Sample records for ammonium sulfates

  1. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2014 CFR


    ... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This substance is generally recognized as safe when used in accordance with good manufacturing or feeding practice. ...

  2. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  3. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  4. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  5. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT... GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS Reg. No. 7783-20-2)...

  6. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  7. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  8. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  9. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  10. Toxicology of ammonium sulfate in the lung

    SciTech Connect

    Pepelko, W.E.; Mattox, J.K.; Cohen, A.L.


    Despite the relatively low toxicity of ammonium sulfate in experimental animals, it cannot be concluded that increased sulfuric acid production is harmless to human health. Many other pollutants are present in ambient air with possible synergistic effects. Sulfuric acid undoubtedly reacts to produce other sulfates in ambient air which are often much more toxic. For example zinc sulfate and zinc ammonium sulfate are much more irritating to the lung than ammonium sulfate. In order to assess with more certainty the health effects of increased sulfuric acid production, it will be necessary to determine accurately that proportion inhaled as free sulfuric acid compared with ammonium sulfate as well as the proportion and kinds of other sulfates present in the atmosphere.

  11. Solubility of the Sodium and Ammonium Salts of Oxalic Acid in Water with Ammonium Sulfate.


    Buttke, Lukas G; Schueller, Justin R; Pearson, Christian S; Beyer, Keith D


    The solubility of the sodium and ammonium salts of oxalic acid in water with ammonium sulfate present has been studied using differential scanning calorimetry, X-ray crystallography, and infrared spectroscopy. The crystals that form from aqueous mixtures of ammonium sulfate/sodium hydrogen oxalate were determined to be sodium hydrogen oxalate monohydrate under low ammonium sulfate conditions and ammonium hydrogen oxalate hemihydrate under high ammonium sulfate conditions. Crystals from aqueous mixtures of ammonium sulfate/sodium oxalate were determined to be ammonium oxalate monohydrate under moderate to high ammonium sulfate concentrations and sodium oxalate under low ammonium sulfate concentrations. It was also found that ammonium sulfate enhances the solubility of the sodium oxalate salts (salting in effect) and decreases the solubility of the ammonium oxalate salts (salting out effect). In addition, a partial phase diagram for the ammonium hydrogen oxalate/water system was determined.

  12. On the evaporation of ammonium sulfate solution

    SciTech Connect

    Drisdell, Walter S.; Saykally, Richard J.; Cohen, Ronald C.


    Aqueous evaporation and condensation kinetics are poorly understood, and uncertainties in their rates affect predictions of cloud behavior and therefore climate. We measured the cooling rate of 3 M ammonium sulfate droplets undergoing free evaporation via Raman thermometry. Analysis of the measurements yields a value of 0.58 {+-} 0.05 for the evaporation coefficient, identical to that previously determined for pure water. These results imply that subsaturated aqueous ammonium sulfate, which is the most abundant inorganic component of atmospheric aerosol, does not affect the vapor-liquid exchange mechanism for cloud droplets, despite reducing the saturation vapor pressure of water significantly.

  13. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2010 CFR



  14. 21 CFR 182.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum ammonium sulfate. 182.1127 Section 182.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b...

  15. 21 CFR 182.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Aluminum ammonium sulfate. 182.1127 Section 182.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b...

  16. 21 CFR 182.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Aluminum ammonium sulfate. 182.1127 Section 182...) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Multiple Purpose GRAS Food Substances § 182.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of use. This substance is generally...

  17. 21 CFR 582.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Aluminum ammonium sulfate. 582.1127 Section 582.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of...

  18. 21 CFR 582.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Aluminum ammonium sulfate. 582.1127 Section 582.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of...

  19. 21 CFR 582.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Aluminum ammonium sulfate. 582.1127 Section 582.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of...

  20. 21 CFR 582.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Aluminum ammonium sulfate. 582.1127 Section 582.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of...

  1. 21 CFR 582.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum ammonium sulfate. 582.1127 Section 582.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b) Conditions of...

  2. 21 CFR 182.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Aluminum ammonium sulfate. 182.1127 Section 182.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b...

  3. 21 CFR 182.1127 - Aluminum ammonium sulfate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Aluminum ammonium sulfate. 182.1127 Section 182.1127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1127 Aluminum ammonium sulfate. (a) Product. Aluminum ammonium sulfate. (b...

  4. Deliquescence behavior of organic/ammonium sulfate aerosol

    NASA Astrophysics Data System (ADS)

    Brooks, Sarah D.; Wise, Matthew E.; Cushing, Melinda; Tolbert, Margaret A.


