with increased N concentrations, and tissue phosphorus (P) concentrations were reduced at 0.5 and 2 mM of N. Tissue concentrations of calcium (Ca), magnesium (Mg), and sulfur (S) changed only slightly at particular N concentrations, yet changed substantially with different N forms. The data indicate that the optimal ranges of N concentrations in both solution and tissues are wider and higher with NO3- than with NH4+ nutrition, and thus a careful control of NH4+ concentrations is necessary to minimize possible ammonium toxicity to potato plants.
Thermodynamics and nucleation mechanism of ammonium jarosite in sulfuric acid solution
NASA Astrophysics Data System (ADS)
Liu, PengFei; Zhang, YiFei; Wang, Li; You, ShaoWei; Bo, Jing
2017-11-01
Jarosite process is one of the most widely used methods in removing Fe, but in which the nucleation mechanism of ammonium jarosite has not been reported. Solubilities of the ammonium jarosite crystals under different Fe2(SO4)3 and (NH4)2SO4 concentrations and under different temperatures were measured, and the experiments of induction periods were systematically investigated in different temperatures (348 k, 358 k and 368 k) and H2SO4 concentrations (9 g/L, 10.8 g/L and 12.6 g/L) by reaction crystallization process based on the thermodynamic equilibrium data. According to the model of classical nucleation theory, the interfacial tension and the surface entropy factors in different conditions were calculated as 1.21 mJ/m2, 1.85 mJ/m2, 1.71 mJ/m2 and 1.51, 1.27, 1.17. The SEM photographs of (H3O, NH4)Fe3(SO4)2(OH)6 approved that the ammonium jarosite crystals were clearly grown by the two-dimensional nucleation mechanism and/or the spiral growth mechanism. But the growth mechanism of (H3O, NH4)Fe3(SO4)2(OH)6 had been determined to be the continuous growth by the surface entropy factor.
Near-infrared detection of ammonium minerals at Ivanhoe Hot Springs, Nevada
NASA Technical Reports Server (NTRS)
Krohn, M. D.
1986-01-01
Airborne Imaging Spectrometer (AIS) data were collected over the fossil hot spring deposit at Ivanhoe, Nevada in order to determine the surface distribution of NH4-bearing minerals. Laboratory studies show that NH4-bearing minerals have characteristic absorption features in the near-infrared (NIR). Ammonium-bearing feldspars and alunites were observed at the surface of Ivanhoe using a hand-held radiometer. However, first look analysis of the AIS images showed that the line was about 500 m east of its intended mark, and the vegetation cover was sufficiently dense to inhibit preliminary attempts at making relative reflectance images for detection of ammonium minerals.
Mukarunyana, Brigitte; van de Vossenberg, Jack; van Lier, Jules B; van der Steen, Peter
2018-04-10
Removal of nitrogen from wastewater without using electricity consuming aerators was previously observed in photo-bioreactors with a mixed algal-bacterial biomass. Algammox is the particular process based on algae, ammonium oxidizing organisms and anammox bacteria. In this research the activity of anammox bacteria in such an oxygen-producing environment was tested, as well as the effect of short-duration increase in dissolved oxygen (DO) to values potentially inhibiting anammox activity. Sequencing batch photo-bioreactors were fed with settled domestic wastewater enriched with ammonium (200mgNH 4 + -N/L) and exposed to light within the photosynthetic active range with intensity of about 500μmol/m 2 ·s. Each cycle consisted of 12h illumination and 12h darkness. A well-settling biomass (10days solids retention time) developed that carried out nitritation, nitrification and anammox. Ammonium removal rate during the light period was 4.5mgN-NH 4 + /L·h, equal to 858mgN-NH 4 + /m 2 ·h or 477mgN-NH 4 + /(mol photons). When the reactors were aerated for 3h to temporarily increase the DO, anammox was inhibited at bulk DO values larger than 0.4-1.0mg/L. For almost oxygen saturated conditions, recovery time was about 9days. Algammox photo-bioreactors are therefore able to overcome short periods of oxygen stress, provided they occur only occasionally. Copyright © 2018 Elsevier B.V. All rights reserved.
Mechano-chemical synthesis K2MF6 (M = Mn, Ni) by cation-exchange reaction at room temperature
NASA Astrophysics Data System (ADS)
Rawat, Pooja; Nagarajan, Rajamani
2018-02-01
In order to establish the power of mechanochemistry to produce industrially important phosphors, synthesis of K2MnF6 has been attempted by the successive grinding reactions of manganese (II) acetate with ammonium fluoride and potassium fluoride. The progress of reaction was followed by ex-situ characterization after periodic intervals of time. Cubic symmetry of K2MnF6 was evident from its powder X-ray diffraction pattern which was refined successfully in cubic space group (Fm-3m) with a = 8.4658 (20) Å. Stretching and bending vibration modes of MnF62- octahedral units appeared at 740 and 482 cm-1 in the fourier transformed infrared spectrum. Bands at 405 and 652 cm-1 appeared in the Raman spectrum and they were finger-print positions of cubic K2MnF6. Other than the ligand to metal charge transfer transition at 242 nm, transitions from 4A2g to 4T1g, 4T2g and 2T2g of Mn4+-ion appeared at 352, 429, 474 and 569 nm in the UV-visible diffuse reflectance spectrum of the sample. Red emission due to Mn4+ was observed in the photoluminescence spectrum with a decay time of 0.22 ms. Following the success in forming cubic K2MnF6, this approach has been extended to synthesize cubic K2NiF6 at room temperature. All these results confirmed the susceptibility of acetate salts of transition metals belonging to first-row of the periodic table to facile fluorination at room temperature aided by mechanical forces.
Lopes, Marta S; Araus, José L
2008-09-01
Long-term differences in photosynthesis, respiration and growth of plants receiving distinct nitrogen (N) sources imply that N metabolism generates signals that regulate metabolism and development. The molecular basis of these signals remains unclear. Here we studied the gene expression profiles of barley (Hordeum vulgare L. cv. Graphic) seedlings fertilized either with ammonium (NH4+), with ammonium and nitrate (NH4+:NO3-), or with nitrate (NO3-) only. Our transcriptome analysis after 48 h of growth in these N sources showed major changes in the expression of genes involved in N metabolism (nitrate reductase), signalling (protein kinases and protein phosphatases), photosynthesis (chlorophyll a/b-binding protein and a PsbQ domain), where increases in NO3- as compared with NH4+ were observed. Moreover, NH4+ assimilation induced genes participating in C and sugars metabolism (phosphoglycerate kinase, glucosyltranferase and galactokinase), respiration (cytochrome c oxidase), protein fate (heat shock proteins) and development (MTN3-like protein). These changes in gene expression could well explain the long-term growth depression observed in NH4+ plants. Even if a few genes participating in protein fate (proteases) and development (OsNAC5) were upregulated in NH4+ as compared with NH4+:NO3-, the general pattern of expression was quite similar between these two N sources. Taken together, these results indicated that other downstream mechanisms should be involved in the synergetic long-term response of NH4+:NO3-.
Sui, Qianwen; Liu, Chong; Dong, Hongmin; Zhu, Zhiping
2014-09-01
A membrane bioreactor (MBR) was developed for the treatment of anaerobically digested swine wastewater and to investigate the effect of ammonium nitrogen concentration on biological nitrogen removal and ammonia-oxidizing bacteria (AOB) community structures. The MBR achieved a high NH4(+)-N removal efficiency of 0.08 kgNMLSS(-1)d(-1) and removed 95% of the influent NH4(+)-N. The TN removal rate was highest of 82.62% at COD/TN and BOD5/TN ratios of 8.76 ± 0.30 and 3.02 ± 0.09, respectively. With the decrease in ammonium nitrogen concentrations, the diversity of the AOB community declined and showed a simple pattern of DGGE. However, the AOB population size remained high, with abundance of 10(7)-10(9) copies mL(-1). With the decrease of ammonium nitrogen concentrations, Nitrosomonas eutropha gradually disappeared, whereas Nitrosomonas sp. OZK11 showed constant adaptability to survive during each treatment stage. The selective effect of ammonium concentration on AOB species could be due to the affinity for NH4(+)-N. In this study, the changes of ammonium nitrogen concentrations in digested swine wastewater were found to have selective effects on the composition of AOB community, and biological nitrogen removal was improved by optimising the influencing parameters. Copyright © 2014. Published by Elsevier B.V.
Huang, Ying; Yang, Fei; Ai, Luoyan; Feng, Min; Wang, Chi; Wang, Zhaohui; Liu, Jianshe
2017-07-01
A large amount of chloride and ammonium ions were produced and released from industrial processes with non-biodegradable organic pollutants to affect efficiencies of advanced oxidation processes (AOPs). Here, the influences of chloride and ammonium ions on Co/peroxymonosulfate (Co/PMS) reaction system, a widely used AOPs to produce sulfate radicals, were investigated by examining the degradation efficiency of an azo dye (Acid Orange 7, AO7). The experimental results showed that a significant decrease in the degradation rate of AO7 was observed in the presence of NH 4 + , while a dual effect of chloride on AO7 bleaching appeared. The presence of NH 4 Cl was unfavorable for AO7 degradation at low concentration (<20 mM), whereas further addition of NH 4 Cl (>20 mM) apparently accelerated AO7 discoloration rate. The apparent effects of the two co-existing inorganic ions were determined by roles of the dominating ions at varied molar ratio of [NH 4 + ]/[Cl - ]. The present study may have technical implications for the treatment of industrial wastewater containing diverse ions in practice. Copyright © 2017 Elsevier Ltd. All rights reserved.
Shi, Pengbo; Jiang, Yingbo; Zhu, Hongtao; Sun, Dezhi
2017-07-01
The CaO dissolution from slag, as well as the effects of influencing parameters (i.e. pH and Ca 2+ concentration) on the ammonium adsorption onto zeolite, was systematically studied in this paper. Modeling results of Ca 2+ and OH - release from slag indicated that pseudo-second-order reaction had a better fitness than pseudo-first-order reaction. Changing pH value from 7 to 12 resulted in a drastic reduction of the ammonium adsorption capacity on zeolite, from the peak adsorption capacity at pH 7. High Ca 2+ concentration in solution also inhibited the adsorption of ammonium onto zeolite. There are two proposed mechanisms for steel slag inhibiting the ammonium adsorption capacity of zeolite. On the one hand, OH - released from steel slag can react with ammonium ions to produce the molecular form of ammonia (NH 3 ·H 2 O), which would cause the dissociation of NH 4 + from zeolite. On the other hand, Ca 2+ could replace the NH 4 + ions to adhere onto the surface of zeolite. An innovative substrate filling configuration with zeolite placed upstream of the steel slag was then proposed to eliminate the disadvantageous effects of steel slag. Experimental results showed that this novel filling configuration was superior to two other filling configurations in terms of ammonium removal.
Wang, Feng; Gao, Jingwen; Tian, Zhongwei; Liu, Yang; Abid, Muhammad; Jiang, Dong; Cao, Weixing; Dai, Tingbo
2016-11-01
Because soil acidification accompanies ammonium (NH 4 + ) stress, the tolerance of higher plants to ammonium is associated with their adaptation to root medium acidification. However, the underlying mechanisms of this adaptation have not been fully elucidated. The objective of this study was thus to elucidate the effect of rhizosphere pH on NH 4 + tolerance in different winter wheat cultivars (Triticum aestivum L.). Hydroponic experiments were carried out on two wheat cultivars: AK58 (an NH 4 + -sensitive cultivar) and XM25 (an NH 4 + -tolerant cultivar). Four pH levels resembling acidified (4.0, 5.0, 6.0 and 7.0) were tested and 5 mM NH 4 + nitrogen (AN) was used as a stress treatment, with 5 mM nitrate nitrogen used as a control. The addition of AN led to a severe reduction in biomass and an increase in free NH 4 + , amino acids, and the activities of glutamine synthetase (GS) and glutamate dehydrogenase (GDH) in the shoots and roots of the two wheat cultivars. Further decreases in growth medium pH led to further increases in free NH 4 + , but decreases in total amino acids and the activities of GS and NADH-dependent glutamate synthase (NADH-GDH). However, there was less of an increase in free NH 4 + and less of a reduction in the activities of GS and NADH-GDH in the cultivar XM25 compared with AK58. In addition, total soluble sugar content and the root-to-shoot soluble sugar ratio were also decreased by AN treatment, except in the shoots of XM25. Decreasing pH resulted in lower root-to-shoot soluble sugar ratios with greater reductions in the AK58 cultivar. These results indicate that wheat growth was inhibited significantly by the addition of NH 4 + combined with low pH. Low medium pH reduced the capacity for nitrogen assimilation and interrupted carbohydrate transport between the shoot and root. The NH 4 + -tolerant cultivar XM25 was better adapted to low rhizosphere pH due to its increased capacity for assimilating NH 4 + efficiently and thereby avoiding toxic levels of intracellular NH 4 + at low medium pH. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Gas-phase ammonia and PM2.5 ammonium in a busy traffic area of Nanjing, China.
Wang, Wenxin; Wang, Shanshan; Xu, Jianhua; Zhou, Rui; Shi, Chanzhen; Zhou, Bin
2016-01-01
The gas-phase ammonia (NH3) and fine particle PM2.5 ammonium (pNH4(+)) (collectively, NHx) were monitored between July 2013 and August 2014 in a busy traffic area of Nanjing, China. Results showed that PM2.5 concentration was 66.7 μg m(-3), and NH3 concentration was 6.66 μg m(-3). In the PM2.5, the concentration of pNH4(+) was 3.04 μg m(-3), SO4(2-) (pSO4(2-)) was 10.16 μg m(-3), and NO3(-) (pNO3(-)) was 1.60 μg m(-3). The significant correlation curves from the tests of PM2.5 revealed that molar ratio of pNH4(+) and pSO4(2-) was approximately 2, which could be (NH4)2SO4. Particulate NH4(+) primarily associated with pSO4(2-), which accounted for 4.54% of total PM2.5 mass. The PM2.5 observed acidic and the NH3 in the atmosphere neutralized acidic species, mainly in a sulfate form. The traffic intensity in the region was partially related to the formation of PM2.5 and NH3, suggesting that traffic pollution may be an important source of PM2.5. The reaction between NHx and acidic species was assumed to the secondary PM2.5. The neutralization and photochemical property of NHx were discussed.
Ariz, Idoia; Asensio, Aaron C; Zamarreño, Angel M; García-Mina, Jose M; Aparicio-Tejo, Pedro M; Moran, Jose F
2013-08-01
An understanding of the mechanisms underlying ammonium (NH(4)(+)) toxicity in plants requires prior knowledge of the metabolic uses for nitrogen (N) and carbon (C). We have recently shown that pea plants grown at high NH(4)(+) concentrations suffer an energy deficiency associated with a disruption of ionic homeostasis. Furthermore, these plants are unable to adequately regulate internal NH4(+) levels and the cell-charge balance associated with cation uptake. Herein we show a role for an extra-C application in the regulation of C-N metabolism in NH(4)(+) -fed plants. Thus, pea plants (Pisum sativum) were grown at a range of NH(4)(+) concentrations as sole N source, and two light intensities were applied to vary the C supply to the plants. Control plants grown at high NH(4)(+) concentration triggered a toxicity response with the characteristic pattern of C-starvation conditions. This toxicity response resulted in the redistribution of N from amino acids, mostly asparagine, and lower C/N ratios. The C/N imbalance at high NH(4)(+) concentration under control conditions induced a strong activation of root C metabolism and the upregulation of anaplerotic enzymes to provide C intermediates for the tricarboxylic acid cycle. A high light intensity partially reverted these C-starvation symptoms by providing higher C availability to the plants. The extra-C contributed to a lower C4/C5 amino acid ratio while maintaining the relative contents of some minor amino acids involved in key pathways regulating the C/N status of the plants unchanged. C availability can therefore be considered to be a determinant factor in the tolerance/sensitivity mechanisms to NH(4)(+) nutrition in plants. Copyright © Physiologia Plantarum 2012.
NASA Astrophysics Data System (ADS)
Ando, T.; Iizuka, Y.; Ohno, H.; Sugiyama, S.
2017-12-01
Emission regulation of anthropogenic NOX and SOX since late 90's rather caused excess atmospheric ammonium (NH3) in agricultural regions (Warner et al., 2017, Geophys. Res. Lett.). The Arctic is one of the most sensitive areas for future warming. Aerosols in the Arctic are transported from the Northern Hemisphere and mostly experience wet deposition (Breider et al., 2014, Jour. of Geophys. Res.: Atmos.). Ice cores preserve past water-soluble aerosols. From these viewpoints, ice cores from the Arctic is suitable to evaluate recent variation in aerosol composition due to human activity in the Northern Hemisphere and aerosol transportation. We analyzed ion concentrations in the ice core samples from a southeastern dome in Greenland (SE-Dome). The concentrations increased for NH4+ and decreased for SO42- after late 90's. The NH4+ increasing trend is due to excess NH3 emission in North America. Cloud nuclei formation depends on chemical form of aerosols. Thus, differences in chemical forms of these ammonium aerosols in SE-Dome samples are important to evaluate the effect on climate change in Greenland. In this study, we identified the chemical form of aerosols (water-soluble inclusions) in the SE-Dome ice core by using micro-Raman spectroscopy. SE-Dome ice core samples were collected in 2015 and enabled us to reconstruct seasonal variation owing to extremely higher accumulation rate ( 1m/yr.). The ice samples were sublimated and accumulated inclusions on the Ni sheets in a clean booth under -22 degrees Celsius. We identified CaSO4, Na2SO4, (NH4)2SO4, NaNO3, NH4NO3 by Raman spectra. This is the first report to identify ammonium salts ((NH4)2SO4 and NH4NO3) from ice core sample. In the summer samples, the relative abundances of CaSO4 and NaNO3 are lower but (NH4)2SO4 are higher than those in the spring samples. NH4+ rapidly react with SO24- under higher temperature. Higher concentration of NH3 in the warmest season possibly enhanced the formation of (NH4)2SO4 in North America and/or transportation of (NH4)2SO4 to the Arctic. Interestingly, (NH4)2SO4 are not detected from the spring samples deposited after late 90's while NH4NO3 are observed. Reduction of SOX emission since late 90's presumably reduced (NH4)2SO4 formation in North America agricultural regions and its transportation to the Arctic such as Greenland.
2015-07-01
Postma et al. 2002). Unionized ammonia (NH3) is more toxic relative to the ammonium ion ( NH4 +) (USEPA 1989, 1999a, 2009). The fraction of total...ammonia (i.e., sum concentration of NH4 + and NH3) that is unionized ammonia (UIA) is contingent on the pH, temperature, and salinity of the test water
Ammonium Nitrogen Removal from Urea Fertilizer Plant Wastewater via Struvite Crystal Production
NASA Astrophysics Data System (ADS)
Machdar, I.; Depari, S. D.; Ulfa, R.; Muhammad, S.; Hisbullah, A. B.; Safrul, W.
2018-05-01
Elimination of ammonium concentration from urea fertilizer plant wastewater through struvite crystal (NH4MgPO4.6H2O) formation by adding MgCl2, KH2PO4, and KOH were studied. This method of elimination has two benefits, namely, reducing ammonium nitrogen content in the wastewater, as well as production of a valuable material (struvite crystal). Struvite is known as a slow-release fertilizer and less soluble. This report presents the ammonium removal efficiencies during struvite formation. The growth of struvite production under different molar ratios of Mg2+:NH4 +:PO4 3- and solution pH is also discussed. To find the efficiencies and measure the growth rates, lab-scale experiments were conducted in a batch crystallizer-reactor. SEM, XRD, and FTIR observation were also applied to investigate the characteristics of struvite. The reactant molar ratios of Mg2+:NH4 +:PO4 3- of 1.2:1:1, 1:1:1.2, and 1:1:1 were evaluated. Each of the molar ratios was treated at the solution pH of 8, 9, and 10. It was found that, the highest ammonium removal efficiency was 94.7% at the molar ratio of 1.2:1:1 and pH of 9. Primarily, the growth rate of struvite formation complied with a first-order kinetic model. The rate constants (k1) were calculated to be 2.6, 4.3, and 5.0 h-1 for solution pH of 8, 9, and 10, respectively. The findings of the study provide suggestion for an alternative sustainable recovery of ammonium nitrogen content in a urea fertilizer plant effluent.
Li, Ya; Shi, Shaoyuan; Cao, Hongbin; Wu, Xinmin; Zhao, Zhijuan; Wang, Liying
2016-02-01
Simulated ammonium chloride wastewater was treated by a lab-scale bipolar membrane electrodialysis for the generation of HCl and NH3·H2O and desalination. The influence of initial concentration of NH4Cl, current density, salt solution volume, initial concentration of acid and base and membrane stack structure on the yields of HCl and NH3·H2O was investigated. The current efficiency and energy consumption were also examined under different conditions. The results showed that, at the current density of 48 mA/cm(2), the highest concentration of HCl and NH3·H2O with initial concentration of 110 g/L NH4Cl was 57.67 g/L and 45.85 g/L, respectively. Higher initial concentration of NH4Cl was favor to reduce unit energy consumption and increase current efficiency of the BMED system. The membrane stack voltage of BMED increased quickly under constant current when the concentration of NH4Cl contained in the solution of salt compartment was depleted below the "inflection point concentration" about 8000 mg/L. It means that the concentration of NH4Cl below 8000 mg/L was no longer suitable for BMED because of higher energy consumption. The HCl and NH3·H2O concentration increased more quickly following the increase of current density. When increasing the volume of NH4Cl, the concentration of HCl and NH3·H2O also increased. The high initial concentration of acid and base could improve the final concentration of them, while the growth rate was decreased. Compared with the BMED system with three compartments, the growth rate of HCl concentration with the two compartments was higher and its unit energy consumption was lower. It meant that the performance of the BMED system could be improved by optimizing operation conditions. The application feasibility of the generation of HCl and NH3·H2O and desalination of ammonium chloride wastewater by BMED was proved. Copyright © 2015 Elsevier Ltd. All rights reserved.
Cao, Shifeng; Yuan, Yongjun; Hu, Zhichao; Zheng, Yonghua
2010-07-15
The potential enhancement of Pichia membranifaciens by ammonium molybdate (NH(4)Mo) to control blue mould caused by Penicillium expansum on peach fruit was investigated. Combining P. membranifaciens at 1x10(8) cell/ml with 1 mM NH(4)Mo provided a more effective control of blue mould rot than applying the yeast or NH(4)Mo alone. Addition of 1 mM NH(4)Mo significantly increased the growth of P. membranifaciens in peach wounds, but did not affect the population in nutrient yeast dextrose broth medium. The in vitro experiment showed that the combined treatment inhibited spore germination and germ tube elongation of P. expansum in comparison with the treatment of P. membranifaciens or NH(4)Mo alone. Moreover, P. membranifaciens, NH(4)Mo, and the combination of them did not impair the quality parameters including fruit firmness and content of total soluble solids, titratable acidity and vitamin C of peach fruit after 6 days of storage at 20 degrees C. These results suggested that the use of NH(4)Mo is a useful approach to improve the efficacy of P. membranifaciens for postharvest disease control in peach fruit. 2010 Published by Elsevier B.V. All rights reserved.
Chemical Ignition of Flame Throwers
1944-04-20
fluorinating agents such as fluorine, antimony penta- fluoride, oxygen fluoride or bromine and chlorine trifluoride mixtures be evaluated. The use...0F2), and bromine and chlorine trifluoride mixtures (BrF3-ClF3). Oxygen fluoride, a gas boiling at -l67°C., has the interesting property of being...ShFc), oxygen fluoride (0F2), and bromine and chlorine fluoride mixtures (BrF3-ClFsJ. Oxygen fluoride Is stable In the presence of moisture. 4
Ferrieri, Richard A.; Schlyer, David J.; Shea, Colleen
1995-06-13
A process for simultaneously producing PET-usable quantities of [.sup.13 N]NH.sub.3 and [.sup.18 F]F.sup.- for radiotracer synthesis is disclosed. The process includes producing [.sup.13 N]NO.sub.2.sup.- /NO.sub.3.sup.- and [.sup.18 F]F.sup.- simultaneously by exposing a low-enriched (20%-30%) [.sup.18 O]H.sub.2 O target to proton irradiation, sequentially isolating the [.sup.13 N]NO.sub.2.sup.- /NO.sub.3.sup.- and [.sup.18 F]F.sup.- from the [.sup.18 O]H.sub.2 O target, and reducing the [.sup.13 N]NO.sub.2.sup.- /NO.sub.3.sup.- to [.sup.13 N]NH.sub.3. The [.sup.13 N]NH.sub.3 and [.sup.18 F]F.sup.- products are then conveyed to a laboratory for radiotracer applications. The process employs an anion exchange resin for isolation of the isotopes from the [.sup.18 O]H.sub.2 O, and sequential elution of [.sup.13 N]NO.sub.2.sup.- /NO.sub.3.sup.- and [ .sup.18 F]F.sup.- fractions. Also the apparatus is disclosed for simultaneously producing PET-usable quantities of [.sup.13 N]NH.sub.3 and [.sup.18 F]F.sup.- from a single irradiation of a single low-enriched [.sup.18 O]H.sub.2 O target.
Direct Synthesis of Anatase Films with ~100% (001) Facets and [001] Preferred Orientation.
Ichimura, Andrew S; Mack, Brianne; Usmani, Shirin M; Mars, Diana
2012-06-26
Anatase films exhibiting ~100% (001) reactive facets at the surface were grown hydrothermally on gold substrate from a homogeneous solution of TiF(4) and NaF. In addition to NaF, it was found that TiO(2) films with very similar properties could be prepared with the fluoride salts LiF, CsF, HF, NH(4)F, and N(CH(2)CH(3))(4)F. The polycrystalline anatase films are continuous, approximately 1 μm thick, and evenly coat the substrate. The surface grain size is ~400 nm. Grazing angle XRD measurements show that the films exhibit a high degree of preferred orientation with the c-axis normal to the substrate surface. SEM images reveal that the grains span the thickness of the films. Annealing the films at 500 °C removes fluorine and causes crystallites within the grains to restructure as shown by SEM, XRD, and Raman spectroscopy. Supported anatase films grown from this one-pot method may serve as oxidative photocatalysts and electrodes for photoelectrochemical applications such as solar cells and hydrogen evolution.
NASA Astrophysics Data System (ADS)
Hampel, Justyna J.; McCarthy, Mark J.; Gardner, Wayne S.; Zhang, Lu; Xu, Hai; Zhu, Guangwei; Newell, Silvia E.
2018-02-01
Taihu Lake is hypereutrophic and experiences seasonal, cyanobacterial harmful algal blooms. These Microcystis blooms produce microcystin, a potent liver toxin, and are linked to anthropogenic nitrogen (N) and phosphorus (P) loads to lakes. Microcystis spp. cannot fix atmospheric N and must compete with ammonia-oxidizing and other organisms for ammonium (NH4+). We measured NH4+ regeneration and potential uptake rates and total nitrification using stable-isotope techniques. Nitrification studies included abundance of the functional gene for NH4+ oxidation, amoA, for ammonia-oxidizing archaea (AOA) and bacteria (AOB). Potential NH4+ uptake rates ranged from 0.02 to 6.80 µmol L-1 h-1 in the light and from 0.05 to 3.33 µmol L-1 h-1 in the dark, and NH4+ regeneration rates ranged from 0.03 to 2.37 µmol L-1 h-1. Nitrification rates exceeded previously reported rates in most freshwater systems. Total nitrification often exceeded 200 nmol L-1 d-1 and was > 1000 nmol L-1 d-1 at one station near a river discharge. AOA amoA gene copies were more abundant than AOB gene copies (p < 0.005) at all times; however, only abundance of AOB amoA (not AOA) was correlated with nitrification rates for all stations and all seasons (p < 0.005). Nitrification rates in Taihu Lake varied seasonally; at most stations, rates were highest in March, lower in June, and lowest in July, corresponding with cyanobacterial bloom progression, suggesting that nitrifiers were poor competitors for NH4+ during the bloom. Regeneration results suggested that cyanobacteria relied extensively on regenerated NH4+ to sustain the bloom. Internal NH4+ regeneration exceeded external N loading to the lake by a factor of 2 but was ultimately fueled by external N loads. Our results thus support the growing literature calling for watershed N loading reductions in concert with existing management of P loads.
NASA Astrophysics Data System (ADS)
Baer, Steven E.; Connelly, Tara L.; Sipler, Rachel E.; Yager, Patricia L.; Bronk, Deborah A.
2014-12-01
Biogeochemical rate processes in the Arctic are not currently well constrained, and there is very limited information on how rates may change as the region warms. Here we present data on the sensitivity of ammonium (NH4+) uptake and nitrification rates to short-term warming. Samples were collected from the Chukchi Sea off the coast of Barrow, Alaska, during winter, spring, and summer and incubated for 24 h in the dark with additions of 15NH4+ at -1.5, 6, 13, and 20°C. Rates of NH4+ uptake and nitrification were measured in conjunction with bacterial production. In all seasons, NH4+ uptake rates were highest at temperatures similar to current summertime conditions but dropped off with increased warming, indicative of psychrophilic (i.e., cold-loving) microbial communities. In contrast, nitrification rates were less sensitive to temperature and were higher in winter and spring compared to summer. These findings suggest that as the Arctic coastal ecosystem continues to warm, NH4+ assimilation may become increasingly important, relative to nitrification, although the magnitude of NH4+ assimilation would be still be lower than nitrification.
Tunneling Spectroscopy of Chemically Treated Surfaces of GaAs(001)
NASA Astrophysics Data System (ADS)
Fan, Jia-Fa; Tokumoto, Hiroshi
1996-03-01
Effect of surface chemical treatment on the surface electronic properties of GaAs(001) was studied by tunneling spectroscopy. Samples of highly-Si-doped GaAs were first cleaned and etched using conventional processes, then soaked in aqueous solutions of (NH_4)_2Sx and/or NH_4F for few hours, and finally rinsed in ethanol. The constant separation spectroscopy was done under pure N2 ambient at room temperature (295K) with our scanning tunneling microscope (STM). As a result, the sulfide treament lead to electron tunnelings starting typically at the sample voltages of -0.50 V and 0.90 V at initial settings of 1.50 V and 0.20 nA. For etched-only surface, however, the starting voltages were -0.70 V and 0.70 V. Effects of heating, laser-irradiation, and the fluoride treatment will be presented. Also, the mechanism of the shift of the surface Fermi level will be discussed.
Tarrasón, D; Ojeda, G; Ortiz, O; Alcañiz, J M
2008-01-01
Anaerobically-digested sludge called fresh sludge (F), composted sludge (C) and thermally-drying sludge (T), all from the same batch, were applied to the surface of a calcareous Udic Calciustept with loamy texture. Dosage equivalent was 10 t ha(-1) of dry matter. The concentration of mineral nitrogen (ammonium and nitrate) in the soil was measured in order to estimate the effects of the post-treatments to which the different kinds of sewage sludge are subjected in relation to the availability of N in the surface layer of the soil. The most significant differences in NH(4)-N and NO(3)-N concentrations due to the transformation of the organic matter were observed during the first three weeks following soil amendment. Thermally-dried and composted sludge initially displayed higher concentrations of ammonium and nitrate in soil. Five months after the amendment, soil applied with fresh sludge showed the highest concentrations of NH(4)-N and NO(3)-N (6.1 and 36.6 mg kg(-1), respectively). It is clear that the processes of composting and thermal-drying influence the bioavailability of nitrogen from the different types of sewage sludge.
Origin of the SN2 benzylic effect.
Galabov, Boris; Nikolova, Valia; Wilke, Jeremiah J; Schaefer, Henry F; Allen, Wesley D
2008-07-30
The S N2 identity exchange reactions of the fluoride ion with benzyl fluoride and 10 para-substituted derivatives (RC6H 4CH 2F, R = CH3, OH, OCH 3, NH2, F, Cl, CCH, CN, COF, and NO2) have been investigated by both rigorous ab initio methods and carefully calibrated density functional theory. Groundbreaking focal-point computations were executed for the C6H5CH 2F + F (-) and C 6H 5CH2Cl + Cl (-) SN2 reactions at the highest possible levels of electronic structure theory, employing complete basis set (CBS) extrapolations of aug-cc-pV XZ (X = 2-5) Hartree-Fock and MP2 energies, and including higher-order electron correlation via CCSD/aug-cc-pVQZ and CCSD(T)/aug-cc-pVTZ coupled cluster wave functions. Strong linear dependences are found between the computed electrostatic potential at the reaction-center carbon atom and the effective SN2 activation energies within the series of para-substituted benzyl fluorides. An activation strain energy decomposition indicates that the SN2 reactivity of these benzylic compounds is governed by the intrinsic electrostatic interaction between the reacting fragments. The delocalization of nucleophilic charge into the aromatic ring in the SN2 transition states is quite limited and should not be considered the origin of benzylic acceleration of SN2 reactions. Our rigorous focal-point computations validate the benzylic effect by establishing SN2 barriers for (F (-), Cl (-)) identity exchange in (C6H5CH2F, C6H 5CH2Cl) that are lower than those of (CH3F, CH3Cl) by (3.8, 1.6) kcal mol (-1), in order.
DISSOLUTION OF ZIRCONIUM AND ALLOYS THEREFOR
Swanson, J.L.
1961-07-11
The dissolution of zirconium cladding in a water solution of ammonium fluoride and ammonium nitrate is described. The method finds particular utility in processing spent fuel elements for nuclear reactors. The zirconium cladding is first dissolved in a water solution of ammonium fluoride and ammonium nitrate; insoluble uranium and plutonium fiuorides formed by attack of the solvent on the fuel materiai of the fuel element are then separated from the solution, and the fuel materiai is dissolved in another solution.
A vacuum ultraviolet photoionization study on the thermal decomposition of ammonium perchlorate
Gobi, Sandor; Zhao, Long; Xu, Bo; ...
2017-11-14
Pyrolysis products of ammonium perchlorate (NH 4ClO 4) at 483 K were monitored on line and in situ via single photon photoionization reflectron time-of-flight spectrometry (PI-ReTOF-MS) in the photon energy range of 9.00–17.50 eV. The photoionization efficiency curves (PIE) of the subliming product molecules were collected and allowed for detection of three class of products containing chlorine, nitrogen, and oxygen including atoms and free radicals. The results found suggest a new insight into possible low-temperature decomposition pathways of NH 4ClO 4.
A vacuum ultraviolet photoionization study on the thermal decomposition of ammonium perchlorate
DOE Office of Scientific and Technical Information (OSTI.GOV)
Gobi, Sandor; Zhao, Long; Xu, Bo
Pyrolysis products of ammonium perchlorate (NH 4ClO 4) at 483 K were monitored on line and in situ via single photon photoionization reflectron time-of-flight spectrometry (PI-ReTOF-MS) in the photon energy range of 9.00–17.50 eV. The photoionization efficiency curves (PIE) of the subliming product molecules were collected and allowed for detection of three class of products containing chlorine, nitrogen, and oxygen including atoms and free radicals. The results found suggest a new insight into possible low-temperature decomposition pathways of NH 4ClO 4.
A vacuum ultraviolet photoionization study on the thermal decomposition of ammonium perchlorate
NASA Astrophysics Data System (ADS)
Góbi, Sándor; Zhao, Long; Xu, Bo; Ablikim, Utuq; Ahmed, Musahid; Kaiser, Ralf I.
2018-01-01
Pyrolysis products of ammonium perchlorate (NH4ClO4) at 483 K were monitored on line and in situ via single photon photoionization reflectron time-of-flight spectrometry (PI-ReTOF-MS) in the photon energy range of 9.00-17.50 eV. The photoionization efficiency curves (PIE) of the subliming product molecules were collected and allowed for detection of three class of products containing chlorine, nitrogen, and oxygen including atoms and free radicals. These results suggest a new insight into possible low-temperature decomposition pathways of NH4ClO4.
NASA Astrophysics Data System (ADS)
Tabatabaee, F.; Sabbagh Alvani, A. A.; Sameie, H.; Moosakhani, S.; Salimi, R.; Taherian, M.
2014-01-01
The most effective process parameters were determined to synthesize spherical LaF3 nanoparticles with controllable size based on ethylenediaminetetraacetic acid (EDTA) via co-precipitation technique. Thermogravimetricdifferential thermal analysis, X-ray diffraction, scanning electron microscopy, dynamic light scattering and FT-IR spectroscopy were used to characterize the resulting powders. Detailed investigations revealed that the optimal LaF3 host nano-material was obtained when NH4F was used as a fluoride source in the presence of EDTA at pH = 5. Furthermore, photoluminescence spectra showed an intense double emission peak at 289 and 302 nm for cerium-doped LaF3 nanocrystals excited at 253 nm, which was assigned to the well-known 5d→4f (2F5/2 and 2F7/2) transitions of Ce3+ levels due to luminescence center mechanism. The experimental results indicate that the synthesized LaF3:0.05Ce powders with a band gap of 5.3 eV are promising phosphors for high density scintillators.
Taylor, Howard E.; Antweiler, Ronald C.; Brinton, Terry I.; Roth, David A.; Moody, John A.
1994-01-01
Extensive flooding in the upper Mississippi River Basin during summer 1993 had a significant effect on the water quality of the Mississippi River. To evaluate the change in temporal distribution and transport of dissolved constituents in the Mississippi River, six water samples were collected by a discharge-weighted method from July through September 1993 near Thebes, Illinois. Sampling at this location provided water-quality information from the upper Mississippi, the Missouri, and the Illinois River Basins. Dissolved major constituents that were analyzed in each of the samples included bicarbonate, calcium (Ca), carbonate (C03), chloride (Cl), dissolved organic carbon, magnesium (Mg), potassium (K), silica NOD, sodium (Na), and sulfate (S04). Dissolved nutrients included ammonium ion (NH4), nitrate (N03), nitrite (N02), and orthophosphate (P04) . Dissolved trace elements included aluminum (Al), arsenic (As), barium (Ba), boron (B), beryllium (Be), bromide (Br), cadmium (Cd), chromium (Cr), cobalt, (Co), copper (Cu), fluoride (F), iron (Fe), lead, lithium (Li), manganese (Mn), mercury (Hg), molybdenum (Mo), nickel (Ni), strontium (Sr), thallium, uranium (U), vanadium (V), and zinc (Zn). Other physical properties of water that were measured included specific conductance, pH and suspended-sediment concentration (particle size, less than 63 micrometers). Results of this study indicated that large quantities of dissolved constituents were transported through the river system. Generally, pH, alkalinity, and specific conductance and the concentrations of B, Br, Ca, Cl, Cr, K, Li, Mg, Mo, Na, S04, Sr, U, and V increased as water discharge decreased, while concentrations of F, Hg, and suspended sediment sharply decreased as water discharge decreased after the crest of the flood. Concentrations of other constituents, such as Al, As, Ba, Be, Co, Cu, Ni, N03, N02, NH4, P04, and Si02, varied with time as discharge decreased after the crest of the flood. For most constituents, the load transported during floods generally is much greater than that transported during low-flow conditions. How ever, for Cd, Cr, Fe, Mn, V, and Zn, loads increased substantially as water discharge decreased after the crest of the flood.
NASA Astrophysics Data System (ADS)
Gunaydin-Sen, Ozge
2005-03-01
Natural abundance ^15N CPMAS NMR has been used to investigate the paraelectric-antiferroelectric phase transition of NH4H2AsO4 (ADA) (TN˜216K) and of NH4H2PO4 (ADP) (148K), with a focus on the role of the NH4^+ ion. Isotropic chemical shift of ^15N for ADA exhibits an almost linear temperature dependence to within TN±1K, and then changes discontinuously, followed by another almost linear dependence. The spectra of the paraelectric and antiferroelectric phases coexist around the TN. The sharp anomaly around TN implies that the NH4^+ ions undergo a displacive transition, whereas the protons in the O-HO bonds undergo an order-disorder transition. The ^15N data thus support a mixed order-disorder-displacive mechanism for this transition. The ^15N data on ADP exhibit somewhat different behavior. ^31P CPMAS measurements will also be presented and discussed in terms of the above model.
NASA Astrophysics Data System (ADS)
Marinova, D.; Karadjova, V.; Stoilova, D.
2015-01-01
Infrared spectra of Tutton compounds, M‧2M‧‧(XO4)2ṡ6H2O (M‧ = K, NH4+; M‧‧ = Mg, Co, Ni, Cu, Zn; X = S, Se), as well as those of SO42- guest ions included in selenate host lattices and of NH4+ guest ions included in potassium host lattices are presented and discussed in the regions of ν3 and ν1 of SO42- guest ions, ν4 of NH4+ guest ions and water librations. The SO42- guest ions matrix-isolated in selenate matrices (approximately 2 mol%) exhibit three bands corresponding to ν3 and one band corresponding to ν1 in good agreement with the low site symmetry C1 of the host selenate ions. When the larger SeO42- ions are replaced by the smaller SO42- ions the mean values of the asymmetric stretching modes νbar3 of the included SO42- ions are slightly shifted to lower frequencies as compared to those of the same ions in the neat sulfate compounds due to the smaller repulsion potential of the selenate matrices (larger unit-cell volumes of the selenates). It has been established that the extent of energetic distortion of the sulfate ions matrix-isolated in the ammonium selenates as deduced from the values of Δν3 and Δν3/νc is stronger than that of the same ions matrix-isolated in the potassium selenates due to the formation of hydrogen bonds between the SO42- guest ions with both the water molecules in the host compounds and the NH4+ host ions (for example, Δν3 of the sulfate guest ions have values of 30 and 51 cm-1 in the nickel potassium and ammonium compounds, and 33 and 49 cm-1 in the zinc potassium and ammonium compounds, respectively). The infrared spectra of ammonium doped potassium sulfate matrices show three bands corresponding to Δν4 of the included ammonium ions in agreement with the low site symmetry C1 of the host potassium ions. However, the inclusion of ammonium ions in selenate matrices (with exception of the magnesium compound) leads to the appearance of four bands in the region of ν4. At that stage of our knowledge we assume that some kind of disorder of the ammonium ions included in selenate lattices occurs due to the different proton acceptor capability of the SO42- and SeO42- ions. The latter ions are known to exhibit stronger proton acceptor abilities. This fact will facilitate the formation of polyfurcate hydrogen bonds of the ammonium ions in the selenate matrices, thus leading to increasing in the coordination number of these ions, i.e. to a disorder of the ammonium guest ions. The strength of the hydrogen bonds formed in the title Tutton compounds as well as that of the hydrogen bonds in potassium compounds containing isomorphously included ammonium ions as deduced from the wavenumbers of the water librations are also discussed. The bands corresponding to water librations in the spectra of the mixed crystals K1.8(NH4)0.2M(XO4)2ṡ6H2O (M = Mg, Co, Ni, Cu, Zn; X = S, Se) broaden and shift to lower frequencies as compared to those of the potassium host compounds, thus indicating that weaker hydrogen bonds are formed in the mixed crystals. These spectroscopic findings are owing to the decrease in the proton acceptor capacity of the SO42- and SeO42- ions due to the formation of hydrogen bonds between the host anions and the guest ammonium cations additionally to water molecules (anti-cooperative or proton acceptor competitive effect). Furthermore, the band shifts in the spectra of the selenate matrices are generally larger than those observed in the spectra of the respective sulfates due to the stronger proton acceptor ability of the selenate ions.
Zhu, Changhua; Yang, Na; Guo, Zhengfei; Qian, Meng; Gan, Lijun
2016-08-01
Root hairs are plastic in response to nutrient supply, but relatively little is known about their development under low ammonium (NH4(+)) conditions. This study showed that reducing NH4(+) for 3 days in wild-type Arabidopsis seedlings resulted in drastic elongation of root hairs. To investigate the possible mediation of ethylene and auxin in this process, seedlings were treated with 2,3,5-triiodobenzoic acid (TIBA, auxin transport inhibitor), 1-naphthylphthalamic acid (NPA, auxin transport inhibitor), p-chlorophenoxy isobutyric acid (PCIB, auxin action inhibitor), aminoethoxyvinylglycine (AVG, chemical inhibitor of ethylene biosynthesis), or silver ions (Ag(+), ethylene perception antagonist) under low NH4(+) conditions. Our results showed that TIBA, NPA and PCIB did not inhibit root hair elongation under low NH4(+) conditions, while AVG and Ag(+) completely inhibited low NH4(+)-induced root hair elongation. This suggested that low NH4(+)-induced root hair elongation was dependent on the ethylene pathway, but not the auxin pathway. Further genetic studies revealed that root hair elongation in auxin-insensitive mutants was sensitive to low NH4(+) treatment, but elongation was less sensitive in ethylene-insensitive mutants than wild-type plants. In addition, low NH4(+)-induced root hair elongation was accompanied by reactive oxygen species (ROS) accumulation. Diphenylene iodonium (DPI, NADPH oxidase inhibitor) and dimethylthiourea (DMTU, ROS scavenger) inhibited low NH4(+)-induced root hair elongation, suggesting that ROS were involved in this process. Moreover, ethylene acted together with ROS to modulate root hair elongation under low NH4(+) conditions. These results demonstrate that a signaling pathway involving ethylene and ROS participates in regulation of root hair elongation when Arabidopsis seedlings are subjected to low NH4(+) conditions. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Pan, Yuepeng; Tian, Shili; Liu, Dongwei; Fang, Yunting; Zhu, Xiaying; Zhang, Qiang; Zheng, Bo; Michalski, Greg; Wang, Yuesi
2016-08-02
The reduction of ammonia (NH3) emissions is urgently needed due to its role in aerosol nucleation and growth causing haze formation during its conversion into ammonium (NH4(+)). However, the relative contributions of individual NH3 sources are unclear, and debate remains over whether agricultural emissions dominate atmospheric NH3 in urban areas. Based on the chemical and isotopic measurements of size-resolved aerosols in urban Beijing, China, we find that the natural abundance of (15)N (expressed using δ(15)N values) of NH4(+) in fine particles varies with the development of haze episodes, ranging from -37.1‰ to -21.7‰ during clean/dusty days (relative humidity: ∼ 40%), to -13.1‰ to +5.8‰ during hazy days (relative humidity: 70-90%). After accounting for the isotope exchange between NH3 gas and aerosol NH4(+), the δ(15)N value of the initial NH3 during hazy days is found to be -14.5‰ to -1.6‰, which indicates fossil fuel-based emissions. These emissions contribute 90% of the total NH3 during hazy days in urban Beijing. This work demonstrates the analysis of δ(15)N values of aerosol NH4(+) to be a promising new tool for partitioning atmospheric NH3 sources, providing policy makers with insights into NH3 emissions and secondary aerosols for regulation in urban environments.
Hu, Long-Jiao; Wang, Kang-Cai; Li, Can-Wen
2013-07-01
To study the effect of nitrogen forms on nitrogen metabolism and main chemical composition of Pinellia ternate. Through the soilless cultivation experiment and based at the same nitrogen level and different NH4(+) -N/NO3(-) -N ratios, nitrate reductase (NR) activity, glutamine synthetase (GS) activity, the content of nitrate nitrogen and ammonium nitrogen in different parts of P. ternate were determined. The contents of total alkaloid, free total organic acids and guanosine in the tuber were determined. The yield of bulbil and tuber was calculated. The test results showed that, with the NH4(+) -N/NO3(-) -N ratio increasing, the activity of nitrate reductase decreased, the content of nitrate nitrogen in the leaves, petioles and tuber increasing initially, then decreased, and the content of nitrate nitrogen in the root decreased. Meanwhile, with the NH4(+) -N/NO3(-) -N ratio increasing, the activity of glutamine synthetase in the leaves, petioles and root increased, the activity of glutamine synthetase in the tuber increasing initially, then decreased. The contents of ammonium nitrogen in the leaves, tuber and root increased initially, then decreased, and the contents of ammonium nitrogen in the petioles increased with the NH4(+)(-N/NO3(-)-N ratio increasing. The yield of bulbil and tuber were the highest at the NH4(+)-N/NO3(-) -N ratio of 75: 25. The content of total alkaloid and guanosine in the tuber were the highest at the NH4(+)-N/NO3(-) -N ratio of 0: 100, and the contents were 0.245% and 0.0197% respectively. With the NH4(+)-N/NO3(-) -N ratio of 50: 50, the content of free total organic acids was the highest, it reached 0.7%, however, the content of free total organic acids was the lowest at the NH4(+) -N/NO3(-) -N ratio of 0: 100. Nitrogen fertilization significant influences the nitrogen metabolism, the yield and main chemical composition of P. ternate.
Böhlke, J.K.; Smith, Richard L.; Miller, Daniel N.