    Recent studies have shown that tropospheric aerosols composed of internal mixtures of organics with sulfates are quite common with the organic composing up to 50% of the particle mass. The influences of the organics on the chemical and physical properties of the aerosol are not known. In this paper, we report the solubility of a series of dicarboxylic acids in saturated ammonium sulfate solution as a function of temperature. We also report the deliquescence relative humidity (DRH) of the pure dicarboxylic acids and of mixtures of dicarboxylic acids with ammonium sulfate. For the systems studied, we find that the presence of water-soluble dicarboxylic acids caused deliquescence to occur at a lower relative humidity (RH) than pure ammonium sulfate. In contrast, the less soluble dicarboxylic acids had no measurable effect on the deliquescence relative humidity of ammonium sulfate.

  5. The effect of ammonium sulfate injection on peripheral nerve.


    Kobayashi, J; Mackinnon, S E; Langer, J C; Hertl, M C; Hunter, D A; Tarasidis, G


    Local anesthetic drugs with prolonged nerve-block effect would have clinical application for postoperative or neuromatous pain relief. This study evaluated the possibility of peripheral nerve neurotoxicity by injection of 10 percent ammonium sulfate. Both intrafascicular and extrafascicular injection of 10 percent ammonium sulfate were tested in the rat sciatic nerve model. One percent lidocaine HCl, 5 percent phenol, and normal saline were similarly injected for comparison. Using histologic studies and motor function evaluation with walking-track analysis, 10 percent ammonium sulfate was found to be neurotoxic when it is injected intrafascicularly; however, extrafascicular injection of this drug did not cause significant nerve injury. The neurotoxicity of the 10 percent ammonium sulfate solution was intermediate between the neurotoxicity of 0.1 percent lidocaine hydrochloride and the marked neurotoxicity of 5 percent phenol solution.

  6. Reactive Uptake of Dimethylamine by Ammonium Sulfate and Ammonium Sulfate-Sucrose Mixed Particles.


    Chu, Yangxi; Chan, Chak K


    Short-chain alkyl amines can undergo gas-to-particle partitioning via reactive uptake by ammonium salts, whose phases have been thought to largely influence the extent of amine uptake. Previous studies mainly focused on particles of single ammonium salt at either dry or wet conditions without any addition of organic compounds. Here we report the uptake of dimethylamine (DMA) by ammonium sulfate (AS) and AS-sucrose mixed particles at different relative humidities (RHs) using an electrodynamic balance coupled with in situ Raman spectroscopy. DMA is selected as a representative of short-chain alkyl amines, and sucrose is used as a surrogate of viscous and hydrophilic organics. Effective DMA uptake was observed for most cases, except for the water-limiting scenario at <5% RH and the formation of an ultraviscous sucrose coating at 10% RH and below. DMA uptake coefficients (γ) were estimated using the particle mass measurements during DMA uptake. Addition of sucrose can increase γ by absorbing water or inhibiting AS crystallization and decrease γ by elevating the particle viscosity and forming a coating layer. DMA uptake can be facilitated for crystalline AS or retarded for aqueous AS with hydrophilic viscous organics (e.g., secondary organic material formed via the oxidation of biogenic volatile organic compounds) present in aerosol particles.

  7. Climate impact of solid ammonium sulfate aerosols as ice nuclei

    NASA Astrophysics Data System (ADS)

    Zhou, C.; Penner, J.


    Laboratory experiments show that solid ammonium sulfate aerosols can act as heterogeneous ice nuclei particles (INPs) in the deposition mode. In this study we used the coupled IMPACT/CAM5 model to track the efflorescence and deliquescence of ammonium sulfate. Liquid pure ammonium sulfate particles effloresce when RHw is below 34% and dissolve when RHw is above 79%. About 1/3 of the total simulated sulfate aerosol mass is in the solid state. When 0.1% of these solid ammonium sulfate aerosols are assumed to be efficient ice nuclei, they act to reduce the bias in simulated ice particle number concentration in cirrus clouds by reducing ice particle number in cold cirrus clouds (T<205 K) and increasing ice particle number in warm cirrus clouds (T>215K). The increased ice particles in warm cirrus clouds lead to an increase in the IWP and a net global warming effect as large as 3 W/m2. The magnitude of the warming effect can vary if a different efficiency of solid ammonium sulfate aerosols acting as ice nuclei particles is assumed.

  8. Ammonium and sulfate ion release of histamine from lung fragments.


    Charles, J M; Menzel, D B


    In vitro studies with guinea pig lung fragments incubated with 10- to 200-mM concentrations of ammonium ion demonstrated the release of substanial quantities of histamine. Of the anions tested with ammonium ion, sulfate was the most potent, while nitrate and acetate ions were of intermediate potency and chloride was less potent. An osmotic effect is unlikely since equal concentrations of sodium chloride failed to release histamine. Isoproterenol, known to decrease anaphylactic histamine release, and acetycholine, known to increase histamine release, had no effect on the ammonium sulfate-mediated release of histamine. N-6 2'-O-Dibutyryladenosine 3',5' monophosphate (dibutyryl c-AMP) was also ineffective. These studies suggest that the inhalation irritation associated with certain sulfate and other salts, may be a function of their ability to release histamine in the presence of amonium ion.

  9. Glufosinate and Ammonium Sulfate Inhibits Atrazine Degradation in Adapted Soils

    USDA-ARS?s Scientific Manuscript database

    The co-application of glufosinate with nitrogen fertilizers may alter atrazine co-metabolism, thereby extending the herbicide’s residual weed control in adapted soils. The objective of this study was to assess the effects of glufosinate, ammonium sulfate, and the combination of glufosinate and ammo...

  10. 40 CFR 721.10170 - Polyoxyethylene polyalkylarylphenylether sulfate ammonium salt (generic).

    Code of Federal Regulations, 2011 CFR


    ... polyalkylarylphenylether sulfate ammonium salt (generic). 721.10170 Section 721.10170 Protection of Environment... polyalkylarylphenylether sulfate ammonium salt (generic). (a) Chemical substance and significant new uses subject to... sulfate ammonium salt (PMN P-03-197) is subject to reporting under this section for the significant...

  11. 40 CFR 721.10170 - Polyoxyethylene polyalkylarylphenylether sulfate ammonium salt (generic).

    Code of Federal Regulations, 2014 CFR


    ... polyalkylarylphenylether sulfate ammonium salt (generic). 721.10170 Section 721.10170 Protection of Environment... polyalkylarylphenylether sulfate ammonium salt (generic). (a) Chemical substance and significant new uses subject to... sulfate ammonium salt (PMN P-03-197) is subject to reporting under this section for the significant...

  12. 40 CFR 721.10170 - Polyoxyethylene polyalkylarylphenylether sulfate ammonium salt (generic).

    Code of Federal Regulations, 2012 CFR


    ... polyalkylarylphenylether sulfate ammonium salt (generic). 721.10170 Section 721.10170 Protection of Environment... polyalkylarylphenylether sulfate ammonium salt (generic). (a) Chemical substance and significant new uses subject to... sulfate ammonium salt (PMN P-03-197) is subject to reporting under this section for the significant...

  13. 40 CFR 721.10170 - Polyoxyethylene polyalkylarylphenylether sulfate ammonium salt (generic).

    Code of Federal Regulations, 2013 CFR


    ... polyalkylarylphenylether sulfate ammonium salt (generic). 721.10170 Section 721.10170 Protection of Environment... polyalkylarylphenylether sulfate ammonium salt (generic). (a) Chemical substance and significant new uses subject to... sulfate ammonium salt (PMN P-03-197) is subject to reporting under this section for the significant...

  14. 40 CFR 721.10170 - Polyoxyethylene polyalkylarylphenylether sulfate ammonium salt (generic).

    Code of Federal Regulations, 2010 CFR


    ... polyalkylarylphenylether sulfate ammonium salt (generic). 721.10170 Section 721.10170 Protection of Environment... polyalkylarylphenylether sulfate ammonium salt (generic). (a) Chemical substance and significant new uses subject to... sulfate ammonium salt (PMN P-03-197) is subject to reporting under this section for the significant...

  15. Producing ammonium sulfate from flue gas desulfurization by-products

    USGS Publications Warehouse

    Chou, I.-Ming; Bruinius, J.A.; Benig, V.; Chou, S.-F.J.; Carty, R.H.


    Emission control technologies using flue gas desulfurization (FGD) have been widely adopted by utilities burning high-sulfur fuels. However, these technologies require additional equipment, greater operating expenses, and increased costs for landfill disposal of the solid by-products produced. The financial burdens would be reduced if successful high-volume commercial applications of the FGD solid by-products were developed. In this study, the technical feasibility of producing ammonium sulfate from FGD residues by allowing it to react with ammonium carbonate in an aqueous solution was preliminarily assessed. Reaction temperatures of 60, 70, and 80??C and residence times of 4 and 6 hours were tested to determine the optimal conversion condition and final product evaluations. High yields (up to 83%) of ammonium sulfate with up to 99% purity were achieved under relatively mild conditions. The optimal conversion condition was observed at 60??C and a 4-hour residence time. The results of this study indicate the technical feasibility of producing ammonium sulfate fertilizer from an FGD by-product. Copyright ?? Taylor & Francis Inc.

  16. Recovery of ammonium sulfate from fermentation waste by electrodialysis.


    Lee, Hong-Joo; Oh, Suk-Jung; Moon, Seung-Hyeon


    Electrodialysis experiments of the lysine fermentation waste were performed to generate demineralized feed and ammonium sulfate, which can be utilized as a fertilizer and an animal feed, respectively. The electrodialysis performances were compared for different ion exchange membranes in terms of ammonium sulfate removal rate, resistance and conductivity change. Analysis of fouling phenomena revealed that organics fouled ion exchange membranes reversibly in electrodialysis of the fermentation waste. In this study, mitigation of membrane fouling with the pulsed electric field was examined for the electrodialysis of the fermentation waste containing strong foulants. The half-wave power reduced membrane fouling significantly. For a quantitative measure of the membrane fouling tendency, a membrane fouling index for electrodialysis was used. This study showed the potential use of pulsed power as an effective fouling mitigation method for the electrodialysis of fermentation waste.