2006-01-01
Ammonium (NH4+) is a major constituent of many contaminated groundwaters, but its movement through aquifers is complex and poorly documented. In this study, processes affecting NH4+ movement in a treated wastewater plume were studied by a combination of techniques including large‐scale monitoring of NH4+ distribution; isotopic analyses of coexisting aqueous NH4+, NO3−, N2, and sorbed NH4+; and in situ natural gradient 15NH4+tracer tests with numerical simulations of 15NH4+, 15NO3−, and 15N2 breakthrough data. Combined results indicate that the main mass of NH4+ was moving downgradient at a rate about 0.25 times the groundwater velocity. Retardation factors and groundwater ages indicate that much of the NH4+ in the plume was recharged early in the history of the wastewater disposal. NO3− and excess N2 gas, which were related to each other by denitrification near the plume source, were moving downgradient more rapidly and were largely unrelated to coexisting NH4+. The δ15N data indicate areas of the plume affected by nitrification (substantial isotope fractionation) and sorption (no isotope fractionation). There was no conclusive evidence for NH4+‐consuming reactions (nitrification or anammox) in the anoxic core of the plume. Nitrification occurred along the upper boundary of the plume but was limited by a low rate of transverse dispersive mixing of wastewater NH4+ and O2 from overlying uncontaminated groundwater. Without induced vertical mixing or displacement of plume water with oxic groundwater from upgradient sources, the main mass of NH4+ could reach a discharge area without substantial reaction long after the more mobile wastewater constituents are gone. Multiple approaches including in situ isotopic tracers and fractionation studies provided critical information about processes affecting NH4+ movement and N speciation.
Tan, Ling Ling; Musa, Ahmad; Lee, Yook Heng
2011-01-01
The use of the enzyme alanine dehydrogenase (AlaDH) for the determination of ammonium ion (NH(4)(+)) usually requires the addition of pyruvate substrate and reduced nicotinamide adenine dinucleotide (NADH) simultaneously to effect the reaction. This addition of reagents is inconvenient when an enzyme biosensor based on AlaDH is used. To resolve the problem, a novel reagentless amperometric biosensor using a stacked methacrylic membrane system coated onto a screen-printed carbon paste electrode (SPE) for NH(4)(+) ion determination is described. A mixture of pyruvate and NADH was immobilized in low molecular weight poly(2-hydroxyethyl methacrylate) (pHEMA) membrane, which was then deposited over a photocured pHEMA membrane (photoHEMA) containing alanine dehydrogenase (AlaDH) enzyme. Due to the enzymatic reaction of AlaDH and the pyruvate substrate, NH(4)(+) was consumed in the process and thus the signal from the electrocatalytic oxidation of NADH at an applied potential of +0.55 V was proportional to the NH(4)(+) ion concentration under optimal conditions. The stacked methacrylate membranes responded rapidly and linearly to changes in NH(4)(+) ion concentrations between 10-100 mM, with a detection limit of 0.18 mM NH(4)(+) ion. The reproducibility of the amperometrical NH(4)(+) biosensor yielded low relative standard deviations between 1.4-4.9%. The stacked membrane biosensor has been successfully applied to the determination of NH(4)(+) ion in spiked river water samples without pretreatment. A good correlation was found between the analytical results for NH(4)(+) obtained from the biosensor and the Nessler spectrophotometric method.
Simultaneous oxidation of ammonium and p-cresol linked to nitrite reduction by denitrifying sludge.
González-Blanco, G; Beristain-Cardoso, R; Cuervo-López, F; Cervantes, F J; Gómez, J
2012-01-01
The metabolic capability of denitrifying sludge to oxidize ammonium and p-cresol was evaluated in batch cultures. Ammonium oxidation was studied in presence of nitrite and/or p-cresol by 55 h. At 50 mg/L NH4+-N and 76 mg/L NO2--N, the substrates were consumed at 100% and 95%, respectively, being N2 the product. At 50 mg/L NH4+-N and 133 mg/L NO2--N, the consumption efficiencies decreased to 96% and 70%, respectively. The increase in nitrite concentration affected the ammonium oxidation rate. Nonetheless, the N2 production rate did not change. In organotrophic denitrification, the p-cresol oxidation rate was slower than ammonium oxidation. In litho-organotrophic cultures, the p-cresol and ammonium oxidation rates were affected at 133 mg/L NO2--N. Nonetheless, at 76 mg/L NO2--N the denitrifying sludge oxidized ammonium and p-cresol, but at different rate. Finally, this is the first work reporting the simultaneous oxidation of ammonium and p-cresol with the production of N2 from denitrifying sludge. Copyright © 2011 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Ahadnejad, Vahid; Hirt, Ann Marie; Valizadeh, Mohammad-Vali; Bokani, Saeed Jabbari
2011-04-01
The ammonium (NH4+) contents of the Malayer area (Western Iran) have been determined by using the colorimetric method on 26 samples from igneous and metamorphic rocks. This is the first analysis of the ammonium contents of Iranian metamorphic and igneous rocks. The average ammonium content of metamorphic rocks decreases from low-grade to high-grade metamorphic rocks (in ppm): slate 580, phyllite 515, andalusite schist 242. In the case of igneous rocks, it decreases from felsic to mafic igneous types (in ppm): granites 39, monzonite 20, diorite 17, gabbro 10. Altered granitic rocks show enrichment in NH4+ (mean 61 ppm). The high concentration of ammonium in Malayer granites may indicate metasedimentary rocks as protoliths rather than meta-igneous rocks. These granitic rocks (S-types) have high K-bearing rock-forming minerals such as biotite, muscovite and K-feldspar which their potassium could substitute with ammonium. In addition, the high ammonium content of metasediments is probably due to inheritance of nitrogen from organic matter in the original sediments. The hydrothermally altered samples of granitic rocks show highly enrichment of ammonium suggesting external sources which intruded additional content by either interaction with metasedimentary country rocks or meteoritic solutions.
Sasani, N; Vahdati Khaki, J; Mojtaba Zebarjad, S
2014-09-01
Fluorapatite-titania coated Ti-based implants are promising for using in dental surgery for restoring teeth. One of the challenges in implantology is to achieve a bioactive coating with appropriate mechanical properties. In this research, simple sol-gel method was developed for synthesis of fluorapatite-titania-carbon nanotube decorated with antibacterial agent. Triethyl phosphate [PO4(C2H5)3], calcium nitrate [Ca(NO3)2] and ammonium fluoride (NH4F) were used as precursors under an ethanol-water based solution for fluorapatite (FA) production. Titanium isopropoxide and isopropanol were used as starting materials for making TiO2 sol-gels. Also, Copper acetate [Cu(C2H3O2)2·H2O] was used as precursor for decoration of multi walled carbon nanotubes (MWCNTs) with wet chemical method. The decorated MWCNTs (CNT(Cu)) were evaluated by transmission electron microscopy (TEM). The phase identification of the FA-TiO2-CNT(Cu) coating was carried out by XRD analysis. Morphology of coated samples was investigated by SEM observations. The surface elastic modulus and hardness of coatings were studied using nanoindentation technique. The results indicate that novel dental implant coating containing FA, TiO2 and copper decorated MWCNTs have proper morphological features. The results of nanoindentation test show that incorporation of CNT(Cu) in FA-TiO2 matrix can improve the nanomechanical properties of composite coating. Copyright © 2014 Elsevier Ltd. All rights reserved.
Wu, H; Zhang, Z X; Zhao, H P; Wu, D C; Wu, B L; Cong, R
2004-12-01
Sodium fluoride-loaded gelatin microspheres (NaF-GMS) were prepared using double-phase emulsified condensation polymerization. The average diameter of microspheres was (11.33+/-5.56) microm. The drug content and encapsulation efficiency were 8.80% and 76.73%, respectively. The fluoride releasing profiles of NaF-GMS in physiological saline and artificial saliva (pH 4.5, pH 6.8) showed that NaF-GMS had a sustained-release property and fluoride release rate was increased in pH 4.5 artificial saliva. Experiments conducted in rabbits' oral cavity using NaF-GMS and NaF solution as control revealed NaF-GMS could maintain oral fluoride retention longer than NaF solution. Cariostatic abilities of NaF-GMS including demineralization prohibition in vitro, fluoride deposition in artificial dental plaque and the ability of targeting to cariogenic bacteria were investigated in artificial dental plaque. The results indicated NaF-GMS with lower fluoride concentrations could achieve equivalent cariostatic effect to the concentrated NaF solution, at the same time, could prolong fluoride retention in dental plaque. Microscopic observation showed that NaF-GMS carrying fusion protein of glucan-binding domain could adhere more bacteria than NaF-GMS and this might indicate the possibility of targeting to cariogenic bacteria when NaF-GMS were properly modified.
Sun, Xiaojie; Zhang, Hongxia; Cheng, Zhaowen
2017-08-01
High concentrations of nitrate-nitrogen (NO 3 - -N) derived from ex situ nitrification phase can inhibit methane production during ex situ nitrification and in situ denitrification bioreactor landfill. A combined process comprised of ex situ simultaneous nitrification-denitrification (SND) in an aged refuse bioreactor (ARB) and in situ denitrification in a fresh refuse bioreactor (FRB) was conducted to reduce the negative effect of high concentrationsof NO 3 - -N. Ex situ SND can be achieved because NO 3 - -N concentration can be reduced and the removal rate of ammonium-nitrogen (NH 4 + -N) remains largely unchanged when the ventilation rate of ARB-A2 is controlled. The average NO 3 - -N concentrations of effluent were 470mg/L in ex situ nitrification ARB-A1 and 186mg/L in ex situ SND ARB-A2. The average NH 4 + -N removal rates of ARB-A1 and ARB-A2 were 98% and 94%, respectively. Based on the experimental data from week 4 to week 30, it is predicted that NH 4 + -N concentration in FRB-F1 of the ex situ nitrification and in situ denitrification process would reach 25mg/L after 63weeks, and about 40weeks for the FRB-F2 of ex situ SND and in situ denitrification process . Ex situ SND and in situ denitrification process can improve themethane production of FRB-F2. The lag phase time of methane production for the FRB-F2 was 11weeks. This phase was significantly shorter than the 15-week phases of FRB-F1 in ex situ nitrification and in situ denitrification process. A seven-week stabilizationphase was required to increase methane content from 5% to 50% for FRB-F2. Methane content in FRB-F1 did not reach 50% but reached the 45% peak after 20weeks. Copyright © 2017 Elsevier Ltd. All rights reserved.
Rain-Franco, Angel; Muñoz, Claudia; Fernandez, Camila
2014-01-01
We investigated the production of ammonium by the photodegradation of dissolved organic matter (DOM) in the coastal upwelling system off central Chile (36°S). The mean penetration of solar radiation (Z1%) between April 2011 and February 2012 was 9.4 m, 4.4 m and 3.2 m for Photosynthetically Active Radiation (PAR; 400-700 nm), UV-A (320-400 nm) and UV-B (280-320 nm), respectively. Ammonium photoproduction experiments were carried out using exudates of DOM obtained from cultured diatom species (Chaetoceros muelleri and Thalassiosira minuscule) as well as natural marine DOM. Diatom exudates showed net photoproduction of ammonium under exposure to UVR with a mean rate of 0.56±0.4 µmol L(-1) h(-1) and a maximum rate of 1.49 µmol L(-1) h(-1). Results from natural marine DOM showed net photoproduction of ammonium under exposure to PAR+UVR ranging between 0.06 and 0.2 µmol L(-1) h(-1). We estimated the potential contribution of photochemical ammonium production for phytoplankton ammonium demand. Photoammonification of diatom exudates could support between 117 and 453% of spring-summer NH4(+) assimilation, while rates obtained from natural samples could contribute to 50-178% of spring-summer phytoplankton NH4(+) requirements. These results have implications for local N budgets, as photochemical ammonium production can occur year-round in the first meters of the euphotic zone that are impacted by full sunlight.
Rain-Franco, Angel; Muñoz, Claudia; Fernandez, Camila
2014-01-01
We investigated the production of ammonium by the photodegradation of dissolved organic matter (DOM) in the coastal upwelling system off central Chile (36°S). The mean penetration of solar radiation (Z1%) between April 2011 and February 2012 was 9.4 m, 4.4 m and 3.2 m for Photosynthetically Active Radiation (PAR; 400–700 nm), UV-A (320–400 nm) and UV-B (280–320 nm), respectively. Ammonium photoproduction experiments were carried out using exudates of DOM obtained from cultured diatom species (Chaetoceros muelleri and Thalassiosira minuscule) as well as natural marine DOM. Diatom exudates showed net photoproduction of ammonium under exposure to UVR with a mean rate of 0.56±0.4 µmol L−1 h−1 and a maximum rate of 1.49 µmol L−1 h−1. Results from natural marine DOM showed net photoproduction of ammonium under exposure to PAR+UVR ranging between 0.06 and 0.2 µmol L−1 h−1. We estimated the potential contribution of photochemical ammonium production for phytoplankton ammonium demand. Photoammonification of diatom exudates could support between 117 and 453% of spring-summer NH4 + assimilation, while rates obtained from natural samples could contribute to 50–178% of spring-summer phytoplankton NH4 + requirements. These results have implications for local N budgets, as photochemical ammonium production can occur year-round in the first meters of the euphotic zone that are impacted by full sunlight. PMID:24968138
Fei, Hailong; Wu, Xiaomin; Li, Huan; Wei, Mingdeng
2014-02-01
A simple and versatile method for preparation of novel sodium intercalated (NH4)2V6O16 is developed via a simple hydrothermal route. It is found that ammonium sodium vanadium bronze displays higher discharge capacity and better rate cyclic stability than ammonium vanadium bronze as lithium-ion battery cathode material because of smaller charge transfer resistance, which would favor superior discharge capacity and rate performance. Crown Copyright © 2013. Published by Elsevier Inc. All rights reserved.
Mazloomi, Farhad; Jalali, Mohsen
2017-08-01
In this research, montmorillonite nanoclay (MNC) and vermiculite were used to adsorb ammonium (NH 4 + ) from simulated wastewater. The effect of organic acids, cations, and anions on adsorption of NH 4 + was also studied using batch experiments. The presence of organic acids significantly decreased the NH 4 + adsorption using both adsorbents and the reduction followed the order of citric acid > malic acid > oxalic acid. The presence of cations in wastewater could decrease the adsorption of NH 4 + and the ion exchange selectivity on the MNC and vermiculite followed the orders Mg > Ca ≥ K > Na and Mg > > Ca > Na > K, respectively. Adsorption of NH 4 + by adsorbents in the presence of sulfate (SO 4 ) was higher than those in the presence of phosphate (PO 4 ) and chloride (Cl) anions. Results indicated that MNC and vermiculite had good potential for NH 4 + removal depending on adsorbent dosage, pH, contact time, and initial NH 4 + concentration. The effect of pH on removal of NH 4 + indicated that MNC would be more appropriate as the adsorbent than vermiculite at low pH values. Kinetic analysis demonstrated that the rate-controlling step adsorption for NH 4 + by MNC and vermiculite was heterogeneous chemisorption and followed the pseudo-second-order model. The desorption experiments indicated that the adsorption of NH 4 + by adsorbents was not fully reversible, and the total recovery of adsorbed NH 4 + for MNC and vermiculite varied in the range of 72 to 94.6% and 11.5 to 45.7%, respectively. Cation exchange model (CEM) in PHREEQC program was used to simulate NH 4 + adsorption. Agreement between measured and simulated data suggested that CEM was favored in simulating adsorption of NH 4 + by clay minerals. The results indicated that MNC and vermiculite have good performance as economic and nature-friendly adsorbents that can ameliorate the water and environment quality.
Durán, U; del Val Río, A; Campos, J L; Mosquera-Corral, A; Méndez, R
2014-01-01
The Anammox-based processes are suitable for the treatment of wastewaters characterized by a low carbon to nitrogen (C/N) ratio. The application of the Anammox process requires the availability of an effluent with a NO2- -N/NH4+ -N ratio composition around 1 g g-1, which involves the necessity of a previous step where the partial nitrification is performed. In this step, the inhibition of the nitrite-oxidizing bacteria (NOB) is crucial. In the present work, a combined partial nitrification-ANaerobic AMmonia OXidation (Anammox) two-units system operated at room temperature (20 degreeC) has been tested for the nitrogen removal of pre-treated pig slurry. To achieve the successful partial nitrification and inhibit the NOB activity, different ammonium/inorganic carbon (NH4+/IC) ratios were assayed from 1.19 to 0.82g NH4+-Ng-1 HCO3-C. This procedure provoked a decrease of the pH value to 6.0 to regulate the inhibitory effect over ammonia-oxidizing bacteria caused by free ammonia. Simultaneously, the NOB experienced the inhibitory effect of free nitrous acid which avoided the presence of nitrate in the effluent. The NH4+/IC ratio which allowed the obtaining of the desired effluent composition (50% of both ammonium and nitrite) was 0.82 +/- 0.02 g NH4+-N g-1 HCO3- -C. The Anammox reactor was fed with the effluent of the partial nitrification unit containing a NO2 -N/NH4+ -N ratio of 1 g g-1' where a nitrogen loading rate of 0.1 g N L-1 d-1 was efficiently removed.
Panwivia, Supaporn; Sirvithayapakorn, Sanya; Wantawin, Chalermraj; Noophan, Pongsak Lek; Munakata-Marr, Junko
2014-01-01
Attached growth-systems for the anaerobic ammonium oxidation (anammox) process have been postulated for implementation in the field. However, information about the anammox process in attached growth-systems is limited. This study compared nitrogen removal rates and nitrous oxide (N2O) production of enriched anammox cultures in both suspended and attached growth sequencing batch reactors (SBRs). Suspended growth reactors (SBR-S) and attached growth reactors using polystyrene sponge as a medium (SBR-A) were used in these experiments. After inoculation with an enriched anammox culture, significant nitrogen removals of ammonium (NH4 (+)) and nitrite (NO2 (-)) were observed under NH4 (+):NO2 (-) ratios ranging from 1:1 to 1:2 in both types of SBRs. The specific rates of total nitrogen removal in SBR-S and SBR-A were 0.52 mg N/mg VSS-d and 0.44 mg N/mg VSS-d, respectively, at an NH4 (+):NO2 (-) ratio of 1:2. N2O production by the enriched anammox culture in both SBR-S and SBR-A was significantly higher at NH4 (+):NO2 (-) ratio of 1:2 than at NH4 (+):NO2 (-) ratios of 1:1 and 1:1.32. In addition, N2O production was higher at a pH of 6.8 than at pH 7.3, 7.8, and 8.3 in both SBR-S and SBR-A. The results of this investigation demonstrate that the anammox process may avoid N2O emission by maintaining an NH4 (+):NO2 (-) ratio of less than 1:2 and pH higher than 6.8.
Atmospheric transport and wet deposition of ammonium in North Carolina
NASA Astrophysics Data System (ADS)
Walker, John T.; Aneja, Viney P.; Dickey, David A.
Wet deposition and transport analysis has been performed for ammonium (NH 4+) in North Carolina, USA. Multiple regression analysis is employed to model the temporal trend and seasonality in monthly volume-weighted mean NH 4+ concentrations in precipitation from 1983 to 1996 at six National Atmospheric Deposition Program/National Trends Network (NADP/NTN) sites. A significant ( p<0.01) increasing trend beginning in 1990, which corresponds to an annual concentration increase of approximately 9.5%, is detected at the rural Sampson County site (NC35), which is located within a densely populated network of swine and poultry operations. This trend is positively correlated with increasing ammonia (NH 3) emissions related to the vigorous growth of North Carolina's swine population since 1990, particularly in the state's Coastal Plain region. A source-receptor regression model, which utilizes weekly NH 4+ concentrations in precipitation in conjunction with boundary layer air mass back trajectories, is developed to statistically test for the influence of a particular NH 3 source region on NH 4+ concentrations at surrounding NADP/NTN sites for the years 1995-1996. NH 3 emissions from this source region, primarily evolving from swine and poultry operations, are found to increase NH 4+ concentration in precipitation at sites up to ≈80 km away. At the Scotland County (NC36) and Wake County (NC41) sites, mean NH 4+ concentrations show increases of at least 44% for weeks during which 25% or more back trajectories are influenced by this source region.
Theoretical Investigations of Nitrocubane Decomposition.
1988-02-29
this line are the ammonium nitronate salts, e.g., 5j rNH C(NO,) 3 The synthesis and characterization of nitrocubanes such as these is currently of...arceenit i th the experimental results is also very good except at the 0% 40 30 00 C-)0 ~10 00 10 -0.8 -0.4 0.0 0.4 0.8 1.2 s(aO) 1Fiunpre 2. Comparison...excellent (differences of 18- 40 %) but at higher temperatures the computed rates are f .actors of 2.2 to 2.7 lwer than the results of Hack et. al. The
Fog water chemistry in Shanghai
NASA Astrophysics Data System (ADS)
Li, Pengfei; Li, Xiang; Yang, Chenyu; Wang, Xinjun; Chen, Jianmin; Collett, Jeffrey L., Jr.
2011-08-01
With the aim of understanding the fog chemistry in a Chinese megacity, twenty-six fog water samples were collected in urban Shanghai from March 2009 to March 2010. The following parameters were measured: pH, electrical conductivity (EC), ten inorganic major ions ( SO42-, NO3-, NO2-, F -, Cl -, Na +, K +, Ca 2+, Mg 2+, NH4+) and four major organic acids (CH 3COO -, HCOO -, CO42-, MSA). The total ionic concentration (TIC) and EC of fog samples were one or two orders of magnitude higher than those often found in Europe, North America and other Asian countries. Pollutants were expected to be mainly from local sources, including factories, motor vehicle emissions and civil construction. Non-local sources such as moderate- and long-range transport of sea salt also contributed to pollution levels in fog events as indicated by back trajectory analysis. The pH of the fog water collected during the monitoring period varied from 4.68 to 6.58; acidic fogs represented about 30.8% of the total fog events during this period. The fog water was characterized by high concentrations of SO42- (20.0% of measured TIC), NO3- (17.1%), NH4+ (28.3%) and Ca 2+ (14.4%). SO42- and NO3-, the main precursors of fog acidity, were related to burning fossil fuels and vehicle emissions, respectively. NH4+, originating from the scavenging of gaseous ammonia and particulate ammonium nitrate and ammonium sulfate, and Ca 2+, originating from the scavenging of coarse particles, acted as acid neutralizers and were the main cause for the relatively high pH of fogs in Shanghai. The ratio of ( SO42- + NO3-)/( NH4+ + Ca 2+) was lower than 1, indicating the alkaline nature of the fog water. A high ratio of NO3-/ SO42- and low ratio of HCOO -/CH 3COO - were consistent with large contributions from vehicular emissions that produce severe air pollution in megacities.
Biogas upgrading by chemical absorption using ammonia rich absorbents derived from wastewater.
McLeod, Andrew; Jefferson, Bruce; McAdam, Ewan J
2014-12-15
The use of ammonia (NH3) rich wastewaters as an ecological chemical absorption solvent for the selective extraction of carbon dioxide (CO2) during biogas upgrading to 'biomethane' has been studied. Aqueous ammonia absorbents of up to 10,000 gNH3 m(-3) demonstrated CO2 absorption rates higher than recorded in the literature for packed columns using 20,000-80,000 g NH3 m(-3) which can be ascribed to the process intensification provided by the hollow fibre membrane contactor used in this study to support absorption. Centrifuge return liquors (2325 g m(-3) ionised ammonium, NH4(+)) and a regenerant (477 gNH4(+) m(-3)) produced from a cationic ion exchanger used to harvest NH4(+) from crude wastewater were also tested. Carbon dioxide fluxes measured for both wastewaters compared reasonably with analogue ammonia absorption solvents of equivalent NH3 concentration. Importantly, this demonstrates that ammonia rich wastewaters can facilitate chemically enhanced CO2 separation which eliminates the need for costly exogenic chemicals or complex chemical handling which are critical barriers to implementation of chemical absorption. When testing NH3 analogues, the potential to recover the reaction product ammonium bicarbonate (NH4HCO3) in crystalline form was also illustrated. This is significant as it suggests a new pathway for ammonia separation which avoids biological nitrification and produces ammonia stabilised into a commercially viable fertiliser (NH4HCO3). However, in real ammonia rich wastewaters, sodium bicarbonate and calcium carbonate were preferentially formed over NH4HCO3 although it is proposed that NH4HCO3 can be preferentially formed by manipulating both ion exchange and absorbent chemistry. Copyright © 2014. Published by Elsevier Ltd.
Zou, Na; Li, Baohai; Dong, Gangqiang; Kronzucker, Herbert J; Shi, Weiming
2012-06-01
Root gravitropism is affected by many environmental stresses, including salinity, drought, and nutrient deficiency. One significant environmental stress, excess ammonium (NH(4)(+)), is well documented to inhibit root elongation and lateral root formation, yet little is known about its effects on the direction of root growth. We show here that inhibition of root elongation upon elevation of external NH(4)(+) is accompanied by a loss in root gravitropism (agravitropism) in Arabidopsis. Addition of potassium (K(+)) to the treatment medium partially rescued the inhibition of root elongation by high NH(4)(+) but did not improve gravitropic root curvature. Expression analysis of the auxin-responsive reporter gene DR5::GUS revealed that NH(4)(+) treatment delayed the development of gravity-induced auxin gradients across the root cap but extended their duration once initiated. Moreover, the β-glucuronidase (GUS) signal intensity in root tip cells was significantly reduced under high NH(4)(+) treatment over time. The potassium carrier mutant trh1 displayed different patterns of root gravitropism and DR5::GUS signal intensity in root apex cells compared with the wild type in response to NH(4)(+). Together, the results demonstrate that the effects of NH(4)(+) on root gravitropism are related to delayed lateral auxin redistribution and the TRH1 pathway, and are largely independent of inhibitory effects on root elongation.
Prieto-Blanco, M C; Jornet-Martínez, N; Moliner-Martínez, Y; Molins-Legua, C; Herráez-Hernández, R; Verdú Andrés, J; Campins-Falcó, P
2015-01-15
This report describes a polydimethylsiloxane (PDMS)-thymol/nitroprusside delivery composite sensor for direct monitoring of ammonium in environmental water samples. The sensor is based on a PDMS support that contains the Berthelot's reaction reagents. To prepare the PDMS-thymol/nitroprusside composite discs, thymol and nitroprusside have been encapsulated in the PDMS matrix, forming a reagent release support which significantly simplifies the analytical measurements, since it avoids the need to prepare derivatizing reagents and sample handling is reduced to the sampling step. When, the PDMS-thymol/nitroprusside composite was introduced in water samples spontaneous release of the chromophore and catalyst was produced, and the derivatization reaction took place to form the indothymol blue. Thus, qualitative analysis of NH4(+) could be carried out by visual inspection, but also, it can be quantified by measuring the absorbance at 690 nm. These portable devices provided good sensitivity (LOD<0.4 mg L(-1)) and reproducibility (RSD <10%) for the rapid detection of ammonium. The PDMS-NH4(+) sensor has been successfully applied to determine ammonium in water samples and in the aqueous extracts of particulate matter PM10 samples. Moreover, the reliability of the method for qualitative analysis has been demonstrated. Finally, the advantages of the PDMS-NH4(+) sensor have been examined by comparing some analytical and complementary characteristics with the properties of well-established ammonium determination methods. Copyright © 2014 Elsevier B.V. All rights reserved.
Identification and Characterization of a PutAMT1;1 Gene from Puccinellia tenuiflora
Bu, Yuanyuan; Sun, Bo; Zhou, Aimin; Zhang, Xinxin; Lee, Imshik; Liu, Shenkui
2013-01-01
Nitrogen is one of the most important limiting factors for plant growth. However, as ammonium is readily converted into ammonia (NH3) when soil pH rises above 8.0, this activity depletes the availability of ammonium (NH4 +) in alkaline soils, consequently preventing the growth of most plant species. The perennial wild grass Puccinellia tenuiflora is one of a few plants able to grow in soils with extremely high salt and alkaline pH (>9.0) levels. Here, we assessed how this species responds to ammonium under such conditions by isolating and analyzing the functions of a putative ammonium transporter (PutAMT1;1). PutAMT1;1 is the first member of the AMT1 (ammonium transporter) family that has been identified in P. tenuiflora. This gene (1) functionally complemented a yeast mutant deficient in ammonium uptake (2), is preferentially expressed in the anther of P. tenuiflora, and (3) is significantly upregulated by ammonium ions in both the shoot and roots. The PutAMT1;1 protein is localized in the plasma membrane and around the nuclear periphery in yeast cells and P. tenuiflora suspension cells. Immunoelectron microscopy analysis also indicated that PutAMT1;1 is localized in the endomembrane. The overexpression of PutAMT1;1 in A. thaliana enhanced plant growth, and increased plant susceptibility to toxic methylammonium (MeA). Here, we confirmed that PutAMT1;1 is an ammonium-inducible ammonium transporter in P. tenuiflora. On the basis of the results of PutAMT1;1 overexpression in A. thaliana, this gene might be useful for improving the root to shoot mobilization of MeA (or NH4 +). PMID:24340088
Emission beyond 4 μm and mid-infrared lasing in a dysprosium-doped indium fluoride (InF3) fiber.
Majewski, Matthew R; Woodward, Robert I; Carreé, Jean-Yves; Poulain, Samuel; Poulain, Marcel; Jackson, Stuart D
2018-04-15
Optical emission from rare-earth-doped fluoride fibers has thus far been limited to less than 4 μm. We extend emission beyond this limit by employing an indium fluoride (InF 3 ) glass fiber as the host, which exhibits an increased infrared transparency over commonly used zirconium fluoride (ZBLAN). Near-infrared pumping of a dysprosium-doped InF 3 fiber results in broad emission centered around 4.3 μm, representing the longest emission yet achieved from a fluoride fiber. The first laser emission in an InF 3 fiber is also demonstrated from the 3 μm dysprosium transition. Finally, a frequency domain excited state lifetime measurement comparison between fluoride hosts suggests that multiphonon effects are significantly reduced in indium fluoride fiber, paving the way to more efficient, longer wavelength lasers compared to ZBLAN fibers.
(Methyl)ammonium Transport in the Nitrogen-Fixing Bacterium Azospirillum brasilense
Van Dommelen, Anne; Keijers, Veerle; Vanderleyden, Jos; de Zamaroczy, Miklos
1998-01-01
An ammonium transporter of Azospirillum brasilense was characterized. In contrast to most previously reported putative prokaryotic NH4+ transporter genes, A. brasilense amtB is not part of an operon with glnB or glnZ which, in A. brasilense, encode nitrogen regulatory proteins PII and PZ, respectively. Sequence analysis predicts the presence of 12 transmembrane domains in the deduced AmtB protein and classifies AmtB as an integral membrane protein. Nitrogen regulates the transcription of the amtB gene in A. brasilense by the Ntr system. amtB is the first gene identified in A. brasilense whose expression is regulated by NtrC. The observation that ammonium uptake is still possible in mutants lacking the AmtB protein suggests the presence of a second NH4+ transport mechanism. Growth of amtB mutants at low ammonium concentrations is reduced compared to that of the wild type. This suggests that AmtB has a role in scavenging ammonium at low concentrations. PMID:9573149
Fluoride geochemistry of thermal waters in Yellowstone National Park: I. Aqueous fluoride speciation
Deng, Y.; Nordstrom, D. Kirk; McCleskey, R. Blaine
2011-01-01
Thermal water samples from Yellowstone National Park (YNP) have a wide range of pH (1–10), temperature, and high concentrations of fluoride (up to 50 mg/l). High fluoride concentrations are found in waters with field pH higher than 6 (except those in Crater Hills) and temperatures higher than 50 °C based on data from more than 750 water samples covering most thermal areas in YNP from 1975 to 2008. In this study, more than 140 water samples from YNP collected in 2006–2009 were analyzed for free-fluoride activity by ion-selective electrode (ISE) method as an independent check on the reliability of fluoride speciation calculations. The free to total fluoride concentration ratio ranged from <1% at low pH values to >99% at high pH. The wide range in fluoride activity can be explained by strong complexing with H+ and Al3+ under acidic conditions and lack of complexing under basic conditions. Differences between the free-fluoride activities calculated with the WATEQ4F code and those measured by ISE were within 0.3–30% for more than 90% of samples at or above 10−6 molar, providing corroboration for chemical speciation models for a wide range of pH and chemistry of YNP thermal waters. Calculated speciation results show that free fluoride, F−, and major complexes (HF(aq)0">HF(aq)0, AlF2+, AlF2+">AlF2+and AlF30">AlF30) account for more than 95% of total fluoride. Occasionally, some complex species like AlF4-">AlF4-, FeF2+, FeF2+">FeF2+, MgF+ and BF2(OH)2-">BF2(OH)2- may comprise 1–10% when the concentrations of the appropriate components are high. According to the simulation results by PHREEQC and calculated results, the ratio of main fluoride species to total fluoride varies as a function of pH and the concentrations and ratios of F and Al.
Quantitative remote sensing of ammonium minerals, Cedar Mountains, Esmeralda County, Nevada
NASA Technical Reports Server (NTRS)
Baugh, William M.; Kruse, Fred A.
1995-01-01
Mineral-bound ammonium (NH4+) was discovered by the U.S. Geological Survey in the southern Cedar Mountains of Esmeralda County, Nevada in 1989. At 10 km in length, this site is 100 times larger than any previously known occurrence in volcanic rocks. The ammonium occurs in two hydrothermally altered, crystal-rich rhyolitic tuff units of Oligocene age, and is both structurally and stratigraphically controlled. This research uses Advanced Visible/Infrared Imaging Spectrometer (AVIRIS) data to quantitatively map the mineral-bound ammonium (buddingtonite) concentration in the altered volcanic rocks. Naturally occurring mineral-bound ammonium is fairly rare; however, it has been found to occur in gold-bearing hydrothermal deposits. Because of this association, it is thought that ammonium may be a useful too in exploration for gold and other metal deposits. Mineral-bound ammonium is produced when an ammonium ion (NH4+) replaces the alkali cation site (usually K+) in the crystal structure of silicate minerals such as feldspars, micas and clays. Buddingtonite is an ammonium feldspar. The ammonium originates in buried organic plant matter and is transported to the host rock by hydrothermal fluids. Ammonium alteration does not produce visible changes in the rock, and it is barely detectable with standard x-ray diffraction methods. It is clearly identified, however, by absorption features in short wave-infrared (SWIR) wavelengths (2.0 - 2.5 micrometers). The ammonium absorption features are believed to be caused by N-H vibrational modes and are analogous to hydroxyl (O-H) vibrational modes, only shifted slightly in wavelength. Buddingtonite absorption features in the near- and SWIR lie at 1.56, 2.02 and 2.12 micrometers. The feature at 2.12 micrometer is the strongest of the three and is the only one used in this study. The southern Cedar Mountains are sparsely vegetated and are an ideal site for a remote sensing study.
Ferrieri, R.A.; Schlyer, D.J.; Shea, C.
1995-06-13
A process for simultaneously producing PET-usable quantities of [{sup 13}N]NH{sub 3} and [{sup 18}F]F{sup {minus}} for radiotracer synthesis is disclosed. The process includes producing [{sup 13}N]NO{sub 2}{sup {minus}}/NO{sub 3}{sup {minus}}and [{sup 18}F]F{sup {minus}} simultaneously by exposing a low-enriched (20%-30%) [{sup 18}O]H{sub 2}O target to proton irradiation, sequentially isolating the [{sup 13}N]NO{sub 2}{sup {minus}}/NO{sub 3}{sup {minus}} and [{sup 18}F]F{sup {minus}} from the [{sup 18}O]H{sub 2}O target, and reducing the [{sup 13}N]NO{sub 2}{sup {minus}}/NO{sub 3}{sup {minus}} to [{sup 13}N]NH{sub 3}. The [{sup 13}N]NH{sub 3} and [{sup 18}F]F{sup {minus}} products are then conveyed to a laboratory for radiotracer applications. The process employs an anion exchange resin for isolation of the isotopes from the [{sup 18}O]H{sub 2}O, and sequential elution of [{sup 13}N]NO{sub 2}{sup {minus}}/NO{sub 3}{sup {minus}} and [{sup 18}F]F{sup {minus}} fractions. Also the apparatus is disclosed for simultaneously producing PET-usable quantities of [{sup 13}N]NH{sub 3} and [{sup 18}F]F{sup {minus}} from a single irradiation of a single low-enriched [{sup 18}O]H{sub 2}O target. 2 figs.
Ammonium fluoride as a mobile phase additive in aqueous normal phase chromatography.
Pesek, Joseph J; Matyska, Maria T
2015-07-03
The use of ammonium fluoride as a mobile phase additive in aqueous normal phase chromatography with silica hydride-based stationary phases and mass spectrometry detection is evaluated. Retention times, peak shape, efficiency and peak intensity are compared to the more standard additives formic acid and ammonium formate. The test solutes were NAD, 3-hydroxyglutaric acid, α-ketoglutaric acid, p-aminohippuric acid, AMP, ATP, aconitic acid, threonine, N-acetyl carnitine, and 3-methyladipic acid. The column parameters are assessed in both the positive and negative ion detection modes. Ammonium fluoride is potentially an aggressive mobile phase additive that could have detrimental effects on column lifetime. Column reproducibility is measured and the effects of switching between different additives are also tested. Copyright © 2015 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Hodyss, R. P.; Thomas, E. C.; Vu, T. H.; Johnson, P. V.; Choukroun, M.
2017-12-01
Subsurface brines on Ceres containing natrite (Na2CO3) and smaller amounts of NH4Cl or NH4HCO3 have been proposed to reach the dwarf planet's surface from an internal reservoir, where the brines freeze and result in bright spots across Ceres. Kinetically frozen solutions containing the likely constituents of Ceres' subsurface brines (ammonium, sodium, carbonate, and chloride ions) were studied via infrared and micro-Raman spectroscopy, where the flash-frozen mixtures were found to preferentially form ammonium chloride and ammonium bicarbonate, even in sodium-dominated solutions. Additionally, sodium chloride only formed when sodium or chloride (or both) were present in excess in the brine solutions. Raman spectroscopy was further employed to analyze the effect of vacuum exposure on these frozen brines over longer periods of time to simulate the surface conditions of Ceres.
Preferential uptake of ammonium ions by zinc ferrocyanide
NASA Technical Reports Server (NTRS)
Braterman, P. S.; Arrhenius, G.; Hui, S.; Paplawsky, W.; Miller, S. L. (Principal Investigator)
1995-01-01
The concentration of ammonia from dilute aqueous solution could have facilitated many prebiotic reactions. This may be especially true if this concentration involves incorporation into an organized medium. We have shown that (unlike iron(III) ferrocyanide) zinc ferrocyanide,Zn2Fe(CN)6 xH2O, preferentially takes up ammonium ions from 0.01 M NH4Cl to give the known material Zn3(NH4)2[Fe(CN)6]2 xH2O, even in the presence of 0.01 M KCl. KCl alone gave Zn3K2[Fe(CN)6]2 xH2O. Products were characterized by elemental (CHN) analysis and powder X-ray diffraction (XRD). We attribute the remarkable specificity for the ammonium ion to the open framework of the product, which offers enough space for hydrogen-bonded ammonium ions, and infer that other inorganic materials with internal spaces rich in water may show a similar preference.
NASA Astrophysics Data System (ADS)
Shuai, W.; Jaffe, P. R.
2017-12-01
Effective ammonium (NH4+) removal has been a challenge in wastewater treatment processes. Aeration, which is required for the conventional NH4+ removal approach by ammonium oxidizing bacteria, is an energy intensive process during the operation of wastewater treatment plant. The efficiency of NH4+ oxidation in natural systems is also limited by oxygen transfer in water and sediments. The objective of this study is to enhance NH4+ removal by applying a novel microbial process, anaerobic NH4+ oxidation coupled to iron (Fe) reduction (also known as Feammox), in constructed wetlands (CW). Our studies have shown that an Acidimicrobiaceae bacterium named A6 can carry out the Feammox process using ferric Fe (Fe(III)) minerals like ferrihydrite as their electron acceptor. To investigate the properties of the Feammox process in CW as well as the influence of electrodes, Feammox bacterium A6 was inoculated in planted CW mesocosms with electrodes installed at multiple depths. CW mesocosms were operated using high NH4+ nutrient solution as inflow under high or low sediment Fe(III) level. During the operation, NH4+ and ferrous Fe concentration, pore water pH, voltages between electrodes, oxidation reduction potential and dissolved oxygen were measured. At the end of the experiment, CW sediment samples at different depths were taken, DNAs were extracted and quantitative polymerase chain reaction and pyrosequencing were performed to analyze the microbial communities. The results show that the high Fe level CW mesocosm has much higher NH4+ removal ability than the low Fe level CW mesocosm after Fe-reducing conditions are developed. This indicates the enhanced NH4+ removal can be attributed to elevated Feammox activity in high Fe level CW mesocosm. The microbial community structures are different in high or low Fe level CW mesocosms and on or away from the installed electrodes. The voltages between cathode and anode increased after the injection of A6 enrichment culture in low Fe level CW mesocosm but remained stable in high Fe level CW mesocosm, indicating A6 may use electrodes as their electron acceptor in the scarcity of Fe(III). The application of Feammox process in Fe-rich CW is promising in providing a cost and energy effective NH4+ removal approach, and the electrogenesis of A6 may also be useful in enhancing the Feammox process.
NASA Astrophysics Data System (ADS)
Cherbadgy, I. I.; Sabitova, L. I.
2011-02-01
A complex study of the influence of various environmental factors on the rate of the oxygen (MO 2), ammonium (MNH 4), and phosphate (MPO 4) metabolism in Ahnfeltia tobuchiensis has been carried out in situ in the Izmena Bay of Kunashir Island. The following environmental factors have been included into the investigation: the photosynthetically active radiation (PAR); the ammonium (NH4); the phosphate (PO4); and the tissue content of carbon (C), nitrogen (N), phosphorus (P), and chlorophyll a (Chl). The population of agar-containing seaweed A. tobuchiensis forms a layer with a thickness up to 0.5 m, which occupies about 23.3 km2; the population's biomass is equal to 125000 tons. The quantitative assessment of the organic matter production and nutrient consumption during the oxygen metabolism (MO 2) has been carried out for the whole population. It has been shown that the daily rate depends on the PAR intensity, the seawater concentrations of PO4 and NH4, and the tissue content of N and P ( r 2 = 0.78, p < 0.001). The daily NH4 consumption averages 0.21 μmol/(gDW h) and depends on the NH4 and O2 concentrations in the seawater and on the C and Chl a content in the algal tissues ( r 2 = 0.64, p < 0.001). The daily PO4 consumption averages 0.01 μmol/(gDW h) and depends on the NH4 concentration in the seawater and on the P content in the algal tissues ( r 2 = 0.40, p < 0.001).
Sancho, I; Licon, E; Valderrama, C; de Arespacochaga, N; López-Palau, S; Cortina, J L
2017-04-15
The integration of up-concentration processes to increase the efficiency of primary sedimentation, as a solution to achieve energy neutral wastewater treatment plants, requires further post-treatment due to the missing ammonium removal stage. This study evaluated the use of zeolites as a post-treatment step, an alternative to the biological removal process. A natural granular clinoptilolite zeolite was evaluated as a sorbent media to remove low levels (up to 100mg-N/L) of ammonium from treated wastewater using batch and fixed bed columns. After being activated to the Na-form (Z-Na), the granular zeolite shown an ammonium exchange capacity of 29±0.8mgN-NH 4 + /g in single ammonium solutions and 23±0.8mgN-NH 4 + /g in treated wastewater simulating up-concentration effluent at pH=8. The equilibrium removal data were well described by the Langmuir isotherm. The ammonium adsorption into zeolites is a very fast process when compared with polymeric materials (zeolite particle diffusion coefficient around 3×10 -12 m 2 /s). Column experiments with solutions containing 100mgN-NH 4 + /L provide effective sorption and elution rates with concentration factors between 20 and 30 in consecutive operation cycles. The loaded zeolite was regenerated using 2g NaOH/L solution and the rich ammonium/ammonia concentrates 2-3g/L in NaOH were used in a liquid-liquid membrane contactor system in a closed-loop configuration with nitric and phosphoric acid as stripping solutions. The ammonia recovery ratio exceeded 98%. Ammonia nitrate and di-ammonium phosphate concentrated solutions reached up to 2-5% wt. of N. Copyright © 2017 Elsevier B.V. All rights reserved.
Methods of decontaminating surfaces and related compositions
Demmer, Ricky L.; Crosby, Daniel; Norton, Christopher J.
2016-11-22
A composition of matter includes water, at least one acid, at least one surfactant, at least one fluoride salt, and ammonium nitrate. A method of decontaminating a surface includes exposing a surface to such a composition and removing the composition from the surface. Other compositions of matter include water, a fatty alcohol ether sulfate, nitrilotriacetic acid, at least one of hydrochloric acid and nitric acid, sodium fluoride, potassium fluoride, ammonium nitrate, and gelatin.
NASA Astrophysics Data System (ADS)
Andresen, L. C.; Bode, S.; Tietema, A.; Boeckx, P.; Rütting, T.
2014-11-01
Monomeric organic nitrogen (N) such as free amino acids (fAA) is an important resource for both plants and soil microorganisms and is, furthermore, a source of ammonium (NH4+) via microbial fAA mineralization. We compared gross fAA dynamics with gross N mineralization in a Dutch heathland soil using 15N labelling. A special focus was made on the effects of climate change factors warming and drought, followed by rewetting. Our aims were to: (1) compare fAA mineralization (NH4+ production from fAAs) with gross N mineralization, (2) assess gross fAA production rate (depolymerization) and turnover time relative to gross N mineralization rate, and (3) assess the effects of warming and drought on these rates. The turnover of fAA in the soil was ca. 3 h, which is almost two orders of magnitude faster than that of NH4+ (i.e. ca. 4 days). This suggests that fAAs is an extensively used resource by soil microorganisms. In control soil (i.e. no climatic treatment), the gross N mineralization rate (10 ± 2.9 μg N g-1 day-1) was eight-times smaller than the summed gross fAA production rate of five AAs (alanine, valine, leucine, isoleucine, proline: 127.4 to 25.0 μg N g-1 day-1). Gross fAA mineralization (3.4 ± 0.2 μg N g-1 day-1) contributed by 34% to the gross N mineralization rate and is, thus, an important component of N mineralization. In the drought treatment, gross fAA production was reduced by 65% and gross fAA mineralization by 41%, compared to control. On the other hand, gross N mineralization was unaffected by drought, indicating an increased mineralization of other soil organic nitrogen (SON) components. Warming did not significantly affect N transformations, even though that gross fAA production was more than halved. Overall our results suggest that heathland soil exposed to droughts has a shift in the composition of the SON being mineralized. Furthermore, compared to agricultural soils, fAA mineralization was relatively less important in the investigated heathland. This indicates a more complex mineralization dynamics in semi-natural ecosystems.
Effect on Ammonium Bromide in dielectric behavior based Alginate Solid Biopolymer electrolytes
NASA Astrophysics Data System (ADS)
Fuzlin, A. F.; Rasali, N. M. J.; Samsudin, A. S.
2018-04-01
This paper present the development of solid biopolymer electrolytes (SBEs) system which has been accomplished by incorporating various composition of ionic dopant namely ammonium bromide (NH4Br) with alginate solution casting method. The prepared sample of SBEs has been analyzed via electrical impedance spectroscopy (EIS) showed that the ionic conductivity at room temperature was increased from 4.67 x 10-7 S cm-1 for un-doped sample to optimum value at 4.41 x 10-5 S cm-1 for composition of 20 wt. % NH4Br. The SBEs system was found to obey the Arrhenius characteristics with R2~1where all sample is thermally activated when increasing temperature. The dielectric behavior of the alginate-NH4Br SBEs system were measured using complex permittivity (ε*) and complex electrical modulus (M*) and shown the non-debye behavior where no single relaxation was found for present SBEs system.
Photometric Determination of Ammonium and Phosphate in Seawater Medium Using a Microplate Reader.
Ruppersberg, Hanna S; Goebel, Maren R; Kleinert, Svea I; Wünsch, Daniel; Trautwein, Kathleen; Rabus, Ralf
2017-01-01
To more efficiently process the large sample numbers for quantitative determination of ammonium (NH4+) and phosphate (orthophosphate, PO43-) generated during comprehensive growth experiments with the marine Roseobacter group member Phaeobacter inhibens DSM 17395, specific colorimetric assays employing a microplate reader (MPR) were established. The NH4+ assay is based on the reaction of NH4+ with hypochlorite and salicylate, yielding a limit of detection of 14 µM, a limit of quantitation of 36 µM, and a linear range for quantitative determination up to 200 µM. The PO43-assay is based on the complex formation of PO43- with ammonium molybdate in the presence of ascorbate and zinc acetate, yielding a limit of detection of 13 µM, a limit of quantitation of 50 µM, and a linear range for quantitative determination up to 1 mM. Both MPR-based assays allowed for fast (significantly lower than 1 h) analysis of 21 samples plus standards for calibration (all measured in triplicates) and showed only low variation across a large collection of biological samples. © 2017 S. Karger AG, Basel.