  17. Production of ammonium sulfate fertilizer from FGD-gypsum

    SciTech Connect

    Chou, M.I.M.; Rostam-Abadi, M.; Li, Y.C.


    The overall goal of this study is to assess the technical and economic feasibilities for producing marketable products including fertilizer-grade ammonium sulfate from gypsum produced as part of lime/limestone flue gas desulfurization (FGD) processes. Millions of tone of FGD-gypsum by-product may be produced in this decade as a result of the 1990 Clean Air Act Amendments. In this research, bench-scale experiments were conducted to obtain process data for the production of ammonium sulfate from FGD-gypsum and to help evaluate technical and economic feasibilities of the process. The FGD-gypsum sample produced from a Chiyoda Thoroughbred 121-FGD process installed on the Abbott power plant in Champaign, EL which was composed of 98.36% gypsum (CaSO{sub 4}{sm_bullet}2H{sub 2}O) and less than 0.01% calcium sulfite (CaSO) was used. The preliminary results of bench-scale experiments to evaluate the influence of reaction conditions to produce ammonium sulfate from FGD-gypsum are presented in this paper.

  18. Glutamate decarboxylase from Lactobacillus brevis: activation by ammonium sulfate.


    Hiraga, Kazumi; Ueno, Yoshie; Oda, Kohei


    In this study, the glutamate decarboxylase (GAD) gene from Lactobacillus brevis IFO12005 (Biosci. Biotechnol. Biochem., 61, 1168-1171 (1997)), was cloned and expressed. The deduced amino acid sequence showed 99.6% and 53.1% identity with GAD of L. brevis ATCC367 and L. lactis respectively. The His-tagged recombinant GAD showed an optimum pH of 4.5-5.0, and 54 kDa on SDS-PAGE. The GAD activity and stability was significantly dependent on the ammonium sulfate concentration, as observed in authentic GAD. Gel filtration showed that the inactive form of the GAD was a dimer. In contrast, the ammonium sulfate-activated form was a tetramer. CD spectral analyses at pH 5.5 revealed that the structures of the tetramer and the dimer were similar. Treatment of the GAD with high concentrations of ammonium sulfate and subsequent dilution with sodium glutamate was essential for tetramer formation and its activation. Thus the biochemical properties of the GAD from L. brevis IFO12005 were significantly different from those from other sources.

  19. Evidence for surface nucleation: efflorescence of ammonium sulfate and coated ammonium sulfate aerosol particles

    NASA Astrophysics Data System (ADS)

    Ciobanu, V. Gabriela; Marcolli, Claudia; Krieger, Ulrich K.; Zuend, Andreas; Peter, Thomas


    Aerosol particles are ubiquitous in the atmosphere and can undergo different phase transitions, such as deliquescence and efflorescence. Using optical microscopy, we investigated the efflorescence of ammonium sulfate (AS) in supersaturated AS and 1:1 and 8:1 (by weight) poly(ethylene glycol)-400 (PEG-400)/AS particles, which were deposited as droplets with diameters in the 16 - 35 μm range on a hydrophobically coated slide. The PEG-400/AS particles that are exposed to decreasing relative humidity (RH) exhibit a liquid-liquid phase separation below 90 % RH with the PEG-400 phase surrounding the aqueous AS inner phase (Marcolli and Krieger, 2006; Ciobanu et al., 2009). Pure AS particles effloresced in the RH range from 36.3 to 43.7 % RH, in agreement with literature data (31 - 48 % RH). In contrast, 1:1 PEG-400/AS particles with diameters of the AS phase from 7.2 - 19.2 μm effloresced between 26.8 - 33.9 % RH and 8:1 PEG-400/AS particles with diameters of the AS phase from 1.8 - 7.3 μm between 24.3 - 29.3 % RH. Such low efflorescence relative humidity (ERH) values have never been reached before for AS particles of this size range. We show that neither a potential inhibition of water evaporation via anomalously slow diffusion through the PEG coating, nor the presence of low amounts of PEG-400 in the AS phase, nor different timescales between various experimental techniques could possibly explain the low AS ERH values of PEG-400/AS particles in our setup. High-speed photography of the efflorescence process allowed to monitor the proceeding of the AS crystallization fronts within the particles with millisecond time resolution. The nucleation locations were deduced based on the initial crystals growth locations. Statistical analysis of 31 and 19 efflorescence events for pure AS and 1:1 PEG-400/AS particles, respectively, identified the air/droplet/substrate contact line and the air/droplet interface as preferred nucleation locations in the case of pure AS particles

  20. 40 CFR 721.10443 - Ethoxylated alkylphenol sulfate, ammonium salt (generic).

    Code of Federal Regulations, 2013 CFR


    ..., ammonium salt (generic). 721.10443 Section 721.10443 Protection of Environment ENVIRONMENTAL PROTECTION... New Uses for Specific Chemical Substances § 721.10443 Ethoxylated alkylphenol sulfate, ammonium salt... identified generically as ethoxylated alkylphenol sulfate, ammonium salt (PMN P-01-470) is subject...

  1. 40 CFR 721.10443 - Ethoxylated alkylphenol sulfate, ammonium salt (generic).

    Code of Federal Regulations, 2014 CFR


    ..., ammonium salt (generic). 721.10443 Section 721.10443 Protection of Environment ENVIRONMENTAL PROTECTION... New Uses for Specific Chemical Substances § 721.10443 Ethoxylated alkylphenol sulfate, ammonium salt... identified generically as ethoxylated alkylphenol sulfate, ammonium salt (PMN P-01-470) is subject...

  2. Evaluating Ammonium, Nitrate and Sulfate Aerosols in 3-Dimensions

    NASA Astrophysics Data System (ADS)

    Mezuman, K.; Bauer, S.; Tsigaridis, K.


    The spatial distribution of aerosols and their chemical composition dictates whether they would have a cooling or a warming effect on the climate system. Hence, properly modeling the 3-dimensonal distribution of aerosols is a crucial step for coherent climate simulations. Since surface networks only give 2-D data, and most satellites supply integrated column information, it is thus important to integrate aircraft measurements in climate model evaluation. In this study, the vertical distribution of ammonium, nitrate, and sulfate, is constrained against a collection of 14 AMS flight campaigns, and surface measurements from 2000-2010 in the USA and Europe. GISS modelE2, one of the only models to include nitrate aerosol in CIMP5, is used with multiple aerosol microphysics (MATRIX, OMA) and thermodynamic (ISORROPIA-II, EQSAM) configurations. Our results show that the MATRIX microphysical scheme improves the model performance for sulfate and that there is a systematic underestimation of ammonium and nitrate over the USA and Europe. In terms of gaseous precursors, underestimation of nitrate and ammonium is likely tied to ammonia emissions uncertainties, while nitric acid concentrations are largely overestimated in the higher levels of the model, influenced by strong strat-trop exchange. At high altitudes, nitrate formation is calculated to be ammonia limited, whose profile measurements are scarce.

  3. Secondary nucleation kinetcs of ammonium sulfate in a CMSMPR crystallizer

    NASA Astrophysics Data System (ADS)

    Daudey, P. J.; van Rosmalen, G. M.; de Jong, E. J.


    Secondary nucleation in suspension is most frequently modelled by an empirical "power-law" relating the nucleation rate to supersaturation and to the slurry density of the crystals already present in the solution. In this paper kinetic rate equations are developed based on a general modelling of secondary nucleation employing two mechanisms, surface breeding and mechanical breeding, each consisting of sequential steps. The specific equations gained in this way are used to determine the breeding mechanisms prevailing in suspension crystallization. Ammonium sulfate was used as a test case. For this system it is concluded that surface breeding is the predominant mechanism in both evaporation and cooling experiments.

  4. Antibody purification: ammonium sulfate fractionation or gel filtration.


    Grodzki, Ana Cristina; Berenstein, Elsa


    Antibodies can be purified by a variety of methods based on their unique physical and chemical properties such as size, solubility, charge, hydrophobicity and binding affinity. This chapter focuses on ammonium sulfate precipitation as a convenient first step in antibody purification in that, it allows the concentration of the starting material and the precipitation of the desired protein. The principle of ammonium sulfate precipitation lies in "salting out" proteins from the solution. The proteins are prevented to form hydrogen bonds with water and the salt facilitates their interaction with each other forming aggregates that afterward precipitate out of solution. Gel filtration or size- exclusion chromatography is also discussed in this chapter. Gel filtration is based on the relative size of protein molecules and it is of great value to separate IgMs, exchange buffers and/or desalt solutions. The columns designed to separate the proteins are composed of porous beads and the proteins will flow through the packed column inside and around the beads, depending on its size.

  5. Salting out of proteins using ammonium sulfate precipitation.


    Duong-Ly, Krisna C; Gabelli, Sandra B


    Protein solubility is affected by ions. At low ion concentrations (<0.5 M), protein solubility increases along with ionic strength. Ions in the solution shield protein molecules from the charge of other protein molecules in what is known as 'salting-in'. At a very high ionic strength, protein solubility decreases as ionic strength increases in the process known as 'salting-out'. Thus, salting out can be used to separate proteins based on their solubility in the presence of a high concentration of salt. In this protocol, ammonium sulfate will be added incrementally to an E. coli cell lysate to isolate a recombinantly over-expressed protein of 20 kDa containing no cysteine residues or tags.