Chen, Qinglin; Wang, Hui; Yang, Baoshan; He, Fei; Han, Xuemei; Song, Ziheng
2015-02-01
The impacts of carbon nanotubes (CNTs) including single-walled carbon nanotubes (SWNTs) and multi-walled carbon nanotubes (MWNTs) on soil microbial biomass and microbial community composition (especially on ammonium oxidizing microorganisms) have been evaluated. The first exposure of CNTs lowered the microbial biomass immediately, but the values recovered to the level of the control at the end of the experiment despite the repeated addition of CNTs. The abundance and diversity of ammonium-oxidizing archaea (AOA) were higher than that of ammonium-oxidizing bacteria (AOB) under the exposure of CNTs. The addition of CNTs decreased Shannon-Wiener diversity index of AOB and AOA. Two-way ANOVA analysis showed that CNTs had significant effects on the abundance and diversity of AOB and AOA. Dominant terminal restriction fragments (TRFs) of AOB exhibited a positive relationship with NH4(+), while AOA was on the contrary. It implied that AOB prefer for high-NH4(+) soils whereas AOA is favored in low NH4(+) soils in the CNT-contaminated soil. Copyright © 2014 Elsevier B.V. All rights reserved.
Werbeck, Nicolas D.; Hansen, D. Flemming
2014-01-01
The equations that describe the time-evolution of transverse and longitudinal 15N magnetisations in tetrahedral ammonium ions, 15NH4+, are derived from the Bloch-Wangsness-Redfield density operator relaxation theory. It is assumed that the relaxation of the spin-states is dominated by (1) the intra-molecular 15N–1H and 1H–1H dipole–dipole interactions and (2) interactions of the ammonium protons with remote spins, which also include the contribution to the relaxations that arise from the exchange of the ammonium protons with the bulk solvent. The dipole–dipole cross-correlated relaxation mechanisms between each of the 15N–1H and 1H–1H interactions are explicitly taken into account in the derivations. An application to 15N-ammonium bound to a 41 kDa domain of the protein DnaK is presented, where a comparison between experiments and simulations show that the ammonium ion rotates rapidly within its binding site with a local correlation time shorter than approximately 1 ns. The theoretical framework provided here forms the basis for further investigations of dynamics of AX4 spin systems, with ammonium ions in solution and bound to proteins of particular interest. PMID:25128779
A simple structural hydrazide-based gelator as a fluoride ion colorimetric sensor.
Bai, Binglian; Ma, Jie; Wei, Jue; Song, Jianxi; Wang, Haitao; Li, Min
2014-06-07
A 4-nitrobenzohydrazide derivative, N-(3,4,5-octyloxybenzoyl)-N'-(4'-nitrobenzoyl)hydrazine (C8), was synthesized. It could form stable gels in some of the tested organic solvents. The wide-angle X-ray diffraction analysis showed that the xerogels exhibited a layered structure. SEM images revealed that the molecules self-assembled into fibrous aggregates in the xerogels. FT-IR studies confirmed that the intermolecular hydrogen bonding between C=O and N-H groups was the major driving force for the formation of self-assembling gel processes. The gel is utilized for a 'naked eye' detection of fluoride ions, through a reversible gel-sol transition, which is associated with a color change from colorless to red. An extended conjugated system formed through the phenyl group and a five-membered ring based on intramolecular hydrogen bonding between the oxygen atom near the deprotonation nitrogen atom and the other NH, which is responsible for the dramatic color change upon addition of fluoride ions.
Omar, Latifah; Ahmed, Osumanu Haruna; Ab Majid, Nik Muhamad
2015-01-01
Improper use of urea may cause environmental pollution through NH3 volatilization and NO3 (-) leaching from urea. Clinoptilolite zeolite and compost could be used to control N loss from urea by controlling NH4 (+) and NO3 (-) release from urea. Soil incubation and leaching experiments were conducted to determine the effects of clinoptilolite zeolite and compost on controlling NH4 (+) and NO3 (-) losses from urea. Bekenu Series soil (Typic Paleudults) was incubated for 30, 60, and 90 days. A soil leaching experiment was conducted for 30 days. Urea amended with clinoptilolite zeolite and compost significantly reduced NH4 (+) and NO3 (-) release from urea (soil incubation study) compared with urea alone, thus reducing leaching of these ions. Ammonium and NO3 (-) leaching losses during the 30 days of the leaching experiment were highest in urea alone compared with urea with clinoptilolite zeolite and compost treatments. At 30 days of the leaching experiment, NH4 (+) retention in soil with urea amended with clinoptilolite zeolite and compost was better than that with urea alone. These observations were because of the high pH, CEC, and other chemical properties of clinoptilolite zeolite and compost. Urea can be amended with clinoptilolite zeolite and compost to improve NH4 (+) and NO3 (-) release from urea.
Sun, Li; Di, Dongwei; Li, Guangjie; Kronzucker, Herbert J; Shi, Weiming
2017-05-01
Ammonium (NH 4 + ) is the predominant nitrogen (N) source in many natural and agricultural ecosystems, including flooded rice fields. While rice is known as an NH 4 + -tolerant species, it nevertheless suffers NH 4 + toxicity at elevated soil concentrations. NH 4 + excess rapidly leads to the disturbance of various physiological processes that ultimately inhibit shoot and root growth. However, the global transcriptomic response to NH 4 + stress in rice has not been examined. In this study, we mapped the spatio-temporal specificity of gene expression profiles in rice under excess NH 4 + and the changes in gene expression in root and shoot at various time points by RNA-Seq (Quantification) using Illumina HiSeqTM 2000. By comparative analysis, 307 and 675 genes were found to be up-regulated after 4h and 12h of NH 4 + exposure in the root, respectively. In the shoot, 167 genes were up-regulated at 4h, compared with 320 at 12h. According to KEGG analysis, up-regulated DEGs mainly participate in phenylpropanoid (such as flavonoid) and amino acid (such as proline, cysteine, and methionine) metabolism, which is believed to improve NH 4 + stress tolerance through adjustment of energy metabolism in the shoot, while defense and signaling pathways, guiding whole-plant acclimation, play the leading role in the root. We furthermore critically assessed the roles of key phytohormones, and found abscisic acid (ABA) and ethylene (ET) to be the major regulatory molecules responding to excess NH 4 + and activating the MAPK (mitogen-activated protein kinase) signal-transduction pathway. Moreover, we found up-regulated hormone-associated genes are involved in regulating flavonoid biosynthesis and are regulated by tissue flavonoid accumulation. Copyright © 2017 Elsevier GmbH. All rights reserved.
Multivariate statistics as means of tracking atmospheric pollution trends in Western Poland.
Astel, Aleksander M; Walna, Barbara; Simeonov, Vasil; Kurzyca, Iwona
2008-02-15
This study was carried out over a period of 4 years (2002-2005) at 2 sites located in western Poland differing as regards to human impact by analysis of chemical composition of bulk precipitation. The aim of the study was to determine the sources of pollutions and assess their quantitative contribution to the bulk precipitation composition and to analyse long term-changes in the chemical quality of precipitation. Based on this information the possible transboundary impacts of pollution were also determined. The samples were characterized by determining the values of pH, electrolytic conductivity and concentration levels of Cl(-), F(-), SO(4)(2-), NO(3)(-), Na(+), K(+), Mg(2+), Ca(2+) and NH(4)(+). Analytical measurements were connected with application of principal component regression (PCR) and time series analysis (TS). Based on PCR results three major sources of pollutants in central part of Poland have been identified and quantitatively assessed as follows: "combined" (Poznań - 31%, WNP - 32%), "soil-particulates" (Poznań - 2%, WNP - 26%), "anthropogenic-fossil fuels" (Poznań - 43%, WNP - 23%). Time series analysis enabled discovering 12-month time cycle for NO(3)(-), NH(4)(+), Cl(-), F(-) and SO(4)(2-) in average monthly concentration values in bulk precipitation collected in Wielkopolski National Park. Seasonal variation in the emission of precursors of NO(3)(-) and NH(4)(+) was caused by changes in intensity of fertilizer application in agriculture and automobile exhaust emissions. Decreasing trend was visible for sulphates, nitrates, chlorides and fluorides which is an important indication of the acid rain reduction in the ecologically protected area and in Poznań.
40 CFR 116.4 - Designation of hazardous substances.
Code of Federal Regulations, 2012 CFR
2012-07-01
..., ammonium sulfocyanide Amly acetate 628637 Amylacetic ester iso- 123922 Pear oil sec- 626380 Banana oil tert... Antimony trifluoride 7783564 Antimony fluoride Antimony trioxide 1309644 Diantimony trioxide, flowers of...
40 CFR 116.4 - Designation of hazardous substances.
Code of Federal Regulations, 2013 CFR
2013-07-01
..., ammonium sulfocyanide Amly acetate 628637 Amylacetic ester iso- 123922 Pear oil sec- 626380 Banana oil tert... Antimony trifluoride 7783564 Antimony fluoride Antimony trioxide 1309644 Diantimony trioxide, flowers of...
40 CFR 116.4 - Designation of hazardous substances.
Code of Federal Regulations, 2014 CFR
2014-07-01
..., ammonium sulfocyanide Amly acetate 628637 Amylacetic ester iso- 123922 Pear oil sec- 626380 Banana oil tert... Antimony trifluoride 7783564 Antimony fluoride Antimony trioxide 1309644 Diantimony trioxide, flowers of...
Theoretical studies of the nucleophilic substitution of halides and amine at a sulfonyl center.
Sung, Dae Dong; Kim, Tae Joon; Lee, Ikchoon
2009-06-25
Gas-phase nucleophilic substitution reactions, F(-) + CH(3)SO(2)F, Cl(-) + CH(3)SO(2)Cl, Cl(-) + CH(3)SO(2)F, and NH(3) + CH(3)SO(2)Cl, have been investigated at the B3LYP/6-311+G** and MP2/6-31+G* levels of theory. A very shallow well for the reaction intermediate in a triple-well potential energy surface (PES) was observed for the identity fluoride exchange, but double well PESs were obtained for the other three reactions with three different PES profiles. NBO analyses of the transition states showed substantial charge transfer interactions in all cases which provided a much larger amount of stabilization energy compared with the corresponding species at the carbon center of methyl halides. This difference is primarily caused by the strong electropositive nature of the sulfur center. The F-S-F axial linkage in the distorted TBP type intermediate in the identity fluoride exchange reaction exhibited a weak three-center, four-electron omega-bonding, which is considered to provide stability of the intermediate. All the reactant (RC) and product complexes (PC) have Cs symmetry. The symmetry plane bisects angles HCH (of methyl group), OSO (of sulfonyl group), and HNH (of ammonia). Vicinal charge transfer interactions between the two out-of-plane C-H, S-O, and N-H bonds provide extra stabilization to the ion-dipole complexes together with H-bond formation of in-plane H atom with the nucleophile and/or leaving group.
Liu, Yang; Tian, Zhongwei; Muhammad, Abid; Zhang, Yixuan; Jiang, Dong; Cao, Weixing; Dai, Tingbo
2016-01-01
Most of the studies about NH4+ stress mechanism simply address the effects of free NH4+, failing to recognize the changed nitrogen assimilation products. The objective of this study was to elucidate the effects of glutamate on root growth under high ammonium (NH4+) conditions in winter wheat (Triticum aestivum L.). Hydroponic experiments were conducted using two wheat cultivars, AK58 (NH4+-sensitive) and Xumai25 (NH4+-tolerant) with either 5 mM NH4+ nitrogen (AN) as stress treatment or 5 mM nitrate (NO3-) nitrogen as control. To evaluate the effects of NH4+-assimilation products on plant growth, 1 μM L-methionine sulfoximine (MSO) (an inhibitor of glutamine synthetase (GS)) and 1 mM glutamates (a primary N assimilation product) were added to the solutions, respectively. The AN significantly reduced plant biomass, total root length, surface area and root volume in both cultivars, but less effect was observed in Xumai25. The inhibition effects were alleviated by the application of MSO but strengthened by the application of glutamate. The AN increased the activities of GS, glutamate dehydrogenase (GDH) in both cultivars, resulting in higher glutamate contents. However, its contents were decreased by the application of MSO. Compared to AK58, Xumai25 showed lower glutamate contents due to its higher activities of glutamic-oxaloacetic transaminase (GOT) and glutamic-pyruvic transaminase (GPT). With the indole-3-acetic acid (IAA) contents decreasing in roots, the ratio of shoot to root in IAA was increased, and further increased by the application of glutamate, and reduced by the application of MSO, but the ratio was lower in Xumai25. Meanwhile, the total soluble sugar contents and its root to shoot ratio also showed similar trends. These results indicate that the NH4+-tolerant cultivar has a greater transamination ability to prevent glutamate over-accumulation to maintain higher IAA transport ability, and consequently promoted soluble sugar transport to roots, further maintaining root growth. PMID:27512992
Lundin, Lisa; Jansson, Stina
2014-01-01
The use of waste wood as an energy carrier has increased during the last decade. However, the higher levels of alkali metals and chlorine in waste wood compared to virgin biomass can promote the formation of deposits and organic pollutants. Here, the effect of fuel composition and the inhibitory effects of ammonium sulfate, (NH4)2SO4, on the concentrations of persistent organic pollutants (POPs) in the flue gas of a lab-scale combustor was investigated. Ammonium sulfate is often used as a corrosion-preventing additive and may also inhibit formation of polychlorinated dibenzo-p-dioxins (PCDDs) and dibenzofurans (PCDFs). In addition to PCDDs and PCDFs, polychlorinated naphthalenes (PCN) and biphenyls (PCB) were also analyzed. It was found that the flue gas composition changed dramatically when (NH4)2SO4 was added: CO, SO2, and NH3 levels increased, while those of HCl decreased to almost zero. However, the additive's effects on POP formation were less pronounced. When (NH4)2SO4 was added to give an S:Cl ratio of 3, only the PCDF concentration was reduced, indicating that this ratio was not sufficient to achieve a general reduction in POP emissions. Conversely, at an S:Cl ratio of 6, significant reductions in the WHO-TEQ value and the PCDD and PCDF contents of the flue gas were observed. The effect on the PCDF concentration was especially pronounced. PCN formation seemed to be promoted by the elevated CO concentrations caused by adding (NH4)2SO4. Copyright © 2013. Published by Elsevier Ltd.
Anammox process for nitrogen removal from anaerobically digested fish canning effluents.
Dapena-Mora, A; Campos, J L; Mosquera-Corral, A; Méndez, R
2006-01-01
The Anammox process was used to treat the effluent generated in an anaerobic digester which treated the wastewater from a fish cannery once previously processed in a Sharon reactor. The effluents generated from the anaerobic digestion are characterised by their high ammonium content (700-1000 g NH4+ -Nm(-3)), organic carbon content (1000-1300 g TOCm(-3)) and salinity up to 8,000-10,000 g NaCl m(-3). In the Sharon reactor, approximately 50% of the NH4+ -N was oxidised to NO2- -N via partial nitrification. The effluent of the Sharon step was fed to the Anammox reactor which treated an averaged nitrogen loading rate of 500 g N m(-3) x d(-1). The system reached an averaged nitrogen removal efficiency of 68%, mainly limited due to the nonstoichiometric relation, for the Anammox process, between the ammonium and nitrite added in the feeding. The Anammox reactor bacterial population distribution, followed by FISH analysis and batch activity assays, did not change significantly despite the continuous entrance to the system of aerobic ammonium oxidisers coming from the Sharon reactor. Most of the bacteria corresponded to the Anammox population and the rest with slight variable shares to the ammonia oxidisers. The Anammox reactor showed an unexpected robustness despite the continuous variations in the influent composition regarding ammonium and nitrite concentrations. Only in the period when NO2- -N concentration was higher than the NH4+ -N concentration did the process destabilise and it took 14 days until the nitrogen removal percentage decreased to 34% with concentrations in the effluent of 340g NH4+ -N m(-3) and 440 g NO2- -N m(-3), respectively. Based on these results, it seems that the Sharon-Anammox system can be applied for the treatment of industrial wastewaters with high nitrogen load and salt concentration with an appropriate control of the NO2- -N/NH4+ -N ratio.
Recovery of ammonia from poultry litter using flat gas permeable membranes.
Rothrock, M J; Szögi, A A; Vanotti, M B
2013-06-01
The use of flat gas-permeable membranes was investigated as components of a new process to capture and recover ammonia (NH3) in poultry houses. This process includes the passage of gaseous NH3 through a microporous hydrophobic membrane, capture with a circulating dilute acid on the other side of the membrane, and production of a concentrated ammonium (NH4) salt. Bench- and pilot-scale prototype systems using flat expanded polytetrafluoroethylene (ePTFE) membranes and a sulfuric acid solution consistently reduced headspace NH3 concentrations from 70% to 97% and recovered 88% to 100% of the NH3 volatilized from poultry litter. The potential benefits of this technology include cleaner air inside poultry houses, reduced ventilation costs, and a concentrated liquid ammonium salt that can be used as a plant nutrient solution. Published by Elsevier Ltd.
Isotopic evidence for enhanced fossil fuel sources of aerosol ammonium in the urban atmosphere.
Pan, Yuepeng; Tian, Shili; Liu, Dongwei; Fang, Yunting; Zhu, Xiaying; Gao, Meng; Gao, Jian; Michalski, Greg; Wang, Yuesi
2018-07-01
The sources of aerosol ammonium (NH 4 + ) are of interest because of the potential of NH 4 + to impact the Earth's radiative balance, as well as human health and biological diversity. Isotopic source apportionment of aerosol NH 4 + is challenging in the urban atmosphere, which has excess ammonia (NH 3 ) and where nitrogen isotopic fractionation commonly occurs. Based on year-round isotopic measurements in urban Beijing, we show the source dependence of the isotopic abundance of aerosol NH 4 + , with isotopically light (-33.8‰) and heavy (0 to +12.0‰) NH 4 + associated with strong northerly winds and sustained southerly winds, respectively. On an annual basis, 37-52% of the initial NH 3 concentrations in urban Beijing arises from fossil fuel emissions, which are episodically enhanced by air mass stagnation preceding the passage of cold fronts. These results provide strong evidence for the contribution of non-agricultural sources to NH 3 in urban regions and suggest that priority should be given to controlling these emissions for haze regulation. This study presents a carefully executed application of existing stable nitrogen isotope measurement and mass-balance techniques to a very important problem: understanding source contributions to atmospheric NH 3 in Beijing. This question is crucial to informing environmental policy on reducing particulate matter concentrations, which are some of the highest in the world. However, the isotopic source attribution results presented here still involve a number of uncertain assumptions and they are limited by the incomplete set of chemical and isotopic measurements of gas NH 3 and aerosol NH 4 + . Further field work and lab experiments are required to adequately characterize endmember isotopic signatures and the subsequent isotopic fractionation process under different air pollution and meteorological conditions. Copyright © 2018 Elsevier Ltd. All rights reserved.
Ambient Ammonium Contribution to total Nitrogen Deposition ...
There has been a wealth of evidence over the last decade illustrating the rising importance of reduced inorganic nitrogen (NHx = ammonia gas, NH3, plus particulate ammonium, p-NH4) in the overall atmospheric mass balance and deposition of nitrogen as emissions of oxidized nitrogen have decreased throughout a period of stable or increasing NH3 emissions. In addition, the fraction of ambient ammonia relative to p-NH4 generally has risen as a result of decreases in both oxides of nitrogen and sulfur emissions. EPA plans to consider ecological effects related to deposition of nitrogen, of which NHx is a contributing component, in the review of secondary National Ambient Air Quality Standards (NAAQS) for oxides of nitrogen and sulfur (NOx/SOx standard). Although these ecological effects are associated with total nitrogen deposition, it will be important to understand the emissions sources contributing to the total nitrogen deposition and to understand how much of the total nitrogen deposition is from deposition of NHx versus other nitrogen species. Because p-NH4 contributes to nitrogen deposition and can also be a significant component of particulate matter, there is a potential overlap in addressing nitrogen based deposition effects in the secondary PM and NOx/SOx NAAQS. Consequently, there is a policy interest in quantifying the contribution of p-NH4 to total nitrogen deposition. While dry deposition of p-NH4 is calculated through a variety of modeling app
USDA-ARS?s Scientific Manuscript database
Ammonia (NH3) emissions are a substantial source of nitrogen pollution to sensitive terrestrial, aquatic, and marine ecosystems. Dependable quantification of NH3 sources is of growing importance due to recently observed increases in ammonium (NH4+) deposition rates that are directly proportional to ...
PCDD/Fs' suppression by sulfur-amine/ammonium compounds.
Fu, Jian-Ying; Li, Xiao-Dong; Chen, Tong; Lin, Xiao-Qing; Buekens, Alfons; Lu, Sheng-Yong; Yan, Jian-Hua; Cen, Ke-Fa
2015-03-01
Three distinct -S and -NH2 or NH4(+) containing compounds, including ammonium thiosulfate, aminosulfonic acid and thiourea, were studied as polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) inhibitors. All these three -S and -N containing compounds tested show strong suppression of PCDD/Fs formation, especially for thiourea which has not been studied before. With a (S+N)/Cl molar ratio of only 0.47, thiourea could inhibit 97.3% of PCDD/Fs and even 99.8% of I-TEQ. At an unusually high de novo test temperature (650 °C), the PCDD/Fs' formation was still very low but also the inhibition capacity of thiourea was weak, with an efficiency of 59% for PCDD/Fs when with a (S+N)/Cl molar ratio of 1.40. The results also revealed that the inhibition capability of the combined -S/-NH2 or -S/NH4(+) suppressant was strongly influenced by both the nature of the functional group of nitrogen and the value of the molar ratio (S+N)/Cl. The amine functional group -NH2 tends to be more efficient than ammonium NH4(+) and within a certain range a higher (S+N)/Cl value leads to a higher inhibition efficiency. Moreover, the emission of gases was continuously monitored: the Gasmet results revealed that SO2, HCN and NH3 were the most important decomposition products of thiourea. Thiourea is non-toxic, environment-friendly and can be sprayed into the post-combustion zone in form of powder or aqueous solution. The cost of thiourea at least can be partially compensated by its high inhibition efficiency. Therefore, the application of thiourea in a full-scale incinerator system is promising and encouraging. Copyright © 2014 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Pan, Y.; Tian, S.; Liu, D.; Fang, Y.; Zhu, X.; Zhang, Q.; Zheng, B.; Michalski, G. M.; Wang, Y.
2016-12-01
The reduction of ammonia (NH3) emissions is urgently needed due to its major contributions to nitrogen deposition and particle pollution. However, the relative contributions of individual NH3 sources are unclear, and debate remains over whether agricultural emissions dominate atmospheric NH3 in urban areas. Based on the chemical and isotopic measurements of size-resolved aerosols in urban Beijing, China, we find that the natural abundance of 15N (expressed using δ15N values) of ammonium (NH4+) in fine particles varies with the development of haze episodes, ranging from -37.1‰ to -21.7‰ during clean/dusty days (relative humidity: ˜ 40%), to -13.1‰ to +5.8‰ during hazy days (relative humidity: 70-90%). After factoring the isotope exchange between NH3 gas and aerosol NH4+, the δ15N value of the initial NH3 during hazy days is found to be -14.5‰ to -1.6‰, which indicates fossil fuel-based emissions. These emissions contribute 90% of the total NH3 during hazy days in urban Beijing. This work demonstrates the analysis of δ15N values of aerosol NH4+ to be a promising new tool for partitioning atmospheric NH3 sources, providing policy makers with insights into NH3 emissions and secondary aerosols for regulation in urban environments. This work also shed lights on the sources of nitrogen deposition in downwind ecosystems.
The Synthesis of Calcium Salt from Brine Water by Partial Evaporation and Chemical Precipitation
NASA Astrophysics Data System (ADS)
Lalasari, L. H.; Widowati, M. K.; Natasha, N. C.; Sulistiyono, E.; Prasetyo, A. B.
2017-02-01
In this study would be investigated the effects of partial evaporation and chemical precipitation in the formation of calcium salt from brine water resources. The chemical reagents used in the study was oxalate acid (C2H2O4), ammonium carbonate (NH4)2CO3) and ammonium hydroxide (NH4OH) with reagent concentration of 2 N, respectively. The procedure was 10 liters brine water evaporated until 20% volume and continued with filtration process to separate brine water filtrate from residue (salt). Salt resulted from evaporation process was characterized by Scanning Electron Microscopy (SEM), X-Ray Fluorescence (XRF) and X-Ray Diffraction (XRD) techniques. Filtrate then was reacted with C2H2O4, (NH4)2CO3 and NH4OH reagents to get salt products in atmospheric condition and variation ratio volume brine water/chemicals (v/v) [10/1; 10/5; 10/10; 10/20; 10/30; 10:50; 20/1; 20/5; 20/10; 20/20; 20/30; 20:50]. The salt product than were filtered, dried, measured weights and finally characterized by SEM/EDS and XRD techniques. The result of experiment showed the chemical composition of brine water from Tirta Sanita, Bogor was 28.87% Na, 9.17% Mg, 2.94% Ca, 22.33% O, 0.71% Sr, 30.02% Cl, 1.51% Si, 1.23% K, 0.55% S, 1.31% Al. The chemical composition of salt resulted by partial evaporation was 53.02% Ca, 28.93%O, 9.50% Na, 2.10% Mg, 1.53% Sr, 1.20% Cl, 1.10% Si, 0.63% K, 0.40% S, 0.39% Al. The salt resulted by total evaporation was indicated namely as NaCl. Whereas salt resulted by partial evaporation was CaCO3 with a purity of 90 % from High Score Plus analysis. In the experiment by chemical precipitation was reported that the reagents of ammonium carbonate were more reactive for synthesizing calcium salt from brine water compared to reagents of oxalate acid and ammonium hydroxide. The salts precipitated by NH4OH, (NH4)2CO3, and H2C2O4 reagents were indicated as NaCl, CaCO3 and CaC2O4.H2O, respectively. The techniques of partial evaporation until 20% volume sample of brine water and chemical precipitation using (NH4)2CO3 reagent are recommended in the synthesis of calcium salts from brine water because are simple, flexible and economical.
Songsiripradubboon, Siriporn; Hamba, Hidenori; Trairatvorakul, Chutima; Tagami, Junji
2014-03-01
To investigate the remineralizing effects of fluoride mouthrinses used at different times and frequency in addition to fluoride toothpaste. A randomized crossover single blinded study comprised 4 experimental phases of 21 days each. Twelve orthodontic volunteers were fixed with an orthodontic bracket containing an artificial carious enamel slab, which was from the same tooth in all 4 phases, and were randomly assigned to the following groups: (1) brushing with F toothpaste 2× per day (F- brush), (2) F- brush+rinsing with 0.05% NaF (F- rinse) after lunch, (3) F- brush+F-rinse before bedtime, and (4) F- brush+F- rinse 2× per day. Mean mineral gain after each phase was determined from mineral density profiles obtained using Micro-CT. The mean mineral gain in all treatments with F- brush and F-rinse were significantly greater than those in F- brush (p<0.05). Moreover F- rinse 2× per day increased lesion remineralization more than F- rinse once a day. The twice-daily use of 0.05% NaF mouthrinse combined with twice-daily regular use of fluoride toothpaste resulted in the greatest remineralization of incipient caries. These data indicate that rinsing frequency is a factor affecting the effectiveness of fluoride mouthrinse. The rinsing frequency of NaF mouthrinse, when used with fluoride toothpaste, also affects the remineralization. This finding, if confirmed by a clinical study, would lead to a new recommendation for fluoride mouthrinse used in high caries risk patients who could benefit from using it twice a day. Copyright © 2014 Elsevier Ltd. All rights reserved.
Hasani, Amirhossein; Le, Quyet Van; Nguyen, Thang Phan; Choi, Kyoung Soon; Sohn, Woonbae; Kim, Jang-Kyo; Jang, Ho Won; Kim, Soo Young
2017-10-16
A facile, highly efficient approach to obtain molybdenum trioxide (MoO 3 )-doped tungsten trioxide (WO 3 ) is reported. An annealing process was used to transform ammonium tetrathiotungstate [(NH 4 ) 2 WS 4 ] to WO 3 in the presence of oxygen. Ammonium tetrathiomolybdate [(NH 4 ) 2 MoS 4 ] was used as a dopant to improve the film for use in an electrochromic (EC) cell. (NH 4 ) 2 MoS 4 at different concentrations (10, 20, 30, and 40 mM) was added to the (NH 4 ) 2 WS 4 precursor by sonication and the samples were annealed at 500 °C in air. Raman, X-ray diffraction, and X-ray photoelectron spectroscopy measurements confirmed that the (NH 4 ) 2 WS 4 precursor decomposed to WO 3 and the (NH 4 ) 2 MoS 4 -(NH 4 ) 2 WS 4 precursor was transformed to MoO 3 -doped WO 3 after annealing at 500 °C. It is shown that the MoO 3 -doped WO 3 film is more uniform and porous than pure WO 3 , confirming the doping quality and the privileges of the proposed method. The optimal MoO 3 -doped WO 3 used as an EC layer exhibited a high coloration efficiency of 128.1 cm 2 /C, which is larger than that of pure WO 3 (74.5 cm 2 /C). Therefore, MoO 3 -doped WO 3 synthesized by the reported method is a promising candidate for high-efficiency and low-cost smart windows.
Fluoride gastrointestinal absorption from Na2FPO3/CaCO3- and NaF/SiO2-based toothpastes.
Falcão, A; Tenuta, L M A; Cury, J A
2013-01-01
Depending on toothpaste formulation, part of the fluoride is insoluble and would not be totally absorbable in the gastrointestinal tract, thus changing dental fluorosis risk estimation. This hypothesis was tested with formulations with either all fluoride in a soluble form (NaF/SiO2-based toothpaste, 1,100 µg F/g as labeled, 1,129.7 ± 49.4 µg F/g soluble fluoride as analyzed) or with around 20% of insoluble fluoride (Na2FPO3/CaCO3-based toothpaste, 1,450 µg F/g as labeled, 1,122.4 ± 76.4 µg F/g soluble fluoride as analyzed). Toothpastes were evaluated either fresh or after accelerated aging, which increased insoluble fluoride to 40% in the Na2FPO3/CaCO3-based toothpaste. In a blind, crossover clinical trial conducted in five legs, 20 adult volunteers ingested 49.5 µg of total fluoride/kg body weight from each formulation or purified water (control). Whole saliva and urine were collected as bioavailability indicators, and pharmacokinetics parameters calculated showed significantly (p < 0.05) lower fluoride bioavailability for Na2FPO3/CaCO3 toothpaste, which was reduced further after aging. A significant correlation between the amount of soluble fluoride ingested, but not total fluoride, and fluoride bioavailability was found (r = 0.57, p < 0.0001). The findings suggest that the estimated fluorosis risk as a result of ingestion of Na2FPO3/CaCO3-based toothpastes should be calculated based on the toothpaste's soluble rather than total fluoride concentration. Copyright © 2012 S. Karger AG, Basel.
NASA Astrophysics Data System (ADS)
Aikawa, Masahide; Hiraki, Takatoshi; Tomoyose, Nobutaka; Ohizumi, Tsuyoshi; Noguchi, Izumi; Murano, Kentaro; Mukai, Hitoshi
2013-11-01
We studied wet deposition by precipitation and the concentrations of aerosols and gases in ambient air in relation to the primary air pollutants discharged from domestic areas. The concentrations of aerosols and gases were influenced by nearby emissions except for non-sea-salt SO, which is transported long distances. The area facing the Sea of Japan showed much larger wet deposition than other areas, although the domestic emissions of the primary air pollutants there were small and showed a peak in wet deposition from October to March, as distinct from April to September in other areas. We performed the correlation analyses between wet deposition of each component and the product of the concentrations of corresponding aerosols and gases in ambient air and the two-thirds power of the precipitation. From the results, following scavenging processes were suggested. • Sulfate and ammonium were scavenged in precipitation as particulate matter such as (NH4)2SO4 and NH4HSO4. • Nitrate was scavenged mainly in precipitation through gaseous HNO3. • Ammonium was complementarily scavenged in precipitation through aerosols such as (NH4)2SO4 and NH4HSO4 and through gaseous NH3.
Meng, Sen; Su, Li; Li, Yiming; Wang, Yinjuan; Zhang, Chunxia; Zhao, Zhong
2016-01-01
Soil salinity is a major abiotic stressor affecting plant growth. Salinity affects nitrification and ammonification in the soil, however, limited information is available on the influence of different N sources on N metabolism during salt stress. To understand the N metabolism changes in response to different N sources during moderate salt stress, we investigated N uptake, assimilation and the transcript abundance of associated genes in Populus simonii seedlings treated with moderate salt stress (75mM NaCl) under hydroponic culture conditions with nitrate (NO3-) or ammonium (NH4+). Salt stress negatively affected plant growth in both NH4+-fed and NO3--fed plants. Both NH4+ uptake and the total N concentration were significantly increased in the roots of the NH4+-fed plants during salt stress. However, the NO3- uptake and nitrate reductase (NR) and nitrite reductase (NiR) activity primarily depended on the NO3- supply and was not influenced by salt stress. Salt stress decreased glutamine synthetase (GS) and glutamate synthase (GOGAT) activity in the roots and leaves. Most genes associated with NO3-uptake, reduction and N metabolism were down-regulated or remained unchanged; while two NH4+ transporter genes closely associated with NH4+ uptake (AMT1;2 and AMT1;6) were up-regulated in response to salt stress in the NH4+-fed plants. The accumulation of different amino acid compounds was observed in the NH4+- and NO3-- fed plants during salt treatment. The results suggested that N metabolism in P. simonii plants exposed to salt enhanced salt resistance in the plants that were fed with NO3- instead of NH4+ as the sole N source. PMID:26950941
Modeling Reduced Nitrogen Deposition in Regulatory Context
Wet and dry deposition of gas phase ammonia (NH3) and particulate ammonium (NH4+) contribute substantially to adverse ecological impacts (e.g., eutrophication) from additional nitrogen loading to terrestrial and aquatic systems. Mitigating ecosystem damage from reduced nitrogen ...
Lee, Carson O; Boe-Hansen, Rasmus; Musovic, Sanin; Smets, Barth; Albrechtsen, Hans-Jørgen; Binning, Philip
2014-11-01
Biological rapid sand filters are often used to remove ammonium from groundwater for drinking water supply. They often operate under dynamic substrate and hydraulic loading conditions, which can lead to increased levels of ammonium and nitrite in the effluent. To determine the maximum nitrification rates and safe operating windows of rapid sand filters, a pilot scale rapid sand filter was used to test short-term increased ammonium loads, set by varying either influent ammonium concentrations or hydraulic loading rates. Ammonium and iron (flock) removal were consistent between the pilot and the full-scale filter. Nitrification rates and ammonia-oxidizing bacteria and archaea were quantified throughout the depth of the filter. The ammonium removal capacity of the filter was determined to be 3.4 g NH4-N m(-3) h(-1), which was 5 times greater than the average ammonium loading rate under reference operating conditions. The ammonium removal rate of the filter was determined by the ammonium loading rate, but was independent of both the flow and influent ammonium concentration individually. Ammonia-oxidizing bacteria and archaea were almost equally abundant in the filter. Both ammonium removal and ammonia-oxidizing bacteria density were strongly stratified, with the highest removal and ammonia-oxidizing bacteria densities at the top of the filter. Cell specific ammonium oxidation rates were on average 0.6 × 10(2) ± 0.2 × 10(2) fg NH4-N h(-1) cell(-1). Our findings indicate that these rapid sand filters can safely remove both nitrite and ammonium over a larger range of loading rates than previously assumed. Copyright © 2014 Elsevier Ltd. All rights reserved.
Fluoride glass starting materials - Characterization and effects of thermal treatment
NASA Technical Reports Server (NTRS)
Chen, William; Dunn, Bruce; Shlichta, Paul; Neilson, George F.; Weinberg, Michael C.
1987-01-01
The production of heavy metal fluoride (HMF) glasses, and the effects of thermal treatments on the HMF glasses are investigated. ZrF4, BaF2, AlF3, LaF3, and NaF were utilized in the synthesis of zirconium-barium-lanthanum-aluminum-sodium fluoride glass. The purity of these starting materials, in particular ZrF4, is evaluated using XRD analysis. The data reveal that low temperature heating of ZrF4-H2O is effective in removing the water of hydration, but causes the production of ZrF4 and oxyfluorides; however, dehydration followed by sublimation results in the production of monoclinic ZrFe without water or oxyfluoride contaminants.
Effect of pretreatment with an Er:YAG laser and fluoride on the prevention of dental enamel erosion.
dos Reis Derceli, Juliana; Faraoni-Romano, Juliana Jendiroba; Azevedo, Danielle Torres; Wang, Linda; Bataglion, César; Palma-Dibb, Regina Guenka
2015-02-01
The aim of this study was to evaluate the effect of the Er:YAG laser and its association with fluoride (1.23% acidulate phosphate fluoride gel) on the prevention of enamel erosion. Sixty specimens were obtained from bovine enamel (4 × 4 mm), which were ground flat, polished, and randomly divided into five groups according to the preventive treatments: control-fluoride application; L--Er:YAG laser; L+F--laser + fluoride; F+L--fluoride + laser; L/F--laser/fluoride simultaneously. Half of the enamel surface was covered with nail varnish (control area), and the other half was pretreated with one of the preventive strategies to subsequently be submitted to erosive challenge. When the laser was applied, it was irradiated for 10 s with a focal length of 4 mm and 60 mJ/2 Hz. Fluoride gel was applied for 4 min. Each specimen was individually exposed to regular Coca-Cola® for 1 min, four times/day, for 5 days. Wear analysis was performed with a profilometer, and demineralization was assessed with an optical microscope. Data were analyzed using the Kruskal-Wallis test (wear)/Dunn test and ANOVA/Fisher's exact tests. The group L/F was similar to control group. The other groups showed higher wear, which did not present differences among them. In the demineralization assessment, the groups F+L and L/F showed lower demineralization in relation to the other groups. It can be concluded that none preventive method was able to inhibit dental wear. The treatments L/F and F+L showed lower enamel demineralization.
Laboratory experiments were conducted to assess whether the presence of liquid water on pre-existing submicron ammonium sulfate aerosols affects yields of condensible organic compounds. Toluene/propylene/NOX/air mixtures were irradiated in the presence of submicron ammonium su...
NASA Astrophysics Data System (ADS)
Updyke, Katelyn M.; Nguyen, Tran B.; Nizkorodov, Sergey A.
2012-12-01
Filter samples of secondary organic aerosols (SOA) generated from the ozone (O3)- and hydroxyl radical (OH)-initiated oxidation of various biogenic (isoprene, α-pinene, limonene, α-cedrene, α-humulene, farnesene, pine leaf essential oils, cedar leaf essential oils) and anthropogenic (tetradecane, 1,3,5-trimethylbenzene, naphthalene) precursors were exposed to humid air containing approximately 100 ppb of gaseous ammonia (NH3). Reactions of SOA compounds with NH3 resulted in production of light-absorbing "brown carbon" compounds, with the extent of browning ranging from no observable change (isoprene SOA) to visible change in color (limonene SOA). The aqueous phase reactions with dissolved ammonium (NH4+) salts, such as ammonium sulfate, were equally efficient in producing brown carbon. Wavelength-dependent mass absorption coefficients (MAC) of the aged SOA were quantified by extracting known amounts of SOA material in methanol and recording its UV/Vis absorption spectra. For a given precursor, the OH-generated SOA had systematically lower MAC compared to the O3-generated SOA. The highest MAC values, for brown carbon from SOA resulting from O3 oxidation of limonene and sesquiterpenes, were comparable to MAC values for biomass burning particles but considerably smaller than MAC values for black carbon aerosols. The NH3/NH4+ + SOA brown carbon aerosol may contribute to aerosol optical density in regions with elevated concentrations of NH3 or ammonium sulfate and high photochemical activity.
Sulfonyl fluoride-based prosthetic compounds as potential 18F labelling agents.
Inkster, James A H; Liu, Kate; Ait-Mohand, Samia; Schaffer, Paul; Guérin, Brigitte; Ruth, Thomas J; Storr, Tim
2012-08-27
Nucleophilic incorporation of [(18)F]F(-) under aqueous conditions holds several advantages in radiopharmaceutical development, especially with the advent of complex biological pharmacophores. Sulfonyl fluorides can be prepared in water at room temperature, yet they have not been assayed as a potential means to (18)F-labelled biomarkers for PET chemistry. We developed a general route to prepare bifunctional 4-formyl-, 3-formyl-, 4-maleimido- and 4-oxylalkynl-arylsulfonyl [(18)F]fluorides from their sulfonyl chloride analogues in 1:1 mixtures of acetonitrile, THF, or tBuOH and Cs[(18)F]F/Cs(2)CO(3(aq.)) in a reaction time of 15 min at room temperature. With the exception of 4-N-maleimide-benzenesulfonyl fluoride (3), pyridine could be used to simplify radiotracer purification by selectively degrading the precursor without significantly affecting observed yields. The addition of pyridine at the start of [(18)F]fluorination (1:1:0.8 tBuOH/Cs(2)CO(3(aq.))/pyridine) did not negatively affect yields of 3-formyl-2,4,6-trimethylbenzenesulfonyl [(18)F]fluoride (2) and dramatically improved the yields of 4-(prop-2-ynyloxy)benzenesulfonyl [(18)F]fluoride (4). The N-arylsulfonyl-4-dimethylaminopyridinium derivative of 4 (14) can be prepared and incorporates (18)F efficiently in solutions of 100 % aqueous Cs(2)CO(3) (10 mg mL(-1)). As proof-of-principle, [(18)F]2 was synthesised in a preparative fashion [88(±8) % decay corrected (n=6) from start-of-synthesis] and used to radioactively label an oxyamino-modified bombesin(6-14) analogue [35(±6) % decay corrected (n=4) from start-of-synthesis]. Total preparation time was 105-109 min from start-of-synthesis. Although the (18)F-peptide exhibited evidence of proteolytic defluorination and modification, our study is the first step in developing an aqueous, room temperature (18)F labelling strategy. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DOE Office of Scientific and Technical Information (OSTI.GOV)
El-Bayoumi, O.
1983-08-09
This invention relates to Fluoride-based glasses that exhibit a high degree of transparency throughout the near ultraviolet visible and mid infrared portions of the spectrum. The glasses are composed of MgF2 and ZnF2 as essential compositional ingredients together with at least two other metallic fluorides from the group of YbF3, ThF4, PbF2, A1F3 and MnF2.
NASA Astrophysics Data System (ADS)
Williams, J. E.; van der Swaluw, E.; de Vries, W. J.; Sauter, F. J.; van Pul, W. A. J.; Hoogerbrugge, R.
2015-08-01
We present a parameterization developed to simulate Ammonium particle (NH4+) concentrations in the Operational Priority Substances (OPS) source-receptor model, without the necessity of using a detailed chemical scheme. By using the ratios of the main pre-cursor gases SO2, NO2 and NH3, and utilising calculations performed using a chemical box-model, we show that the parameterization can simulate annual mean NH4+ concentration fields to within ∼15% of measured values at locations throughout the Netherlands. Performing simulations for different decades, we find a strong correlation of simulated NH4+ distributions for both past (1993-1995) and present (2009-2012) time periods. Although the total concentration of NH4+ has decreased over the period, we find that the fraction of NH4+ transported into the Netherlands has increased from around 40% in the past to 50% for present-day. This is due to the variable efficiency of mitigation practises across economic sectors. Performing simulations for the year 2020 using associated emission estimates, we show that there are generally decreases of ∼8-25% compared to present day concentrations. By altering the meteorological fields applied in the future simulations, we show that a significant uncertainty of between ∼50 and 100% exists on this estimated NH4+ distribution as a result of variability in the temperature dependent emission terms and relative humidity. Therefore, any projections of future NH4+ distributions should be performed using well chosen meteorological fields representing recent meteorological situations.
NASA Astrophysics Data System (ADS)
Bonavia, Grant; Haushalter, R. C.; Zubieta, Jon
1996-11-01
The hydrothermal reactions of FPO3H2with vanadium oxides result in the incorporation of fluoride into V-P-O frameworks as a consequence of metal-mediated hydrolysis of the fluorophosphoric acid to produce F-and PO3-4. By exploiting this convenient source of F-, two 3-dimensional oxo-fluorovanadium phosphate phases were isolated, [H2N(C2H4)2NH2]0.5[(VO)4V(HOP4)2(PO4)2F2(H2O)4) · 2H2O (1 · 2H2O) and K2[(VO)3(PO4)2F2(H2O)] · H2O (2 · H2O). Both anionic frameworks contain (VIVO)-F--phosphate layers, with confacial bioctahedral {(VIVO)2FO6} units as the fundamental motif. In the case of 1, the layers are linked through {VIIIO6} octahedra, while for 2 the interlayer connectivity is provided by edge-sharing {(VIVO)2F2O6} units. Crystal data are 1 · 2H2O, CH10FN0.5O13P2V2.5, monoclinicC2/m,a= 18.425(4) Å,c= 8.954(2) Å, β = 93.69(2)0,V= 1221.1(4) Å3,Z= 4,Dcalc= 2.423 g cm-3; 2 · H2O, H4F2K2O13P2V3, triclinicPoverline1,a= 7.298(1) Å,b= 8.929(2) Å,c = 10.090(2) Å, α = 104.50(2)0, β = 100.39(2)0, δ = 92.13(2)0,V= 623.8(3) Å3,Z= 2,Dcalc= 2.891 g cm-3.
NASA Astrophysics Data System (ADS)
Qi, Jianhua; Liu, Xiaohuan; Yao, Xiaohong; Zhang, Ruifeng; Chen, Xiaojing; Lin, Xuehui; Gao, Huiwang; Liu, Ruhai
2018-01-01
Asian dust has been reported to carry anthropogenic reactive nitrogen during transport from source areas to the oceans. In this study, we attempted to characterize NH4+ and NO3- in atmospheric particles collected at a coastal site in northern China during spring dust events from 2008 to 2011. Based on the mass concentrations of NH4+ and NO3- in each total suspended particle (TSP) sample, the samples can be classified into increasing or decreasing types. In Category 1, the concentrations of NH4+ and NO3- were 20-440 % higher in dust day samples relative to samples collected immediately before or after a dust event. These concentrations decreased by 10-75 % in the dust day samples in Categories 2 and 3. Back trajectory analysis suggested that multiple factors, such as the transport distance prior to the reception site, the mixing layer depth on the transport route and the residence time across highly polluted regions, might affect the concentrations of NH4+ and NO3-. NH4+ in the dust day samples was likely either in the form of ammonium salts existing separately to dust aerosols or as the residual of incomplete reactions between ammonium salts and carbonate salts. NO3- in the dust day samples was attributed to various formation processes during the long-range transport. The positive matrix factorization (PMF) receptor model results showed that the contribution of soil dust increased from 23 to 36 % on dust days, with decreasing contributions from local anthropogenic inputs and associated secondary aerosols. The estimated deposition flux of NNH4++NO3- varied greatly from event to event; e.g., the dry deposition flux of NNH4++NO3- increased by 9-285 % in Category 1 but decreased by 46-73 % in Category 2. In Category 3, the average dry deposition fluxes of particulate nitrate and ammonium decreased by 46 % and increased by 10 %, respectively, leading to 11-48 % decrease in the fluxes of NNH4++NO3-.
Chemical vapor transport of layer structured crystal β-ZrNCl
NASA Astrophysics Data System (ADS)
Ohashi, M.; Yamanaka, S.; Hattori, M.
1988-12-01
A layer structured compound β-ZrNCl is transported to a higher temperature zone with the aid of ammonium chloride as the transporting agent in the temperature range of 823-1173 K. The transport mechanism can be explained by the formation of a volatile compound (NH 4) 2ZrCl 6: β- ZrNCl+5 NH4Cl→( NH4) 2ZrCl6+4 NH3. The measurements of the vapor pressure and the mass spectrum revealed that (NH 4) 2ZrCl 6 decomposed congruently according to the equation: ( NH4) 2ZrCl6( s)→ ZrCl4( g)+2 NH3( g)+2 HCl( g) The enthalpy change for the decomposition was determined to be 533 kJ/mol. By combining the above two equations, a simplified transport equation is derived: β- ZrNCl( s)+3 HCl( g)⇌ ZrCl4( g+ NH3( g) .