  6. Seeded batch crystallization of ammonium aluminum sulfate from aqueous solution

    NASA Astrophysics Data System (ADS)

    Kubota, Noriaki; Onosawa, Masahiro


    Seed crystals of ammonium aluminum sulfate ((NH 4)Al(SO 4) 2··12H 2O) were grown in aqueous solution by cooling. The temperature of a crystallizer was lowered with no control by circulating cooling water through the jacket. It fell in an exponential manner. The effects of seed amount and size on the product crystal size distribution were examined. The product crystals obtained were of narrow and uni-modal size distribution with suppressed secondary nucleation if seed crystals were loaded more than a critical value. The critical value was determined and well compared with previously reported values for other material systems. This crystallization technique does not need any prior knowledge of the kinetics of crystal growth and nucleation. It is simple and robust, and can be easily applied to an existing crystallizer without installing any additional control systems.

  7. Large electrocaloric effects in single-crystal ammonium sulfate.


    Crossley, S; Li, W; Moya, X; Mathur, N D


    Electrocaloric (EC) effects are typically studied near phase transitions in ceramic and polymer materials. Here, we investigate EC effects in an inorganic salt, namely ammonium sulfate (NH4)2SO4, with an order-disorder transition whose onset occurs at 223 K on cooling. For a single crystal thinned to 50 μm, we use a Maxwell relation to find a large isothermal entropy change of 30 J K(-1) kg(-1) in response to a field change of 400 kV cm(-1) The Clausius-Clapeyron equation implies a corresponding adiabatic temperature change of 4.5 K.This article is part of the themed issue 'Taking the temperature of phase transitions in cool materials'. © 2016 The Author(s).

  8. Cold Case: Radar investigation of ammonium sulfate cryovolcanism on Titan

    NASA Astrophysics Data System (ADS)

    Thomann, C.; Hayes, A. G.; Hofgartner, J.; Lunine, J. I.; Le Gall, A.


    The detection of a large tidal k2 value from Cassini [1] constitutes very strong evi-dence for a subcrustal ocean, most plausibly dominated by water. However, the secondary constituents are not known. One interesting possibility that has received scant attention in analysis of surface data sets is that the ocean contain aqueous ammonium sulfates, which erupted on the surface in the past to create vast, smooth plains [2]. We adopt the hypothesis that the undifferentiated plains—the "bland-lands" in the mid-latitudes of Titan—are these deposits, and test it using radiometry with SAR data. Lopez et al (this conference) investigate the global distribution and possible origin of this type of unit. We extracted SAR and radiometry-during-SAR data sets from the PDS, and pro-duced maps of brightness temperatures. The SAR imagery was used to identify locations where crossovers exist -some of which are in the undifferentiated plains--and hence where brightness temperatures at different incidence angles are available. We derived emissivities from the data using a simple radiometric model [3] to ac-count for the brightness temperature differences as a function of surface roughness, volume scattering and emissivity. We test the hypothesis by assessing whether the derived emissivities and volume scattering in the bland-lands are consistent with the model cryoclastic ash of ice and ammonium sulfate proposed in [2], distinct from that in other terrains. [1] L. Iess, R.A. Jacobson, M. Ducci, D.J. Stevenson, J.I. Lunine, J.W. Armstrong, S.W. Asmar, P. Racioppa, N.J. Rappaport, P. Tortora, Science, 337, 457 (2012). [2] A.D. Fortes, P.M. Grinrod, S.K. Trickett, L. Vocadlo. Icarus, 188, 139 (2007). [3] T.L. White and J.R. Cogdell. The Moon, 6, 235 (1973).

  9. Source regions of ammonium nitrate, ammonium sulfate, and natural silicates in the surface aerosols of Moscow oblast

    NASA Astrophysics Data System (ADS)

    Shukurov, K. A.; Shukurova, L. M.


    Maps of potential source regions of ammonium nitrate, ammonium sulfate, and natural silicates in the surface aerosols in 2002-2005, 2010, and 2012-2015 are obtained based on measurements of the optical depth of 1-2 μm surface aerosol samples and the analysis results of backward trajectories of air parcels at the Zvenigorod scientific station (ZSS) of the A. M. Obukhov Institute of Atmospheric Physics, Russian Academy of Sciences. The most likely potential source regions of ammonium nitrate are in western and central Europe; those of ammonium sulfate are in southern Ukraine, southern Russia, and northwest Kazakhstan; and those of natural silicates are in the Caspian and Aral regions. The maps of potential source regions are consistent with EMEP fields of surface concentrations of nitrates and sulfates and natural aerosol concentration in PM2.5.

  10. Efficient ozone, sulfate, and ammonium free resist stripping process

    NASA Astrophysics Data System (ADS)

    Dattilo, Davide; Dietze, Uwe


    In recent years, photomask resist strip and cleaning technology development was substantially driven by the industry's need to prevent surface haze formation through the elimination of sulfuric acid and ammonium hydroxide from these processes. As a result, conventional SPM (H2SO4 + H2O2) was replaced with Ozone water (DIO3) for resist stripping and organic removal to eliminate chemical haze formation [1, 2]. However, it has been shown that DIO3 basted strip and clean process causes oxidative degradation of photomask materials [3, 4]. Such material damage can affect optical properties of funcitional mask layers, causeing CD line-width, phase, transmission and reflection changes, adversely affecting image transfer during the Lithography process. To overcome Ozone induced surface damage, SUSS MicroTec successfully developed a highly efficient strip process, where photolysis of DIO3 is leading to highly reactive hydroxyl radical formation, as the main contribution to hydrocarbon removal without surface damage [5]. This technology has been further extended to a final clean process, which is utilizing pure DI water for residual organic material removal during final clean [6]. Recently, SUS MicroTec did also successfully release strip and clean processes which completely remove NH4OH, eliminating any chemicals known today to induce haze [7]. In this paper we show the benefits of these new technologies for highly efficient sulfate and ammonium free stripping and cleaning processes.

  11. Sulfate-Reducing Ammonium Oxidation: A Thermodynamically Feasible Metabolic Pathway in Subseafloor Sediment

    NASA Astrophysics Data System (ADS)

    Schrum, H. N.; Spivack, A. J.; Kastner, M.; D'Hondt, S. L.


    Sulfate-reducing ammonium oxidation, a process that has not been previously inferred in natural environments, is indicated based on dissolved chemical fluxes and Gibbs energies of reaction in sedimentary porewaters. Bay of Bengal (Indian Ocean) porewater profiles demonstrate that significant ammonium is consumed in the interface between ammonium and sulfate containing waters. Loss of ammonium in this interval greatly exceeds possible nitrogen demand by biomass production. In situ Gibbs energies of reaction (ΔG) for the reaction, 8NH4+ +3SO42- = 4N2 + 3HS- + 12 H2O + 5H+) in Bay of Bengal sediment and Greenwich Bay (Rhode Island) sediment indicate that sulfate-reducing ammonium oxidation is energy yielding. Relatively small and constant but consistently negative in-situ Gibbs energies in both locations suggest that microorganisms can derive energy from this reaction. In combination, the Gibbs energies and the substantial ammonium loss suggest that sulfate-reducing ammonium oxidation occurs in Bay of Bengal sediments. The Greenwich Bay DG results suggest that the process may also occur in anoxic sediment where the ammonium concentration profile shows no net loss of ammonium These sites are not geochemically unique; large areas of the ocean floor have conditions favorable for sulfate-reducing ammonium oxidation. If this reaction occurs globally, it may be a significant sink for fixed nitrogen.

  12. Ammonium sulfate and MALDI in-source decay: a winning combination for sequencing peptides.


    Delvolve, Alice; Woods, Amina S


    In previous papers, we highlighted the role of ammonium sulfate in increasing peptide fragmentation by in-source decay (ISD). The current work systematically investigated effects of matrix assisted laser desorption ionization (MALDI) extraction delay, peptide amino acid composition, matrix, and ammonium sulfate concentration on peptide ISD fragmentation. The data confirmed that ammonium sulfate increased peptides signal-to-noise ratio as well as their in-source fragmentation, resulting in complete sequence coverage regardless of the amino acid composition. This method is easy, inexpensive, and generates the peptides sequence instantly.

  13. [Evaluation of phenol ammonium sulfate sedimentation method for diagnosis of pulmonary tuberculosis].


    Akgüneş, Alper; Coban, Ahmet Yilmaz; Taşdelen Fişgin, Nuriye; Acuner, Ibrahim Cağatay; Durupinar, Belma


    In the study, the results of culture have been accepted as a gold standard and the specificity and sensitivity of phenol ammonium sulfate sedimentation method has been evaluated. When it is evaluated according to the results of culture, it has been found that the specificity and sensitivity of phenol ammonium sulfate sedimentation method is 90%, the specificity of the process which is made through the N-acetyl-L-cysteine NaOH method is 90% and the sensitivity of it is 85%. In conclusion, the phenol ammonium sulfate method seems to be as a secure method that can only be used in the laboratories in which microscopic studies are made.

  14. Crystallization of Chicken Egg-White Lysozyme from Ammonium Sulfate

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Pusey, Marc L.