González-Valdez, Eduardo; Alarcón, Alejandro; Ferrera-Cerrato, Ronald; Vega-Carrillo, Héctor René; Maldonado-Vega, María; Salas-Luévano, Miguel Ángel; Argumedo-Delira, Rosalba
2018-06-15
This study evaluated the ability of Brassica napus for extracting gold (Au), silver (Ag) and copper (Cu) from a mine tailings, with the inoculation of two Aspergillus niger strains, and the application of ammonium thiocyanate (NH 4 SCN) or ammonium thiosulfate [(NH 4 ) 2 S 2 O 3 ]. After seven weeks of growth inoculated or non-inoculated plants were applied with 1 or 2 g kg -1 of either NH 4 SCN or (NH 4 ) 2 S 2 O 3 , respectively. Eight days after the application of the chemical compounds, plants were harvested for determining the total dry biomass, and the content of Au, Ag, and Cu in plant organs. Application of (NH 4 ) 2 S 2 O 3 or NH 4 SCN resulted in enhanced Au-accumulation in stems (447% and 507%, respectively), while either (NH 4 ) 2 S 2 O 3 +Aspergillus, or NH 4 SCN increased the Au-accumulation in roots (198.5% and 404%, respectively) when compared to the control. Treatments with (NH 4 ) 2 S 2 O 3 or (NH 4 ) 2 S 2 O 3 +Aspergillus significantly increased (P ≤ 0.001) the accumulation of Ag in leaves (677% and 1376%, respectively), while NH 4 SCN + Aspergillus, and (NH 4 ) 2 S 2 O 3 enhanced the accumulation in stems (7153% and 6717.5%). The Ag-accumulation in roots was stimulated by NH 4 SCN+ Aspergillus, and (NH 4 ) 2 S 2 O 3 + Aspergillus (132.5% and 178%, respectively), when compared to the control. The combination of NH 4 SCN+Aspergillus significantly enhanced the Cu-accumulation in leaves (228%); whereas NH 4 SCN+ Aspergillus, or (NH 4 ) 2 S 2 O 3 + Aspergillus resulted in greater accumulation of Cu in stems (1233.5% and 1580%, respectively) than the control. Results suggest that either NH 4 SCN or (NH 4 ) 2 S 2 O 3 (with or without Aspergillus) improved the accumulation of Au and Ag by B. napus. Accumulation of Au and Ag in plant organs overpassed the hyperaccumulation criterion (> 1 mg kg -1 of plant biomass); whereas Cu-accumulation in stems and roots also overpassed such criterion (> 1000 mg kg -1 ) by applying either NH 4 SCN or (NH 4 ) 2 S 2 O 3 + A. niger. Copyright © 2018 Elsevier Inc. All rights reserved.
The stability of accumulating nitrite from Swine wastewater in a sequencing batch reactor.
Wang, Liang; Zhu, Jun; Miller, Curtis
2011-02-01
Shortcut nitrification is the first step of shortcut nitrogen removal from swine wastewater. Stably obtaining an effluent with a significant amount of nitrite is the premise for the subsequent shortcut denitrification. In this paper, the stability of nitrite accumulation was investigated using a 1.5-day hydraulic retention time in a 10-L (working volume) activated sludge sequencing batch reactor (SBR) with an 8-h cycle consisted of 4 h 38 min aerobic feeding, 1 h 22 min aerobic reaction, 30 min settling, 24 min withdrawal, and 1 h 6 min idle. The nitrite production stability was tested using four different ammonium loading rates, 0.075, 0.062, 0.053, and 0.039 g NH(4)-N/g (mixed liquid suspended solid, MLSS) day in a 2-month running period. The total inorganic nitrogen composition in the effluent was not affected when the ammonium load was between 0.053 and 0.075 g NH(4)-N/g MLSS · day (64% NO(2)-N, 16% NO(3)-N, and 20% NH(4)-N). Under 0.039 g NH(4)-N/g MLSS · day, more NO(2)-N was transformed to NO(3)-N with an effluent of 60% NO(2)-N, 20% NO(3)-N, and 20% NH(4)-N. The reducing load test was able to show the relationship between a declining free nitrous acid (FNA) concentration and the decreasing nitrite production, indicating that the inhibition of FNA on nitrite oxidizing bacteria depends on its levels and an ammonium loading rate around 0.035 g NH(4)-N/g MLSS · day is the lower threshold for producing a nitrite dominance effluent in the activated sludge SBR under the current settings.
Sequential 28-day and 90-day oral toxicity studies were performed in male and female rats with ammonium perfluorobutyrate (NH4+PFBA) at doses up to 150 and 30 mg/kg/d, respectively. Ammonium perfluorooctanoate was used as a comparator at a dose of 30 mg/kg/d in the 28-d study. Fe...
Xu, Changwen; Yuan, Haiping; Lou, Ziyang; Zhang, Guofang; Gong, Junzhe; Zhu, Nanwen
2013-12-01
Magnesium ammonium phosphate (MAP) precipitation was introduced to remove ammonium nitrogen (NH4(+)-N) in autothermal thermophilic aerobic digestion (ATAD) in this study. The dosing time of MgCl2 · 6H2O and NaH2PO4 · 2H2O will influence the removal efficiency of ammonium nitrogen greatly, and the time interval of 2nd, 7th, 12th day were chosen in ATAD process. The lowest NH4(+)-N concentration was found in the 2nd day dosing digester, and 38.37% of VS removal rate was obtained after 12 days digestion, which achieved stabilization 9 days earlier than the non-dosing digester. It revealed that removal of ammonium nitrogen could accelerate the sludge stabilization process. Meanwhile, 49.30% of VS removal rate was found in the 2nd day dosing digester in the 21st day, much higher than that in the non-dosing digester, the 7th day dosing digester, and the 12th day dosing digester, with the corresponding value of 38.37%, 38.38% and 37.04%, respectively. Copyright © 2013 Elsevier Ltd. All rights reserved.
Benthic nitrogen turnover processes in coastal sediments at the Danube Delta
NASA Astrophysics Data System (ADS)
Bratek, Alexander; Dähnke, Kirstin; Neumann, Andreas; Möbius, Jürgen; Graff, Florian
2017-04-01
The Black Sea Shelf has been exposed to strong anthropogenic pressures from intense fisheries and high nutrient inputs and eutrophication over the past decades. In the light of decreasing riverine nutrient loads and improving nutrient status in the water column, nutrient regeneration in sediments and biological N-turnover in the Danube Delta Front have an important effect on nutrient loads in the shelf region. In May 2016 we determined pore water nutrient profiles in the Danube River Delta-Black Sea transition zone, aiming to assess N-regeneration and elimination based on nutrient profiles and stable N- isotope changes (nitrate and ammonium) in surface water masses and in pore water. We aimed to investigate the magnitude and isotope values of sedimentary NH4+ and NO3- and their impact on the current N-budget in Black Sea Shelf water. Based on changes in the stable isotope ratios of NO3- and NH4+, we aimed to differentiate diffusion and active processing of ammonium as well as nitrate sources and sinks in bottom water. First results show that the concentration of NH4+ in pore water increases with depth, reaching up to 1500 µM in deeper sediment layers. We find indications for high fluxes of ammonium to the overlying water, while stable isotope profiles of ammonium suggest that further processing, apart from mere diffusion, acts on the pore water ammonium pool. Nitrate concentration and stable isotope profiles show rapid consumption in deeper anoxic sediment layers, but also suggest that nitrate regeneration in bottom water increases the dissolved nitrate pool. Overall, the isotope and concentration data of pore water ammonium clearly mirror a combination of turnover processes and diffusion.
Development of a sustained fluoride delivery system.
Baturina, Olga; Tufekci, Eser; Guney-Altay, Ozge; Khan, Shadeed M; Wnek, Gary E; Lindauer, Steven J
2010-11-01
To develop a novel delivery system by which fluoride incorporated into elastomeric rings, such as those used to ligate orthodontic wires, will be released in a controlled and constant manner. Polyethylene co-vinyl acetate (PEVA) was used as the model elastomer. Samples (N = 3) were prepared by incorporating 0.02 to 0.4 g of sodium fluoride (NaF) into previously prepared PEVA solution. Another group of samples prepared in the same manner were additionally dip-coated in PEVA to create an overcoat. Fluoride release studies were conducted in vitro using an ion selective electrode over a period of 45 days. The amount of fluoride released was compared to the optimal therapeutic dose of 0.7 microg F(-)/ring/d. Only coated samples with the highest fluoride content (group D, 0.4 g of NaF) were able to release fluoride at therapeutic levels. When fluoride release from coated and uncoated samples with the same amount of NaF were compared, it was shown that the dip-coating technique resulted in a fluoride release in a controlled manner while eliminating the initial burst effect. This novel fluoride delivery matrix provided fluoride release at a therapeutically effective rate and profile.
Extraction of Vanadium from Vanadium Slag Via Non-salt Roasting and Ammonium Oxalate Leaching
NASA Astrophysics Data System (ADS)
Li, Meng; Du, Hao; Zheng, Shili; Wang, Shaona; Zhang, Yang; Liu, Biao; Dreisinger, David Bruce; Zhang, Yi
2017-10-01
A clean method featuring non-salt roasting followed by (NH4)2C2O4 leaching to recover vanadium from vanadium slag was proposed. The carcinogenic Cr6+ compounds and exhaust gases were avoided, and the water generated from vanadate precipitation may be recycled and reused in this new leaching process. The leaching residues may be easily used by a blast furnace. Moreover, (NH4)2C2O4 solution was used as a leaching medium to avoid expensive and complicated ammonium controlling operations as a result of the stability of (NH4)2C2O4 at a high temperature. The transformation mechanisms of vanadium- and chromium-bearing phases were systematically investigated by x-ray diffraction analysis and scanning electron microscopy with energy-disperse x-ray spectrometry, respectively. In addition, the effects of oxygen concentration, roasting temperature, and holding time on vanadium recovery were investigated. Finally, the effects of leaching variables on the vanadium leaching rate were also examined.
Characteristics of ammonium and nitrate uptake by phytoplankton in Lake Kinneret
DOE Office of Scientific and Technical Information (OSTI.GOV)
Berman, T.; Sherr, B.F.; Sherr, E.
1984-03-01
Seasonal and diurnal patterns of NH/sub 4//sup +/ and NO/sub 3//sup -/ uptake were determined for Lake Kinneret phytoplankton. Nanoplankton generally, but not always, had a higher uptake of NH/sub 4//sup +/ and NO/sub 3//sup -/ than did net plankton. Ammonium was always taken up preferentially and the phytoplankton had lower apparent affinity constants (K/sub s/) for this ion than for NO/sub 3//sup -/. However, during the annual dinoflagellate bloom of Peridinium (February-May), when ambient levels of NH/sub 4//sup +/ were low and those of NO/sub 3//sup -/ were high, a considerable portion of the total N flux was derivedmore » from NO/sub 3//sup -/. The finding that NO/sub 3//sup -/ was utilized by the dinoflagellates implies that control of the amounts of this nutrient, which is predominantly supplied from watershed sources, could be important in limiting eutrophication in Lake Kinneret.« less
NASA Astrophysics Data System (ADS)
Valdes, V.; Escribano, R.; Fernandez, C.; Molina, V.
2016-02-01
Zooplankton play a pivotal role in the nitrogen cycle by sustaining phytoplankton and heterotrophic bacterial growth through N excretion. This biogeochemical interaction between microbial community and zooplankton has been poorly studied in the ocean. In this work we explored the interaction between the nitrogen compounds excreted by dominant copepods in the upwelling zone off central Chile and the activity of ammonium oxidizing microbial community. For doing so, two experiments were conducted in May and early September 2010 off Concepción (36°S) in central-southern Chile upon non-upwelling condition. Among organic and inorganic nitrogen compounds excreted by copepods (NH4+, DON, NO3- and NO2-), DON was the most abundant. In the first experiment, DON excretion rate was <0.6 μmol L-1 h-1 in the first hours of incubation, while in the second experiment we found values of 0.9 μmol L-1 h-1 in the last hour of incubation. NH4+ excretion rates were lower than those of DON, with values ca. 0.02 and < 0.4 μmol L-1 h-1 in autumn and winter, respectively. When assessing the response of microbial ammonium oxidizing groups to the input of these excreted products, it was found that NH4+ was significantly consumed in the first four hours of incubation in the autumn experiment, while bacterioplankton abundance incremented to 8 x105 to 1.2 x106 cells mL-1 after 6 hours. The activity of AOB and AOA amoA transcript copies increased from 1,539 to 5,669 copies mL-1 and 1,510 a 3,763 copies mL-1, respectively. In the second experiment, NH4+ showed complete consumption in the first two hours of incubation and specific groups of AOA and AOB transcript were below <10,000 copies mL-1. Our findings confirm, that NH4+ is not the main compound excreted by copepods, and this can be directly used by bacterioplankton and AOB followed by AOA response to available NH4+. Both are able to utilize a large proportion of ammonium excreted by the copepods during austral autumn and winter.
DETECTION OF THE AMMONIUM ION IN SPACE
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cernicharo, J.; Tercero, B.; Fuente, A.
2013-07-01
We report on the detection of a narrow feature at 262816.73 MHz toward Orion and the cold prestellar core B1-bS which we attribute to the 1{sub 0}-0{sub 0} line of the deuterated ammonium ion, NH{sub 3}D{sup +}. The observations were performed with the IRAM 30 m radio telescope. The carrier has to be a light molecular species as it is the only feature detected over 3.6 GHz of bandwidth. The hyperfine structure is not resolved, indicating a very low value for the electric quadrupolar coupling constant of nitrogen which is expected for NH{sub 3}D{sup +} as the electric field overmore » the N nucleus is practically zero. Moreover, the feature is right at the predicted frequency for the 1{sub 0}-0{sub 0} transition of the ammonium ion, 262817 {+-} 6 MHz (3{sigma}), using rotational constants derived from new infrared data obtained in our laboratory in Madrid. The estimated column density is (1.1 {+-} 0.2) Multiplication-Sign 10{sup 12} cm{sup -2}. Assuming a deuterium enhancement similar to that of NH{sub 2}D, we derive N(NH{sub 4}{sup +}) {approx_equal} 2.6 Multiplication-Sign 10{sup 13} cm{sup -2}, i.e., an abundance for ammonium of a few 10{sup -11}.« less
Studies on the use of supercritical ammonia for ceramic nitride synthesis and fabrication
NASA Technical Reports Server (NTRS)
Cornell, Linda; Lin, Y. C.; Philipp, Warren H.
1990-01-01
The extractability of ammonia halides (including ammonium thiocyanate) formed as byproducts from the synthesis of Si(NH)2 via ammonolysis of the corresponding silicon tetrahalides using supercritical NH3 as the extraction medium was investigated. It was found that the NH4SCN byproduct of ammonolysis of Si(SCN)4 can be almost completely extracted from the insoluble Si(NH)2 forming a promising system for the synthesis of pure Si(NH)2, one of the best precursors for Si3N4. In addition it was found that Si3N4, AlN, BN, and Si(NH)2 are insoluble in SC ammonia. Also discussed are design considerations for a supercritical ammonia extraction unit.
Crystal growth in supercritical ammonia using high surface area silicon nitride feedstock
NASA Astrophysics Data System (ADS)
Kaskel, Stefan; Khanna, Meikh; Zibrowius, Bodo; Schmidt, Hans-Werner; Ullner, Dirk
2004-01-01
The use of amorphous high surface area silicon nitride is proposed as a raw material for crystallization experiments in supercritical ammonia. Compared with earlier studies, the use of highly dispersed solids results in the crystallization of inorganic nitrides under relatively mild conditions (673 K). Mineralizers such as amides (LiNH 2, NaNH 2, KNH 2) are found to be effective crystallization aids. The crystalline products, detected using powder X-ray diffraction, are either MSi 2N 3 (M=Li, Na) or Si 2N 2NH. Si 2N 2NH is also characterized using 29Si MAS NMR. The spectrum shows a narrow line located at -44.7 ppm, whereas for amorphous silicon nitride-based materials the line is broad. The ammonothermal reaction of NaAl(NH 2) 4 and high surface area silicon nitride at 673 K affords a new orthorhombic phase, isostructural with NaSi 2N 3, but with extended lattice constants ( a=9.634, b=5.643, c=5.011 Å). Effective crystallization is also achieved using fluoride mineralizers (KF, CsF) at 673 K. A new small scale autoclave, suitable for laboratory syntheses at temperatures up to 873 K, is presented that can be loaded under inert gas.
Omar, Latifah; Ahmed, Osumanu Haruna; Majid, Nik Muhamad Ab.
2015-01-01
Improper use of urea may cause environmental pollution through NH3 volatilization and NO3 − leaching from urea. Clinoptilolite zeolite and compost could be used to control N loss from urea by controlling NH4 + and NO3 − release from urea. Soil incubation and leaching experiments were conducted to determine the effects of clinoptilolite zeolite and compost on controlling NH4 + and NO3 − losses from urea. Bekenu Series soil (Typic Paleudults) was incubated for 30, 60, and 90 days. A soil leaching experiment was conducted for 30 days. Urea amended with clinoptilolite zeolite and compost significantly reduced NH4 + and NO3 − release from urea (soil incubation study) compared with urea alone, thus reducing leaching of these ions. Ammonium and NO3 − leaching losses during the 30 days of the leaching experiment were highest in urea alone compared with urea with clinoptilolite zeolite and compost treatments. At 30 days of the leaching experiment, NH4 + retention in soil with urea amended with clinoptilolite zeolite and compost was better than that with urea alone. These observations were because of the high pH, CEC, and other chemical properties of clinoptilolite zeolite and compost. Urea can be amended with clinoptilolite zeolite and compost to improve NH4 + and NO3 − release from urea. PMID:25793220
Ammonia emissions from different fertilizing strategies in Mediterranean rainfed winter cereals
NASA Astrophysics Data System (ADS)
Bosch-Serra, Àngela D.; Yagüe, María R.; Teira-Esmatges, María R.
2014-02-01
Anthropogenic ammonia (NH3) emissions mainly result from agricultural activities where manure spreading plays a significant role. For a Mediterranean rainfed winter cereal system there is a lack of data regarding NH3 emissions. The aim of this work is to provide field data on N losses due to NH3 volatilization as a consequence of the introduction of slurries in fertilization strategies and also, to assess the influence of environmental conditions and slurry characteristics on emissions. The fertilizing strategies include the use of slurry from fattening pigs (PS), sows (PSS) and/or mineral fertilizer (M) as ammonium nitrate. Fertilizers were spread over the calcareous soil at sowing and/or at tillering at rates from 15 to 45 kg NH4+-N ha-1 for M and from 48.8 to 250.3 kg NH4+-N ha-1 for slurries. The NH3 emissions were quantified during three cropping seasons. Average losses from the total ammonium nitrogen applied ranged from 7 to 78% for M and from 6 to 64% for slurries and they were not directly proportional to the amounts of applied ammonium. The best results on NH3 volatilization reduction were registered when soil water content (SWC, 0-30 cm) was below 56% of its field capacity and also, when slurry dry matter (DM) was in the interval of 6.1-9.3% for PS or much lower (0.8%) for PSS. High slurry DM favoured crust formation and the lower rates promoted infiltration, both of which reduced NH3 emissions. Nevertheless, at tillering, the lower DM content was the most effective in controlling emissions (<9 kg NH3-N ha-1) and equalled M fertilizer in cumulative NH3 loss (p > 0.05). A single slurry application at tillering did not negatively affect yield biomass. The combining of recommended timing of applications with slurry DM content and SWC should allow producers to minimize volatilization while maintaining financial benefits.
The fate of ammonium-nitrogen in leachate contaminated groundwater system
NASA Astrophysics Data System (ADS)
M, Atta; W, Yaacob W. Z.
2015-09-01
Hydrogeochemical conditions influences strongly on ammonium attenuation and ultimately its long-term fate in the subsurface. The purpose of this work was to identify the conditions influencing the persistence of ammonium-nitrogen in the contaminated groundwater system of Taman Beringin ex-landfill site in Malaysia. This study applies hydrogeochemical data extractions techniques of redox sensitive groundwater species from previously installed monitoring wells between February to August 2014. Electrochemical measurements of Oxidation Reduction Potential (ORP) were collected successively with several other physicochemical parameters including pH, Temperature, and DO in the landfill site. The result show that the mean concentration of NH4-N, NO2-N, and NO3-N are: (47.98±81.83 mg/L), (0.17±0.22 mg/L) and (6.11± 8.74 mg/L) respectively. The mean range of redox potentials (-10.25±128.28 mV) delineated areas of strongly reducing conditions. Based on the evaluation of the data, NH4-N, NO2-N and NO3-N accounts for 89.98%, 0.28% and 9.7% respectively of the groundwater concentration of total nitrogen, while a miniature proportion of oxidisable nitrogen concentrations (10.02%) are attributed t o biological process of nitrification. Relationship exist between data set NH4-N and ORP (r = -0.65009). It was concluded that although biological attenuation processes are effectively decreasing the ammonia concentrations in some of the wells, the processes are inhibited by chemical conditions that were attributed to Fe reducing conditions as observed in some of the wells. NH4-N will remain persistent and at elevated levels as much as the conditions persist and contributes in determining the fate of NH4-N in the Taman Beringin ground water system.
Anhydrous hydrogen fluoride electrolyte battery. [Patent application
Not Available
1972-06-26
It is an object of the invention to provide a primary cell or battery using ammonium fluoride--anhydrous hydrogen fluoride electrolyte having improved current and power production capabilities at low temperatures. It is operable at temperatures substantially above the boiling point of hydrogen fluoride. (GRA)
NASA Astrophysics Data System (ADS)
Kumar, A.; Marcolli, C.; Luo, B.; Krieger, U. K.; Peter, T.
2017-12-01
Semivolatile species present in the atmosphere are prone to adhere to mineral dust particle surfaces during long range transport, and could potentially change the particle surface properties and its ice nucleation (IN) efficiency. Immersion freezing experiments were performed with microcline (K-feldspar), known to be highly IN active, suspended in aqueous solutions of ammonia, (NH4)2SO4, NH4HSO4, NH4NO3, NH4Cl, Na2SO4, H2SO4, K2SO4 and KCl to investigate the effect of solutes on the IN efficiency. Freezing of emulsified droplets investigated with a differential scanning calorimeter (DSC) showed that the heterogeneous ice nucleation temperatures deviate from the water activity-based IN theory, describing heterogeneous ice nucleation temperatures as a function of solution water activity by a constant offset with respect to the ice melting point curve (Zobrist et al. 2008). IN temperatures enhanced up to 4.5 K were observed for very dilute NH3 and NH4+-containing solutions while a decrease was observed as the concentration was further increased. For all solutes with cations other than NH4+, the IN efficiency decreased. An increase of the IN efficiency in very dilute NH3 and NH4+-containing solutions followed by a decrease with increasing concentration was also observed for sanidine (K-feldspar) and andesine (Na/Ca-feldspar). This is an important indication towards specific chemical interactions between solutes and the feldspar surface which is not captured by the water activity-based IN theory. A similar trend is present but less pronounced in case of kaolinite and mica, while quartz is barely affected. We hypothesize that the hydrogen bonding of NH3 molecules with surface -OH groups could be the reason for the enhanced freezing temperatures in dilute ammonia and ammonium containing solutions as they could form an ice-like overlayer providing hydrogen bonding groups for ice to nucleate on top of it. This implies to possibilities of enhanced IN efficiency, especially in mixed-phase cloud regime, of ammonium sulfate coated mineral dust particles in the condensation mode when the coating dilutes during cloud droplet activation.
Usuda, Kan; Ueno, Takaaki; Ito, Yuichi; Dote, Tomotaro; Yokoyama, Hirotaka; Kono, Koichi; Tamaki, Junko
2016-09-01
The present risk assessment study of fluoride salts was conducted by oral administration of three different doses of sodium and potassium fluorides (NaF, KF) and zinc fluoride tetrahydrate (ZnF2 •4H2O) to male Wistar rats. The rats were divided into control and nine experimental groups, to which oral injections of 0.5 mL distilled water and 0.5 mL of fluoride solutions, respectively, were given. The dosage of fluoride compounds was adjusted to contain 2.1 mg (low-dose group, LG), 4.3 mg (mid-dose group, MG), and 5.4 mg fluoride per 200 g rat body weight (high-dose group, HG) corresponding to 5, 10, and 12.5 % of LD50 values for NaF. The 24-h urine volume, N-acetyl-β-D-glucosaminidase (NAG) and creatinine clearance (Ccr) were measured as markers of possible acute renal impact. The levels of alanine aminotransferase (ALT) and aspartate aminotransferase (AST) were determined in serum samples as markers of acute hepatic impact. The levels of serum and urinary fluoride were determined to evaluate fluoride bioavailability. The results reveal that higher doses of NaF, KF, and ZnF2 induced renal damage as indicated by higher urinary NAG (p < 0.05 with ≥90th percentile of control). High doses of ZnF2 also induced a significant Ccr decrease (p < 0.05 with ≤10th percentile of control). Low doses of NaF and mid-doses of ZnF2 induced polyuria (p < 0.05 with ≥90th percentile of control) while medium doses of NaF and low doses of KF also induced liver damage, as indicated by a high level of AST (p < 0.05 with ≥90th percentile of control). These findings suggest that oral administration of fluoride is a potential, dose-dependent risk factor of renal tubular damage.
Hydroxylamine-dependent anaerobic ammonium oxidation (anammox) by "Candidatus Brocadia sinica".
Oshiki, Mamoru; Ali, Muhammad; Shinyako-Hata, Kaori; Satoh, Hisashi; Okabe, Satoshi
2016-09-01
Although metabolic pathways and associated enzymes of anaerobic ammonium oxidation (anammox) of 'Ca. Kuenenia stuttgartiensis' have been studied, those of other anammox bacteria are still poorly understood. NO2- reduction to NO is considered to be the first step in the anammox metabolism of 'Ca. K. stuttgartiensis', however, 'Ca. Brocadia' lacks the genes that encode canonical NO-forming nitrite reductases (NirS or NirK) in its genome, which is different from 'Ca. K. stuttgartiensis'. Here, we studied the anammox metabolism of 'Ca. Brocadia sinica'. (15) N-tracer experiments demonstrated that 'Ca. B. sinica' cells could reduce NO2- to NH2 OH, instead of NO, with as yet unidentified nitrite reductase(s). Furthermore, N2 H4 synthesis, downstream reaction of NO2- reduction, was investigated using a purified 'Ca. B. sinica' hydrazine synthase (Hzs) and intact cells. Both the 'Ca. B. sinica' Hzs and cells utilized NH2 OH and NH4+, but not NO and NH4+, for N2 H4 synthesis and further oxidized N2 H4 to N2 gas. Taken together, the metabolic pathway of 'Ca. B. sinica' is NH2 OH-dependent and different from the one of 'Ca. K. stuttgartiensis', indicating metabolic diversity of anammox bacteria. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
On the effectiveness of nitrogen oxide reductions as a control over ammonium nitrate aerosol
NASA Astrophysics Data System (ADS)
Pusede, S. E.; Duffey, K. C.; Shusterman, A. A.; Saleh, A.; Laughner, J. L.; Wooldridge, P. J.; Zhang, Q.; Parworth, C. L.; Kim, H.; Capps, S. L.; Valin, L. C.; Cappa, C. D.; Fried, A.; Walega, J.; Nowak, J. B.; Hoff, R. M.; Berkoff, T. A.; Beyersdorf, A. J.; Olson, J.; Crawford, J. H.; Cohen, R. C.
2015-10-01
Nitrogen oxides (NOx) have fallen steadily across the US over the last fifteen years. At the same time, due to patterns diesel truck activities, NOx concentrations decrease on weekends relative to weekdays, largely without co-occurring changes in other gas-phase emissions. These trends taken together provide two independent constraints on the role of NOx in the nonlinear chemistry of atmospheric oxidation. In this context, we interpret interannual trends in wintertime ammonium nitrate (NH4NO3) in the San Joaquin Valley of California, a location with the worst aerosol pollution in the US and where a large portion of aerosol mass is NH4NO3. Here, we show that NOx reductions have simultaneously decreased nighttime and increased daytime NH4NO3 production over the last decade. We find a substantial decrease in NH4NO3 since 2000 and conclude that this decrease is due to reduced nitrate radical-initiated production at night in residual layers that are decoupled from fresh emissions at the surface. Further reductions in NOx are imminent in California, and nationwide, and we make a quantitative prediction of the response of NH4NO3. We show that the combination of rapid chemical production and efficient NH4NO3 loss via deposition of gas-phase nitric acid implies high aerosol days in cities in the San Joaquin Valley air basin are responsive to local changes in NOx within those individual cities. Our calculations indicate that large decreases in NOx in the future will not only lower wintertime NH4NO3 concentrations, they will also cause a transition in the dominant NH4NO3 source from nighttime to daytime chemistry.
On the effectiveness of nitrogen oxide reductions as a control over ammonium nitrate aerosol
NASA Astrophysics Data System (ADS)
Pusede, S. E.; Duffey, K. C.; Shusterman, A. A.; Saleh, A.; Laughner, J. L.; Wooldridge, P. J.; Zhang, Q.; Parworth, C. L.; Kim, H.; Capps, S. L.; Valin, L. C.; Cappa, C. D.; Fried, A.; Walega, J.; Nowak, J. B.; Weinheimer, A. J.; Hoff, R. M.; Berkoff, T. A.; Beyersdorf, A. J.; Olson, J.; Crawford, J. H.; Cohen, R. C.
2016-03-01
Nitrogen oxides (NOx) have fallen steadily across the US over the last 15 years. At the same time, NOx concentrations decrease on weekends relative to weekdays, largely without co-occurring changes in other gas-phase emissions, due to patterns of diesel truck activities. These trends taken together provide two independent constraints on the role of NOx in the nonlinear chemistry of atmospheric oxidation. In this context, we interpret interannual trends in wintertime ammonium nitrate (NH4NO3) in the San Joaquin Valley of California, a location with the worst aerosol pollution in the US and where a large portion of aerosol mass is NH4NO3. Here, we show that NOx reductions have simultaneously decreased nighttime and increased daytime NH4NO3 production over the last decade. We find a substantial decrease in NH4NO3 since 2000 and conclude that this decrease is due to reduced nitrate radical-initiated production at night in residual layers that are decoupled from fresh emissions at the surface. Further reductions in NOx are imminent in California, and nationwide, and we make a quantitative prediction of the response of NH4NO3. We show that the combination of rapid chemical production and efficient NH4NO3 loss via deposition of gas-phase nitric acid implies that high aerosol days in cities in the San Joaquin Valley air basin are responsive to local changes in NOx within those individual cities. Our calculations indicate that large decreases in NOx in the future will not only lower wintertime NH4NO3 concentrations but also cause a transition in the dominant NH4NO3 source from nighttime to daytime chemistry.
Wang, Rui; Bai, Na; Xu, Shengjun; Zhuang, Guoqiang; Bai, Zhihui; Zhao, Zhirui; Zhuang, Xuliang
2018-03-01
Constructed wetlands (CWs) cultivated with Myriophyllum aquaticum showed great potential for total nitrogen (TN) removal from aquatic ecosystems in previous studies. To evaluate the growth characteristics, photosynthetic pigment content, and antioxidative responses of M. aquaticum, as well as its TN removal efficiency in CWs, M. aquaticum was treated with different levels of ammonium (NH 4 + ) and nitrate (NO 3 - ) for 28 days. The results indicated that M. aquaticum had strong nitrogen stress tolerance and was more likely to be suppressed by high levels of NH 4 + than NO 3 - . High levels of NH 4 + also led to inhibition of synthesis of photosynthetic pigments and increased peroxidase activity in plant leaves, which was not found in the NO 3 - treatments. High levels of both NH 4 + and NO 3 - generated obvious oxidative stress through elevation of malondialdehyde content while decreasing superoxide dismutase activity in the early stage. A sustainable increase of TN removal efficiency in most of the CWs indicated that M. aquaticum was a candidate species for treating wastewater with high levels of nitrogen because of its higher tolerance for NH 4 + and NO 3 - stress. However, the increase of TN removal efficiency was hindered in the late stage when treated with high levels of NH 4 + of 26 and 36 mmol/L, indicating that its tolerance to NH 4 + stress might have a threshold. The results of this study will enrich the studies on detoxification of high ammonium ion content in NH 4 + -tolerant submerged plants and supply valuable reference data for proper vegetation of M. aquaticum in CWs.
Spray deposition of highly transparent fluorine doped cadmium oxide thin films
NASA Astrophysics Data System (ADS)
Deokate, R. J.; Pawar, S. M.; Moholkar, A. V.; Sawant, V. S.; Pawar, C. A.; Bhosale, C. H.; Rajpure, K. Y.
2008-01-01
The cadmium oxide (CdO) and F:CdO films have been deposited by spray pyrolysis method using cadmium acetate and ammonium fluoride as precursors for Cd and F ions, respectively. The effect of temperature and F doping on the structural, morphological, optical and Hall effect properties of sprayed CdO thin films was investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), atomic force microscopy (AFM), optical absorption and electrical measurement techniques. TGA and DTA studies, indicates the formation of CdO by decomposition of cadmium acetate after 250 °C. XRD patterns reveal that samples are polycrystalline with cubic structure and exhibits (2 0 0) preferential orientation. Considerable broading of (2 0 0) peak, simultaneous shifting of corresponding Bragg's angle have been observed with respect to F doping level. SEM and AFM show the heterogeneous distribution of cubical grains all over the substrate, which are randomly distributed. F doping shifts the optical gap along with the increase in the transparency of CdO films. The Hall effect measurement indicates that the resistivity and mobility decrease up to 4% F doping.
Xu, Zhengtao; Mitzi, David B; Medeiros, David R
2003-03-10
The organic-inorganic hybrid [(CH(3))(3)NCH(2)CH(2)NH(3)]SnI(4) presents a layered perovskite structure, templated by an organic dication containing both a primary and a quaternary ammonium group. Due to the high charge density and small size of the organic cation, the separation of the perovskite layers is small and short iodine-iodine contacts of 4.19 A are formed between the layers. Optical thin-film measurements on this compound indicate a significant red shift of the exciton peak (630 nm) associated with the band gap, as compared with other SnI(4)(2)(-)-based layered perovskite structures.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Pei, Shi-Tu; Jiang, Shuai; Liu, Yi-Rong
2015-03-03
Although ammonium ion–water clusters are abundant in the biosphere, some information regarding these clusters, such as their growth route, the influence of temperature and humidity, and the concentrations of various hydrated clusters, is lacking. In this study, theoretical calculations are performed on ammonium ion–water clusters. These theoretical calculations are focused on determining the following characteristics: (1) the pattern of cluster growth; (2) the percentages of clusters of the same size at different temperatures and humidities; (3) the distributions of different isomers for the same size clusters at different temperatures; (4) the relative strengths of the noncovalent interactions for clusters ofmore » different sizes. The results suggest that the dipole moment may be very significant for the ammonium ion–water system, and some new stable isomers were found. The nucleation of ammonium ions and water molecules is favorable at low temperatures; thus, the clusters observed at high altitudes might not be present at low altitudes. High humidity can contribute to the formation of large ammonium ion–water clusters, whereas the formation of small clusters may be favorable under low-humidity conditions. The potential energy surfaces (PES) of these different sized clusters are complicated and differ according to the distribution of isomers at different temperatures. Some similar structures are observed between NH4+(H2O)n and M(H2O)n (where M represents an alkali metal ion or water molecule); when n = 8, the clusters begin to form the closed-cage geometry. As the cluster size increases, these interactions become progressively weaker. The successive binding energy at the DF-MP2-F12/VDZ-F12 level is better than that at the PW91PW91/6-311++G(3df, 3pd) level and is consistent with the experimentally determined values.« less
Pei, Shi-Tu; Jiang, Shuai; Liu, Yi-Rong; Huang, Teng; Xu, Kang-Ming; Wen, Hui; Zhu, Yu-Peng; Huang, Wei
2015-03-26
Although ammonium ion-water clusters are abundant in the biosphere, some information regarding these clusters, such as their growth route, the influence of temperature and humidity, and the concentrations of various hydrated clusters, is lacking. In this study, theoretical calculations are performed on ammonium ion-water clusters. These theoretical calculations are focused on determining the following characteristics: (1) the pattern of cluster growth; (2) the percentages of clusters of the same size at different temperatures and humidities; (3) the distributions of different isomers for the same size clusters at different temperatures; (4) the relative strengths of the noncovalent interactions for clusters of different sizes. The results suggest that the dipole moment may be very significant for the ammonium ion-water system, and some new stable isomers were found. The nucleation of ammonium ions and water molecules is favorable at low temperatures; thus, the clusters observed at high altitudes might not be present at low altitudes. High humidity can contribute to the formation of large ammonium ion-water clusters, whereas the formation of small clusters may be favorable under low-humidity conditions. The potential energy surfaces (PES) of these different sized clusters are complicated and differ according to the distribution of isomers at different temperatures. Some similar structures are observed between NH4(+)(H2O)n and M(H2O)n (where M represents an alkali metal ion or water molecule); when n = 8, the clusters begin to form the closed-cage geometry. As the cluster size increases, these interactions become progressively weaker. The successive binding energy at the DF-MP2-F12/VDZ-F12 level is better than that at the PW91PW91/6-311++G(3df, 3pd) level and is consistent with the experimentally determined values.
Rong, Yaoguang; Hou, Xiaomeng; Hu, Yue; Mei, Anyi; Liu, Linfeng; Wang, Ping; Han, Hongwei
2017-01-01
Organometal lead halide perovskites have been widely used as the light harvester for high-performance solar cells. However, typical perovskites of methylammonium lead halides (CH3NH3PbX3, X=Cl, Br, I) are usually sensitive to moisture in ambient air, and thus require an inert atmosphere to process. Here we demonstrate a moisture-induced transformation of perovskite crystals in a triple-layer scaffold of TiO2/ZrO2/Carbon to fabricate printable mesoscopic solar cells. An additive of ammonium chloride (NH4Cl) is employed to assist the crystallization of perovskite, wherein the formation and transition of intermediate CH3NH3X·NH4PbX3(H2O)2 (X=I or Cl) enables high-quality perovskite CH3NH3PbI3 crystals with preferential growth orientation. Correspondingly, the intrinsic perovskite devices based on CH3NH3PbI3 achieve an efficiency of 15.6% and a lifetime of over 130 days in ambient condition with 30% relative humidity. This ambient-processed printable perovskite solar cell provides a promising prospect for mass production, and will promote the development of perovskite-based photovoltaics. PMID:28240286
Dissolution of Uranium(IV) Oxide in Solutions of Ammonium Carbonate and Hydrogen Peroxide
DOE Office of Scientific and Technical Information (OSTI.GOV)
Smith, Steven C.; Peper, Shane M.; Douglas, Matthew
2009-09-12
Understanding the dissolution characteristics of uranium oxides is of fundamental scientific interest. Bench scale experiments were conducted to determine the optimal dissolution parameters of uranium(IV) oxide (UO2) powder in solutions of ammonium carbonate [(NH4)2CO3] and hydrogen peroxide (H2O2). Experimental parameters included variable peroxide and carbonate concentrations, and temperature. Results indicate the dissolution rate of UO2 in 1 M (NH4)2CO3 increases linearly with peroxide concentration ranging from 0.05 – 2 M (1:1 to 40:1 mol ratio H2O2:U), with no apparent maximum rate reached under the limited conditions used in our study. Temperature ranging studies show the dissolution rate of UO2 inmore » 1 M (NH4)2CO3 and 0.1 M H2O2 (2:1 mol ratio H2O2:U) increases linearly from 15 °C to 60 °C, again with no apparent maximum rate reached. Dissolution of UO2 in solutions with constant [H2O2] and [(NH4)2CO3] ranging from 0.5 to 2 M showed no difference in rate; however dissolution was significantly reduced in 0.05 M (NH4)2CO3 solution. The results of this study demonstrate the influence of [H2O2], [(NH4)2CO3], and temperature on the dissolution of UO2 in peroxide-containing (NH4)2CO3 solutions. Future studies are planned to elucidate the solution and solid state complexes in these systems.« less
NASA Astrophysics Data System (ADS)
Hansen, D. Flemming
2017-06-01
Many chemical and biological processes rely on the movement of monovalent cations and an understanding of such processes can therefore only be achieved by characterising the dynamics of the involved ions. It has recently been shown that 15N-ammonium can be used as a proxy for potassium to probe potassium binding in bio-molecules such as DNA quadruplexes and enzymes. Moreover, equations have been derived to describe the time-evolution of 15N-based spin density operator elements of 15NH4+ spin systems. Herein NMR pulse sequences are derived to select specific spin density matrix elements of the 15NH4+ spin system and to measure their longitudinal relaxation in order to characterise the rotational correlation time of the 15NH4+ ion as well as report on chemical exchange events of the 15NH4+ ion. Applications to 15NH4+ in acidic aqueous solutions are used to cross-validate the developed pulse sequence while measurements of spin-relaxation rates of 15NH4+ bound to a 41 kDa domain of the bacterial Hsp70 homologue DnaK are presented to show the general applicability of the derived pulse sequence. The rotational correlation time obtained for 15N-ammonium bound to DnaK is similar to the correlation time that describes the rotation about the threefold axis of a methyl group. The methodology presented here provides, together with the previous theoretical framework, an important step towards characterising the motional properties of cations in macromolecular systems.
Harris, Curtis; Dallas, Cham; Rollor, Edward; White, Catherine; Blount, Benjamin; Valentin-Blasini, Liza; Fisher, Jeffrey
2012-08-01
Radioactive iodide ((131)I-) protection studies have focused primarily on the thyroid gland and disturbances in the hypothalamic-pituitary-thyroid axis. The objective of the current study was to establish (131)I- urinary excretion profiles for saline, and the thyroid protectants, potassium iodide (KI) and ammonium perchlorate over a 75 hour time-course. Rats were administered (131)I- and 3 hours later dosed with either saline, 30 mg/kg of NH(4)ClO(4) or 30 mg/kg of KI. Urinalysis of the first 36 hours of the time-course revealed that NH(4)ClO(4) treated animals excreted significantly more (131)I- compared with KI and saline treatments. A second study followed the same protocol, but thyroxine (T(4)) was administered daily over a 3 day period. During the first 6-12 hour after (131)I- dosing, rats administered NH(4)ClO(4) excreted significantly more (131)I- than the other treatment groups. T(4) treatment resulted in increased retention of radioiodide in the thyroid gland 75 hour after (131)I- administration. We speculate that the T(4) treatment related reduction in serum TSH caused a decrease synthesis and secretion of thyroid hormones resulting in greater residual radioiodide in the thyroid gland. Our findings suggest that ammonium perchlorate treatment accelerates the elimination rate of radioiodide within the first 24 to 36 hours and thus may be more effective at reducing harmful exposure to (131)I- compared to KI treatment for repeated dosing situations. Repeated dosing studies are needed to compare the effectiveness of these treatments to reduce the radioactive iodide burden of the thyroid gland.
Atmospheric ammonia and its impacts on regional air quality over the megacity of Shanghai, China.
Wang, Shanshan; Nan, Jialiang; Shi, Chanzhen; Fu, Qingyan; Gao, Song; Wang, Dongfang; Cui, Huxiong; Saiz-Lopez, Alfonso; Zhou, Bin
2015-10-30
Atmospheric ammonia (NH3) has great environmental implications due to its important role in ecosystem and global nitrogen cycle, as well as contribution to secondary particle formation. Here, we report long-term continuous measurements of NH3 at different locations (i.e. urban, industrial and rural) in Shanghai, China, which provide an unprecedented portrait of temporal and spatial characteristics of atmospheric NH3 in and around this megacity. In addition to point emission sources, air masses originated from or that have passed over ammonia rich areas, e.g. rural and industrial sites, increase the observed NH3 concentrations inside the urban area of Shanghai. Remarkable high-frequency NH3 variations were measured at the industrial site, indicating instantaneous nearby industrial emission peaks. Additionally, we observed strong positive exponential correlations between NH4(+)/(NH4(+)+NH3) and sulfate-nitrate-ammonium (SNA) aerosols, PM2.5 mass concentrations, implying a considerable contribution of gas-to-particle conversion of ammonia to SNA aerosol formation. Lower temperature and higher humidity conditions were found to favor the conversion of gaseous ammonia to particle ammonium, particularly in autumn. Although NH3 is currently not included in China's emission control policies of air pollution precursors, our results highlight the urgency and importance of monitoring gaseous ammonia and improving its emission inventory in and around Shanghai.
Atmospheric ammonia and its impacts on regional air quality over the megacity of Shanghai, China
Wang, Shanshan; Nan, Jialiang; Shi, Chanzhen; Fu, Qingyan; Gao, Song; Wang, Dongfang; Cui, Huxiong; Saiz-Lopez, Alfonso; Zhou, Bin
2015-01-01
Atmospheric ammonia (NH3) has great environmental implications due to its important role in ecosystem and global nitrogen cycle, as well as contribution to secondary particle formation. Here, we report long-term continuous measurements of NH3 at different locations (i.e. urban, industrial and rural) in Shanghai, China, which provide an unprecedented portrait of temporal and spatial characteristics of atmospheric NH3 in and around this megacity. In addition to point emission sources, air masses originated from or that have passed over ammonia rich areas, e.g. rural and industrial sites, increase the observed NH3 concentrations inside the urban area of Shanghai. Remarkable high-frequency NH3 variations were measured at the industrial site, indicating instantaneous nearby industrial emission peaks. Additionally, we observed strong positive exponential correlations between NH4+/(NH4++NH3) and sulfate-nitrate-ammonium (SNA) aerosols, PM2.5 mass concentrations, implying a considerable contribution of gas-to-particle conversion of ammonia to SNA aerosol formation. Lower temperature and higher humidity conditions were found to favor the conversion of gaseous ammonia to particle ammonium, particularly in autumn. Although NH3 is currently not included in China’s emission control policies of air pollution precursors, our results highlight the urgency and importance of monitoring gaseous ammonia and improving its emission inventory in and around Shanghai. PMID:26514559
Dentifrices, mouthwashes, and remineralization/caries arrestment strategies
Zero, Domenick T
2006-01-01
While our knowledge of the dental caries process and its prevention has greatly advanced over the past fifty years, it is fair to state that the management of this disease at the level of the individual patient remains largely empirical. Recommendations for fluoride use by patients at different levels of caries risk are mainly based on the adage that more is better. There is a general understanding that the fluoride compound, concentration, frequency of use, duration of exposure, and method of delivery can influence fluoride efficacy. Two important factors are (1) the initial interaction of relatively high concentrations of fluoride with the tooth surface and plaque during application and (2) the retention of fluoride in oral fluids after application. Fluoride dentifrices remain the most widely used method of delivering topical fluoride. The efficacy of this approach in preventing dental caries is beyond dispute. However, the vast majority of currently marketed dentifrice products have not been clinically tested and have met only the minimal requirements of the FDA monograph using mainly laboratory testing and animal caries testing. Daily use of fluoride dental rinses as an adjunct to fluoride dentifrice has been shown to be clinically effective as has biweekly use of higher concentration fluoride rinses. The use of remineralizing agents (other than fluoride), directed at reversing or arresting non-cavitated lesions, remains a promising yet largely unproven strategy. High fluoride concentration compounds, e.g., AgF, Ag(NH3)2F, to arrest more advanced carious lesions with and without prior removal of carious tissue are being used in several countries as part of the Atraumatic Restorative Treatment (ART) approach. Most of the recent innovations in oral care products have been directed toward making cosmetic marketing claims. There continues to be a need for innovation and collaboration with other scientific disciplines to fully understand and prevent dental caries. PMID:16934126
Reconstructive phase transition in (NH4)3TiF7 accompanied by the ordering of TiF6 octahedra.
Molokeev, Maxim; Misjul, S V; Flerov, I N; Laptash, N M
2014-12-01
An unusual phase transition P4/mnc → Pa\\bar 3 has been detected after cooling the (NH4)3TiF7 compound. Some TiF6 octahedra, which are disordered in the room-temperature tetragonal structure, become ordered in the low-temperature cubic phase due to the disappearance of the fourfold axis. Other TiF6 octahedra undergo large rotations resulting in huge displacements of the F atoms by 1.5-1.8 Å that implies a reconstructive phase transition. It was supposed that phases P4/mbm and Pm\\bar 3m could be a high-temperature phase and a parent phase, respectively, in (NH4)3TiF7. Therefore, the sequence of phase transitions can be written as Pm\\bar 3m → P4/mbm → P4/mnc → Pa\\bar 3. The interrelation between (NH4)3TiF7, (NH4)3GeF7 and (NH4)3PbF7 is found, which allows us to suppose phase transitions in relative compounds.
Investigation of phase transitions in LiK 1- x(NH 4) xSO 4 mixed crystal
NASA Astrophysics Data System (ADS)
Freire, P. T. C.; Paraguassu, W.; Silva, A. P.; Pilla, O.; Teixeira, A. M. R.; Sasaki, J. M.; Mendes Filho, J.; Guedes, I.; Melo, F. E. A.
1999-02-01
We present Raman scattering results on LiK 1- x(NH 4) xSO 4 mixed crystal for temperatures between 100 and 300 K. We observed that in this temperature range the crystal undergoes two different phase transitions, which we call Bansal and Tomaszewski phase transitions. The introduction of ammonium ions in the potassium sites increases the C 66→C 3v4 (Bansal) phase transition temperature and decreases the Tomaszewski phase transition temperature. Finally, the most impressive effect of the presence of ammonium impurity in the LiKSO 4 structure is the decrease in the temperature hysteresis of Bansal phase transition and the almost complete destruction of hysteresis in the Tomaszewski phase transition, leading to a high temperature range of stability of the trigonal phase.
Bernadette C. Proemse; Bernhard Mayer; Mark E. Fenn; Christopher S. Ross
2013-01-01
Industrial nitrogen (N) emissions in the Athabasca oil sands region (AOSR), Alberta, Canada, affect nitrate (NO3) and ammonium (NH4) deposition rates in close vicinity of industrial emitters. NO3-N and NH4-N open field and throughfall deposition rates were determined at various...
Growth response of cottonwood roots to varied NH4:NO3 ratios in enriched patches
Walter T.M. Woolfolk; Alexander L. Friend
2003-01-01
Maximization of short-rotation forest plantation yields requires frequent applications of nutriends, especially nitrogen(N). Whole-plant growth is known to be sensitive to teh proportion of ammonium to nitrate (NH4:NO3). However, the extent to which N form affects root growth, branching and morphology is poorly understood...
Mössbauer effect of 151Eu in europium oxalate and fluorides
NASA Astrophysics Data System (ADS)
Wynter, C. I.; Oliver, F. W.; Davis, Alfred; Spijkerman, J. J.; Stadelmaier, H.; Wolfe, E. A.
1993-04-01
In a short communication [C.I. Wynter et al., Radiochimica Acta 55 (1991) 111.] we reported "relative broadening factors" of europium fluoride (EuF 3), europium oxide (Eu 2O 3), europium oxalate decahydrate (Eu 2(C 2O 4) 3.10H 2O and europium benzoate tetrahydrate Eu(C 6H 5COO) 3.4H 2O. Indications of the "relative broadening factor" of the oxalate compared to the fluoride suggested that the oxalate may indeed be a better host for the 21.6-keV gamma ray transition than the fluoride. In a continuing search for a better host matrix for this Mössbauer transition, we have prepared additionally a systematic series of fluorides, namely. EuF 3, NaEuF 4, Na 3EuF 6, and K 3EuF 6 to measure the linewidths and compute the "true" broadening factor using the natural linewidth of 151Eu as 1.31 {mm}/{s}.
Vanlerberghe, G C; Joy, K W; Turpin, D H
1991-02-01
We have determined the flow of (15)N into free amino acids of the N-limited green alga Selenastrum minutum (Naeg.) Collins after addition of (15)NH(4) (+) to aerobic or anaerobic cells. Under aerobic conditions, only a small proportion of the N assimilated was retained in the free amino acid pool. However, under anaerobic conditions almost all assimilated NH(4) (+) accumulates in alanine. This is a unique feature of anaerobic NH(4) (+) assimilation. The pathway of carbon flow to alanine results in the production of ATP and reductant which matches exactly the requirements of NH(4) (+) assimilation. Alanine synthesis is therefore an excellent strategy to maintain energy and redox balance during anaerobic NH(4) (+) assimilation.
Chen, C R; Phillips, I R; Wei, L L; Xu, Z H
2010-06-01
Australia is the largest producer of bauxite in the world, with an annual output of approximately 62 million metric dry tons in 2007. For every tonne of alumina, about 2 tonnes of highly alkaline and highly saline bauxite-processing residue are produced. In Western Australia, Alcoa World Alumina, Australia (Alcoa) produces approximately 15 MT of residue annually from its refineries (Kwinana, Pinjarra and Wagerup). The bauxite-processing residue sand (BRS) fraction represents the primary material for rehabilitating Alcoa's residue disposal areas (RDAs). However, the inherently hostile characteristics (high alkalinity, high salinity and poor nutrient availability) of BRS pose severe limitations for establishing sustainable plant cover systems. Alcoa currently applies 2.7 t ha(-1) of di-ammonium phosphate ((NH(4))(2)HPO(4); DAP)-based fertiliser as a part of rehabilitation of the outer residue sand embankments of its RDAs. Limited information on the behaviour of the dominant components of this inorganic fertiliser in highly alkaline BRS is currently available, despite the known effects of pH on ammonium (NH(4)) and phosphorus (P) behaviour. The aim of this study was to quantify the effects of pH on NH(3) volatilisation and residual nitrogen (N) in BRS following DAP applications. The sponge-trapping and KCl-extraction method was used for determining NH(3) volatilisation from surface-applied DAP in samples of BRS collected from each of Alcoa's three Western Australia Refineries (Kwinana, Pinjarra, Wagerup) under various pH conditions (pH 4, 7, 9 and 11). Following cessation of volatilisation, the residual N was extracted from BRS using 2 M KCl and concentrations of NH (4) (+) -N and NO (3) (-) -N were determined by flow injection analysis. The quantities of NH(3) volatilised increased dramatically as the pH increased from 4 to 11. Much of the N lost as NH(3) (up to 95.2%) occurred within a short period (24 h to 7 days), particularly for the pH 9 and 11 treatments. Concentrations of residual NH (4) (+) -N recovered in DAP-treated BRS at the end of the experiment decreased with increasing pH. This finding was consistent with increasing loss of N via volatilisation as pH increased. The concentration of NO (3) (-) -N was very low due to no nitrification in BRS. The pH was a key driver for NH(3) volatilisation from DAP-treated BRS and primarily controlled N dynamics in BRS. Results indicate that NH(4) not adsorbed by BRS was highly susceptible to volatilisation. The likely lack of nitrifying bacteria did not allow conversion of ammonium to nitrate, thereby further exacerbating the potential for loss via volatilisation It was demonstrated that the pH is the key factor controlling the loss of inorganic N from BRS. Although volatilisation was considerably lower at pH 4, achieving this pH reduction in the field is not possible at present. Findings from this study highlight the need to better understand which forms of N fertiliser are most suitable for use in highly alkaline BRS. Although pH reduction is the most likely means of stopping NH(3) volatilisation in BRS, it is economically and operationally unfeasible to add sufficient acidity for adequately lowering pH in the BRS for revegetation. More attention on forms of fertilisers more suitable to highly alkaline, microbially inert soil conditions appears to be warranted.
Fabrication and cytocompatibility of spherical magnesium ammonium phosphate granules.
Christel, Theresa; Geffers, Martha; Klammert, Uwe; Nies, Berthold; Höß, Andreas; Groll, Jürgen; Kübler, Alexander C; Gbureck, Uwe
2014-09-01
Magnesium phosphate compounds, as for example struvite (MgNH4PO4·6H2O), have comparable characteristics to calcium phosphate bone substitutes, but degrade faster under physiological conditions. In the present work, we used a struvite forming calcium doped magnesium phosphate cement with the formulation Ca0.75Mg2.25(PO4)2 and an ammonium phosphate containing aqueous solution to produce round-shaped granules. For the fabrication of spherical granules, the cement paste was dispersed in a lipophilic liquid and stabilized by surfactants. The granules were characterized with respect to morphology, size distribution, phase composition, compressive strength, biocompatibility and solubility. In general, it was seen that small granules can hardly be produced by means of emulsification, when the raw material is a hydraulic paste, because long setting times promote coalescence of initially small unhardened cement droplets. Here, this problem was solved by using an aqueous solution containing both the secondary (NH4)2HPO4 and primary ammonium phosphates NH4H2PO4 to accelerate the setting reaction. This resulted in granules with 97 wt.% having a size in the range between 200 and 1,000 μm. The novel solution composition doubled the compressive strength of the cement to 37 ± 5 MPa without affecting either the conversion to struvite or the cytocompatibility using human fetal osteoblasts. Copyright © 2014 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Vargeese, Anuj A.; Mija, S. J.; Muralidharan, Krishnamurthi
2014-07-01
Ammonium nitrate (AN) is crystallized along with copper oxide, titanium dioxide, and lithium fluoride. Thermal kinetic constants for the decomposition reaction of the samples were calculated by model-free (Friedman's differential and Vyzovkins nonlinear integral) and model-fitting (Coats-Redfern) methods. To determine the decomposition mechanisms, 12 solid-state mechanisms were tested using the Coats-Redfern method. The results of the Coats-Redfern method show that the decomposition mechanism for all samples is the contracting cylinder mechanism. The phase behavior of the obtained samples was evaluated by differential scanning calorimetry (DSC), and structural properties were determined by X-ray powder diffraction (XRPD). The results indicate that copper oxide modifies the phase transition behavior and can catalyze AN decomposition, whereas LiF inhibits AN decomposition, and TiO2 shows no influence on the rate of decomposition. Possible explanations for these results are discussed. Supplementary materials are available for this article. Go to the publisher's online edition of the Journal of Energetic Materials to view the free supplemental file.
NASA Astrophysics Data System (ADS)
Deppe, Marianna; Well, Reinhard; Giesemann, Anette; Flessa, Heinz
2016-04-01
High concentrations of ammonium as they occur, e.g., after point-injection of ammonium fertilizer solution according to the CULTAN fertilization technique may retard nitrification. Potential advantages in comparison to conventional fertilization include a higher N efficiency of crops, reduced nitrate leaching, and lower N2O and N2 emissions. Dynamics of nitrification due to plant uptake and dilution processes, leading to decreasing ammonium concentrations in fertilizer depots, has only poorly been studied before. Furthermore, there is little information about the relative contribution of different N2O production processes under these conditions. To elucidate the process dynamics a laboratory incubation study was conducted. After fertilization with ammonium sulfate at 5 levels (from 0 to 5000 mg NH4+-N kg-1; 20mg NO3--N kg-1 each), sandy loam soil was incubated in dynamic soil microcosms for 21 days. N2O, CH4 and CO2 fluxes as well as isotope signatures of N2O and, at three dates, NO3- and NH4+ were measured. To identify N2O production processes, acetylene inhibition (0.01 vol.%), 15N tracer approaches, and isotopomer data (15N site preference and δ18O) were used. N2O emissions were highest at 450mg NH4+-N kg-1 and declined with further increasing concentrations. At 5000 mg NH4+-N kg-1 nitrification was completely inhibited. However, approximately 90% of N2O production was inhibited by acetylene application, and there was no change in the relative contribution of nitrification and denitrification to N2O production with N level. Applying the non-equilibrium technique to our 15N tracer data revealed heterogeneous distribution of denitrification in soil, with at least two distinct NO3- pools, and spatial separation of NO3- formation and consumption. In comparison with the acetylene inhibition and 15N tracer approaches the results of the isotopomer approach were reasonable and indicated substantial contribution of nitrifier-denitrification (10-40%) to total N2O production.
Nanita, Sergio C; Padivitage, Nilusha L T
2013-03-20
A sample extraction and purification procedure that uses ammonium-salt-induced acetonitrile/water phase separation was developed and demonstrated to be compatible with the recently reported method for pesticide residue analysis based on fast extraction and dilution flow injection mass spectrometry (FED-FI-MS). The ammonium salts evaluated were chloride, acetate, formate, carbonate, and sulfate. A mixture of NaCl and MgSO4, salts used in the well-known QuEChERS method, was also tested for comparison. With thermal decomposition/evaporation temperature of <350°C, ammonium salts resulted in negligible ion source residual under typical electrospray conditions, leading to consistent method performance and less instrument cleaning. Although all ammonium salts tested induced acetonitrile/water phase separation, NH4Cl yielded the best performance, thus it was the preferred salting out agent. The NH4Cl salting out method was successfully coupled with FI/MS/MS and tested for fourteen pesticide active ingredients: chlorantraniliprole, cyantraniliprole, chlorimuron ethyl, oxamyl, methomyl, sulfometuron methyl, chlorsulfuron, triflusulfuron methyl, azimsulfuron, flupyrsulfuron methyl, aminocyclopyrachlor, aminocyclopyrachlor methyl, diuron and hexazinone. A validation study was conducted with nine complex matrices: sorghum, rice, grapefruit, canola, milk, eggs, beef, urine and blood plasma. The method is applicable to all analytes, except aminocyclopyrachlor. The method was deemed appropriate for quantitative analysis in 114 out of 126 analyte/matrix cases tested (applicability rate=0.90). The NH4Cl salting out extraction/cleanup allowed expansion of FI/MS/MS for analysis in food of plant and animal origin, and body fluids with increased ruggedness and sensitivity, while maintaining high-throughput (run time=30s/sample). Limits of quantitation (LOQs) of 0.01mgkg(-1) (ppm), the 'well-accepted standard' in pesticide residue analysis, were achieved in >80% of cases tested; while limits of detection (LODs) were typically in the range of 0.001-0.01mgkg(-1) (ppm). A comparison to a well-established HPLC/MS/MS method was also conducted, yielding comparable results, thus confirming the suitability of NH4Cl salting out FI/MS/MS for pesticide residue analysis. Copyright © 2013 Elsevier B.V. All rights reserved.
Liu, Yangxian; Wang, Qian
2014-10-21
In this article, a novel technique on removal of elemental mercury (Hg(0)) from flue gas by thermally activated ammonium persulfate ((NH4)(2)S(2)O(8)) has been developed for the first time. Some experiments were carried out in a bubble column reactor to evaluate the effects of process parameters on Hg(0) removal. The mechanism and kinetics of Hg(0) removal are also studied. The results show that the parameters, (NH4)(2)S(2)O(8) concentration, activation temperature and solution pH, have significant impacts on Hg(0) removal. The parameters, Hg(0), SO2 and NO concentration, only have small effects on Hg(0) removal. Hg(0) is removed by oxidations of (NH4)(2)S(2)O(8), sulfate and hydroxyl free radicals. When (NH4)(2)S(2)O(8) concentration is more than 0.1 mol/L and solution pH is lower than 9.71, Hg(0) removal by thermally activated (NH4)(2)S(2)O(8) meets a pseudo-first-order fast reaction with respect to Hg(0). However, when (NH4)(2)S(2)O(8) concentration is less than 0.1 mol/L or solution pH is higher than 9.71, the removal process meets a moderate speed reaction with respect to Hg(0). The above results indicate that this technique is a feasible method for emission control of Hg(0) from flue gas.
Recovery of ammonia from anaerobically digested manure using gas-permeable membranes
USDA-ARS?s Scientific Manuscript database
The gas-permeable membrane process can recover ammonia from wastewater with high nitrogen load, reducing pollution whilst converting ammonia into an ammonium salt fertilizer. The process involves manure pH control to increase ammonium (NH4) recovery rate that is normally carried out using an alkali....
NASA Astrophysics Data System (ADS)
Butler, T.; Vermeylen, F.; Lehmann, C. M.; Likens, G. E.; Puchalski, M.
2016-12-01
Data from bi-weekly passive samplers from 18 of the longest operating National Atmospheric Deposition Program's (NADP) Ammonia Monitoring Network (AMoN) sites (most operating from 2008 to 2015) show that concentrations of NH3 have been increasing (p-value < 0.0001) over large regions of the USA. This trend is occurring at a seasonal and annual level of aggregation. Using random coefficient models (RCM), the mean slope for the 18 sites combined shows an increase of NH3 concentration of +7% per year, with a 95% confidence interval (C.I.) from +5% to +9% per year. Travel blank corrected data using the same approach show increasing NH3 concentrations of +9% (95% C.I. +5% to +13%) per year. During a comparable period (2008-2014) NADP precipitation chemistry sites in the same regions show significant increasing (p-value = 0.0001) precipitation NH4+ concentrations trends for all sites combined of +5% (95% C.I. +3% to +7%) per year. Emissions inventory data for the study period show nearly constant rates of NH3 emissions, but large reductions in NOx and SO2 emissions. Seasonal air quality data from the Clean Air Status and Trends Network (CASTNET) sites in these regions show significant declines in atmospheric particulate SO42- and NH4+, and particulate NO3- plus HNO3 (total NO3-) during the same period. Less formation of acidic SO4 and NO3, due to reduced SO2 and NOx emissions, provide less substrate to interact with NH3 and form particulate ammonium species. Thus, concentrations of NH3 can increase in the atmosphere even if emissions remain constant. A likely result may be more localized deposition of NH3, as opposed to the more long-range transport and deposition of ammonium nitrate (NH4NO3) and sulfate (NH4)2SO4). Additionally, the spatial distribution of wet and dry acidic deposition will be impacted.
High-Pressure Synthesis and Characterization of the Ammonium Yttrium Borate (NH4)YB8O14.
Schmitt, Martin K; Podewitz, Maren; Liedl, Klaus R; Huppertz, Hubert
2017-11-20
The first high-pressure yttrium borate (NH 4 )YB 8 O 14 was synthesized at 12.8 GPa/1300 °C using a Walker-type multianvil module. The compound crystallizes in the orthorhombic space group Pnma (no. 62) with the lattice parameters a = 17.6375(9), b = 10.7160(5), and c = 4.2191(2) Å. (NH 4 )YB 8 O 14 constitutes a novel structure type but exhibits similarities to the crystal structure of β-BaB 4 O 7 . X-ray single-crystal and powder diffraction, EDX, vibrational spectroscopy as well as quantum chemical calculations were used to characterize (NH 4 )YB 8 O 14 .
Rattray, G.; Sievering, H.
2001-01-01
Micrometeorological measurements and ambient air samples, analyzed for concentrations of NH3, HNO3, NH4+, and NO3-, were collected at an alpine tundra site on Niwot Ridge, Colorado. The measured concentrations were extremely low and ranged between 5 and 70ngNm-3. Dry deposition fluxes of these atmospheric species were calculated using the micrometeorological gradient method. The calculated mean flux for NH3 indicates a net deposition to the surface and indicates that NH3 contributed significantly to the total N deposition to the tundra during the August-September measurement period. Our pre-measurement estimate of the compensation point for NH3 in air above the tundra was 100-200ngNm-3; thus, a net emission of NH3 was expected given the low ambient concentrations of NH3 observed. Based on our results, however, the NH3 compensation point at this alpine tundra site appears to have been at or below about 20ngNm-3. Large deposition velocities (>2cms-1) were determined for nitrate and ammonium and may result from reactions with surface-derived aerosols. Copyright (C) 2001 Elsevier Science B.V.Micrometeorological measurements and ambient air samples, analyzed for concentrations of NH3, HNO3, NH4+, and NO3-, were collected at an alpine tundra site on Niwot Ridge, Colorado. The measured concentrations were extremely low and ranged between 5 and 70 ng N m-3. Dry deposition fluxes of these atmospheric species were calculated using the micrometeorological gradient method. The calculated mean flux for NH3 indicates a net deposition to the surface and indicates that NH3 contributed significantly to the total N deposition to the tundra during the August-September measurement period. Our pre-measurement estimate of the compensation point for NH3 in air above the tundra was 100-200 ng N m-3; thus, a net emission of NH3 was expected given the low ambient concentrations of NH3 observed. Based on our results, however, the NH3 compensation point at this alpine tundra site appears to have been at or below about 20 ng N m-3. Large deposition velocities (>2 cm s-1) were determined for nitrate and ammonium and may result from reactions with surface-derived aerosols.
NASA Astrophysics Data System (ADS)
Yücel, Mete; Bayrak, Ahmet; Yücel, Esra Barlas; Ozben, Cenap S.
2018-02-01
Massive Ammonium Nitrate (NH4-NO3) based explosives buried underground are commonly used in terror attacks. These explosives can be detected using neutron scattering method with some limitations. Simulations are very useful tools for designing a possible detection system for these kind of explosives. Geant4 simulations were used for generating neutrons at 14 MeV energy and tracking them through the scattering off the explosive embedded in soil. Si-PIN photodiodes were used as detector elements in the design for their low costs and simplicity for signal readout electronics. Various neutron-charge particle converters were applied on to the surface of the photodiodes to increase the detection efficiency. Si-PIN photodiodes coated with 6LiF provided the best result for a certain energy interval. Energy depositions in silicon detector from all secondary particles generated including photons were taken into account to generate a realistic background. Humidity of soil, one of the most important parameter for limiting the detection, was also studied.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Araujo, Jose Adroalado de
1974-05-15
The paper deals with the ammonium diuranate continuous precipitation with a high chemical purity degree from uranyl nitrate solutions, using 1.2 and 2.4 ammonium hydroxide solutions and gaseous NH{sub 3} as a precipitating agent. The precipitations were carried out in a continuous procedure with one and two stages. The variables studied were the NH[sub 4}OH solutions concentration, ADU precipitation curve, the flow rate of reactants, the temperature of the precipitation, pH of the suspended ADU, and ammonium diuranate filtrability. The experimental work performed and the data obtained permitted the design of a chemical reactor for the continuous nuclear grade ADUmore » precipitation at the Chemical Engineering Department of the Atomic Energy Institute of Sao Paulo.« less
NASA Astrophysics Data System (ADS)
Parameswaran, V.; Nallamuthu, N.; Devendran, P.; Nagarajan, E. R.; Manikandan, A.
2017-06-01
Solid polymer blend electrolytes are widely studied due to their extensive applications particularly in electrochemical devices. Blending polymer makes the thermal stability, higher mechanical strength and inorganic salt provide ionic charge carrier to enhance the conductivity. In these studies, 50% polyvinyl alcohol (PVA), 50% poly (N-vinyl pyrrolidone) (PVP) and 2.5% L-Asparagine mixed with different ratio of the Ammonium bromide (NH4Br), have been synthesized using solution casting technique. The prepared PVA/PVP/L-Asparagine/doped-NH4Br polymer blend electrolyte films have been characterized by various analytical methods such as FT-IR, XRD, impedance spectroscopy, TG-DSC and scanning electron microscopy. FT-IR, XRD and TG/DSC analysis revealed the structural and thermal behavior of the complex formation between PVA/PVP/L-Asparagine/doped-NH4Br. The ionic conductivity and the dielectric properties of PVA/PVP/L-Asparagine/doped-NH4Br polymer blend electrolyte films were examined using impedance analysis. The highest ionic conductivity was found to be 2.34×10-4 S cm-1 for the m.wt. composition of 50%PVA:50%PVP:2.5%L-Asparagine:doped 0.15 g NH4Br at ambient temperature. Solid state proton battery is fabricated and the observed open circuit voltage is 1.1 V and its performance has been studied.
Xiong, Zhi-ting; Lu, Ping
2002-04-01
When EDTA was added alone in the Pb-contaminated sand, the plant biomass and the total Pb amount in Plant decreased in both species, Brassica pekinensis and B. juncea var. multiceps, though the shoot Pb amount increased. In contrast, when (NH4)2SO4 was added alone in the Pb-contaminated sand, little effect was observed on the shoot Pb amount, though the root Pb amount was significantly increased in B. juncea var. multiceps. When amending EDTA and (NH4)2SO4 in combination, however, the shoot Pb amount in both species substantially increased, being, on an average, 2 times and 9 times higher than that in EDTA alone or (NH4)2SO4 alone amended treatment, respectively. The two amendments showed antagonism for plant growth, but synergism for Pb bioaccumulation. B. pekinensis showed its highest level of shoot and total Pb amount in the treatment amended with EDTA and (NH4)2SO4 only a half as much as in the other treatments. It is inferred that the mechanisms responsible for the joint-enhanced Pb accumulation might be concerned with the acidification of the growth medium, cation exchange reaction and relieving EDTA induced toxicity as results by amending ammonium sulfate.
Effects of gaseous fluoride on Delicious and Golden Delicious apples
DOE Office of Scientific and Technical Information (OSTI.GOV)
Young, M.J.
1973-01-01
Atmospheric fluorides were monitored in apple and other fruit orchards around two adjacent sources of fluoride emissions. Delicious and Golden Delicious trees were fumigated with low (4.6-4.7 micrograms F/cu m) fluoride levels once, twice, or three times a week. However, both methods were adequate in the determination of the fluoride distribution pattern in the study area. Considerably higher levels of fluoride were detected at sampling sites downwind of the emission sources. Fluoride-induced tip necrosis on apple leaves was observed in one orchard where a mean seasonal limed filter paper value of 82.4 micrograms F/d sq m/mo and 22.5 F inmore » the washed foliage were recorded. Tip necrosis increased as the F level and frequency of exposure increased. Leaf respiration was inhibited at the lower but not the higher F fumigation level. Fruit respiration was stimulated to equal levels by the two F concentrations used. A trend toward increased inhibition of fruit ethylene production at lower exposure factors (concentration times time) was observed. The loss of green color in the skin of treated fruits was retarded relative to an increase in the F level and the exposure frequency. With the exception of leaf respiration, where an inverse relationship was found, the degree of response with respect to leaf injury, fruit respiration, and color were directly affected by the exposure factor used. Within the scope of this study, fruit shape, firmness, and soluble solids were not affected by the treatments.« less
Vohra, M S; Selimuzzaman, S M; Al-Suwaiyan, M S
2010-05-01
The main objective of the present study was to investigate the efficiency of titanium dioxide (TiO2) assisted photocatalytic degradation (PCD) process for the removal of ammonium-ammonia (NH4(+)-NH3) from the aqueous phase and in the presence of co-pollutants thiosulfate (S2O3(2-)) and p-cresol (C6H4CH3OH) under varying mixed conditions. For the NH4(+)-NH3 only PCD experiments, results showed higher NH4 -NH3 removal at pH 12 compared to pH 7 and 10. For the binary NH4(+)-NH3/S2O3(2-) studies the respective results indicated a significant lowering in NH4(+)-NH3 PCD in the presence of S2O32- at pH 7/12 whereas at pH 10 a marked increase in NH4(+)-NH3 removal transpired. A similar trend was noted for the p-cresol/NH4(+)-NH3 binary system. Comparing findings from the binary (NH4(+)-NH3/S2O3(2-) and p-cresol/NH4(+)-NH3) and tertiary (NH4(+)-NH3/S2O3(2-)/p-cresol) systems, at pH 10, showed fastest NH4(+)-NH3 removal transpiring for the tertiary system as compared to the binary systems, whereas both the binary systems indicated comparable NH4(+)-NH3 removal trends. The respective details have been discussed.
Swanner, Elizabeth D.; Templeton, Alexis S.
2011-01-01
The existence of life in the deep terrestrial subsurface is established, yet few studies have investigated the origin of nitrogen that supports deep life. Previously, 16S rRNA gene surveys cataloged a diverse microbial community in subsurface fluids draining from boreholes 3000 feet deep at Henderson Mine, CO, USA (Sahl et al., 2008). The prior characterization of the fluid chemistry and microbial community forms the basis for the further investigation here of the source of NH4+. The reported fluid chemistry included N2, NH4+ (5–112 μM), NO2− (27–48 μM), and NO3− (17–72 μM). In this study, the correlation between low NH4+ concentrations in dominantly meteoric fluids and higher NH4+ in rock-reacted fluids is used to hypothesize that NH4+ is sourced from NH4+-bearing biotite. However, biotite samples from the host rocks and ore-body minerals were analyzed by Fourier transform infrared (FTIR) microscopy and none-contained NH4+. However, the nitrogenase-encoding gene nifH was successfully amplified from DNA of the fluid sample with high NH4+, suggesting that subsurface microbes have the capability to fix N2. If so, unregulated nitrogen fixation may account for the relatively high NH4+ concentrations in the fluids. Additionally, the amoA and nxrB genes for archaeal ammonium monooxygenase and nitrite oxidoreductase, respectively, were amplified from the high NH4+ fluid DNA, while bacterial amoA genes were not. Putative nitrifying organisms are closely related to ammonium-oxidizing Crenarchaeota and nitrite-oxidizing Nitrospira detected in other subsurface sites based upon 16S rRNA sequence analysis. Thermodynamic calculations underscore the importance of NH4+ as an energy source in a subsurface nitrification pathway. These results suggest that the subsurface microbial community at Henderson is adapted to the low nutrient and energy environment by their capability of fixing nitrogen, and that fixed nitrogen may support subsurface biomass via nitrification. PMID:22190904
Methods to Stabilize and Destabilize Ammonium Borohydride
DOE Office of Scientific and Technical Information (OSTI.GOV)
Nielsen, Thomas K.; Karkamkar, Abhijeet J.; Bowden, Mark E.
2013-01-21
Ammonium borohydride, NH4BH4, has a high hydrogen content of ρm = 24.5 wt% H2 and releases 18 wt% H2 below T = 160 °C. However, the half-life of bulk NH4BH4 at ambient temperatures, ~6 h, is insufficient for practical applications. The decomposition of NH4BH4 (ABH2) was studied at variable hydrogen and argon back pressures to investigate possible pressure mediated stabilization effects. The hydrogen release rate from solid ABH2 at ambient temperatures is reduced by ~16 % upon increasing the hydrogen back pressure from 5 to 54 bar. Similar results were obtained using argon pressure and the observed stabilization may bemore » explained by a positive volume of activation in the transition state leading to hydrogen release. Nanoconfinement in mesoporous silica, MCM-41, was investigated as alternative means to stabilize NH4BH4. However, other factors appear to significantly destabilize NH4BH4 and it rapidly decomposes at ambient temperatures into [(NH3)2BH2][BH4] (DADB) in accordance with the bulk reaction scheme. The hydrogen desorption kinetics from nanoconfined [(NH3)2BH2][BH4] is moderately enhanced as evidenced by a reduction in the DSC decomposition peak temperature of ΔT = -13 °C as compared to the bulk material. Finally, we note a surprising result, storage of DADB at temperature < -30 °C transformed, reversibly, the [(NH3)2BH2][BH4] into a new low temperature polymorph as revealed by both XRD and solid state MAS 11B MAS NMR. TA & AK are thankful for support from the US Department of Energy, Office of Basic Energy Sciences, Division of Chemical Sciences, Geosciences & Biosciences. A portion of the research was performed using EMSL, a national scientific user facility sponsored by the Department of Energy's Office of Biological and Environmental Research and located at Pacific Northwest National Laboratory (PNNL). PNNL is operated by Battelle.« less
77 FR 50926 - Security Zones; Certain Dangerous Cargo Vessels, Tampa, FL
Federal Register 2010, 2011, 2012, 2013, 2014
2012-08-23
... Certain Dangerous Cargo (CDC) vessels, which are vessels carrying anhydrous ammonia, liquefied propane gas... Republican National Convention in Tampa, Florida. A CDC vessel is one carrying anhydrous ammonia, liquefied... vessel carrying Anhydrous Ammonia (NH3), Liquefied Petroleum Gas (LPG), or Ammonium Nitrate (NH4) and...
Effects of Sodium Citrate on the Ammonium Sulfate Recycled Leaching of Low-Grade Zinc Oxide Ores
NASA Astrophysics Data System (ADS)
Yang, Kun; Li, Shi-wei; Zhang, Li-bo; Peng, Jin-hui; Ma, Ai-yuan; Wang, Bao-bao
2016-03-01
The effects of sodium citrate on ammonium sulfate recycled leaching of low-grade zinc oxide ores were studied. By applying various kinds of detection and analysis techniques such as chemical composition analysis, chemical phase method, scanning electron microscopy and energy dispersive spectrum (SEM/EDS), X-ray diffraction (XRD) and Fourier-transforming infrared spectrum (FT-IR), zinc raw ore, its leaching slag and the functional mechanism of sodium citrate were investigated. Based on a comprehensive analysis, it can be concluded that in contrast to hemimorphite (Zn4Si2O7(OH)2 · H2O), amorphous smithsonite (ZnCO3) and zinc silicate (Zn2SiO4) prove to be refractory phases under ammonium sulfate leaching, while sodium citrate has a better chelating action with the refractory phases, resulting in a higher zinc leaching rate. Under conditions of [NH3]/[NH3]T molar ratio being 0.5, [NH3]T being 7.5 mol/L, [Na3C6H5O7] being 0.2 mol/L, S/L ratio being 1:5, temperature being 303 K, holding time being 1 h in each of the two stages, and stirring rate being 300 rpm, the leaching rate of zinc reached 93.4%. In this article, sulfate ammonium recycled technology also reveals its unique advantage in processing low-grade zinc oxide ores accompanied by high silicon and high alkaline gangue.
Nitrogen forms and levels influence on growth and nutrition of cacao
USDA-ARS?s Scientific Manuscript database
Ammonium and nitrate are the major forms of N present in tropical soils. A climatically controlled growth chamber experiment was conducted to assess the influence of forms (NO3-, NH4+, and mix of NO3- + NH4+) and levels (1.5 to 12.0 mM) of N on the growth and nutrition of cacao (Theobroma cacao L). ...
Characterization of chitosan-starch blend based biopolymer electrolyte doped with ammonium nitrate
NASA Astrophysics Data System (ADS)
Shaffie, Ahmad Hakimi; Khiar, Azwani Sofia Ahmad
2018-06-01
Polymer electrolyte is an ionic conductor formed by dissolving salt in polymer host. In this work, starch/chitosan blend based polymer electrolyte was prepared with different weight percentage of Ammonium Nitrate (NH4NO3) via solution casting technique. The film was characterized by impedance spectroscopy HIOKI 3531- 01 LCR Hi-Tester to measure its ionic conductivity over a wide range of frequency between 50Hz-5MHz and at ambient temperature. Sample with 35 wt% of NH4NO3 shows the highest conductivity of (6.34 ± 1.52) = 10-7 Scm-1. X-ray diffraction (XRD) and Fourier transform infrared (FTIR) spectroscopy were used to correlate the ionic conductivity results.
NASA Astrophysics Data System (ADS)
Zhou, Junhong; Zhang, Wei; Yang, Jun; Jiang, Benzheng; Chen, Weiming
2016-05-01
In order to explore the interaction mechanism between 2,2-Bis (ethylferrocenyl) propane (GFP) and ammonium perchlorate (AP) at low temperature (below 250 °C), all the possible intermolecular interactions between GFP and AP were calculated. The calculations were performed in single molecule, cluster and slab models. The calculation results show that the interactions between GFP and AP at low temperature mainly come from GFP:-H+ and GFP-NH4+ pair interactions. We speculate that the interaction mechanism between GFP and AP at low temperature is that GFP/H+ or GFP/NH4+ interactions cause GFP to be protonated, and then protonated GFP is to further oxidized.
Norman, M; Twetman, S; Hultgren Talvilahti, A; Granström, E; Stecksén-Blicks, C
2017-03-01
To assess the urinary fluoride excretion in preschool children after drinking fluoridated milk with 0.185 mg F and 0.375 mg F and to study the impact of use of fluoride toothpaste. Double-blind cross-over study. Nine healthy children, 2.5-4.5 years of age. In a randomized order, participants drank 1.5 dl milk once daily for 7 days with no fluoride added (control), 0.185 mg fluoride added and 0.375 mg fluoride added. The experiment was performed twice with (Part I) and without (Part II) parental tooth brushing with 1,000 ppm fluoride toothpaste. The fluoride content in the piped drinking water was 0.5 mg F/L. Urinary fluoride excretion. The 24-hour urinary fl uoride excretion/kg body weight varied from 0.014 mg F for the placebo intervention and non-fluoride toothpaste to 0.027 mg F for the 0.375 mg intervention with use of 1,000 ppm fluoride toothpaste. The difference compared with the placebo intervention was not statistically significant for any of the interventions when fluoride toothpaste was used (p⟩0.05) while it was statistically significantly different when non-fluoride toothpaste was used (p⟨0.05). All sources of fluoride must be considered when designing community programs. With 0.5 mg F/L in the drinking water and daily use of fluoride toothpaste, most children had a fluoride intake optimal for dental health. In this setting, additional intake of fluoride milk was within safe limits up to 0.185 mg/day while conclusions about the safety of 0.375 mg/day were uncertain. Copyright© 2017 Dennis Barber Ltd
NASA Astrophysics Data System (ADS)
Howard, C. M.; Wood, I. G.; Fortes, A. D.; Vocadlo, L.
2016-12-01
BackgroundInteractions between simple molecules are of fundamental interest across diverse areas of the physical sciences, and the ternary system NH3 + CO2 ± H2O is no exception. In the outer solar system, interaction of CO2 with aqueous ammonia is likely to occur, synthesizing `rock-forming' minerals [1], with CO2 perhaps playing a role in ammonia-water oceans and cryomagmas inside icy planetary bodies - the discovery of ammonium carbonates in a crater of Pluto's moon Charon [2] adds weight to CO2 occuring in these planetary environments. In the same context, ammonium carbonates may have some astrobiological relevance, since removal of water leads to the formation of urea. On Earth, combination of CO2 with aqueous ammonia has relevance to carbon capture schemes [3], and there is interest in using such materials for hydrogen storage in fuel cells [4]. Consequently, from earthly matters of climate change to the study of extraterrestrial ices, understanding the structures and properties of ammonium carbonates are important. Despite this, our knowledge of ammonium carbonates is limited under ambient conditions of pressure and temperature and is entirely absent at the higher pressures, severely limiting our ability to model the behaviour of NH3 + CO2 ± H2O solids and fluids in planetary environments. ResultsWe report the results of several experiments using variable pressure and temperature neutron diffraction work on ammonium carbonate monohydrate, ammonium bicarbonate and ammonium carbamate, with complementary Density Functional Theory (DFT) calculations. The excellent agreement between experiments and DFT calculations obtained so far adds weight to the accuracy of calculated material properties of ammonium sesquicarbonate monohydrate and several polymorphs of urea where little empirical data exists. These experimental and computational studies provide the structural, thermoelastic and vibrational information required for accurate planetary modelling and remote identification of these material on planetary surfaces. [1] Kargel (1991) Icarus 94 , 368-390. [2] De Sanctis et al. (2016) Nature Letters, 1-4. [3] Han et al. (2013) Int. J. Greenhouse Gas Control 14 , 270-281. [4] Lan et al. (2012) Int. J. Hydrogen Energy 37 (2), 1482-1494.
Effects of Feedstock and Pyrolysis Temperature on Biochar Adsorption of Ammonium and Nitrate
Gai, Xiapu; Wang, Hongyuan; Liu, Jian; Zhai, Limei; Liu, Shen; Ren, Tianzhi; Liu, Hongbin
2014-01-01
Biochar produced by pyrolysis of biomass can be used to counter nitrogen (N) pollution. The present study investigated the effects of feedstock and temperature on characteristics of biochars and their adsorption ability for ammonium N (NH4 +-N) and nitrate N (NO3 −-N). Twelve biochars were produced from wheat-straw (W-BC), corn-straw (C-BC) and peanut-shell (P-BC) at pyrolysis temperatures of 400, 500, 600 and 700°C. Biochar physical and chemical properties were determined and the biochars were used for N sorption experiments. The results showed that biochar yield and contents of N, hydrogen and oxygen decreased as pyrolysis temperature increased from 400°C to 700°C, whereas contents of ash, pH and carbon increased with greater pyrolysis temperature. All biochars could sorb substantial amounts of NH4 +-N, and the sorption characteristics were well fitted to the Freundlich isotherm model. The ability of biochars to adsorb NH4 +-N followed: C-BC>P-BC>W-BC, and the adsorption amount decreased with higher pyrolysis temperature. The ability of C-BC to sorb NH4 +-N was the highest because it had the largest cation exchange capacity (CEC) among all biochars (e.g., C-BC400 with a CEC of 38.3 cmol kg−1 adsorbed 2.3 mg NH4 +-N g−1 in solutions with 50 mg NH4 + L−1). Compared with NH4 +-N, none of NO3 −-N was adsorbed to biochars at different NO3 − concentrations. Instead, some NO3 −-N was even released from the biochar materials. We conclude that biochars can be used under conditions where NH4 +-N (or NH3) pollution is a concern, but further research is needed in terms of applying biochars to reduce NO3 −-N pollution. PMID:25469875
Effects of feedstock and pyrolysis temperature on biochar adsorption of ammonium and nitrate.
Gai, Xiapu; Wang, Hongyuan; Liu, Jian; Zhai, Limei; Liu, Shen; Ren, Tianzhi; Liu, Hongbin
2014-01-01
Biochar produced by pyrolysis of biomass can be used to counter nitrogen (N) pollution. The present study investigated the effects of feedstock and temperature on characteristics of biochars and their adsorption ability for ammonium N (NH4(+)-N) and nitrate N (NO3(-)-N). Twelve biochars were produced from wheat-straw (W-BC), corn-straw (C-BC) and peanut-shell (P-BC) at pyrolysis temperatures of 400, 500, 600 and 700°C. Biochar physical and chemical properties were determined and the biochars were used for N sorption experiments. The results showed that biochar yield and contents of N, hydrogen and oxygen decreased as pyrolysis temperature increased from 400°C to 700°C, whereas contents of ash, pH and carbon increased with greater pyrolysis temperature. All biochars could sorb substantial amounts of NH4(+)-N, and the sorption characteristics were well fitted to the Freundlich isotherm model. The ability of biochars to adsorb NH4(+)-N followed: C-BC>P-BC>W-BC, and the adsorption amount decreased with higher pyrolysis temperature. The ability of C-BC to sorb NH4(+)-N was the highest because it had the largest cation exchange capacity (CEC) among all biochars (e.g., C-BC400 with a CEC of 38.3 cmol kg(-1) adsorbed 2.3 mg NH4(+)-N g(-1) in solutions with 50 mg NH4(+) L(-1)). Compared with NH4(+)-N, none of NO3(-)-N was adsorbed to biochars at different NO3(-) concentrations. Instead, some NO3(-)-N was even released from the biochar materials. We conclude that biochars can be used under conditions where NH4(+)-N (or NH3) pollution is a concern, but further research is needed in terms of applying biochars to reduce NO3(-)-N pollution.
40 CFR 471.65 - Pretreatment standards for new sources (PSNS).
Code of Federal Regulations, 2013 CFR
2013-07-01
....205 0.098 Zinc 0.713 0.298 Ammonia 65.1 28.6 Fluoride 29.1 12.9 (c) Drawing spent neat oils—subpart F... Zinc 0.105 0.044 Ammonia 9.59 4.22 Fluoride 4.28 1.90 (f) Extrusion press hydraulic fluid leakage... Ammonia 23.7 10.5 Fluoride 10.6 4.70 (g) Forging spent lubricants—subpart F—PSNS. There shall be no...
40 CFR 471.65 - Pretreatment standards for new sources (PSNS).
Code of Federal Regulations, 2012 CFR
2012-07-01
....205 0.098 Zinc 0.713 0.298 Ammonia 65.1 28.6 Fluoride 29.1 12.9 (c) Drawing spent neat oils—subpart F... Zinc 0.105 0.044 Ammonia 9.59 4.22 Fluoride 4.28 1.90 (f) Extrusion press hydraulic fluid leakage... Ammonia 23.7 10.5 Fluoride 10.6 4.70 (g) Forging spent lubricants—subpart F—PSNS. There shall be no...
40 CFR 471.65 - Pretreatment standards for new sources (PSNS).
Code of Federal Regulations, 2014 CFR
2014-07-01
....205 0.098 Zinc 0.713 0.298 Ammonia 65.1 28.6 Fluoride 29.1 12.9 (c) Drawing spent neat oils—subpart F... Zinc 0.105 0.044 Ammonia 9.59 4.22 Fluoride 4.28 1.90 (f) Extrusion press hydraulic fluid leakage... Ammonia 23.7 10.5 Fluoride 10.6 4.70 (g) Forging spent lubricants—subpart F—PSNS. There shall be no...
Vieira-Filho, Marcelo S; Ito, Debora T; Pedrotti, Jairo J; Coelho, Lúcia H G; Fornaro, Adalgiza
2016-10-01
Ammonia is a key alkaline species, playing an important role by neutralizing atmospheric acidity and inorganic secondary aerosol production. On the other hand, the NH3/NH4 (+) increases the acidity and eutrophication in natural ecosystems, being NH3 classified as toxic atmospheric pollutant. The present study aims to give a better comprehension of the nitrogen content species distribution in fine and coarse particulate matter (PM2.5 and PM2.5-10) and to quantify ammonia vehicular emissions from an urban vehicular tunnel experiment in the metropolitan area of São Paulo (MASP). MASP is the largest megacity in South America, with over 20 million inhabitants spread over 2000 km(2) of urbanized area, which faces serious environmental problems. The PM2.5 and PM2.5-10 median mass concentrations were 44.5 and 66.6 μg m(-3), respectively, during weekdays. In the PM2.5, sulfate showed the highest concentration, 3.27 ± 1.76 μg m(-3), followed by ammonium, 1.14 ± 0.71 μg m(-3), and nitrate, 0.80 ± 0.52 μg m(-3). Likewise, the dominance (30 % of total PM2.5) of solid species, mainly the ammonium salts, NH4HSO4, (NH4)2SO4, and NH4NO3, resulted from simulation of inorganic species. The ISORROPIA simulation was relevant to show the importance of environment conditions for the ammonium phase distribution (solid/aqueous), which was solely aqueous at outside and almost entirely solid at inside tunnel. Regarding gaseous ammonia concentrations, the value measured inside the tunnel (46.5 ± 17.5 μg m(-3)) was 3-fold higher than that outside (15.2 ± 11.3 μg m(-3)). The NH3 vehicular emission factor (EF) estimated by carbon balance for urban tunnel was 44 ± 22 mg km(-1). From this EF value and considering the MASP traffic characteristics, it was possible to estimate more than 7 Gg NH3 year(-1) emissions that along with NOx are likely to cause rather serious problems to natural ecosystems in the region.
Li, Dejun
2013-01-01
Cropland soil is an important source of atmospheric nitric oxide (NO) and ammonia (NH3). Chinese croplands are characterized by intensive management, but limited information is available with regard to NO emissions from croplands in China and NH3 emissions in south China. In this study, a mesocosm experiment was conducted to measure NO and NH3 emissions from a typical vegetable-land soil in the Pearl River Delta following the applications of 150 kg N ha−1 as urea, ammonium nitrate (AN) and ammonium bicarbonate (ABC), respectively. Over the sampling period after fertilization (72 days for NO and 39 days for NH3), mean NO fluxes (± standard error of three replicates) in the control and urea, AN and ABC fertilized mesocosms were 10.9±0.9, 73.1±2.9, 63.9±1.8 and 66.0±4.0 ng N m−2 s−1, respectively; mean NH3 fluxes were 8.9±0.2, 493.6±4.4, 144.8±0.1 and 684.7±8.4 ng N m−2 s−1, respectively. The fertilizer-induced NO emission factors for urea, AN and ABC were 2.6±0.1%, 2.2±0.1% and 2.3±0.2%, respectively. The fertilizer-induced NH3 emission factors for the three fertilizers were 10.9±0.2%, 3.1±0.1% and 15.2±0.4%, respectively. From the perspective of air quality protection, it would be better to increase the proportion of AN application due to its lower emission factors for both NO and NH3. PMID:23527173
Li, Dejun
2013-01-01
Cropland soil is an important source of atmospheric nitric oxide (NO) and ammonia (NH3). Chinese croplands are characterized by intensive management, but limited information is available with regard to NO emissions from croplands in China and NH3 emissions in south China. In this study, a mesocosm experiment was conducted to measure NO and NH3 emissions from a typical vegetable-land soil in the Pearl River Delta following the applications of 150 kg N ha(-1) as urea, ammonium nitrate (AN) and ammonium bicarbonate (ABC), respectively. Over the sampling period after fertilization (72 days for NO and 39 days for NH3), mean NO fluxes (± standard error of three replicates) in the control and urea, AN and ABC fertilized mesocosms were 10.9±0.9, 73.1±2.9, 63.9±1.8 and 66.0±4.0 ng N m(-2) s(-1), respectively; mean NH3 fluxes were 8.9±0.2, 493.6±4.4, 144.8±0.1 and 684.7±8.4 ng N m(-2) s(-1), respectively. The fertilizer-induced NO emission factors for urea, AN and ABC were 2.6±0.1%, 2.2±0.1% and 2.3±0.2%, respectively. The fertilizer-induced NH3 emission factors for the three fertilizers were 10.9±0.2%, 3.1±0.1% and 15.2±0.4%, respectively. From the perspective of air quality protection, it would be better to increase the proportion of AN application due to its lower emission factors for both NO and NH3.
Recovery of gold from waste electrical and electronic equipment (WEEE) using ammonium persulfate.
Alzate, Andrea; López, Maria Esperanza; Serna, Claudia
2016-11-01
This paper presents a novel methodology to recover gold from waste electrical and electronic equipment (WEEE) using ammonium persulfate ((NH 4 ) 2 S 2 O 8 ). Gold was recovered as a fine coating using substrate oxidation without shredding or grinding process. The WEEE sample was characterized giving values of Au: 1.05g/kg, Fe: 86.00g/kg, Ni: 73.64g/kg, Cu: 26.65g/kg. The effect of (NH 4 ) 2 S 2 O 8 concentration (0.22-1.10M), oxygen (0.0-1.4L/min) and L/S ratio (10-30mL/g) on the main responses (substrate oxidation and Au recovery) was investigated implementing response surface methodology with numerical optimization. A quadratic model was developed and quantities greater than 98% of Au were recovered. The findings presented suggest that, optimized quantities of ammonium persulfate in aqueous highly oxygenated media could be used to extract superficial gold from WEEE. Copyright © 2016 Elsevier Ltd. All rights reserved.
Recovery of valuable metals from waste diamond cutters through ammonia-ammonium sulfate leaching
NASA Astrophysics Data System (ADS)
Xue, Ping; Li, Guang-qiang; Yang, Yong-xiang; Qin, Qin-wei; Wei, Ming-xing
2017-12-01
Copper and zinc were recovered from waste diamond cutters through leaching with an ammonia-ammonium sulfate system and air as an oxidant. The effects of experimental parameters on the leaching process were investigated, and the potential-pH ( E-pH) diagrams of Cu-NH3-SO4 2--H2O and Zn-NH3-SO4 2--H2O at 25°C were drawn. Results showed that the optimal parameters for the leaching reaction are as follows: reaction temperature, 45°C; leaching duration, 3 h; liquid-to-solid ratio, 50:1 (mL/g); stirring speed, 200 r/min; ammonia concentration, 4.0 mol/L; ammonium sulfate concentration, 1.0 mol/L; and air flow rate, 0.2 L/min. The results of the kinetics study indicated that the leaching is controlled by the surface chemical reaction at temperatures below 35°C, and the leaching is controlled by diffusion through the product layer at temperatures above 35°C.
SEASONAL NH 3 EMISSIONS FOR ANNUAL 2001 CMAQ SIMULATION: INVERSE MODEL ESTIMATION AND EVALUATION
The formation of ammonium nitrate aerosols is often limited by ammonia (NH3), and sulfate aerosols are predominantly in the form of ammonium sulfate. While NH3plays a central role in the prediction of nitrate and sulfate aerosols, inherent uncertainty exist...
Zhao, Yafei; Zhang, Bing; Zhang, Xiang; Wang, Jinhua; Liu, Jindun; Chen, Rongfeng
2010-06-15
Well-ordered cubic NaA zeolite was first synthesized using natural halloysite mineral with nanotubular structure as source material by hydro-thermal method. SEM and HRTEM images indicate that the synthesized NaA zeolite is cubic-shaped crystal with planar surface, well-defined edges and symmetrical and uniform pore channels. The adsorption behavior of ammonium ions (NH(4)(+)) from aqueous solution onto NaA zeolite was investigated as a function of parameters such as equilibrium time, pH, initial NH(4)(+) concentration, temperature and competitive cations. The Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms. A maximum adsorption capacity of 44.3 mg g(-1) of NH(4)(+) was achieved. The regeneration and reusable ability of this adsorbent was evaluated, and the results indicated that the recovered adsorbent could be used again for NH(4)(+) removal with nearly constant adsorption capacity. Thermodynamic parameters such as change in free energy (DeltaG(0)), enthalpy (DeltaH(0)) and entropy (DeltaS(0)) were also determined, which indicated that the adsorption was a spontaneous and exothermic process at ambient conditions. Compared with other adsorbents, the as-synthesized NaA zeolite displays a faster adsorption rate and higher adsorption capacity, which implies potential application for removing NH(4)(+) pollutants from wastewaters. Copyright 2010 Elsevier B.V. All rights reserved.
PROTOPLASMIC POTENTIALS IN HALICYSTIS
Blinks, L. R.
1933-01-01
The nature and origin of the large "protoplasmic" potential in Halicystis must be studied by altering conditions, not only in external solutions, but in the sap and the protoplasm itself. Such interior alteration caused by the penetration of ammonia is described. Concentrations of NH4Cl in the sea water were varied from 0.00001 M to above 0.01 M. At pH 8.1 there is little effect below 0.0005 M NH4Cl. At about 0.001 M a sudden reversal of the potential difference across the protoplasm occurs, from about 68 mv. outside positive to 30 to 40 mv. outside negative. At this threshold value the time curve is characteristically S-shaped, with a slow beginning, a rapid reversal, and then an irregularly wavering negative value. There are characteristic cusps at the first application of the NH4Cl, also immediately after the reversal. The application of higher NH4Cl concentrations causes a more rapid reversal, and also a somewhat higher negative value. Conversely the reduction of NH4Cl concentrations causes recovery of the normal positive potential, but the threshold for recovery is at a lower concentration than for the original reversal. A temporary overshooting or increase of the positive potential usually occurs on recovery. The reversals may be repeated many times on the same cell without injury. The plot of P.D. against the log of ammonium ion concentration is not the straight line characteristic of ionic concentration effects, but has a break of 100 mv. or more at the threshold value. Further evidence that the potential is not greatly influenced by ammonium ions is obtained by altering the pH of the sea water. At pH 5, no reversal occurs with 0.1 M NH4Cl, while at pH 10.3, the NH4Cl threshold is 0.0001 M or less. This indicates that the reversal is due to undissociated ammonia. The penetration of NH3 into the cells increases both the internal ammonia and the pH. The actual concentration of ammonium salt in the sap is again shown to have little effect on the P.D. The pH is therefore the governing factor. But assuming that NH3 enters the cells until it is in equilibrium between sap and sea water, no sudden break of pH should occur, pH being instead directly proportional to log NH3 for any constant (NH4) concentration. Experimentally, a linear relation is found between the pH of the sap and the log NH3 in sea water. The sudden change of P.D. must therefore be ascribed to some system in the cell upon which the pH change operates. The pH value of the sap at the NH3 threshold is between 6.0 and 6.5 which corresponds well with the pH value found to cause reversal of P.D. by direct perfusion of solutions in the vacuole. PMID:19872757
Sun, Zilong; Nie, Qingli; Zhang, Lianjie; Niu, Ruiyan; Wang, Jundong; Wang, Shaolin
2017-02-01
Previous investigations have demonstrated the adverse impacts of fluoride on Sertoli cells (SCs), such as oxidative stress and apoptosis. SCs are the crucial cellular components that can create the immune privileged environment in testis. However, the effect of fluoride on SCs immune privilege is unknown. In this study, mouse SCs were exposed to sodium fluoride with varying concentrations of 10 -5 , 10 -4 , and 10 -3 mol/L to establish the model of fluoride-treated SCs (F-SCs) in vitro. After 48 h of incubation, F-SCs were transplanted underneath the kidney capsule of mice for 21 days, or cocultured with spleen lymphocytes for another 48 h. Immunohistochemical analysis of GATA4 in SCs grafts underneath kidney capsule presented less SCs distribution and obvious immune cell infiltration in F-SCs groups. In addition, the levels of FasL protein and mRNA in non-cocultured F-SCs decreased with the increase of fluoride concentration. When cocultured with F-SCs, lymphocytes presented significantly high cell viability and low apoptosis in F-SCs groups. Protein and mRNA expressions of FasL in cocultured F-SCs and Fas in lymphocytes were reduced, and the caspase 8 and caspase 3 mRNA levels were also decreased in fluoride groups in a dose-dependent manner. These findings indicated that fluoride influenced the testicular immune privilege through disturbing the Fas/FasL system. Copyright © 2016 Elsevier Ltd. All rights reserved.
Development of fluorapatite cement for dental enamel defects repair.
Wei, Jie; Wang, Jiecheng; Shan, Wenpeng; Liu, Xiaochen; Ma, Jian; Liu, Changsheng; Fang, Jing; Wei, Shicheng
2011-06-01
In order to restore the badly carious lesion of human dental enamel, a crystalline paste of fluoride substituted apatite cement was synthesized by using the mixture of tetracalcium phosphate (TTCP), dicalcium phosphate anhydrous (DCPA) and ammonium fluoride. The apatite cement paste could be directly filled into the enamel defects (cavities) to repair damaged dental enamel. The results indicated that the hardened cement was fluorapatite [Ca(10)(PO(4))(6)F(2), FA] with calcium to phosphorus atom molar ratio (Ca/P) of 1.67 and Ca/F ratio of 5. The solubility of FA cement in Tris-HCl solution (pH = 5) was slightly lower than the natural enamel, indicating the FA cement was much insensitive to the weakly acidic solutions. The FA cement was tightly combined with the enamel surface, and there was no obvious difference of the hardness between the FA cement and natural enamel. The extracts of FA cement caused no cytotoxicity on L929 cells, which satisfied the relevant criterion on dental biomaterials, revealing good cytocompatibility. In addition, the results showed that the FA cement had good mechanical strength, hydrophilicity, and anti-bacterial adhesion properties. The study suggested that using FA cement was simple and promising approach to effectively and conveniently restore enamel defects.
Recovery of ammonia from swine manure using gas-permeable membranes: Effect of aeration
USDA-ARS?s Scientific Manuscript database
Gas-permeable membranes can recover ammonia from manure, reducing pollution whilst converting ammonia into ammonium salt fertilizer. The process involves manure pH control to increase ammonium (NH4) recovery rate that is normally carried out using an alkali. In this study a new strategy to avoid the...
Yun, Jung-Ho; Ng, Yun Hau; Ye, Changhui; Mozer, Attila J; Wallace, Gordon G; Amal, Rose
2011-05-01
This work reports the use of sodium fluoride (in ethylene glycol electrolyte) as the replacement of hydrofluoric acid and ammonium fluoride to fabricate long and perpendicularly well-aligned TiO₂ nanotube (TNT) (up to 21 μm) using anodization. Anodizing duration, applied voltage and electrolyte composition influenced the geometry and surface morphologies of TNT. The growth mechanism of TNT is interpreted by analyzing the current transient profile and the total charge density generated during anodization. The system with low water content (2 wt %) yielded a membrane-like mesoporous TiO₂ film, whereas high anodizing voltage (70 V) resulted in the unstable film of TNT arrays. An optimized condition using 5 wt % water content and 60 V of anodizing voltage gave a stable array of nanotube with controllable length and pore diameter. Upon photoexcitation, TNTs synthesized under this condition exhibited a slower charge recombination rate as nanotube length increased. When made into cis-diisothiocyanato-bis(2,2̀-bipyridyl-4,4̀-dicarboxylato) ruthenium(II) bis (tetrabutyl-ammonium)(N719) dye-sensitized solar cells, good device efficiency at 3.33 % based on the optimized TNT arrays was achieved with longer electron time compared with most mesoporous TiO₂ films.
Yuan, Haiping; Xu, Changwen; Zhu, Nanwen
2014-10-01
Magnesium ammonium phosphate (MAP) precipitation was introduced to remove ammonium nitrogen (NH4(+)-N) in autothermal thermophilic aerobic digestion (ATAD) in this study by addition of MgCl2 · 6H2O and NaH2PO4 · 2H2O. The results showed that the lowest NH4(+)-N concentration was found in the D2 digester after 2nd day dosing treatment and 38.12% of VS removal efficiency was obtained after 15 days ATAD treatment. Sludge stabilization was achieved in the D2 digester 6 days earlier than the non-dosing digester when 8.7 g/L MgCl2 · 6H2O and 6.7 g/L NaH2PO4 · 2H2O were added into the digester. Furthermore, the highest VS removal efficiency of 40.03% was observed after 21 days digestion in D2 digesters. Therefore, MAP precipitation was an effective method for the ammonium nitrogen disinhibition when 8.7 g/L MgCl2 · 6H2O and 6.7 g/L NaH2PO4 · 2H2O were added into on the 2nd day after the digester startup. Copyright © 2014 Elsevier Ltd. All rights reserved.
NASA Technical Reports Server (NTRS)
Goyal, S. S.; Rains, D. W.; Huffaker, R. C.
1988-01-01
A fast, sensitive, simple, and highly reproducible method for routine assay of ammonium ion (NH4+) was developed by using HPLC equipment. The method is based on the reaction of NH4+ with o-phthalaldehyde (OPA) in the presence of 2-mercaptoethanol. After an on-line derivatization, the resulting NH4(+)-OPA product was quantified by using fluorometric or spectrophotometric detection. For fluorometric detection, the excitation and emission wavelengths were 410 and 470 nm, respectively. The spectrophotometric detection was made by measuring absorbance at 410 nm. Results on the effects of OPA-reagent composition and pH, reaction temperature, sample matrix, and linearity of the assay are presented. Even though it took about 2 min from the time of sample injection to the appearance of sample peak, sample injections could be overlapped at an interval of about 1 min. Thus, the actual time needed for analysis was about 1 min per assay. The method can be used in a fully automated mode by using an autosampler injector.
NASA Astrophysics Data System (ADS)
Yurtseven, H.; Kavruk, D.
In this study, we calculate the Raman frequencies as a function of temperature for the fixed pressures of 706, 1080 and 6355 bars using the volume data for phase II of ammonium iodide. The Raman frequencies calculated here are for the translational optic ν5 TOM (125 cm-1) lattice mode that is located at the zone boundary (M point) of the Brillouin zone of phase II for NH4I. For this calculation the volume data obtained at zero pressure, is used through the mode Grüneisen parameter for the disordered phase II (β phase) which has the CsCl structure of NH4I. Our predicted frequencies of the ν5 TOM (125 cm-1) mode can be compared when the Raman data for this lattice mode is available at various temperatures for fixed pressures of 706, 1080 and 6355 bars in the disordered phase II of ammonium iodide.
Hessini, Kamel; Kronzucker, Herbert J; Abdelly, Chedly; Cruz, Cristina
2017-06-01
The C 4 grass Spartina alterniflora is known for its unique salt tolerance and strong preference for ammonium (NH 4 + ) as a nitrogen (N) source. We here examined whether Spartina's unique preference for NH 4 + results in improved performance under drought stress. Manipulative greenhouse experiments were carried out to measure the effects of variable water availability and inorganic N sources on plant performance (growth, photosynthesis, antioxidant, and N metabolism). Drought strongly reduced leaf number and area, plant fresh and dry weight, and photosynthetic activity on all N sources, but the reduction was most pronounced on NH 4 + . Indeed, the growth advantage seen on NH 4 + in the absence of drought, producing nearly double the biomass compared to growth on NO 3 - , was entirely obliterated under both intermediate and severe drought conditions (50 and 25% field capacity, respectively). Both fresh and dry weight became indistinguishable among N sources under drought. Major markers of the antioxidant capacity of the plant, the activities of the enzymes superoxide dismutase, catalase, ascorbate peroxidase, and glutathione reductase, showed higher constitutive levels on NH 4 + . Catalase and glutathione reductase were specifically upregulated in NH 4 + -fed plants with increasing drought stress. This upregulation, however, failed to protect the plants from drought stress. Nitrogen metabolism was characterized by lower constitutive levels of glutamine synthetase in NH 4 + -fed plants, and a rise in glutamate dehydrogenase (GDH) activity under drought, accompanied by elevated proline levels in leaves. Our results support postulates on the important role of GDH induction, and its involvement in the synthesis of compatible solutes, under abiotic stress. We show that, despite this metabolic shift, S. alterniflora's sensitivity to drought does not benefit from growth on NH 4 + and that the imposition of drought stress equalizes all N-source-related growth differences observed under non-drought conditions. Copyright © 2017 Elsevier GmbH. All rights reserved.
A three-dimensional model of the global ammonia cycle
NASA Astrophysics Data System (ADS)
Dentener, Frank J.; Crutzen, Paul J.
1994-11-01
Using a three-dimensional (3-D) transport model of the troposphere, we calculated the global distributions of ammonia (NH3) and ammonium (NH4(+)), taking into account removal of NH3 on acidic aerosols, in liquid water clouds and by reaction with OH. Our estimated global 10 deg x 10 deg NH3 emission inventory of 45 Tg N-NH3/yr provides a reasonable agreement between calculated wet NH4(+) deposition and measurements and of measured and modeled NH4(+) in aerosols, although in Africa and Asia especially discrepancies exist. NH3 emissions from natural continental ecosystems were calculated applying a canopy compensation point and oceanic NH3 emissions were related to those of DMS (dimethylsulfide). In many regions of the earth, the pH found in rain and cloud water can be attributed to acidity derived from NO, SO2 and DMS emissions and alkalinity from NH3. In the remote lower troposphere, sulfate aerosols are calculated to be almost neutralized to ammonium sulfate (NH4)2SO4, whereas in the middle and upper troposphere, according to our calculations, the aerosol should be more acidic, as a result of the oxidation of DMS and SO2 throughout the troposphere and removal of NH3 on acidic aerosols at lower heights. Although the removal of NH3 by reaction with the OH radical is relatively slow, the intermediate NH2 radical can provide a substantial annual N2O source of 0.9(+0.9/-0.4) Tg, thus contributing by about 5% to estimated global N2O production. The oxidation by OH of NH3 from anthropogenic sources accounts for 10% of the estimated total anthropogenic sources of N2O. This source was not accounted for in previous studies, and is mainly located in the tropics, which have high NH3 and OH concentrations. Biomass burning plumes, containing high NO(x) and NH3 concentrations provide favorable conditions for gas phase N2O production. This source is probably underestimated in this model study, due to the coarse resolution of the 3-D model, and the rather low biomass burning NH3 and NO(x) emissions adopted. The estimate depends heavily on poorly known concentrations of NH3 (and NO(x)) in the tropics, and uncertainties in the rate constants of the reactions NH2 + NO2 yields N2O + H2O (R4), and NH2 + O3 yields NH2O + O2(R7).
Oxidation of ammonia and methane in an alkaline, saline lake
Joye, S.B.; Connell, T.L.; Miller, L.G.; Oremland, R.S.; Jellison, R.S.
1999-01-01
The oxidation of ammonia (NH3) and methane (CH4) was investigated in an alkaline saline lake, Mono Lake, California (U.S.A.). Ammonia oxidation was examined in April and July 1995 by comparing dark 14CO2 fixation rates in the presence or absence of methyl fluoride (MeF), an inhibitor of NH3 oxidation. Ammonia oxidizer-mediated dark 14CO2 fixation rates were similar in surface (5-7 m) and oxycline (11-15 m) waters, ranging between 70-340 and 89-186 nM d-1, respectively, or 1-7% of primary production by phytoplankton. Ammonia oxidation rates ranged between 580-2,830 nM d-1 in surface waters and 732-1,548 nM d-1 in oxycline waters. Methane oxidation was examined using a 14CH4 tracer technique in July 1994, April 1995, and July 1995. Methane oxidation rates were consistently higher in July, and rates in oxycline and anaerobic bottom waters (0.5-37 and 7-48 nM d-1, respectively) were 10-fold higher than those in aerobic surface waters (0.04-3.8 nM d-1). The majority of CH4 oxidation, in terms of integrated activity, occurred within anoxic bottom waters. Water column oxidation reduced the potential lake-atmosphere CH4 flux by a factor of two to three. Measured oxidation rates and water column concentrations were used to estimate the biological turnover times of NH3 and CH4. The NH3 pool turns over rapidly, on time scales of 0.8 d in surface waters and 10 d within the oxycline, while CH4 is cycled on 103-d time scales in surface waters and 102-d time scales within oxycline and bottom waters. Our data suggest an important role for NH3 oxidation in alkaline, saline lakes since the process converts volatile NH3 to soluble NO2-, thereby reducing loss via lake-atmosphere exchange and maintaining nitrogen in a form that is readily available to phytoplankton.
Combined Tin-Containing Fluoride Solution and CO2 Laser Treatment Reduces Enamel Erosion in vitro.
Esteves-Oliveira, Marcella; Witulski, Nadine; Hilgers, Ralf-Dieter; Apel, Christian; Meyer-Lueckel, Hendrik; Eduardo, Carlos de Paula
2015-01-01
The aim of this in vitro study was to evaluate the effect of combined CO2 laser and tin-containing fluoride treatment on the formation and progression of enamel erosive lesions. Ninety-six human enamel samples were obtained, stored in thymol solution and, after surface polishing, randomly divided into 6 different surface treatment groups (n = 16 in each group) as follows: no treatment, control (C); one CO2 laser irradiation (L1); two CO2 laser irradiations (L2); daily application of fluoride solution (F); combined daily fluoride solution + one CO2 laser irradiation (L1F), and combined daily fluoride solution + two CO2 laser irradiations (L2F). Laser irradiation was performed at 0.3 J/cm2 (5 µs/226 Hz/10.6 µm) on day 1 (L1) and day 6 (L2). The fluoride solution contained AmF/NaF (500 ppm F), and SnCl2 (800 ppm Sn) at pH 4.5. After surface treatment the samples were submitted to an erosive cycling over 10 days, including immersion in citric acid (2 min/0.05 M/pH = 2.3) 6 times daily and storage in remineralization solution (≥1 h) between erosive attacks. At the end of each cycling day, the enamel surface loss (micrometers) was measured using a 3D laser profilometer. Data were statistically analyzed by means of a 2-level mixed effects model and linear contrasts (α = 0.05). Group F (-3.3 ± 2.0 µm) showed significantly lower enamel surface loss than groups C (-27.22 ± 4.1 µm), L1 (-18.3 ± 4.4 µm) and L2 (-16.3 ± 5.3 µm) but higher than L1F (-1.0 ± 4.4 µm) and L2F (1.4 ± 3.2 µm, p < 0.05). Under the conditions of this in vitro study, the tin-containing fluoride solution caused 88% reduction of enamel surface loss, while its combination with CO2 laser irradiation at 0.3 J/cm2 hampered erosive loss almost completely. © 2015 S. Karger AG, Basel.
Pérez-Delgado, Carmen M.; García-Calderón, Margarita; Márquez, Antonio J.; Betti, Marco
2015-01-01
It is well established that the plastidic isoform of glutamine synthetase (GS2) is the enzyme in charge of photorespiratory ammonium reassimilation in plants. The metabolic events associated to photorespiratory NH4 + accumulation were analyzed in a Lotus japonicus photorespiratory mutant lacking GS2. The mutant plants accumulated high levels of NH4 + when photorespiration was active, followed by a sudden drop in the levels of this compound. In this paper it was examined the possible existence of enzymatic pathways alternative to GS2 that could account for this decline in the photorespiratory ammonium. Induction of genes encoding for cytosolic glutamine synthetase (GS1), glutamate dehydrogenase (GDH) and asparagine synthetase (ASN) was observed in the mutant in correspondence with the diminishment of NH4 +. Measurements of gene expression, polypeptide levels, enzyme activity and metabolite levels were carried out in leaf samples from WT and mutant plants after different periods of time under active photorespiratory conditions. In the case of asparagine synthetase it was not possible to determine enzyme activity and polypeptide content; however, an increased asparagine content in parallel with the induction of ASN gene expression was detected in the mutant plants. This increase in asparagine levels took place concomitantly with an increase in glutamine due to the induction of cytosolic GS1 in the mutant, thus revealing a major role of cytosolic GS1 in the reassimilation and detoxification of photorespiratory NH4 + when the plastidic GS2 isoform is lacking. Moreover, a diminishment in glutamate levels was observed, that may be explained by the induction of NAD(H)-dependent GDH activity. PMID:26091523
Sequence of phase transitions in (NH4)3SiF7.
Mel'nikova, S V; Molokeev, M S; Laptash, N M; Pogoreltsev, E I; Misyul, S V; Flerov, I N
2017-02-21
Single crystals of silicon double salt (NH 4 ) 3 SiF 7 = (NH 4 ) 2 SiF 6 ·NH 4 F = (NH 4 ) 3 [SiF 6 ]F were grown and studied by the methods of polarization optics, X-ray diffraction and calorimetry. A sequence of symmetry transformations with the temperature change was established: P4/mbm (Z = 2) (G 1 ) ↔ Pbam (Z = 4) (G 2 ) ↔ P2 1 /c (Z = 4) (G 3 ) ↔ P1[combining macron] (Z = 4) (G 4 ) ↔ P2 1 /c (Z = 8) (G 5 ). Crystal structures of different phases were determined. The experimental data were also interpreted by a group-theoretical analysis of the complete condensate of order parameters taking into account critical and noncritical atomic displacements. Strengthening of the N-HF hydrogen bonds can be a driving force of the observed phase transitions.
NASA Technical Reports Server (NTRS)
Downing, H. D.; Pinkley, L. W.; Sethna, P. P.; Williams, D.
1977-01-01
The infrared spectral reflectance at near normal incidence has been measured for 3.2 M, 2.4 M, and 1.6 M solutions of ammonium sulfate, an aerosol abundant in the stratosphere and also present in the troposphere. Kramers-Kronig analysis was used to determine values of the refractive and absorption indices from the measured spectral reflectance. A synthetic spectrum of crystalline ammonium sulfate was obtained by extrapolation of the absorption index obtained for the solution to the absorber number densities of the NH4 and SO4 ions characteristic of the crystal.
Investigation of ionic conduction in PEO-PVDF based blend polymer electrolytes
NASA Astrophysics Data System (ADS)
Patla, Subir Kumar; Ray, Ruma; Asokan, K.; Karmakar, Sanat
2018-03-01
We investigate the effect of blend host polymer on solid polymer electrolyte (SPE) films doped with ammonium iodide (NH4I) salt using a variety of experimental techniques. Structural studies on the composite SPEs show that the blending of Poly(ethylene oxide) (PEO)-Poly(vinylidene fluoride) (PVDF) polymers in a suitable ratio enhances the amorphous fraction of the polymer matrix and facilitates fast ion conduction through it. We observe that the addition of a small amount of PVDF in the PEO host polymer enhances the ion - polymer interaction leading to more ion dissociation. As a result, the effective number of mobile charge carriers within the polymer matrix increases. Systematic investigation in these blend SPEs shows that the maximum conductivity (1.01 × 10-3 S/cm) is obtained for PEO - rich (80 wt. % PEO, 20 wt. % PVDF) composites at 35 wt. % NH4I concentration at room temperature. Interestingly, at higher salt concentrations (above 35 wt. %), the conductivity is found to decrease in this system. The reduction of conductivity at higher salt concentrations is the consequence of decrease in the carrier concentration due to the formation of an ion pair and ion aggregates. PVDF-rich compositions (20 wt. % PEO and 80 wt. % PVDF), on the other hand, show a very complex porous microstructure. We also observe a much lower ionic conductivity (maximum ˜ 10-6 S/cm at 15 wt. % salt) in these composite systems relative to PEO-rich composites.
ESR spectra of NSO/sub 4//sup 2 -/ in (NH/sub 4/)/sub 2/SO/sub 4/
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bailey, C.E.
1981-03-01
The slow decay of NH/sub 3//sup +/ and NH/sub 2//sup +/ centers in ammonium sulfate produce a new, very stable, paramagnetic center that has been identified as NSO/sub 4//sup 2 -/. This center has g values of g/sub x/ = 2.012, g/sub y/ = 2.011, and g/sub z/ = 2.007 with the corresponding hfi constants A/sub x/ = A/sub y/ = 0.0 and A/sub z/ = 25.2 G. No change in this center is observed on passage of the crystal through the ferroelectric phase transition.
Fluoride loaded polymeric nanoparticles for dental delivery.
Nguyen, Sanko; Escudero, Carlos; Sediqi, Nadia; Smistad, Gro; Hiorth, Marianne
2017-06-15
The overall aim of the present paper was to develop fluoride loaded nanoparticles based on the biopolymers chitosan, pectin, and alginate, for use in dental delivery. First, the preparation of nanoparticles in the presence of sodium fluoride (NaF) as the active ingredient by ionic gelation was investigated followed by an evaluation of their drug entrapment and release properties. Chitosan formed stable, spherical, and monodisperse nanoparticles in the presence of NaF and tripolyphoshate as the crosslinker, whereas alginate and pectin were not able to form any definite nanostructures in similar conditions. The fluoride loading capacity was found to be 33-113ppm, and the entrapment efficiency 3.6-6.2% for chitosan nanoparticles prepared in 0.2-0.4% (w/w) NaF, respectively. A steady increase in the fluoride release was observed for chitosan nanoparticles prepared in 0.2% NaF both in pH5 and 7 until it reached a maximum at time point 4h and maintained at this level for at least 24h. Similar profiles were observed for formulations prepared in 0.4% NaF; however the fluoride was released at a higher level at pH5. The low concentration, but continuous delivery of fluoride from the chitosan nanoparticles, with possible expedited release in acidic environment, makes these formulations highly promising as dental delivery systems in the protection against caries development. Copyright © 2017 Elsevier B.V. All rights reserved.
High-pressure synthesis and characterization of the first cerium fluoride borate CeB{sub 2}O{sub 4}F
DOE Office of Scientific and Technical Information (OSTI.GOV)
Hinteregger, Ernst; Wurst, Klaus; Tribus, Martina
2013-08-15
CeB{sub 2}O{sub 4}F is the first cerium fluoride borate, which is exclusively built up of one-dimensional, infinite chains of condensed trigonal-planar [BO{sub 3}]{sup 3−} groups. This new cerium fluoride borate was synthesized under high-pressure/high-temperature conditions of 0.9 GPa and 1450 °C in a Walker-type multianvil apparatus. The compound crystallizes in the orthorhombic space group Pbca (No. 61) with eight formula units and the lattice parameters a=821.63(5), b=1257.50(9), c=726.71(6) pm, V=750.84(9) Å{sup 3}, R{sub 1}=0.0698, and wR{sub 2}=0.0682 (all data). The structure exhibits a 9+1 coordinated cerium ion, one three-fold coordinated fluoride ion and a one-dimensional chain of [BO{sub 3}]{sup 3−}more » groups. Furthermore, IR spectroscopy, Electron Micro Probe Analysis and temperature-dependent X-ray powder diffraction measurements were performed. - Graphical abstract: A new rare-earth fluoride borate CeB{sub 2}O{sub 4}F could be synthesized under high-pressure/high-temperature conditions of 0.9 °GPa and 1450 °Cin a Walker-type multianvil apparatus. The crystal structure represents a new structure type in the class of rare-earth fluoride borates. The structure exhibits a 9+1 coordinated cerium ion, one three-fold coordinated fluoride ion and a one-dimensional chain of [BO{sub 3}]{sup 3−} groups. A closer view on the ac-plane shows an interesting wave-like modulation of the borate chains. Highlights: • CeB{sub 2}O{sub 4}F is the first fluoride borate exclusively built up of one-dimensional, infinite chains of condensed trigonal-planar [BO{sub 3}]{sup 3−} groups. • CeB{sub 2}O{sub 4}F is the first cerium fluoride borate. • High-pressure conditions were necessary to synthesize CeB{sub 2}O{sub 4}F.« less
The kinetics for ammonium and nitrite oxidation under the effect of hydroxylamine.
Wan, Xinyu; Xiao, Pengying; Zhang, Daijun; Lu, Peili; Yao, Zongbao; He, Qiang
2016-01-01
The kinetics for ammonium (NH4(+)) oxidation and nitrite (NO2(-)) oxidation under the effect of hydroxylamine (NH2OH) were studied by respirometry using the nitrifying sludge from a laboratory-scale sequencing batch reactor. Modified models were used to estimate kinetics parameters of ammonia and nitrite oxidation under the effect of hydroxylamine. An inhibition effect of hydroxylamine on the ammonia oxidation was observed under different hydroxylamine concentration levels. The self-inhibition coefficient of hydroxylamine oxidation and noncompetitive inhibition coefficient of hydroxylamine for nitrite oxidation was estimated by simulating exogenous oxygen-uptake rate profiles, respectively. The inhibitive effect of NH2OH on nitrite-oxidizing bacteria was stronger than on ammonia-oxidizing bacteria. This work could provide fundamental data for the kinetic investigation of the nitrification process.
Thermal and X-ray diffraction analysis studies during the decomposition of ammonium uranyl nitrate.
Kim, B H; Lee, Y B; Prelas, M A; Ghosh, T K
Two types of ammonium uranyl nitrate (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O and NH 4 UO 2 (NO 3 ) 3 , were thermally decomposed and reduced in a TG-DTA unit in nitrogen, air, and hydrogen atmospheres. Various intermediate phases produced by the thermal decomposition and reduction process were investigated by an X-ray diffraction analysis and a TG/DTA analysis. Both (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O and NH 4 UO 2 (NO 3 ) 3 decomposed to amorphous UO 3 regardless of the atmosphere used. The amorphous UO 3 from (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O was crystallized to γ-UO 3 regardless of the atmosphere used without a change in weight. The amorphous UO 3 obtained from decomposition of NH 4 UO 2 (NO 3 ) 3 was crystallized to α-UO 3 under a nitrogen and air atmosphere, and to β-UO 3 under a hydrogen atmosphere without a change in weight. Under each atmosphere, the reaction paths of (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O and NH 4 UO 2 (NO 3 ) 3 were as follows: under a nitrogen atmosphere: (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 ·H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 → NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → γ-UO 3 → U 3 O 8 , NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → α-UO 3 → U 3 O 8 ; under an air atmosphere: (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 ·H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 → NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → γ-UO 3 → U 3 O 8 , NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → α-UO 3 → U 3 O 8 ; and under a hydrogen atmosphere: (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 ·H 2 O → (NH 4 ) 2 UO 2 (NO 3 ) 4 → NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → γ-UO 3 → α-U 3 O 8 → UO 2 , NH 4 UO 2 (NO 3 ) 3 → A-UO 3 → β-UO 3 → α-U 3 O 8 → UO 2 .
Ammonia is suspected of causing some of the toxicity observed in marine sediment toxicity tests because it is sometimes found at elevated concentrations in marine interstitial waters. In marine waters, ammonia exists as un-ionized ammonia (NH3) and ammonium (NH4+) which combine ...
NASA Astrophysics Data System (ADS)
Mouser, P. J.
2010-12-01
In order to develop decision-making tools for the prediction and optimization of subsurface bioremediation strategies, we must be able to link the molecular-scale activity of microorganisms involved in remediation processes with biogeochemical processes observed at the field-scale. This requires the ability to quantify changes in the in situ metabolic condition of dominant microbes and associate these changes to fluctuations in nutrient levels throughout the bioremediation process. It also necessitates a need to understand the spatiotemporal variability of the molecular-scale information to develop meaningful parameters and constraint ranges in complex bio-physio-chemical models. The expression of three Geobacter species genes (ammonium transporter (amtB), nitrogen fixation (nifD), and a housekeeping gene (recA)) were tracked at two monitoring locations that differed significantly in ammonium (NH4+) concentrations during a field-scale experiment where acetate was injected into the subsurface to simulate Geobacteraceae in a uranium-contaminated aquifer. Analysis of amtB and nifD mRNA transcript levels indicated that NH4+ was the primary form of fixed nitrogen during bioremediation. Overall expression levels of amtB were on average 8-fold higher at NH4+ concentrations of 300 μM or more than at lower NH4+ levels (average 60 μM). The degree of temporal correlation in Geobacter species mRNA expression levels was calculated at both locations using autocorrelation methods that describe the relationship between sample semi-variance and time lag. At the monitoring location with lower NH4+, a temporal correlation lag of 8 days was observed for both amtB and nifD transcript patterns. At the location where higher NH4+ levels were observed, no discernable temporal correlation lag above the sampling frequency (approximately every 2 days) was observed for amtB or nifD transcript fluctuations. Autocorrelation trends in recA expression levels at both locations indicated that while a temporal correlation in the general metabolic activity of Geobacter species may exist, considerable variability in transcript levels masked these correlations at the sampled scale. These findings suggest that when Geobacter species are dependent upon a particular nutrient such as NH4+, the time length for which their activity level relating to this nutrient condition can be predicted is significantly enhanced.
NASA Astrophysics Data System (ADS)
Nemitz, E.; Sutton, M. A.; Wyers, G. P.; Jongejan, P. A. C.
2004-07-01
A field measurement campaign was carried out over a Dutch heathland to investigate the effect of gas-to-particle conversion and ammonium aerosol evaporation on surface/atmosphere fluxes of ammonia and related species. Continuous micrometeorological measurements of the surface exchange of NH3, SO2, HNO3 and HCl were made and are analyzed here with regard to average fluxes, deposition velocities (Vd), canopy resistances (Rc) and canopy compensation point for NH3. Gradients of SO2, HNO3 and HCl were measured with a novel wet-denuder system with online anion chromatography. Measurements of HNO3 and HCl indicate an Rc of 100 to 200 s m-1 during warm daytime periods, probably at least partly due to non-zero acid partial pressures above NH4NO3 and NH4Cl on the leaf surfaces. Although it is likely that this observation is exacerbated by the effect of the evaporation of airborne NH4+ on the gradient measurements, the findings nevertheless add to the growing evidence that HNO3 and HCl are not always deposited at the maximum rate. Ammonia (NH3) fluxes show mainly deposition, with some periods of significant daytime emission. The net exchange could be reproduced both with an Rc model (deposition fluxes only) using resistance parameterizations from former measurements, as well as with the canopy compensation point model, using parameterizations derived from the measurements. The apoplastic ratio of ammonium and hydrogen concentration (Γs=[NH4+]/[H+]) of 1200 estimated from the measurements is large for semi-natural vegetation, but smaller than indicated by previous measurements at this site.
NASA Astrophysics Data System (ADS)
Nemitz, E.; Sutton, M. A.; Wyers, G. P.; Jongejan, P. A. C.
2004-03-01
A field measurement campaign was carried out over a Dutch heathland to investigate the effect of gas-to-particle conversion and ammonium aerosol evaporation on surface/atmosphere fluxes of ammonia and related species. Continuous micrometeorological measurements of the surface exchange of NH3, SO2, HNO3 and HCl were made and are analyzed here with regard to average fluxes, deposition velocities (Vd), canopy resistances (Rc) and canopy compensation point for NH3. Gradients of SO2, HNO3 and HCl were measured with a novel wet-denuder system with online anion chromatography. Measurements of HNO3 and HCl indicate an Rc of 100 to 200 s m-1 during warm daytime periods, probably at least partly due to non-zero acid partial pressures above NH4NO3 and NH4Cl on the leaf surfaces. Although it is likely that this observation is exacerbated by the effect of the evaporation of airborne NH4+ on the gradient measurements, the findings nevertheless add to the growing evidence that HNO3 and HCl are not always deposited at the maximum rate. Ammonia (NH3) fluxes show mainly deposition, with some periods of significant daytime emission. The net exchange could be reproduced both with an Rc model (deposition fluxes only) using resistance parameterizations from former measurements, as well as with the canopy compensation point model, using parameterizations derived from the measurements. The apoplastic ratio of ammonium and hydrogen concentration (Γs=[NH4+]/[H+]) of 1200 estimated from the measurements is large for semi- natural vegetation, but smaller than indicated by previous measurements at this site.
Measuring and modeling the salting-out effect in ammonium sulfate solutions.
Wang, Chen; Lei, Ying Duan; Endo, Satoshi; Wania, Frank
2014-11-18
The presence of inorganic salts significantly influences the partitioning behavior of organic compounds between environmentally relevant aqueous phases, such as seawater or aqueous aerosol, and other, nonaqueous phases (gas phase, organic phase, etc.). In this study, salting-out coefficients (or Setschenow constants) (KS [M(-1)]) for 38 diverse neutral compounds in ammonium sulfate ((NH4)2SO4) solutions were measured using a shared headspace passive dosing method and a negligible depletion solid phase microextraction technique. The measured KS were all positive, varied from 0.216 to 0.729, and had standard errors in the range of 0.006-0.060. Compared to KS for sodium chloride (NaCl) in the literature, KS values for (NH4)2SO4 are always higher for the same compound, suggesting a higher salting-out effect of (NH4)2SO4. A polyparameter linear free energy relationship (pp-LFER) for predicting KS in (NH4)2SO4 solutions was generated using the experimental data for calibration. pp-LFER predicted KS agreed well with measured KS reported in the literature. KS for (NH4)2SO4 was also predicted using the quantum-chemical COSMOtherm software and the thermodynamic model AIOMFAC. While COSMOtherm generally overpredicted the experimental KS, predicted and experimental values were correlated. Therefore, a fitting factor needs to be applied when using the current version of COSMOtherm to predict KS. AIOMFAC tends to underpredict the measured KS((NH4)2SO4) but always overpredicts KS(NaCl). The prediction error is generally larger for KS(NaCl) than for KS((NH4)2SO4). AIOMFAC also predicted a dependence of KS on the salt concentrations, which is not observed in the experimental data. In order to demonstrate that the models developed and calibrated in this study can be applied to estimate Setschenow coefficients for atmospherically relevant compounds involved in secondary organic aerosol formation based on chemical structure alone, we predicted and compared KS for selected α-pinene oxidation products.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Kagan, Benjamin D.; Lichtscheidl, Alejandro G.; Erickson, Karla A.
Trimethyltin fluoride (Me₃SnF) is a mild and selective reagent for the installation of actinide fluoride bonds as demonstrated by the room temperature synthesis of a variety of organometallic and inorganic thorium(IV), uranium(IV), and uranium(V) fluoride complexes ((1,2,4-tBu₃C₅H₂)₂ThF₂, (C₅Me₅)₂U(F)(O-2,6-iPr₂C₆H₃), U(F)(O-2,6-tBu₂C₆H₃)₃, U(F)[N(SiMe₃)₂]₃ (C₅Me₅)₂UF₂(L) (L = O=PMe₃, O=PPh₃, O=PCy₃), and (C₅Me₅)₂U(F)(=N-2,6-iPr₂C₆H₃)) from their corresponding chloride, bromide, and iodide analogues. From these reactions, the new (C₅Me₅)₂UF₂(L) (L = O=PPh₃, O=PCy₃) uranium fluoride complexes were isolated and characterized by NMR spectroscopy and X-ray crystallography.
Kagan, Benjamin D.; Lichtscheidl, Alejandro G.; Erickson, Karla A.; ...
2017-11-07
Trimethyltin fluoride (Me₃SnF) is a mild and selective reagent for the installation of actinide fluoride bonds as demonstrated by the room temperature synthesis of a variety of organometallic and inorganic thorium(IV), uranium(IV), and uranium(V) fluoride complexes ((1,2,4-tBu₃C₅H₂)₂ThF₂, (C₅Me₅)₂U(F)(O-2,6-iPr₂C₆H₃), U(F)(O-2,6-tBu₂C₆H₃)₃, U(F)[N(SiMe₃)₂]₃ (C₅Me₅)₂UF₂(L) (L = O=PMe₃, O=PPh₃, O=PCy₃), and (C₅Me₅)₂U(F)(=N-2,6-iPr₂C₆H₃)) from their corresponding chloride, bromide, and iodide analogues. From these reactions, the new (C₅Me₅)₂UF₂(L) (L = O=PPh₃, O=PCy₃) uranium fluoride complexes were isolated and characterized by NMR spectroscopy and X-ray crystallography.
Andrade do Canto, Catarina Simone; Rodrigues, José Alberto Domingues; Ratusznei, Suzana Maria; Zaiat, Marcelo; Foresti, Eugênio
2008-02-01
An investigation was performed on the biological removal of ammonium nitrogen from synthetic wastewater by the simultaneous nitrification/denitrification (SND) process, using a sequencing batch biofilm reactor (SBBR). System behavior was analyzed as to the effects of sludge type used as inoculum (autotrophic/heterotrophic), wastewater feed strategy (batch/fed-batch) and aeration strategy (continuous/intermittent). The presence of an autotrophic aerobic sludge showed to be essential for nitrification startup, despite publications stating the existence of heterotrophic organisms capable of nitrifying organic and inorganic nitrogen compounds at low dissolved oxygen concentrations. As to feed strategy, batch operation (synthetic wastewater containing 100 mg COD/L and 50 mg N-NH(4)(+)/L) followed by fed-batch (synthetic wastewater with 100 mg COD/L) during a whole cycle seemed to be the most adequate, mainly during the denitrification phase. Regarding aeration strategy, an intermittent mode, with dissolved oxygen concentration of 2.0mg/L in the aeration phase, showed the best results. Under these optimal conditions, 97% of influent ammonium nitrogen (80% of total nitrogen) was removed at a rate of 86.5 mg N-NH(4)(+)/Ld. In the treated effluent only 0.2 mg N-NO(2)(-)/L,4.6 mg N-NO(3)(-)/L and 1.0 mg N-NH(4)(+)/L remained, demonstrating the potential viability of this process in post-treatment of wastewaters containing ammonium nitrogen.
Su, Yuan; Liu, Jia; Yue, Qinyan; Li, Qian; Gao, Baoyu
2014-01-01
A new feather protein-grafted poly(potassium acrylate)/polyvinyl alcohol (FP-g-PKA/PVA) semi-interpenetrating polymer networks (semi-IPNs) hydrogel was produced through graft copolymerization with FP as a basic macromolecular skeletal material, acrylic acid as a monomer and PVA as a semi-IPNs polymer. The adsorption of ammonium and phosphate ions from aqueous solution using the new hydrogel as N and P controlled-release fertilizer with water-retention capacity was studied. The effects of pH value, concentration, contact time and ion strength on NH4+ and PO3-4 removal by FP-g-PKA/PVA semi-IPNs hydrogel were investigated using batch adsorption experiments. The results indicated that the hydrogel had high adsorption capacities and fast adsorption rates for NH4+ and PO3-4 in wide pH levels ranging from 4.0 to 9.0. Kinetic analysis presented that both NH4+ and PO3-4 removal were closely fitted with the pseudo-second-order model. Furthermore, the adsorption isotherms of hydrogel were best represented by the Freundlich model. The adsorption-desorption experimental results showed the sustainable stability of FP-g-PKA/PVA semi-IPNs hydrogel for NH4+ and PO3-4 removal. Overall, FP-g-PKA/PVA could be considered as an efficient material for the removal and recovery of nitrogen and phosphorus with the agronomic reuse as a fertilizer.
NASA Technical Reports Server (NTRS)
Janice, Bishop; Banin, A.; Mancinelli, R. L.; Klovstad, M. R.; DeVincenzi, Donald L. (Technical Monitor)
2001-01-01
Nitrogen is an essential element for life. It is the only element among the six major biogenic elements, C, O, S, O, P, H, whose presence in the Martian soil has not been positively and directly established. We describe here a study assessing the ability to detect NH4 in soils by two methods: differential thermal analysis (DTA) and infrared (IR) reflectance spectroscopy. Four standard clay minerals (kaolinite, montmorillonite, illite and attapulgite) and an altered tephra sample from Mauna Kea were treated with NH4 in this study. Samples of the NH4-treated and leached clays were analyzed by DTA and infrared (IR) reflectance spectroscopy to quantify the delectability of soluble and sorbed/fixed NH4. An exotherm at 270-280 C was clearly detected in the DTA curves of NH4-treated (non-leached) samples. This feature is assigned to the thermal decomposition reaction of NH4. Spectral bands observed at 1.56, 2.05, 2.12, 3.06, 3.3, 3.5, 5.7 and 7.0 microns in the reflectance spectra of NH4-treated and leached samples are assigned to the sorbed/fixed ammonium in the clays. The montmorillonite has shown the most intense absorbance due to fixed ammonium among the leached samples in this study, as a result of its high cation sorption capacity. It is concluded that the presence of sorbed or fixed NH4 in clays may be detected by infrared (IR) reflectance or emission spectroscopy. Distinction between soluble and sorbed NH4 may be achieved through the presence or absence of several spectral features assigned to the sorbed NH4 moietyi and, specifically, by use of the 4.2 micrometer feature assigned to solution NH4. Thermal analyses furnish supporting evidence of ammonia in our study through detection of N released at temperatures of 270-330 C. Based on these results it is estimated that IR spectra measured from a rover should be able to detect ammonia if present above 20 mg NH4/g sample in the surface layers. Orbital IR spectra and thermal analyses measured on a rover may be able to detect ammonia in soils as well but at higher abundances. The spectral features at 3.06 and 7.0 microns due to bound NH4 in clays and altered Hawaiian tephra appear to be the most promising for detection by orbital spectrometers. If N species are present on Mars the sedimentary deposits may be the best regions to look for them.
Wei, Wei; Shao, Shi Jun; Guo, Yong
2015-10-05
A compound based on 2,2'-bis(indolyl)methane containing nitro group was studied as a new anion receptor. It could recognize selectively F(-) by an increasing fluorescence signal and a visible color change from colorless to blue. The introduction of nitro group induced the spectral dual-function related to the deprotonation of N-H protons. Copyright © 2015 Elsevier B.V. All rights reserved.
A Low Temperature Infrared Study Of Deuterated NH4VO3
NASA Astrophysics Data System (ADS)
de Waal, D.; Heyns, A. M.
1989-12-01
The existence of (NH4)2V6016 as an intermediate in the thermal decomposition of NH4V03 to V205 has been confirmed by vibrational spectroscopy, resulting in the following reaction in an open systeml: NH4VO3 1 bar, air, 50-200°C/(1) (NH4)2v6o16 1 bar, air, ca.360°C/(2) V205 The kinetics of reaction (1) was studied by means of Raman spectroscopy, and structural information on NH4V03 and (N114)V60 16 was required to obtain an accurate description of the reaction mechanism2. Information on the site symmetry of an ammonium ion and hydrogen bonding in a crystal can be obtained by considering the infrared spectra of isotopically dilute NH3D+ ions in the lattice at liquid nitrogen temperatures3, especially as the position of hydrogen atoms in (NHO2V6016 could not be determined by X-ray methods.
The Effect of a Low Fluoride Delivery System on Bacterial Metabolism.
1980-09-01
Fluorides, an4 -Ique mechanisms, slow release delivery, temporary restora- tions, bacterial attachment, Streptococcus mutans , bacterial metabo’ilsm...concentrations of NaF, SnF 4 , Na2SnF6 , TiF 4 , and SnCI2 on altering plaque formation by Streptococcus mutans NCTC 10449. Specific tests were...preparation. Microorganisms, Growth Media, and Growth A streptomycin resistant mutant of Streptococcus mutans NCTC 10449 (Bratthall serotype c) has been
We use the adjoint of a global 3-D chemical transport model (GEOS-Chem) to optimizeammonia (NH3+4 wet deposition fluxes. Optimized emissions are derive...
Surface tension measurements of aqueous ammonium chloride (NH4Cl) in air
NASA Technical Reports Server (NTRS)
Lowry, S. A.; Mccay, M. H.; Mccay, T. D.; Gray, P. A.
1989-01-01
Aqueous NH4Cl's solidification is often used to model metal alloy solidification processes. The present determinations of the magnitude of the variation of aqueous NH4Cl's surface tension as a function of both temperature and solutal concentration were conducted at 3, 24, and 40 C over the 72-100 wt pct water solutal range. In general, the surface tension increases 0.31 dyn/cm per percent decrease in wt pct of water, and decreases 0.13 dyn/cm for each increase in deg C. Attention is given to the experimental apparatus employed.
Koh, Rongzhen; Pukallus, Margaret L; Newman, Bruce; Foley, Michael; Walsh, Laurence J; Seow, W Kim
2015-01-01
In December 2008, artificial water fluoridation was introduced for the first time to the Logan-Beaudesert district in the state of Queensland, Australia. The aim of this study was to evaluate the effects of water fluoridation in the primary dentition in this community after a period of 36 months. Children aged 4-9 years with clinical examinations and bitewing radiographs (BWs) taken before water fluoridation (pre-F) were randomly selected as comparison controls for age matched children who had been exposed to a mean period of 36 months of water fluoridation (post-F). A total of 201 sets of pre-F BWs from children (mean age 6.95 ± 1.05 years) and 256 sets of post-F BWs from children (mean age 7.19 ± 1.23 years) attending schools in the district were randomly selected. Caries experience in the primary dentition was determined as decayed, missing or filled teeth/surfaces (dmft/dmfs). The caries prevalence for the pre-F group was 87% compared to 75% in the post-F group (Odds ratio (OR): 0.44, 95% CI: 0.27-0.72). Overall, there was a 19 percent reduction of mean dmft from 4.54 in the pre-F group to 3.66 in the post-F group (p = 0.005). After fluoridation, the dmfs was reduced from 6.68 to 5.17 (p = 0.0056). The distal surfaces of maxillary first primary molars experienced the greatest reduction (26%) in caries experience after water fluoridation (p < 0.001). After only 36 months of water fluoridation there was a significant drop in caries prevalence from 87 to 75% and a 19% reduction in caries experience in a community with one of the highest caries rates in Australia.
Nutrient removal by Chlorella vulgaris F1068 under cetyltrimethyl ammonium bromide induced hormesis.
Zhou, Qiongzhi; Li, Feng; Ge, Fei; Liu, Na; Kuang, Yangduo
2016-10-01
Toxicants are generally harmful to biotechnology in wastewater treatment. However, trace toxicant can induce microbial hormesis, but to date, it is still unknown how this phenomenon affects nutrient removal during municipal wastewater treatment process. Therefore, this study focused on the effects of hormesis induced by cetyltrimethyl ammonium bromide (CTAB), a representative quaternary ammonium cationic surfactant, on nutrient removal by Chlorella vulgaris F1068. Results showed that when the concentration of CTAB was less than 10 ng/L, the cellular components chlorophyll a, proteins, polysaccharides, and total lipids increased by 10.11, 58.17, 38.78, and 11.87 %, respectively, and some enzymes in nutrient metabolism of algal cells, such as glutamine synthetase (GS), acid phosphatase (ACP), H(+)-ATPase, and esterase, were also enhanced. As a result, the removal efficiencies of ammonia nitrogen (NH4 (+)) and total phosphorus (TP) increased by 14.66 and 8.51 %, respectively, compared to the control during a 7-day test period. The underlying mechanism was mainly due to an enhanced photosynthetic activity of C. vulgaris F1068 indicated by the increase in chlorophyll fluorescence parameters (the value of Fv/Fm, ΦII, Fv/Fo, and rETR increased by 12.99, 7.56, 25.59, and 8.11 %, respectively) and adenylate energy charge (AEC) (from 0.68 to 0.72). These results suggest that hormesis induced by trace toxicants could enhance the nutrient removal, which would be further considered in the design of municipal wastewater treatment processes. Graphical abstract The schematic mechanism of C. vulgaris F1068 under CTAB induced hormesis. Green arrows ( ) represent the increase and the red arrow ( ) represents the decrease.
NASA Astrophysics Data System (ADS)
Wang, Yujie; Wang, Shuangbao; Deng, Saifu; Liu, Jianting; Zhang, Jiahui
2017-10-01
Optical glass was very important for the development of optical fiber sensor. In this paper, a new type fluoride glass of ZrF4-BaF2-AlF3-NaF-MgF2(ZBANM) was synthesized for sensing application which has low loss and high magneto-optical coefficient, and it was found that the glass system had at least 60% transmittance from 3.5 μm to 7 μm and smallest verdet constant of 4.628E-5/(rad A-1) at 632.8 nm. The relationship among the compositions of sample glass with its thermal property, optical absorptivity and magnetic-optical coefficients was respectively studied with Thermal Gravimetric-Differential Thermal Analyzer, Fourier Transform infrared spectroscopy and a home-made magneto optical bench. The study indicated that transmittance of fluoride glass structure had been obviously improved after moderate content of Mg2+ and Na+ was doped. Simultaneously, with the molar ratio of alkaline-earth ions Mg increased, the Verdet constant of fluoride glass was increased. And the glass structure with composition of 48%ZrF4-24%BaF2-6%AlF3-8%NaF-14%MgF2 exhibited a small molar absorptivity and the largest Verdet constant of 2.853E-4/(rad A-1).
Liebold, Christoph; List, Felix; Kalbitzer, Hans Robert; Sterner, Reinhard; Brunner, Eike
2010-01-01
The imidazole glycerol phosphate (ImGP) synthase from the hyperthermophilic bacterium Thermotoga maritima is a 1:1 complex of the glutaminase subunit HisH and the cyclase subunit HisF. It has been proposed that ammonia generated by HisH is transported through a channel to the active site of HisF, which generates intermediates of histidine (ImGP) and de novo biosynthesis of 5-aminoimidazole-4-carboxamideribotide. Solution NMR spectroscopy of ammonium chloride-titrated samples was used to study the interaction of NH3 with amino acids inside this channel. Although numerous residues showed 15N chemical shift changes, most of these changes were caused by nonspecific ionic strength effects. However, several interactions appeared to be specific. Remarkably, the amino acid residue Thr 78—which is located in the central channel—shows a large chemical shift change upon titration with ammonium chloride. This result and the reduced catalytic activity of the Thr78Met mutant indicate a special role of this residue in ammonia channeling. To detect and further characterize internal cavities in HisF, which might for example contribute to ammonia channeling, the interaction of HisF with the noble gas xenon was analyzed by solution NMR spectroscopy using 1H-15N HSQC experiments. The results indicate that HisF contains three distinct internal cavities, which could be identified by xenon-induced chemical shift changes of the neighboring amino acid residues. Two of these cavities are located at the active site at opposite ends of the substrate N′-[(5′-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamide-ribonucleotide (PRFAR) binding groove. The third cavity is located in the interior of the central β-barrel of HisF and overlaps with the putative ammonia transport channel. PMID:20665694
Kasturi, Singh; Marikumar, R; Vaidyanathan, Sivakumar
2018-05-10
The LaF 3 nanocrystals through a facile hydrothermal route with hexagonal structures have been synthesized via doping of trivalent rare earth (RE 3+ ) ions - RE = Tb, Sm, Dy and Tm - with rod-like and perforated morphologies using NH 4 F as fluorine precursor. Hexagonal phase formation was confirmed by powder X-ray diffraction. The crystalline sizes were calculated by the Scherrer equation where found to have an average crystalline size of 12 to 35 nm. The morphological studies of the nanocrystals were carried out by means of transmission electron microscopy (TEM). The LaF 3 :Tm 3+ ,Sm 3+ ions show the characteristic emission of Tb 3+ and Tm 3+ respectively. In Sm 3+ -doped LaF 3 , three prominent emission peaks at 561, 597 and 641 nm were found, which belong to 4 G 5/2 → 6 H 5/2 , 4 G 5/2 → 6 H 7/2 (magnetic dipole) and 4 G 5/2 → 6 H 9/2 (electric dipole) transitions, respectively. The Dy 3+ activated LaF 3 shows blue and yellow emission and the corresponding CIE color coordinate show white light emission (CCT value 10650 K). Copyright © 2018 John Wiley & Sons, Ltd.
Chai, Lihong; Wang, Hongyuan; Zhao, Hongfeng; Dong, Suiming
2017-04-01
Bufo gargarizans tadpoles were chronically exposed to waterborne fluoride at measured concentrations ranging from 0.4 to 61.2 mg F - /L for 70 days from Gosner stage 26 to completion of metamorphosis. The chronic exposure caused a concentration-dependent mortality in all tested fluoride concentrations. Total length, snout-to-vent length (SVL), body mass, and developmental stage of tadpoles were significantly inhibited at 42.6 mg F - /L. In addition, significant metamorphic delay and increase in size at completion of metamorphosis occurred after exposure to 19.8 mg F - /L. Moreover, 19.8 mg F - /L suppressed the bone mineralization of larvae at completion of metamorphosis. However, the bone mineralization could be enhanced by 4.1 mg F - /L. In conclusion, our results suggested that the presence of high concentrations of fluoride could increase mortality risk, delay metamorphosis, and suppress skeletal ossification in B. gargarizans larvae.
Very low H O H bending frequencies. IV. Fourier transform infrared spectra of synthetic dittmarite
NASA Astrophysics Data System (ADS)
Šoptrajanov, Bojan; Stefov, Viktor; Kuzmanovski, Igor; Jovanovski, Gligor; Lutz, H. Dieter; Engelen, Bernward
2002-08-01
The Fourier transform infrared spectra of MgNH 4PO 4·H 2O (the synthetic analogue of the mineral dittmarite) and of a series of its partially deuterated analogues have been studied as a part of our continuous work on compounds exhibiting very low water bending frequencies. Although, the presence of ammonium bands makes the assignments in this case more difficult than for the potassium analogues, the isomorphism between the compounds of the MNH 4PO 4·H 2O type (M=Mg, Co, Ni, Mn and one of the polymorphs of CdNH 4PO 4·H 2O) and those which contain potassium instead of ammonium as well as the careful analysis of the spectra warrant the conclusion that in the presently studied compound the water bending mode appears at a frequency which is far more than 100 cm -1 lower than in the gaseous water. The spectra clearly show that the ammonium ions in the structure are involved in quite strong hydrogen bonds, a characteristic which is a precondition for a material to behave as a protonic conductor.
Azolla-Anabaena Relationship 1
Meeks, John C.; Steinberg, Nisan A.; Enderlin, Carol S.; Joseph, Cecillia M.; Peters, Gerald A.
1987-01-01
The major radioactive products of the fixation of [13N]N2 by Azolla caroliniana Willd.-Anabaena azollae Stras. were ammonium, glutamine, and glutamate, plus a small amount of alanine. Ammonium accounted for 70 and 32% of the total radioactivity recovered after fixation for 1 and 10 minutes, respectively. The presence of a substantial pool of [13N]N2-derived 13NH4+ after longer incubation periods was attributed to the spatial separation between the site of N2-fixation (Anabaena) and a second, major site of assimilation (Azolla). Initially, glutamine was the most highly radioactive organic product formed from [13N]N2, but after 10 minutes of fixation glutamate had 1.5 times more radiolabel than glutamine. These kinetics of radiolabeling, along with the effects of inhibitors of glutamine synthetase and glutamate synthase on assimilation of exogenous and [13N]N2-derived 13NH4+, indicate that ammonium assimilation occurred by the glutamate synthase cycle and that glutamate dehydrogenase played little or no role in the synthesis of glutamate by Azolla-Anabaena. PMID:16665538
Verhamme, Daniel T; Prosser, James I; Nicol, Graeme W
2011-06-01
The first step of nitrification, oxidation of ammonia to nitrite, is performed by both ammonia-oxidising archaea (AOA) and ammonia-oxidising bacteria (AOB) in soil, but their relative contributions to ammonia oxidation and existence in distinct ecological niches remain to be determined. To determine whether available ammonia concentration has a differential effect on AOA and AOB growth, soil microcosms were incubated for 28 days with ammonium at three concentrations: native (control), intermediate (20 μg NH(4)(+)-N per gram of soil) and high (200 μg NH(4)(+)-N per gram of soil). Quantitative PCR demonstrated growth of AOA at all concentrations, whereas AOB growth was prominent only at the highest concentration. Similarly, denaturing gradient gel electrophoresis (DGGE) analysis revealed changes in AOA communities at all ammonium concentrations, whereas AOB communities changed significantly only at the highest ammonium concentration. These results provide evidence that ammonia concentration contributes to the definition of distinct ecological niches of AOA and AOB in soil.
Verhamme, Daniel T; Prosser, James I; Nicol, Graeme W
2011-01-01
The first step of nitrification, oxidation of ammonia to nitrite, is performed by both ammonia-oxidising archaea (AOA) and ammonia-oxidising bacteria (AOB) in soil, but their relative contributions to ammonia oxidation and existence in distinct ecological niches remain to be determined. To determine whether available ammonia concentration has a differential effect on AOA and AOB growth, soil microcosms were incubated for 28 days with ammonium at three concentrations: native (control), intermediate (20 μg NH4+-N per gram of soil) and high (200 μg NH4+-N per gram of soil). Quantitative PCR demonstrated growth of AOA at all concentrations, whereas AOB growth was prominent only at the highest concentration. Similarly, denaturing gradient gel electrophoresis (DGGE) analysis revealed changes in AOA communities at all ammonium concentrations, whereas AOB communities changed significantly only at the highest ammonium concentration. These results provide evidence that ammonia concentration contributes to the definition of distinct ecological niches of AOA and AOB in soil. PMID:21228892
Comar, Lívia P; Souza, Beatriz M; Al-Ahj, Luana P; Martins, Jessica; Grizzo, Larissa T; Piasentim, Isabelle S; Rios, Daniela; Buzalaf, Marília Afonso Rabelo; Magalhães, Ana Carolina
2017-10-12
This in vitro study aimed to evaluate the action of TiF4 on sound and carious bovine and human enamel. Sound (S) and pre-demineralised (DE) bovine and human (primary and permanent) enamel samples were treated with TiF4 (pH 1.0) or NaF varnishes (pH 5.0), containing 0.95, 1.95, or 2.45% F for 12 h. The enamel surfaces were analysed using SEM-EDX (scanning electron microscopy/energy-dispersive X-ray spectroscopy) (n = 10, 5 S and 5 DE) and KOH-soluble fluoride was quantified (n = 20, 10 S and 10 DE). Hydroxyapatite powder produced by precipitation method was treated with the corresponding fluoride solutions for 1 min (n = 2). The formed compounds were detected using X-ray diffraction (XRD). All TiF4 varnishes produced a coating layer rich in Ti and F on all types of enamel surface, with micro-cracks in its extension. TiF4 (1.95 and 2.45% F) provided higher fluoride deposition than NaF, especially for bovine enamel (p < 0.0001). It also induced a higher fluoride deposition on DE samples compared to S samples (p < 0.0001), except for primary enamel. The Ti content was higher for bovine and human primary enamel than human permanent enamel, with some differences between S and DE. The XRD analysis showed that TiF4 induced the formation of new compounds such as CaF2, TiO2, and Ti(HPO4)2·H2O. In conclusion, TiF4 (>0.95% F) interacts better, when compared to NaF, with bovine and human primary enamel than with human permanent enamel. TiF4 provoked higher F deposition compared to NaF. Carious enamel showed higher F uptake than sound enamel by TiF4 application, while Ti uptake was dependent on the enamel condition and origin. © 2017 S. Karger AG, Basel.
Lubricants or lubricant additives composed of ionic liquids containing ammonium cations
Qu, Jun [Knoxville, TN; Truhan, Jr; John, J [Cookeville, TN; Dai, Sheng [Knoxville, TN; Luo, Huimin [Knoxville, TN; Blau, Peter J [Knoxville, TN
2010-07-13
A lubricant or lubricant additive is an ionic liquid alkylammonium salt. The alkylammonium salt has the structure R.sub.xNH.sub.(4-x).sup.+,[F.sub.3C(CF.sub.2).sub.yS(O).sub.2].sub.2N.sup- .- where x is 1 to 3, R is independently C.sub.1 to C.sub.12 straight chain alkyl, branched chain alkyl, cycloalkyl, alkyl substituted cycloalkyl, cycloalkyl substituted alkyl, or, optionally, when x is greater than 1, two R groups comprise a cyclic structure including the nitrogen atom and 4 to 12 carbon atoms, and y is independently 0 to 11. The lubricant is effective for the lubrication of many surfaces including aluminum and ceramics surfaces.
Thermophysical properties of aqueous solution of ammonium-based ionic liquids.
Umapathi, Reddicherla; Attri, Pankaj; Venkatesu, Pannuru
2014-06-05
Experimental densities (ρ), ultrasonic sound velocities (u), viscosities (η), and refractive indices (n(D)) of binary mixtures of ammonium-based ionic liquids (ILs) such as diethylammonium acetate (DEAA) [(CH3CH2)2NH][CH3COO], triethylammonium acetate (TEAA) [(CH3CH2)3NH][CH3COO], diethylammonium hydrogen sulfate (DEAS) [(CH3CH2)2NH][HSO4], triethylammonium hydrogen sulfate (TEAS) [(CH3CH2)3NH][HSO4], trimethylammonium acetate (TMAA) [(CH3)3NH][CH3COO], and trimethylammonium hydrogen sulfate (TMAS) [(CH3)3NH][HSO4] with water are reported over the wide composition range at 25 °C under atmospheric pressure. The excess molar volumes (V(E)), deviation in isentropic compressibilities (Δκ(s)), deviation in viscosities (Δη) and deviation in refractive indices (Δn(D)) are calculated from experimental values and are correlated by Redlich-Kister polynomial equations. The V(E) and Δκ(s) values for the aforesaid systems are negative over the entire composition range while the Δη and Δn(D) values are positive under the same experimental conditions. The intermolecular interactions and structural effects were analyzed on the basis of measured and derived properties. A qualitative analysis of the results is discussed in terms of the ion-dipole, ion-pair interactions and hydrogen bonding between ILs and water. Furthermore, the hydrogen bonding features between ILs with water were analyzed by using a molecular modeling program with the help of HyperChem7.
Khansari, Maryam Emami; Johnson, Corey R; Basaran, Ismet; Nafis, Aemal; Wang, Jing; Leszczynski, Jerzy; Hossain, Md Alamgir
2015-01-01
Tris(3-aminopropyl)amine-based tripodal urea and thiourea receptors, tris([(4-cyanophenyl)amino]propyl)urea ( L1 ) and tris([(4-cyanophenyl)amino]propyl)thiourea ( L2 ), have been synthesized and their anion binding properties have been investigated for halides and oxoanions. As investigated by 1 H NMR titrations, each receptor binds an anion with a 1:1 stoichiometry via hydrogen-bonding interactions (NH⋯anion), showing the binding trend in the order of F - > H 2 PO 4 - > HCO 3 - > HSO 4 - > CH 3 COO - > SO 4 2- > Cl - > Br - > I in DMSO- d 6 . The interactions of the receptors were further studied by 2D NOESY, showing the loss of NOESY contacts of two NH resonances for the complexes of F - , H 2 PO 4 - , HCO 3 - , HSO 4 - or CH 3 COO - due to the strong NH⋯anion interactions. The observed higher binding affinity for HSO 4 - than SO 4 2- is attributed to the proton transfer from HSO 4 - to the central nitrogen of L1 or L2 which was also supported by the DFT calculations, leading to the secondary acid-base interactions. The thiourea receptor L2 has a general trend to show a higher affinity for an anion as compared to the urea receptor L1 for the corresponding anion in DMSO- d 6 . In addition, the compound L2 has been exploited for its extraction properties for fluoride in water using a liquid-liquid extraction technique, and the results indicate that the receptor effectively extracts fluoride from water showing ca. 99% efficiency (based on L2 ).
Aguirre-Sierra, Arantxa; Alonso, Alvaro; Camargo, Julio A
2013-08-01
Laboratory experiments were performed to examine the toxic effects of fluoride (F(-)) on the survival and behavior of white-clawed crayfish (Austropotamobius pallipes). Body fluoride contents (bioaccumulation) of test crayfish were also examined. No significant differences between male and female crayfish regarding mortality, escape (tail-flip) response, and fluoride bioaccumulation were detected. For mortality, 48-, 72-, 96-, 120-, 144-, 168-, and 192-h median lethal concentrations (LC50) were estimated to be 93.0, 55.3, 42.7, 36.5, 32.9, 30.6, and 28.9 mg F(-)/l, respectively. For the escape response, 48-, 72-, 96-, 120-, 144-, 168- and 192-h median effective concentrations (EC50) were estimated to be 18.4, 11.1, 8.6, 7.4, 6.7, 6.2 and 5.9 mg F(-)/l, respectively. Average food consumption in test crayfish tended to decrease with increasing water fluoride concentration with a 192-h lowest-observed effect concentration of 10.7 mg F(-)/l. These results indicate that the escape response was the most sensitive end point to fluoride toxicity followed by food consumption and mortality. Fluoride bioaccumulation in test crayfish increased with increasing water fluoride concentration and exposure time. The exoskeleton accumulated more fluoride than muscle. A comparison of the obtained results with previous data for other freshwater invertebrates shows that white-clawed crayfish are relatively tolerant to fluoride toxicity. We conclude that fluoride pollution in freshwater ecosystems should not be viewed as an important risk factor contributing to the catastrophic decrease of A. pallipes in many European countries. Our results indicate that fluoride bioaccumulation in A. pallipes might be used as a bioindicator of fluoride pollution in freshwater ecosystems where it is present.
River flow and ammonium discharge determine spring phytoplankton blooms in an urbanized estuary
NASA Astrophysics Data System (ADS)
Dugdale, Richard; Wilkerson, Frances; Parker, Alexander E.; Marchi, Al; Taberski, Karen
2012-12-01
Nutrient loadings to urbanized estuaries have increased over the past decades in response to population growth and upgrading to secondary sewage treatment. Evidence from the San Francisco Estuary (SFE) indicates that increased ammonium (NH4) loads have resulted in reduced primary production, a counter-intuitive finding; the NH4 paradox. Phytoplankton uptake of nitrate (NO3), the largest pool of dissolved inorganic nitrogen, is necessary for blooms to occur in SFE. The relatively small pool of ambient NH4, by itself insufficient to support a bloom, prevents access to NO3 and bloom development. This has contributed to the current rarity of spring phytoplankton blooms in the northern SFE (Suisun Bay), in spite of high inorganic nutrient concentrations, improved water transparency and seasonally low biomass of bivalve grazers. The lack of blooms has likely contributed to deleterious bottom-up impacts on estuarine fish. This bloom suppression may also occur in other estuaries that receive large amounts of anthropogenic NH4. In 2010 two rare diatom blooms were observed in spring in Suisun Bay (followed by increased abundances of copepods and pelagic fish), and like the prior bloom observed in 2000, chlorophyll accumulated after NH4 concentrations were decreased. In 2010, low NH4 concentrations were apparently due to a combination of reduced NH4 discharge from a wastewater treatment plant and increased river flow. To understand the interactions of river flow, NH4 discharge and bloom initiation, a conceptual model was constructed with three criteria; 1) NH4 loading must not exceed the capacity of the phytoplankton to assimilate the inflow of NH4, 2) the NH4 concentration must be ≤4 μmol L-1 to enable phytoplankton NO3 uptake, 3) the dilution rate of phytoplankton biomass set by river flow must not exceed the phytoplankton growth rate to avoid "washout". These criteria were determined for Suisun Bay; with sufficient irradiance and present day discharge of 15 tons NH4-N d-1at the upstream wastewater treatment plant (WTP). The loading criterion requires phytoplankton NH4 uptake to exceed 1.58 mmol m-2 d-1; the concentration criterion requires river flow >800 m3 s-1 at the WTP for sufficient NH4 dilution and the washout criterion requires river flow at Suisun Bay <1100 m3 s-1. The model and criteria are used to suggest how a reduction in anthropogenic NH4, either by reduced discharge or increased dilution (river flow), could be used as a management tool to restore pre-existing productivity in the SFE and similarly impacted estuaries.
FLUORIDE CONTENT OF COMMERCIALLY AVAILABLE BOTTLED DRINKING WATER IN BANGKOK, THAILAND.
Rirattanapong, Praphasri; Rirattanapong, Opas
2016-09-01
The use of bottled drinking water may be a source of fluoride and could be a risk factor for fluorosis among infants and young children. The aim of this study was to evaluate the fluoride content of commercially available bottled drinking water in Bangkok, Thailand. Forty-five water samples (15 samples of plain water and 30 samples of mineral water) were purchased from several supermarkets in Bangkok, Thailand. Three bottles of each water sample were purchased, and the fluoride content of each sample was measured twice using a combination fluoride-ion selective electrode. The average reading for each sample was then calculated. Data were analyzed by descriptive statistics. Differences between mineral and plain water samples were determined by Student’s t-test. The mean (±SD) fluoride content for all the water samples was 0.17 (±0.17) mg F/l (range: 0.01-0.89 mg F/l). Six brands (13%) tested stated the fluoride content on the label. The actual fluoride content in each of their brands varied little from the label. Eight samples (18%) had a fluoride content >0.3 mg F/l and two samples (4%) had a fluoride content >0.6 mg F/l. The mean mineral water fluoride concentration was significantly higher than the mean fluoride concentration of plain water (p=0.001). We found commercially sold bottled drinking water in Bangkok, Thailand contained varying concentrations of fluoride; some with high concentrations of fluoride. Health professions need to be aware this varying fluoride content of bottled drinking water and educate the parents of infants and small children about this when prescribing fluoride supplements. Consideration should be made to have fluoride content put on the label of bottled water especially among brands with a content >0.3 mg F/l.
Transport characteristics of mammalian Rh and Rh glycoproteins expressed in heterologous systems.
Westhoff, C M; Wylie, D E
2006-01-01
The development and use of heterologous expression systems is critical for deciphering the function of mammalian Rh and Rh-glycoproteins. The studies here use Xenopus oocytes, well known for their ability to readily traffic and express difficult membrane proteins, and S. cerevisiae wild-type strains and mutants that are defective in ammonium transport. Data obtained in both of these expression systems revealed that mammalian Rh-glycoprotein-mediated transport (RhAG, RhBG, and RhCG) is an electroneutral process that is driven by the NH4+ concentration and the transmembrane H+ gradient, effectively exchanging NH4+ for H+ in a process that results in transport of net NH3. Homology modeling and functional studies suggest that the more recently evolved erythrocyte blood group proteins, RhCE and RhD, may not function directly in ammonia transport and may be evolving a new function in the RBC membrane. The relationship of Rh and Rh-glycoproteins to the Amt/Mep ammonium transporters is substantiated with functional transport data and structural modeling.
Carvalho, Thiago S; Bönecker, Marcelo; Altenburger, Markus J; Buzalaf, Marília A R; Sampaio, Fabio C; Lussi, Adrian
2015-07-01
Calcium glycerophosphate (CaGP) was added to fluoride varnishes to analyze their preventive effect on initial enamel erosion and fluoride uptake: potassium hydroxide (KOH)-soluble and KOH-insoluble fluoride bound to enamel. This study was carried out in two parts. Part 1: 108 enamel samples were randomly distributed into six varnish groups: base varnish (no active ingredients); Duraphat® (2.26%NaF); Duofluorid® (5.63%NaF/CaF2); experimental varnish 1 (1%CaGP/5.63 NaF/CaF2); experimental varnish 2 (5%CaGP/5.63%NaF/CaF2); and no varnish. Cyclic demineralization (90 s; citric acid, pH = 3.6) and remineralization (4 h) was made once a day, for 3 days. Change in surface microhardness (SMH) was measured. Part 2: 60 enamel samples were cut in half and received no varnish (control) or a layer of varnish: Duraphat®, Duofluorid®, experimental varnishes 1 and 2. Then, KOH-soluble and KOH-insoluble fluoride were analyzed using an electrode. After cyclic demineralization, SMH decreased in all samples, but Duraphat® caused less hardness loss. No difference was observed between varnishes containing CaGP and the other varnishes. Similar amounts of KOH-soluble and insoluble fluoride was found in experimental varnish 1 and Duofluorid®, while lower values were found for experimental varnish 2 and Duraphat®. The addition of CaGP to fluoride varnishes did not increase fluoride bound to enamel and did not enhance their protection against initial enamel erosion. We observe that the fluoride varnishes containing CaGP do not promote greater amounts of fluoride bound to enamel and that fluoride bound to enamel may not be closely related to erosion prevention.
Metal leaching from refinery waste hydroprocessing catalyst.
Marafi, Meena; Rana, Mohan S
2018-05-18
The present study aims to develop an eco-friendly methodology for the recovery of nickel (Ni), molybdenum (Mo), and vanadium (V) from the refinery waste spent hydroprocessing catalyst. The proposed process has two stages: the first stage is to separate alumina, while the second stage involves the separation of metal compounds. The effectiveness of leaching agents, such as NH 4 OH, (NH 4 ) 2 CO 3 , and (NH 4 ) 2 S 2 O 8 , for the extraction of Mo, V, Ni, and Al from the refinery spent catalyst has been reported as a function of reagent concentration (0.5 to 2.0 molar), leaching time (1 to 6 h), and temperature (35 to 60°C). The optimal leaching conditions were achieved to obtain the maximum recovery of Mo, Ni, and V metals. The effect of the mixture of multi-ammonium salts on the metal extraction was also studied, which showed an adverse effect for Ni and V, while marginal improvement was observed for Mo leaching. The ammonium salts can form soluble metal complexes, in which stability or solubility depends on the nature of ammonium salt and the reaction conditions. The extracted metals and support can be reused to synthesize a fresh hydroprocessing catalyst. The process will reduce the refinery waste and recover the expensive metals. Therefore, the process is not only important from an environmental point of view but also vital from an economic perspective.
Zhao, Li; Li, Yanli; Wang, Shidong; Wang, Xinyi; Meng, Hongqi; Luo, Shaohe
2016-09-01
Adsorption kinetics and transformation process of ammonium ion (NH4(+)) were investigated to advance the understanding of N cycle in a low-temperature loose-pore geothermal reservoir. Firstly, batch experiments were performed in order to determine the sorption capacity and the kinetic mechanism of NH4(+) onto a loose-pore geothermal reservoir matrix. Then column experiments were carried out at temperatures from 20°C to 60°C in order to determine the transport parameters and transformation mechanism of NH4(+) in the studied matrix. The results showed that the adsorption process of NH4(+) onto the porous media well followed the pseudo-second-order model. No obvious variation of hydrodynamic dispersion coefficient (D) and retardation factor (R) was observed at different transport distances at a Darcy's flux of 2.27cm/h, at which nitrification could be neglected. The simulated D obtained by the CDE model in CXTFIT2.1 increased with temperature while R decreased with temperature, indicating that the adsorption capacity of NH4(+) onto the matrix decreased with the increasing of temperature. When the Darcy's flux was decreased to 0.014cm/h, only a little part of NH4(+) could be transformed to nitrate, suggesting that low density of nitrifiers existed in the simulated loose-pore geothermal reservoir. Although nitrification rate increased with temperature in the range of 20°C to 60°C, it was extremely low and no accumulation of nitrite was observed under the simulated low-temperature geothermal conditions without addition of biomass and oxygen. Copyright © 2016 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Liu, Wenjing; Yu, Longfei; Zhang, Ting; Kang, Ronghua; Zhu, Jing; Mulder, Jan; Huang, Yongmei; Duan, Lei
2017-09-01
Chronically elevated deposition of reactive nitrogen (N), as ammonium (NH4+) and nitrate (NO3-), in subtropical forests with monsoonal climate has caused widespread N leaching in southern China. So far, little is known about the effect of further increases in N input and changes in the relative proportion of NH4+ and NO3- on turnover rate and fate of atmogenic N. Here we report a 15N tracer experiment in Tieshanping (TSP) forest, SW China, conducted as part of a long-term N fertilization experiment, using NH4NO3 and NaNO3, where effects of a doubling of monthly N inputs were compared. In June 2012, the regular N fertilizers were replaced by their 15N-labeled forms, viz., 15NH4NO3 and Na15NO3, as a single-dose addition. Mass balances of N for the initial 1.5 years following label addition showed that for both treatments, 70% to 80% of the annual N input was leached as NO3-, both at ambient and at double N input rates. This confirms the earlier reported extreme case of N saturation at TSP. The 15N, added as Na15NO3, showed recoveries of about 74% in soil leachates, indicating that NO3- input at TSP is subject to a rapid and nearly quantitative loss through direct leaching as a mobile anion. By contrast, recoveries of 15N in soil leachates of only 33% were found if added as 15NH4NO3. Much of the 15N was immobilized in the soil and to a lesser extent in the vegetation. Thus, immobilization of fresh N input is significantly greater if added as NH4+, than as NO3-.
Where is the nitrogen on Mars?
NASA Astrophysics Data System (ADS)
Mancinelli, Rocco L.; Banin, Amos
2003-07-01
Nitrogen is an essential element for life. Specifically, fixed nitrogen (i.e. NH3, NH4+, NOx or N that is chemically bound to either inorganic or organic molecules and can be released by hydrolysis to form NH3 or NH4+) is useful to living organisms. Nitrogen on present-day Mars has been analysed only in the atmosphere. The inventory is a small fraction of the amount of nitrogen presumed to have been received by the planet during its accretion. Where is the missing nitrogen? Answering this question is crucial for understanding the probability of the origin and evolution of life on Mars, and for its future astrobiological exploration. The two main processes that could have removed nitrogen from the atmosphere include: (1) non-thermal escape of N atoms to space and (2) burial within the regolith as nitrates and ammonium salts. Nitrate would probably be stable in the highly oxidized surface soil of Mars and could have served as an NO3[minus sign] sink. Such accumulations are observed in certain desert environments on Earth. Some NH4+ nitrogen may also be fixed and stabilized in the soil by inclusion as a structural cation in the crystal lattices of certain phyllosilicates replacing K+. Analysis of the Martian soil for traces of NO3[minus sign] and NH4+ during future missions will provide important information regarding the nitrogen abundance on Mars. We hypothesize that Mars soil, as typical of extremely dry desert soils on Earth, is likely to contain at least some of the missing nitrogen as nitrate salts and some fixed ammonium bound to aluminosilicate minerals.
Yu, Hua-Gen; Han, Huixian; Guo, Hua
2016-04-14
Vibrational energy levels of the ammonium cation (NH4(+)) and its deuterated isotopomers are calculated using a numerically exact kinetic energy operator on a recently developed nine-dimensional permutation invariant semiglobal potential energy surface fitted to a large number of high-level ab initio points. Like CH4, the vibrational levels of NH4(+) and ND4(+) exhibit a polyad structure, characterized by a collective quantum number P = 2(v1 + v3) + v2 + v4. The low-lying vibrational levels of all isotopomers are assigned and the agreement with available experimental data is better than 1 cm(-1).
Ammonium Assimilation Requires Mitochondrial Respiration in the Light 1
Weger, Harold G.; Birch, Douglas G.; Elrifi, Ivor R.; Turpin, David H.
1988-01-01
Mass spectrometric analysis of O2 and CO2 exchange in the green alga Selenastrum minutum (Naeg. Collins) provides evidence for the occurrence of mitochondrial respiration in light. Stimulation of amino acid synthesis by the addition of NH4Cl resulted in nearly a 250% increase in the rate of TCA cycle CO2 efflux in both light and dark. Ammonium addition caused a similar increase in cyanide sensitive O2 consumption in both light and dark. Anaerobiosis inhibited the CO2 release caused by NH4Cl. These results indicated that the cytochrome pathway of the mitochondrial electron transport chain was operative and responsible for the oxidation of a large portion of the NADH generated during the ammonium induced increase in TCA cycle activity. In the presence of DCMU, ammonium addition also stimulated net O2 consumption in the light. This implied that the Mehler reaction did not play a significant role in O2 consumption under our conditions. These results show that both the TCA cycle and the mitochondrial electron transport chain are capable of operation in the light and that an important role of mitochondrial respiration in photosynthesizing cells is the provision of carbon skeletons for biosynthetic reactions. PMID:16665971
NASA Astrophysics Data System (ADS)
Link, Michael F.; Kim, Jounghwa; Park, Gyutae; Lee, Taehyoung; Park, Taehyun; Babar, Zaeem Bin; Sung, Kijae; Kim, Pilho; Kang, Seokwon; Kim, Jeong Soo; Choi, Yongjoo; Son, Jihawn; Lim, Ho-Jin; Farmer, Delphine K.
2017-05-01
A vehicle fleet representative of passenger vehicles driven in the Seoul Metropolitan Region was investigated for primary emissions and secondary chemistry. Exhaust was photochemically oxidized in a flow reactor to determine the ammonium nitrate (NH4NO3) aerosol formation potential from vehicles of gasoline, diesel and liquid petroleum gasoline (LPG) fuel types. Secondary formation of aerosol NH4NO3, was larger than primary emissions for all vehicle fuel types except diesel, for which negligible secondary NH4NO3 production was observed. Although diesel vehicles emitted more primary nitrogen oxides than other vehicle types, ammonia emitted from gasoline and liquid petroleum gasoline fuels types limited the secondary production of NH4NO3. The results suggest that gasoline and liquid petroleum gasoline vehicles with three-way catalysts could be an important source of ammonia for NH4NO3 aerosol formation in ammonia-limited environments, including the Seoul Metropolitan Region.
Ammonium Is Toxic for Aging Yeast Cells, Inducing Death and Shortening of the Chronological Lifespan
Santos, Júlia
2012-01-01
Here we show that in aging Saccharomyces cerevisiae (budding yeast) cells, NH4 + induces cell death associated with shortening of chronological life span. This effect is positively correlated with the concentration of NH4 + added to the culture medium and is particularly evident when cells are starved for auxotrophy-complementing amino acids. NH4 +-induced cell death is accompanied by an initial small increase of apoptotic cells followed by extensive necrosis. Autophagy is inhibited by NH4 +, but this does not cause a decrease in cell viability. We propose that the toxic effects of NH4 + are mediated by activation of PKA and TOR and inhibition of Sch9p. Our data show that NH4 + induces cell death in aging cultures through the regulation of evolutionary conserved pathways. They may also provide new insights into longevity regulation in multicellular organisms and increase our understanding of human disorders such as hyperammonemia as well as effects of amino acid deprivation employed as a therapeutic strategy. PMID:22615903
NASA Astrophysics Data System (ADS)
Miller, D. J.; Liu, Z.; Sun, K.; Tao, L.; Nowak, J. B.; Bambha, R.; Michelsen, H. A.; Zondlo, M. A.
2014-12-01
Agricultural ammonia (NH3) emissions are highly uncertain in current bottom-up inventories. Ammonium nitrate is a dominant component of fine aerosols in agricultural regions such as the Central Valley of California, especially during winter. Recent high resolution regional modeling efforts in this region have found significant ammonium nitrate and gas-phase NH3 biases during summer. We compare spatially-resolved surface and boundary layer gas-phase NH3 observations during NASA DISCOVER-AQ California with Community Multi-Scale Air Quality (CMAQ) regional model simulations driven by the EPA NEI 2008 inventory to constrain wintertime NH3 model biases. We evaluate model performance with respect to aerosol partitioning, mixing and deposition to constrain contributions to modeled NH3 concentration biases in the Central Valley Tulare dairy region. Ammonia measurements performed with an open-path mobile platform on a vehicle are gridded to 4 km resolution hourly background concentrations. A peak detection algorithm is applied to remove local feedlot emission peaks. Aircraft NH3, NH4+ and NO3- observations are also compared with simulations extracted along the flight tracks. We find NH3 background concentrations in the dairy region are underestimated by three to five times during winter and NH3 simulations are moderately correlated with observations (r = 0.36). Although model simulations capture NH3 enhancements in the dairy region, these simulations are biased low by 30-60 ppbv NH3. Aerosol NH4+ and NO3- are also biased low in CMAQ by three and four times respectively. Unlike gas-phase NH3, CMAQ simulations do not capture typical NH4+ or NO3- enhancements observed in the dairy region. In contrast, boundary layer height simulations agree well with observations within 13%. We also address observational constraints on simulated NH3 deposition fluxes. These comparisons suggest that NEI 2008 wintertime dairy emissions are underestimated by a factor of three to five. We test sensitivity to emissions by increasing the NEI 2008 NH3 emissions uniformly across the dairy region and evaluate the impact on modeled concentrations. These results are applicable to improving predictions of ammoniated aerosol loading and highlight the value of mobile platform spatial NH3 measurements to constrain emission inventories.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Vanlerberghe, G.C.; Turpin, D.H.; Joy, K.W.
The authors have determined the flow of {sup 15}N into free amino acids of the N-limited green alga Selenastrum minutum (Naeg.) Collins after addition of {sup 15}NH{sub 4}{sup +} to aerobic or anaerobic cells. Under aerobic conditions, only a small proportion of the N assimilated was retained in the free amino acid pool. However, under anaerobic conditions almost all assimilated NH{sub 4}{sup +} accumulates in alanine. This is a unique feature of anaerobic NH{sub 4}{sup +} assimilation. The pathway of carbon flow to alanine results in the production of ATP and reductant which matches exactly the requirements of NH{sub 4}{supmore » +} assimilation. Alanine synthesis is therefore an excellent strategy to maintain energy and redox balance during anaerobic NH{sub 4}{sup +} assimilation.« less
Loss-of-function and gain-of-function phenotypes of stomatocytosis mutant RhAG F65S
Stewart, Andrew K.; Shmukler, Boris E.; Vandorpe, David H.; Rivera, Alicia; Heneghan, John F.; Li, Xiaojin; Hsu, Ann; Karpatkin, Margaret; O'Neill, Allison F.; Bauer, Daniel E.; Heeney, Matthew M.; John, Kathryn; Kuypers, Frans A.; Gallagher, Patrick G.; Lux, Samuel E.; Brugnara, Carlo; Westhoff, Connie M.
2011-01-01
Four patients with overhydrated cation leak stomatocytosis (OHSt) exhibited the heterozygous RhAG missense mutation F65S. OHSt erythrocytes were osmotically fragile, with elevated Na and decreased K contents and increased cation channel-like activity. Xenopus oocytes expressing wild-type RhAG and RhAG F65S exhibited increased ouabain and bumetanide-resistant uptake of Li+ and 86Rb+, with secondarily increased 86Rb+ influx sensitive to ouabain and to bumetanide. Increased RhAG-associated 14C-methylammonium (MA) influx was severely reduced in RhAG F65S-expressing oocytes. RhAG-associated influxes of Li+, 86Rb+, and 14C-MA were pharmacologically distinct, and Li+ uptakes associated with RhAG and RhAG F65S were differentially inhibited by NH4+ and Gd3+. RhAG-expressing oocytes were acidified and depolarized by 5 mM bath NH3/NH4+, but alkalinized and depolarized by subsequent bath exposure to 5 mM methylammonium chloride (MA/MA+). RhAG F65S-expressing oocytes exhibited near-wild-type responses to NH4Cl, but MA/MA+ elicited attenuated alkalinization and strong hyperpolarization. Expression of RhAG or RhAG F65S increased steady-state cation currents unaltered by bath Li+ substitution or bath addition of 5 mM NH4Cl or MA/MA+. These oocyte studies suggest that 1) RhAG expression increases oocyte transport of NH3/NH4+ and MA/MA+; 2) RhAG F65S exhibits gain-of-function phenotypes of increased cation conductance/permeability, and loss-of-function phenotypes of decreased and modified MA/MA+ transport, and decreased NH3/NH4+-associated depolarization; and 3) RhAG transports NH3/NH4+ and MA/MA+ by distinct mechanisms, and/or the substrates elicit distinct cellular responses. Thus, RhAG F65S is a loss-of-function mutation for amine transport. The altered oocyte intracellular pH, membrane potential, and currents associated with RhAG or RhAG F65S expression may reflect distinct transport mechanisms. PMID:21849667
Vicente, José; Chicote, María-Teresa; Guerrero, Rita; Jones, Peter G.; Ramírez De Arellano, M. Carmen
1997-09-24
The complexes [Au(acac-kappaC(2))(PR(3))] (acac = acetylacetonate, R = Ph, C(6)H(4)OMe-4) react with (NH(4))ClO(4) to give amminegold(I), [Au(NH(3))(PR(3))]ClO(4), amidogold(I), [(AuPR(3))(2)(&mgr;(2)-NH(2))]ClO(4), or nitridogold(I), [(AuPR(3))(4)(&mgr;(4)-N)]ClO(4), complexes, depending on the reaction conditions. Similarly, [Au(acac-kappaC(2))(PPh(3))] reacts with (NH(3)R')OTf (OTf = CF(3)SO(3)) (1:1) or with [H(3)N(CH(2))(2)NH(2)]OTf (1:1) to give (amine)gold(I) complexes [Au(NH(2)R')(PPh(3))]OTf (R' = Me, C(6)H(4)NO(2)-4) or [(AuPPh(3))(2){&mgr;(2)-H(2)N(CH(2))(2)NH(2)}](OTf)(2), respectively. The ammonium salts (NH(2)R'(2))OTf (R' = Et, Ph) react with [Au(acac-kappaC(2))(PR(3))] (R = Ph, C(6)H(4)OMe-4) (1:2) to give, after hydrolysis, the oxonium salts [(AuPR(3))(3)(&mgr;(3)-O)]OTf (R = Ph, C(6)H(4)OMe-4). When NH(3) is bubbled through a solution of [AuCl(tht)] (tht = tetrahydrothiophene), the complex [Au(NH(3))(2)]Cl precipitates. Addition of [Au(NH(3))(2)]Cl to a solution of AgClO(4) or TlOTf leads to the isolation of [Au(NH(3))(2)]ClO(4) or [Au(NH(3))(2)]OTf, respectively. The crystal structure of [(AuPR(3))(3)(&mgr;(3)-O)]OTf.Me(2)CO (R = C(6)H(4)OMe-4) has been determined: triclinic, space group P&onemacr;, a = 14.884(3) Å, b = 15.828(3) Å, c = 16.061(3) Å, alpha = 83.39(3) degrees, beta = 86.28(3) degrees, gamma = 65.54(3) degrees, R1 (wR2) = 0.0370 (0.0788). The [(AuPR(3))(3)(&mgr;(3)-O)](+) cation shows an essentially trigonal pyramidal array of three gold atoms and one oxygen atom with O-Au-P bond angles of ca. 175 degrees and Au.Au contacts in the range 2.9585(7)-3.0505(14) Å. These cations are linked into centrosymmetric dimers through two short Au.Au [2.9585(7), 3.0919(9) Å] contacts. The gold atoms of the dimer form a six-membered ring with a chair conformation.
Cyclic variations in nitrogen uptake rate of soybean plants: ammonium as a nitrogen source
NASA Technical Reports Server (NTRS)
Henry, L. T.; Raper, C. D. Jr
1989-01-01
When NO3- is the sole nitrogen source in flowing solution culture, the net rate of nitrogen uptake by nonnodulated soybean (Glycine max L. Merr. cv Ransom) plants cycles between maxima and minima with a periodicity of oscillation that corresponds with the interval of leaf emergence. Since soybean plants accumulate similar quantities of nitrogen when either NH4+ or NO3- is the sole source in solution culture controlled at pH 6.0, an experiment was conducted to determine if the oscillations in net rate of nitrogen uptake also occur when NH4+ is the nitrogen source. During a 21-day period of vegetative development, net uptake of NH4+ was measured daily by ion chromatography as depletion of NH4+ from a replenished nutrient solution containing 1.0 millimolar NH4+. The net rate of NH4+ uptake oscillated with a periodicity that was similar to the interval of leaf emergence. Instances of negative net rates of uptake indicate that the transition between maxima and minima involved changes in influx and efflux components of net NH4+ uptake.
Li, Yuxin; Tafti, Bashir A; Shaba, Wisam; Berenji, Gholam R
2011-07-01
A 68-year-old man with history of heavy smoking was admitted for increasing falls during the past 4 weeks. Chest x-ray revealed a right upper lobe mass. Biopsy demonstrated poorly differentiated non-small-cell carcinoma. F-18 fluoride positron emission tomography/computer tomography (PET/CT) was performed to evaluate bone metastasis. Review of the sectional PET images demonstrated extraosseous fluoride uptake in the primary lung mass, as well as ring-shaped fluoride uptake in the cerebral metastatic lesion. Neither of these lesions demonstrated calcifications on CT images. The patient received radiation treatment of the brain metastasis after F-18 fluoride PET/CT study.
Lee, Do Gyun; Cho, Kun-Ching; Chu, Kung-Hui
2015-04-01
This study investigated two possible strategies, increasing ammonia oxidation activity and bioaugmenting with triclosan-degrader Sphingopyxis strain KCY1, to enhance triclosan removal in nitrifying activated sludge (NAS). Triclosan (2 mg L(-1)) was removed within 96-h in NAS bioreactors amended with 5, 25 and 75 mg L(-1) of ammonium (NH4-N). The fastest triclosan removal was observed in 25 mg NH4-NL(-1) amended-bioreactors where high ammonia oxidation occurred. Inhibition of ammonia oxidation and slower triclosan removal were observed in 75 mg NH4-NL(-1) amended-bioreactors. Triclosan removal was correlated to the molar ratio of the amount of nitrate produced to the amount of ammonium removed. Bioaugmentation with strain KCY1 did not enhance triclosan removal in the bioreactors with active ammonia oxidation. Approximately 36-42% and 59% of triclosan added were removed within 24-h by ammonia-oxidizing bacteria and unknown triclosan-degrading heterotrophs, respectively. The results suggested that increasing ammonia oxidation activity can be an effective strategy to enhance triclosan removal in NAS. Copyright © 2015 Elsevier Ltd. All rights reserved.
Ammonium Hydrosulfide: Coloring Jupiter's Clouds
NASA Astrophysics Data System (ADS)
Loeffler, Mark J.; Hudson, Reggie L.; Chanover, Nancy J.; Simon, Amy A.
2015-11-01
The appearance and composition of Jupiter’s Great Red Spot (GRS) have been studied for over a century, yet there still is no consensus for what is causing the GRS’s color. As the GRS is believed to originate in tropospheric clouds, it seems likely that one or more cloud components may contribute to the GRS's color. Recently, we have begun to investigate whether either ammonium hydrosulfide (NH4SH), a predicted cloud component, or its radiation-chemical products can produce color and/or an ultraviolet-visible spectrum similar to what has been observed on Jupiter via remote sensing (e.g., Simon et al., 2015). Our initial experiments relied on infrared spectroscopy to quantify the radiolytic and thermal stability of NH4SH and to identify the new chemical products formed during MeV ion irradiation (Loeffler et al., 2015). This DPS presentation will cover some of our most recent results detailing the ultraviolet-visible spectral and color changes observed during irradiation and post-irradiation warming of NH4SH ices. This work is funded by NASA’s Outer Planets and Planetary Atmospheres programs.
Crystallographic nature of fluoride in enameloids of fish.
LeGeros, R Z; Suga, S
1980-01-01
X-ray diffraction studies on calcified tissues (teeth and/or scales) of fish and of shark showed that the presence of fluoride affects the crystallite size and lattice parameters of the apatite phase. An inverse correlation between F contents (ranging from 0.2 to 3.8 wt% F) and alpha-axis dimensions (9.441 to 9.375 +/- 0.003 A) exists for both synthetic and enameloid apatites and is consistent with the F-for-OH substitution in the apatite, idealized as Ca10(PO4)6(OH)2 and Ca10(PO4)6F2, for fluoride-free and maximum fluoride-substituted apatite, respectively. In synthetic systems, the incorporation of F is found to be dependent on the F concentration of the media from which the apatite formed. This dependency is also observed between F content of the dentine apatites and the F concentration of the water from which the fish can (i.e., less than 0.08 ppmF in fresh water, about 1.3 ppm in seawater). However, no such dependency was observed between the F incorporation in fish enameloid apatite and the F concentration in the water of origin. In some cases, the F incorporated in the enameloid apatite is much in excess of what can be expected from the F concentration of water. These observations suggest that in some fish, a fluoride-concentrating mechanism is operative during the formation of the enameloid but not during the formation of the dentine, and this mechanism appears to be specie-related.
Vapour pressure of ammonium chloride aerosol: Effect of temperature and humidity
NASA Astrophysics Data System (ADS)
Pio, Casimiro A.; Harrison, Roy M.
The effect of relative humidity (RH) on the constant for dissociation of ammonium chloride into gaseous HCl and NH 3 has been estimated for different temperatures, using thermodynamic data. At RH over 75-85% the ammonium chloride aerosol exists in the liquid phase, with the dissociation constant two orders of magnitude lower at 98% RH than for solid aerosol at the same temperature. It is predicted that ammonium chloride aqueous aerosol forms predominantly in fogwater and cloud droplets, and in regions where local emissions of NH 3 are important.
NASA Astrophysics Data System (ADS)
Arsene, Cecilia; Olariu, Romeo Iulian; Zarmpas, Pavlos; Kanakidou, Maria; Mihalopoulos, Nikolaos
2011-02-01
Atmospheric loadings of the aerosols coarse (particles of AED > 1.5 μm) and fine fractions (particles of AED < 1.5 μm) were determined in Iasi, north-eastern Romania from January 2007 to March 2008. Concentrations of water soluble ions (SO 42-, NO 3-, Cl -, C 2O 42-, NH 4+, K +, Na +, Ca 2+ and Mg 2+) were measured using ion chromatography (IC). In the coarse particles, calcium and carbonate are the main ionic constituents (˜65%), whereas in the fine particles SO 42-, NO 3-, Cl - and NH 4+ are the most abundant. Temperature and relative humidity (RH) associated with increased concentrations of specific ions might be the main factors controlling the aerosol chemistry at the investigated site. From August 2007 to March 2008 high RH (as high as 80% for about 82% of the investigated period) was prevailing in Iasi and the collected particles were expected to have deliquesced and form an internal mixture. We found that in fine particles ammonium nitrate (NH 4NO 3) is important especially under conditions of NH 4+/SO 42- ratio higher than 1.5 and high RH (RH above deliquescence of NH 4Cl, NH 4NO 3 and (NH 4) 2SO 4). At the investigated site large ammonium artifacts may occur due to inter-particle interaction especially under favorable meteorological conditions. A methodology for estimating the artifact free ambient ammonium concentration is proposed for filter pack sampling data of deliquesced particles. Nitrate and sulfate ions in coarse particles are probably formed via reactions of nitric and sulfuric acid with calcium carbonate and sodium chloride which during specific seasons are abundant at the investigated site. In the fine mode sulfate concentration maximized during summer (due to enhanced photochemistry) and winter (due to high concentration of SO 2 emitted from coal burning). Natural contributions, dust or sea-salt related, prevail mainly in the coarse particles. From May 2007 to August 2007, when air masses originated mainly from Black Sea, in the coarse particles an nss-Cl/Na ratio of 1.11 was measured. Elevated levels of chloride in fine particles have been attributed to waste burning in the proximity of the investigated site or to NaCl salt widely spread on roads during winter. Considering the importance of atmospheric aerosols, this study may constitute a reference point for Eastern Europe.
NASA Astrophysics Data System (ADS)
Leng, Yan-Li; Zhang, Jian-Hui; Li, Qiao; Zhang, You-Ming; Lin, Qi; Yao, Hong; Wei, Tai-Bao
2016-10-01
A colorimetric and fluorescent dual-channel fluoride chemosensor N,N‧-bis (4-diethylaminosalicylidene) hydrazine (sensor S) bearing two imine groups has been designed and synthesized. This structurally simple probe displays rapid response and high selectivity for fluoride over other common anions (Cl-, Br-, I-, AcO-, H2PO4-, HSO4-, ClO4-, CN- and SCN-) in a highly polar aqueous DMSO solution. Mechanism studies suggested that the sensor firstly combined with F- through hydrogen bonds and then experienced the deprotonation process at higher concentrations of F- anion to the two Ar-OH groups. The detection limit was 5.78 × 10- 7 M of F-, which points to the high detection sensitivity. Test strips based on sensor S were fabricated, which could act as a convenient and efficient F- test kit to detect F- for ;in-the-field; measurement.
Salomão, Priscila Maria Aranda; de Oliveira, Flávia Amadeu; Rodrigues, Paula Danielle; Al-Ahj, Luana Polioni; Gasque, Kellen Cristina da Silva; Jeggle, Pia; Buzalaf, Marilia Afonso Rabelo; de Oliveira, Rodrigo Cardoso; Edwardson, John Michael
2017-01-01
Objective Titanium tetrafluoride (TiF4) has shown promising effect in preventing tooth lesions. Therefore, we compared the cytotoxicity of TiF4 with sodium fluoride (NaF) (already applied in Dentistry) considering different fluoride concentrations, pH values and experimental models. Materials and methods Step 1) NIH/3T3 fibroblasts were exposed to mediums containing NaF or TiF4 (from 0.15 to 2.45% F), both at native and adjusted pH, for 6 h. Step 2) NIH/3T3 were exposed to NaF or TiF4 varnishes with 0.95, 1.95 or 2.45% F (native pH), for 6, 12 or 24 h. We applied MTT (1st and 2nd steps) and Hoescht/PI stain (2nd step) assays. Step 3) NIH/3T3 were exposed to NaF or TiF4 varnish (2.45% F), at native pH, for 6 or 12 h. The cell stiffness was measured by atomic force microscopy (AFM). Results Step 1) All cells exposed to NaF or TiF4 mediums died, regardless of the F concentration and pH. Step 2) Both varnishes, at 1.90 and 2.45% F, reduced cell viability by similar extents (33–86% at 6 h, 35–93% at 12 h, and 87–98% at 24 h) compared with control, regardless of the type of fluoride. Varnishes with 0.95% F did not differ from control. Step 3) TiF4 and NaF reduced cell stiffness to a similar extent, but only TiF4 differed from control at 6 h. Conclusions Based on the results of the 3 experimental steps, we conclude that TiF4 and NaF have similar cytotoxicity. The cytotoxicity was dependent on F concentration and exposure time. This result gives support for testing the effect of TiF4 varnish in vivo. PMID:28614381
NASA Technical Reports Server (NTRS)
Keller, M.; Kaplan, W. A.; Wofsy, S. C.; Da Costa, Jose Maria
1988-01-01
Undisturbed oxisols in a central Amazon tropical forest were fertilized with ammonium, nitrate, or phosphate. Enhanced emissions of N2O were observed for all treatments within one day of fertilization, with the response NO3(-) much greater than NH4(+) much greater than PO4(3-). Approximately, 0.5 percent of applied NO3(-) was converted to N2O within two weeks after application, with less than 0.1 percent of the NH4(+) converted to N2O. These experiments reveal a potentially large source of N2O from microbial reduction of NO3(-) in the clay soils of Amazonia.
Delbem, Alberto Carlos Botazzo; Souza, José Antonio Santos; Zaze, Ana Carolina Soares Fraga; Takeshita, Eliana Mitsue; Sassaki, Kikue Takebayashi; Moraes, João Carlos Silos
2014-01-01
The present study analyzed the action of sodium trimetaphosphate (TMP) and/or fluoride on hydroxyapatite. Hydroxyapatite powder was suspended in different solutions: deionized water, 500 µg F/mL, 1,100 µg F/mL, 1%TMP, 3%TMP, 500 µg F/mL plus 1%TMP and 500 µg F/mL plus 3%TMP. The pH value of the solutions was reduced to 4.0 and after 30 min, raised to 7.0 (three times). After pH-cycling, the samples were analyzed by X-ray diffraction and infrared spectroscopy. The concentrations of calcium fluoride, fluoride, calcium and phosphorus were also determined. Adding 1% or 3% TMP to the solution containing 500 µg F/mL produced a higher quantity of calcium fluoride compared to samples prepared in a 1,100 µg F/mL solution. Regarding the calcium concentration, samples prepared in solutions of 1,100 µg F/mL and 500 µg F/mL plus TMP were statistically similar and showed higher values. Using solutions of 1,100 µg F/mL and 500 µg F/mL plus TMP resulted in a calcium/phosphorus ratio close to that of hydroxyapatite. It is concluded that the association of TMP and fluoride favored the precipitation of a more stable hydroxyapatite.
Zhang, Shasha; Fang, Yunting; Xi, Dan
2015-07-30
There are several preparation methods for the measurement of the nitrogen (N) isotopic composition of ammonium (NH4 (+) ) in different types of samples (freshwater, saltwater and soil extracts). The diffusion method is the most popular and it involves NH4 (+) in solutions being released under alkaline conditions and then immediately trapped by an acidified filter. However, the traditional preparation is designed for samples with large volume and relatively high N concentrations. The performance of diffusion for small-volume samples (e.g., a few milliliters) remains unknown. We examined the overall performance of micro-diffusion on 5 mL samples on varying the incubation time, temperature and initial NH4 (+) concentration. The trapped ammonia was chemically converted into nitrous oxide (N2 O) with hypobromite and hydroxylamine in sequence. The produced N2 O was analyzed by a commercially available purge and cryogenic trap system coupled to an isotope ratio mass spectrometer. We found that diffusion can be complete with no more than 7 days of treatment at 37 °C. Increasing the temperature to 50 °C and the incubation time to 11 days did not improve the overall performance. There were no significant differences in the overall performance during diffusion with NH4 (+) concentrations from 15 to 60 μM. The blank size was relatively large, and the N contamination might come from the reagents especially KCl salts. The method presented here combines micro-diffusion and hypobromite oxidation and hydroxylamine reduction. It is suitable for samples with small volume and low NH4 (+) concentrations. Our study demonstrates that the NH4 (+) concentrations in samples can be as low as 15 μM, and a volume of 5 mL is sufficient for this method. We suggest that this method can be used for the routine determination of (15) N/(14) N for either natural abundance or (15) N-enriched NH4 (+) . Copyright © 2015 John Wiley & Sons, Ltd.
Growth of Ammonium Bisulfate Clusters by Adsorption of Oxygenated Organic Molecules
DOE Office of Scientific and Technical Information (OSTI.GOV)
DePalma, Joseph W.; Wang, Jian; Wexler, Anthony S.
Quantum chemical calculations were employed to model the interactions of the [(NH 4 +) 4(HSO 4 -) 4] ammonium bisulfate cluster with one or more molecular products of monoterpene oxidation. A strong interaction was found between the bisulfate ion of the cluster and a carboxylic acid, aldehyde or ketone functionality of the organic molecule. Free energies of adsorption for carboxylic acids were in the -70 to -73 kJ/mol range, while those for aldehydes and ketones were in the -46 to -50 kJ/mol range. These values suggest that a small ambient ammonium bisulfate cluster, such as the [(NH 4 +) 4(SOmore » 4 -) 4] cluster, is able to adsorb an oxygenated organic molecule. Although adsorption of the first molecule is highly favorable, adsorption of subsequent molecules is not, suggesting that sustained uptake of organic molecules does not occur, and thus is not a pathway for continuing growth of the cluster. This result is consistent with ambient measurements showing that particles below ~1 nm grow slowly, while those above 1 nm grow at an increasing rate presumably due to a lower surface energy barrier enabling the uptake of organic molecules. This work provides insight into the molecular level interactions which affect sustained cluster growth by uptake of organic molecules.« less
Growth of Ammonium Bisulfate Clusters by Adsorption of Oxygenated Organic Molecules
DePalma, Joseph W.; Wang, Jian; Wexler, Anthony S.; ...
2015-10-21
Quantum chemical calculations were employed to model the interactions of the [(NH 4 +) 4(HSO 4 -) 4] ammonium bisulfate cluster with one or more molecular products of monoterpene oxidation. A strong interaction was found between the bisulfate ion of the cluster and a carboxylic acid, aldehyde or ketone functionality of the organic molecule. Free energies of adsorption for carboxylic acids were in the -70 to -73 kJ/mol range, while those for aldehydes and ketones were in the -46 to -50 kJ/mol range. These values suggest that a small ambient ammonium bisulfate cluster, such as the [(NH 4 +) 4(SOmore » 4 -) 4] cluster, is able to adsorb an oxygenated organic molecule. Although adsorption of the first molecule is highly favorable, adsorption of subsequent molecules is not, suggesting that sustained uptake of organic molecules does not occur, and thus is not a pathway for continuing growth of the cluster. This result is consistent with ambient measurements showing that particles below ~1 nm grow slowly, while those above 1 nm grow at an increasing rate presumably due to a lower surface energy barrier enabling the uptake of organic molecules. This work provides insight into the molecular level interactions which affect sustained cluster growth by uptake of organic molecules.« less
Biocompatible inorganic nanoparticles for [18F]-fluoride binding with applications in PET imaging
Jauregui-Osoro, Maite; Williamson, Peter A.; Glaria, Arnaud; Sunassee, Kavitha; Charoenphun, Putthiporn; Green, Mark A.; Mullen, Gregory E. D.; Blower, Philip J.
2014-01-01
A wide selection of insoluble nanoparticulate metal salts was screened for avid binding of [18F]-fluoride. Hydroxyapatite and aluminium hydroxide nanoparticles showed particularly avid and stable binding of [18F]-fluoride in various biological media. The in vivo behaviour of the [18F]-labelled hydroxyapatite and aluminium hydroxide particles was determined by PET-CT imaging in mice. [18F]-labelled hydroxyapatite was stable in circulation and when trapped in various tissues (lung embolisation, subcutaneous and intramuscular), but accumulation in liver via reticuloendothelial clearance was followed by gradual degradation and release of [18F]-fluoride (over a period of 4 h) which accumulated in bone. [18F]-labelled aluminium hydroxide was also cleared to liver and spleen but degraded slightly even without liver uptake (subcutanenous and intramuscular). Both materials have properties that are an attractive basis for the design of molecular targeted PET imaging agents labelled with 18F. PMID:21394352
Wang, L Y; Song, E H; Deng, T T; Zhou, Y Y; Liao, Z F; Zhao, W R; Zhou, B; Zhang, Q Y
2017-08-14
Herein, a Mn 4+ ion doped complex ternary-alkaline fluoride red phosphor K 2 NaAlF 6 :Mn 4+ has been synthesized through a facile two-step co-precipitation method at room temperature. The crystal structure, morphological properties and influence of the dopant concentration, temperature and humidity on luminescence properties as well as the performance of the as-synthesized phosphor used in white light emitting diodes (WLEDs) were investigated carefully. Intense absorption in the blue region (∼460 nm) and bright narrow-band red emission (∼630 nm) with high color purity were observed from this resultant powder. Temperature-dependent investigation and reliability examination in a HTHH environment (85 °C high temperature and 85% high humidity) indicate that the obtained ternary-alkaline fluoride phosphor K 2 NaAlF 6 :Mn 4+ presents more exceptional thermal quenching behavior and longevity compared to some other binary-alkaline fluorides. Moreover, using K 2 NaAlF 6 :Mn 4+ as a red light component, a warm WLED with a preferable color rendering index (R a = 85.5) and luminous efficacy (LE = 91.2 lm W -1 ) as well as a low corresponding color temperature (CCT = 3650 K) is easily achieved, further revealing the great potential of the as-prepared ternary-alkaline fluoride red phosphor K 2 NaAlF 6 :Mn 4+ for WLED applications.
Hsieh, Chia-Fang; Guerrero, Lorna; Méndez, Ramón; Mosquera-Corral, Anuska; Vidal, Gladys
2017-01-01
The effect of free ammonia (NH3 or FA), free nitrous acid (HNO2 or FNA), and total alkalinity (TA) on the performance of a partial nitrification (PN) sequencing batch reactor (SBR) treating anaerobically pretreated pig slurry was studied. The SBR was operated under alternating oxic/anoxic (O/A) conditions and was fed during anoxic phases. This strategy allowed using organic matter to partially remove nitrite (NO2−) and nitrate (NO3−) generated during oxic phases. The desired NH4+ to NO2− ratio of 1.3 g N/g N was obtained when an Ammonium Loading Rate (ALR) of 0.09 g NH4+-N/L·d was applied. The system was operated at a solid retention time (SRT) of 15–20 d and dissolved oxygen (DO) levels higher than 3 mg O2/L during the whole operational period. PN mainly occurred caused by the inhibitory effect of FNA on nitrite oxidizing bacteria (NOB). Once HNO2 concentration was negligible, NH4+ was fully oxidized to NO3− in spite of the presence of FA. The use of biomass acclimated to ammonium as inoculum avoided a possible effect of FA on NOB activity. PMID:29018815
Cui, Xiaoqiang; Hao, Hulin; Zhang, Changkuan; He, Zhenli; Yang, Xiaoe
2016-01-01
The objective of this study was to investigate the relationship between Cd(2+)/NH4(+) sorption and physicochemical properties of biochars produced from different wetland plants. Biochars from six species of wetland plants (i.e., Canna indica, Pennisetum purpureum Schum, Thalia dealbata, Zizania caduciflora, Phragmites australis and Vetiveria zizanioides) were obtained at 500°C and characterized, and their sorption for ammonium and cadmium was determined. There were significant differences in elemental composition, functional groups and specific surface area among the biochars derived from different wetland plant species. Sorption of ammonium and cadmium on the biochars could be described by a pseudo second order kinetic model, and the simple Langmuir model fits the isotherm data better than the Freundlich or Temkin model. The C. indica derived biochar had the largest sorption capacity for NH4(+) and Cd(2+), with a maximum sorption of 13.35 and 125.8mgg(-1), respectively. P. purpureum Schum derived biochar had a similar maximum sorption (119.3mgg(-1)) for Cd(2+). Ammonium sorption was mainly controlled by cation exchange, surface complexation with oxygen-containing functional groups and the formation of magnesium ammonium phosphate compounds, whereas for Cd(2+) sorption, the formation of cadmium phosphate precipitates, cation exchange and binding to oxygen-containing groups were the major possible mechanisms. In addition, the sorption of ammonium and cadmium was not affected by surface area and microporosity of the biochars. Copyright © 2015 Elsevier B.V. All rights reserved.
Sadeghi, Saman; Liang, Vincent; Cheung, Shilin; Woo, Suh; Wu, Curtis; Ly, Jimmy; Deng, Yuliang; Eddings, Mark; van Dam, R. Michael
2015-01-01
A brass-platinum electrochemical micro flow cell was developed to extract [18F]fluoride from an aqueous solution and release it into an organic based solution, suitable for subsequent radio-synthesis, in a fast and reliable manner. This cell does not suffer electrode erosion and is thus reusable while operating faster by enabling increased voltages. By optimizing temperature, trapping and release potentials, flow rates, and electrode materials, an overall [18F]fluoride trapping and release efficiency of 84±5% (n=7) was achieved. X-ray photoelectron spectroscopy (XPS) was used to analyze electrode surfaces of various metal-metal systems and the findings were correlated with the performance of the electrochemical cell. To demonstrate the reactivity of the released [18F]fluoride, the cell was coupled to a flow-through reactor and automated synthesis of [18F]FDG with a repeatable decay-corrected yield of 56±4% (n=4) was completed in <15 min. A multi-human dose of 5.92 GBq [18F]FDG was also demonstrated. PMID:23474380
Scherzer, Sönke; Krol, Elzbieta; Kreuzer, Ines; Kruse, Jörg; Karl, Franziska; von Rüden, Martin; Escalante-Perez, Maria; Müller, Thomas; Rennenberg, Heinz; Al-Rasheid, Khaled A S; Neher, Erwin; Hedrich, Rainer
2013-09-09
Ammonium transporter (AMT/MEP/Rh) superfamily members mediate ammonium uptake and retrieval. This pivotal transport system is conserved among all living organisms. For plants, nitrogen represents a macronutrient available in the soil as ammonium, nitrate, and organic nitrogen compounds. Plants living on extremely nutrient-poor soils have developed a number of adaptation mechanisms, including a carnivorous lifestyle. This study addresses the molecular nature, function, and regulation of prey-derived ammonium uptake in the Venus flytrap, Dionaea muscipula, one of the fastest active carnivores. The Dionaea muscipula ammonium transporter DmAMT1 was localized in gland complexes where its expression was upregulated upon secretion. These clusters of cells decorating the inner trap surface are engaged in (1) secretion of an acidic digestive enzyme cocktail and (2) uptake of prey-derived nutrients. Voltage clamp of Xenopus oocytes expressing DmAMT1 and membrane potential recordings with DmAMT1-expressing Dionaea glands were used to monitor and compare electrophysiological properties of DmAMT1 in vitro and in planta. DmAMT1 exhibited the hallmark biophysical properties of a NH4(+)-selective channel. At depolarized membrane potentials (Vm = 0), the Km (3.2 ± 0.3 mM) indicated a low affinity of DmAMT1 for ammonium that increased systematically with negative going voltages. Upon hyperpolarization to, e.g., -200 mV, a Km of 0.14 ± 0.015 mM documents the voltage-dependent shift of DmAMT1 into a NH4(+) transport system of high affinity. We suggest that regulation of glandular DmAMT1 and membrane potential readjustments of the endocrine cells provide for effective adaptation to varying, prey-derived ammonium sources. Copyright © 2013 Elsevier Ltd. All rights reserved.
Dental caries and dental fluorosis at varying water fluoride concentrations.
Heller, K E; Eklund, S A; Burt, B A
1997-01-01
The purpose of this study was to investigate the relationships between caries experience and dental fluorosis at different fluoride concentrations in drinking water. The impact of other fluoride products also was assessed. This study used data from the 1986-87 National Survey of US School-children. Fluoride levels of school water were used as an indicator of the children's water fluoride exposure. The use of fluoride drops, tablets, professional fluoride treatments, and school fluoride rinses were ascertained from caregiver questionnaires. Only children with a single continuous residence (n = 18,755) were included in this analysis. The sharpest declines in dfs and DMFS were associated with increases in water fluoride levels between 0 and 0.7 ppm F, with little additional decline between 0.7 and 1.2 ppm F. Fluorosis prevalence was 13.5 percent, 21.7 percent, 29.9 percent, and 41.4 percent for children who consumed < 0.3, 0.3 to < 0.7, 0.7 to 1.2, and > 1.2 ppm F water. In addition to fluoridated water, the use of fluoride supplements was associated with both lower caries and increased fluorosis. A suitable trade-off between caries and fluorosis appears to occur around 0.7 ppm F. Data from this study suggest that a reconsideration of the policies concerning the most appropriate concentrations for water fluoridation might be appropriate for the United States.
Jiang, Yiqi; Wang, Hong; Wang, Wannan; Deng, Liangwei; Wang, Wenguo
2018-05-01
Liquid digestate (LD) is highly turbid and contains ammonium (NH 4 + -N), which negatively influences microalgal growth. Therefore, a method of reducing LD turbidity and NH 4 + -N content is proposed, using struvite precipitation. To obtain struvite precipitation supernatant with an ideal UV transmittance, NH 4 + -N concentration, and N/P ratio for microalgal growth, the effects of pH and the molar ratio of NH 4 + /Mg 2+ /PO 4 3- were studied. Results show that the optimal NH 4 + /Mg 2+ /PO 4 3- molar ratio was 1:1.5:1.5, with a pH value of 8.5, following NaOH addition. Gray relational analysis (GRA) was applied to obtain a relative gray scale for the evaluation of multiple outputs. Results show that Chlorella regularis FACHB-1068 was the optimal microalgae species to support growth in the struvite precipitation supernatant. Using struvite precipitation and treatment with cultured C. regularis FACHB-1068 for 7 days, the removal efficiencies of NH 4 + -N, PO 4 3- -P, and COD in LD were 96.52, 99.33, and 35.30%, respectively.
Zhang, Qian; Lin, Bing; Hong, Junming; Chang, Chang-Tang
2017-02-01
This study focuses on the effectiveness of zeolite (10% CF-Z [0.5]) hydrothermally synthesized from waste quartz sand and calcium fluoride (CF) for ammonium ion and heavy metal removal. Zeolite was characterized through powder X-ray diffraction, Fourier-transform infrared spectroscopy, micromeritics N 2 adsorption/desorption analysis, and field emission scanning electron microscopy. The effects of CF addition, Si/Al ratio, initial ammonium concentration, solution pH, and temperature on the adsorption of ammonium on 10% CF-Z (0.5) were further examined. Results showed that 10% CF-Z (0.5) was a single-phase zeolite A with cubic-shaped crystals and 10% CF-Z (0.5) efficiently adsorbs ammonium and heavy metals. For instance, 91% ammonium (10 mg L -1 ) and 93% lead (10 mg L -1 ) are removed. The adsorption isotherm, kinetics, and thermodynamics of ammonium adsorption on 10% CF-Z (0.5) were also theoretically analyzed. The adsorption isotherm of ammonium and lead on 10% CF-Z (0.5) in single systems indicated that Freundlich model provides the best fit for the equilibrium data, whereas pseudo-second-order model best describes the adsorption kinetics. The adsorption degree of ions on 10% CF-Z (0.5) in mixed systems exhibits the following pattern: lead > ammonium > cadmium > chromium.
Burbank, Brant D; Cooper, Ryan L; Kava, Alyssa; Hartjes, Jennifer M; McHale, William A; Latta, Mark A; Gross, Stephen M
2017-04-01
To determine if pit-and-fissure sealants with microencapsulated remineralizing agents with sustained release of fluoride, calcium and phosphate ions could promote enamel fluoride uptake by demineralized tooth structure. Sealants that contained 5 w/w% microcapsules with aqueous solutions of 5M Ca(NO3)2 or 0.8M NaF or 6.0M K2HPO4 or a mixture of all three were prepared. Ion release profiles were measured as a function of time. Enamel fluoride uptake by demineralized tooth structure was determined. Sustained release of fluoride, calcium and phosphate ions from a sealant was demonstrated. Fluoride uptake by demineralized enamel was significantly increased compared to a control sealant manufactured without microcapsules (P< 0.01). Bovine enamel that contained 2.2±2.1 µg F/g of enamel prior to exposure to a sealant without microcapsules had 2.3±0.5 after 90 days. Enamel exposed to sealant with 5w/% NaF microcapsules went from 3.5±3.5 µg F/g of enamel prior to exposure to 148±76 after 90 days. Enamel exposed to sealant with 2 w/w% NaF, 2 w/w% Ca(NO3)2 and 1 w/w% K2HPO4 microcapsules went from 1.7±0.7 µg F/g of enamel prior to exposure to 190±137 after 90 days. Sealants with encapsulated remineralizing agents were capable of releasing biologically available fluoride, calcium, and phosphate ions. Incorporation of these microcapsules in pit and fissure sealants is a promising method for remineralization determined by enamel fluoride uptake measurements.
Vallet, Valérie; Wahlgren, Ulf; Szabó, Zoltán; Grenthe, Ingmar
2002-10-21
The reaction mechanism for the exchange of fluoride in UO(2)F(5)(3-) and UO(2)F(4)(H(2)O)(2-) has been investigated experimentally using (19)F NMR spectroscopy at -5 degrees C, by studying the line broadening of the free fluoride, UO(2)F(4)(2-)(aq) and UO(2)F(5)(3-), and theoretically using quantum chemical methods to calculate the activation energy for different pathways. The new experimental data allowed us to make a more detailed study of chemical equilibria and exchange mechanisms than in previous studies. From the integrals of the different individual peaks in the new NMR spectra, we obtained the stepwise stability constant K(5) = 0.60 +/- 0.05 M(-1) for UO(2)F(5)(3-). The theoretical results indicate that the fluoride exchange pathway of lowest activation energy, 71 kJ/mol, in UO(2)F(5)(3-) is water assisted. The pure dissociative pathway has an activation energy of 75 kJ/mol, while the associative mechanism can be excluded as there is no stable UO(2)F(6)(4-) intermediate. The quantum chemical calculations have been made at the SCF/MP2 levels, using a conductor-like polarizable continuum model (CPCM) to describe the solvent. The effects of different model assumptions on the activation energy have been studied. The activation energy is not strongly dependent on the cavity size or on interactions between the complex and Na(+) counterions. However, the solvation of the complex and the leaving fluoride results in substantial changes in the activation energy. The mechanism for water exchange in UO(2)F(4)(H(2)O)(2-) has also been studied. We could eliminate the associative mechanism, the dissociative mechanism had the lowest activation energy, 39 kJ/mol, while the interchange mechanism has an activation energy that is approximately 50 kJ/mol higher.
DOE Office of Scientific and Technical Information (OSTI.GOV)
Behrenfeld, M.J.; Lean, D.R.S.; Lee, H. II
1995-02-01
Ultraviolet-B radiation (UVBR: 290-320 nm) inhibited ammonium uptake ({rho}{sub NH4}) and nitrate uptake ({rho}{sub NO3}) in natural plankton assemblages collected during a transect from 37{degrees}N to 55{degrees}N in the Pacific Ocean. Comparison of responses in {rho}{sub NH4} to ambient solar- and lamp-enhanced UVBR spectra allowed calculation of an action spectrum for {rho}{sub NH4} inhibition. The slope of the action spectrum for {rho}{sub NH4} is half as steep as action spectra for UVBR inhibition of photosynthetic carbon uptake. Consequently, UVBR-induced photoinhibition of {rho}{sub NH4} extends to greater depths than inhibition of carbon fixation due to the greater relative effect of longermore » UVBR wavelengths. Inhibition of {rho}{sub NH4} was dependent upon UVBR dose when doses were weighted by the {rho}{sub NH4} action spectrum. Dependence of UVBR inhibition of {rho}{sub NH4} on dose rate was not apparent. We found that near-surface {rho}{sub NH4} and {rho}{sub NO3} can be overestimated in excess of 50% when measured using standard incubation vessels made of UVBR-absorbing materials such as polycarbonate. 68 refs., 9 figs., 1 tab.« less
NASA Astrophysics Data System (ADS)
Li, Long; Lollar, Barbara Sherwood; Li, Hong; Wortmann, Ulrich G.; Lacrampe-Couloume, Georges
2012-05-01
Ammonium/ammonia is an essential nutrient and energy source to support life in oceanic and terrestrial hydrothermal systems. Thus the stability of ammonium is crucial to determine the habitability or ecological structure in hydrothermal environments, but still not well understood. To date, the lack of constraints on nitrogen isotope fractionations between ammonium and ammonia has limited the application of nitrogen isotopes to trace (bio)geochemical processes in such environments. In this study, we carried out laboratory experiments to (1) examine the stability of ammonium in an ammonium sulfate solution under temperature conditions from 20 to 70 °C and pH from 2.1 to 12.6 and (2) determine nitrogen isotope fractionation between ammonium and ammonia. Our experimental results show that ammonium is stable under the experimental temperatures when pH is less than 6. In experiments with starting pH greater than 8, significant ammonium was lost as a result of dissociation of ammonium and degassing of ammonia product. Nitrogen concentrations in the fluids decreased by more than 50% in the first two hours, indicating extremely fast effusion rates of ammonia. This implies that ammonium at high pH fluids (e.g., Lost City Hydrothermal Vents, Oman ophiolite hyperalkaline springs) may not be stable. Habitable environments may be more favorable at the leading edge of a pH gradient toward more acidic conditions, where the fluid can efficiently trap any ammonia transferred from a high pH vent. Although modeling shows that high temperature, low pH hydrothermal vents (e.g., Rainbow hydrothermal vent) may have the capability to retain ammonium, their high temperatures may limit habitability. The habitable zone associated with such a hydrothermal vent is likely at the lower front of a temperature gradient. In contrast, modeling of ammonium in deep terrestrial systems, suggests that saline fracture waters in crystalline rocks such as described in the Canadian Shield and in the Witwatersrand Basin, South Africa may also provide habitable environments for life. The nitrogen isotope results of remaining ammonium from the partial dissociation experiments fit well with a batch equilibrium model, indicating equilibrium nitrogen isotope fractionations have been reached between ammonium and its dissociation product aqueous ammonia. Modeling yielded nitrogen isotope fractionations between ammonium and aqueous ammonia were 45.4‰ at 23 °C, 37.7‰ at 50 °C, and 33.5‰ at 70 °C, respectively. A relationship between nitrogen equilibrium isotope fractionation and temperature is determined for the experimental temperature range as: 103·lnα(aq)=25.94×{103}/{T}-42.25 Integrated with three previous theoretical estimates on nitrogen isotope equilibrium fractionations between ammonium and gaseous ammonia, we achieved three possible temperature-dependent nitrogen isotope equilibrium fractionation between aqueous ammonia and gaseous ammonia:
Thermal energy storage material
Leifer, Leslie
1976-01-01
A thermal energy storage material which is stable at atmospheric temperature and pressure and has a melting point higher than 32.degree.F. is prepared by dissolving a specific class of clathrate forming compounds, such as tetra n-propyl or tetra n-butyl ammonium fluoride, in water to form a substantially solid clathrate. The resultant thermal energy storage material is capable of absorbing heat from or releasing heat to a given region as it transforms between solid and liquid states in response to temperature changes in the region above and below its melting point.
Brennan, R B; Clifford, E; Devroedt, C; Morrison, L; Healy, M G
2017-03-01
Landfill leachate is the result of water percolating through waste deposits that have undergone aerobic and anaerobic microbial decomposition. In recent years, increasingly stringent wastewater discharge requirements have raised questions regarding the efficacy of co-treatment of leachate in municipal wastewater treatment plants (WWTPs). This study aimed to (1) examine the co-treatment of leachate with a 5-day biochemical oxygen demand (BOD 5 ): chemical oxygen demand (COD) ratio less than or slightly greater than 0.26 (intermediate age leachate) in municipal WWTPs (2) quantify the maximum hydraulic and mass (expressed as mass nitrogen or COD) loading of landfill leachate (as a percentage of the total influent loading rate) above which the performance of a WWTP may be inhibited, and (3) quantify the impact of a range of hydraulic loading rates (HLRs) of young and intermediate age leachate, loaded on a volumetric basis at 0 (study control), 2, 4 and 10% (volume landfill leachate influent as a percentage of influent municipal wastewater), on the effluent ammonium concentrations. The leachate loading regimes examined were found to be appropriate for effective treatment of intermediate age landfill leachate in the WWTPs examined, but co-treatment may not be suitable in WWTPs with low ammonium-nitrogen (NH 4 -N) and total nitrogen (TN) emission limit values (ELVs). In addition, intermediate leachate, loaded at volumetric rates of up to 4% or 50% of total WWTP NH 4 -N loading, did not significantly inhibit the nitrification processes, while young leachate, loaded at volumetric rates greater of than 2% (equivalent to 90% of total WWTP NH 4 -N loading), resulted in a significant decrease in nitrification. The results show that current hydraulic loading-based acceptance criteria recommendations should be considered in the context of leachate NH 4 -N composition. The results also indicate that co-treatment of old leachate in municipal WWTPs may represent the most sustainable solution for ongoing leachate treatment in the cases examined. Copyright © 2016 Elsevier Ltd. All rights reserved.
Structural and electrical characterization of tamarind seed polysaccharide (TSP) doped with NH4HCO2
NASA Astrophysics Data System (ADS)
Premalatha, M.; Mathavan, T.; Selvasekarapandian, S.; Selvalakshmi, S.
2018-04-01
In the modern era, development of electrochemical energy devices such as batteries, fuel cells and supercapacitors gain attention due to the deficiency of renewable energy resources. More specifically, proton conducting materials create prime interest in the development of electrochemical devices. In this regards, a novel proton conducting biopolymer electrolyte based on Tamarind Seed Polysaccharide (TSP) was synthesized with different concentration of ammonium formate (NH4HCO2). The amorphous nature of the polymer electrolytes has been identified by XRD technique. The observed ionic conductivity values reveal that the biopolymer containing 1 g TSP: 0.4 g NH4HCO2 has highest ionic conductivity 1.23×10-3 S cm-1.
2016-01-01
The development of a practical and scalable process for the asymmetric synthesis of sitagliptin is reported. Density functional theory calculations reveal that two noncovalent interactions are responsible for the high diastereoselection. The first is an intramolecular hydrogen bond between the enamide NH and the boryl mesylate S=O, consistent with MsOH being crucial for high selectivity. The second is a novel C–H···F interaction between the aryl C5-fluoride and the methyl of the mesylate ligand. PMID:25799267
Crystal structure of dimethylammonium hydrogen oxalate hemi(oxalic acid)
Diallo, Waly; Gueye, Ndongo; Crochet, Aurélien; Plasseraud, Laurent; Cattey, Hélène
2015-01-01
Single crystals of the title salt, Me2NH2 +·HC2O4 −·0.5H2C2O4, were isolated as a side product from the reaction involving Me2NH, H2C2O4 and Sn(n-Bu)3Cl in a 1:2 ratio in methanol or by the reaction of the (Me2NH2)2C2O4 salt and Sn(CH3)3Cl in a 2:1 ratio in ethanol. The asymmetric unit comprises a dimethylammonium cation (Me2NH2 +), an hydrogenoxalate anion (HC2O4 −), and half a molecule of oxalic acid (H2C2O4) situated about an inversion center. From a supramolecular point of view, the three components interact together via hydrogen bonding. The Me2NH2 + cations and the HC2O4 − anions are in close proximity through bifurcated N—H⋯(O,O) hydrogen bonds, while the HC2O4 − anions are organized into infinite chains via O—H⋯O hydrogen bonds, propagating along the a-axis direction. In addition, the oxalic acid (H2C2O4) molecules play the role of connectors between these chains. Both the carbonyl and hydroxyl groups of each diacid are involved in four intermolecular interactions with two Me2NH2 + and two HC2O4 − ions of four distinct polymeric chains, via two N—H⋯O and two O—H⋯O hydrogen bonds, respectively. The resulting molecular assembly can be viewed as a two-dimensional bilayer-like arrangement lying parallel to (010), and reinforced by a C—H⋯O hydrogen bond. PMID:25995858
NASA Astrophysics Data System (ADS)
Kleeman, Michael J.; Ying, Qi; Kaduwela, Ajith
The effect of NO x, volatile organic compound (VOC), and NH 3 emissions control programs on the formation of particulate ammonium nitrate in the San Joaquin Valley (SJV) was examined under the typical winter conditions that existed on 4-6 January, 1996. The UCD/CIT photochemical transport model was used for this study so that the source origin of primary particulate matter and secondary particulate matter could be identified. When averaged across the entire SJV, the model results predict that 13-18% of the reactive nitrogen (NO y=NO x+reaction products of NO x) emitted from local sources within the SJV was converted to nitrate at the ground level. Each gram of NO x emitted locally within the SJV (expressed as NO 2) produced 0.23-0.31 g of particulate ammonium nitrate (NH 4NO 3), which is much smaller than the maximum theoretical yield of 1.7 g of NH 4NO 3 per gram of NO 2. The fraction of reactive nitrogen converted to nitrate varied strongly as a function of location. Urban regions with large amounts of fresh NO emissions converted little reactive nitrogen to nitrate, while remote areas had up to 70% conversion (equivalent to approximately 1.2 g of NH 4NO 3 per gram of NO 2). The use of a single spatially averaged ratio of NH 4NO 3/NO x as a predictor of how changes to NO x emissions would affect particulate nitrate concentrations would not be accurate at all locations in the SJV under the conditions studied. The largest local sources of particulate nitrate in the SJV were predicted to be diesel engines and catalyst equipped gasoline engines under the conditions experienced on 6 January, 1996. Together, these sources accounted for less than half of the ground-level nitrate aerosol in the SJV. The remaining fraction of the aerosol nitrate originated from reactive nitrogen originally released upwind of the SJV. The majority of this upwind reactive nitrogen was already transformed to nitrate by the time it entered the SJV. The effect of local emissions controls on this upwind material was small. A 50% reduction in NO x emissions applied to sources within the SJV reduced the predicted concentration of total nitrate by approximately 25% during the study episode. VOC emissions controls were less effective, while reasonable NH 3 emissions controls had the smallest effect on the amount of ammonium nitrate produced. A 50% reduction in VOC emissions lowered predicted concentrations of total nitrate by 17.5%, while a 50% reduction in NH 3 emissions lowered predicted concentrations of total nitrate by only 10%. This latter result is expected since the formation of ammonium nitrate aerosol is limited by the availability of gas-phase nitric acid, with large amounts of excess NH 3 available. NO x emissions controls appear to be the most efficient method to reduce the concentration of locally generated particulate nitrate in the SJV under the conditions experienced on 4-6 January, 1996.
Effects of fluoride on development and growth of Rana chensinensis embryos and larvae.
Chai, Lihong; Dong, Suiming; Zhao, Hongfeng; Deng, Hongzhang; Wang, Hongyuan
2016-04-01
The present study examined the adverse effects of fluoride exposure on embryos and larvae of Rana chensinensis. Survival, morphological abnormalities, growth and development, time to metamorphosis and size at metamorphic climax of R. chensinensis were examined. Our results showed that embryos malformation occurred in all fluoride treatments. Morphological abnormalities of embryos are characterized by axial flexures, the extrusion of fin axis, edema, and ruffled dorsal and ventral fin. Additionally, 4.1mg F(-)/L and above could significantly inhibit embryos growth and development. On day 15, total length and weight of tadpole were significantly lower in 19.6 and 42.4 mg F(-)/L treatments compared to control. However, significant reductions in total length and weight were observed only at 42.4 mg F(-)/L on day 30. Moreover, significant metamorphic delay and decrease in the size at metamorphic climax were found in larvae exposed to 42.4 mg F(-)/L. Taken together, embryos of R. chensinensis are more vulnerable to fluoride exposure than their tadpoles. Our results suggested that the presence of high concentrations fluoride might increase mortality risk and a reduction in juvenile recruitment in the field by increasing embryos malformation, delaying metamorphosis and decreasing size at metamorphosis. Copyright © 2015 Elsevier Inc. All rights reserved.
Water Evaporation from Acoustically Levitated Aqueous Solution Droplets.
Combe, Nicole A; Donaldson, D James
2017-09-28
We present a systematic study of the effect of solutes on the evaporation rate of acoustically levitated aqueous solution droplets by suspending individual droplets in a zero-relative humidity environment and measuring their size as a function of time. The ratios of the early time evaporation rates of six simple salts (NaCl, NaBr, NaNO 3 , KCl, MgCl 2 , CaCl 2 ) and malonic acid to that of water are in excellent agreement with predictions made by modifying the Maxwell equation to include the time-dependent water activity of the evaporating aqueous salt solution droplets. However, the early time evaporation rates of three ammonium salt solutions (NH 4 Cl, NH 4 NO 3 , (NH 4 ) 2 SO 4 ) are not significantly different from the evaporation rate of pure water. This finding is in accord with a previous report that ammonium sulfate does not depress the evaporation rate of its solutions, despite reducing its water vapor pressure, perhaps due to specific surface effects. At longer evaporation times, as the droplets approach crystallization, all but one (MgCl 2 ) of the solution evaporation rates are well described by the modified Maxwell equation.
Castro, Samuel Rodrigues; Araújo, Mahira Adna Cota; Lange, Liséte Celina
2013-01-01
Chemical precipitation of struvite as a technique of ammonium nitrogen (NH(4)-N) removal from concentrated wastewater has been shown to be an attractive alternative due to its high effectiveness, reaction rate, simplicity, environmental sustainability and, especially, the application potential of the generated solids for the fertilizer industry. The technique of experimental design has been used in order to identify and evaluate the optimum conditions of chemical precipitation reaction applied in a struvite sedimentation study. The preliminary tests were performed using synthetic effluent with a concentration equal to 500.0 mg N L(-1). The stoichiometric ratio Mg:NH(4):PO(4) equal to 1.5:1.0:1.25 and pH equal to 8.5 were taken to be the optimum conditions, where a NH(4)-N removal equal to 98.6% was achieved with only 10-min reaction time. This condition has been used to evaluate the struvite sedimentation from synthetic wastewaters, intending to check the optimum conditions achieved by the experimental design in different initial concentrations, 1,000 and 2,000 mg N L(-1). The results were typical of a good zonal sedimentation and can be used in the scale up the system.