    Chicken egg-white lysozyme was crystallized from ammonium sulfate over the pH range 4.0-7.8, with protein concentrations from 100 to 150 mg/ml. Crystals were obtained by vapor-diffusion or batch-crystallization methods. The protein crystallized in two morphologies with an apparent morphology dependence on temperature and protein concentration. In general, tetragonal crystals could be grown by lowering the protein concentration or temperature. Increasing the temperature or protein concentration resulted in the growth of orthorhombic crystals. Representative crystals of each morphology were selected for X-ray analysis. The tetragonal crystals belonged to the P4(sub 3)2(sub 1)2 space group with crystals grown at ph 4.4 having unit-cell dimensions of a = b = 78.7 1, c=38.6 A and diffracting to beyond 2.0 A. The orthorhombic crystals, grown at pH 4.8, were of space group P2(sub 1)2(sub 1)2 and had unit-cell dimensions of a = 30.51, b = 56.51 and c = 73.62 A.

  15. Crystallization of Chicken Egg-White Lysozyme from Ammonium Sulfate

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Pusey, Marc L.


    Chicken egg-white lysozyme was crystallized from ammonium sulfate over the pH range 4.0-7.8, with protein concentrations from 100 to 150 mg/ml. Crystals were obtained by vapor-diffusion or batch-crystallization methods. The protein crystallized in two morphologies with an apparent morphology dependence on temperature and protein concentration. In general, tetragonal crystals could be grown by lowering the protein concentration or temperature. Increasing the temperature or protein concentration resulted in the growth of orthorhombic crystals. Representative crystals of each morphology were selected for X-ray analysis. The tetragonal crystals belonged to the P4(sub 3)2(sub 1)2 space group with crystals grown at ph 4.4 having unit-cell dimensions of a = b = 78.7 1, c=38.6 A and diffracting to beyond 2.0 A. The orthorhombic crystals, grown at pH 4.8, were of space group P2(sub 1)2(sub 1)2 and had unit-cell dimensions of a = 30.51, b = 56.51 and c = 73.62 A.

  16. An ammonium sulfate sensitive chitinase from Streptomyces sp. CS501.


    Rahman, Md Arifur; Choi, Yun Hee; Pradeep, G C; Yoo, Jin Cheol


    A chitinase from Streptomyces sp. CS501 was isolated from the Korean soil sample, purified by single-step chromatography, and biochemically characterized. The extracellular chitinase (Ch501) was purified to 4.60 fold with yield of 28.74 % using Sepharose Cl-6B column. The molecular mass of Ch501 was approximately 43 kDa as estimated by SDS-PAGE and zymography. The enzyme (Ch501) was found to be stable over a broad pH range (5.0-10.0) and temperature (up to 50 °C), and have an optimum temperature of 60 °C. N-terminal sequence of Ch501 was AAYDDAAAAA. Intriguingly, Ch501 was highly sensitive to ammonium sulfate but it's completely suppressed activity was recovered after desalting out. TLC analysis of Ch501 showed the production of N-acetyl D-glucosamine (GlcNAc) and Diacetylchitobiose (GlcNAc)2, as a principal hydrolyzed product. Ch501 shows antifungal activity against Fusarium solani and Aspergillus brasiliensis, which can be used for the biological control of fungus. As has been simple in purification, stable in a broad range of pH, ability to produce oligosaccharides, and antifungal activity showed that Ch501 has potential applications in industries as for chitooligosaccharides production used as prebiotics and/or for the biological control of plant pathogens in agriculture.

  17. [Effect of ammonium sulfate aerosol on the photochemical reaction of toluene/ NO(x)/air mixture].


    Wu, Shan; Hao, Ji-Ming; Lü, Zi-Feng; Zhao, Zhe; Li, Jun-Hua


    The effect of ammonium sulfate aerosol on the photochemical reaction of toluene/NO(x)/air mixture was evaluated with Tsinghua Smog Chamber facility. The results indicate that the presence of concentrated preexisting ammonium sulfate aerosol shortens the time to reach maximum PM (particle matter) concentration and increases the aerosol yield of toluene. And under the presence of high concentrated ammonium sulfate aerosol seed, the concentration of aerosol does not have significant effects on NO(x), NO and O3 variation, but affects the formation of secondary organic aerosol (SOA). The SOA yield increases with the increasing initial ammonium sulfate seed concentration (< 160 microg x m(-3)). From the minimum 7.2% to the maximum 11.7%, the percentage increase of SOA yield is more than 60%.

  18. A case of fatal intoxication with ammonium sulfate and a toxicological study using rabbits.


    Sato, A; Gonmori, K; Yoshioka, N


    Agricultural fertilizers such as ammonium sulfate are widely used in house gardens as well as in agriculture, but few case reports or toxicological studies of ingested fertilizers have been reported. This paper investigates a fatal case of ammonium sulfate poisoning and demonstrates its clinical and biochemical findings in rabbits. An 85-year-old woman was found dead lying on the ground outside her house in the middle of March, but the autopsy could not determine the cause of her death. Examination at the police laboratory of the solution in the beer can found next to her showed that it was very likely ammonium sulfate. Our measurement showed a significant increase of ammonium and sulfate ions in serum and gastric contents. The cause of her death was determined as poisoning by ammonium sulfate. The total dose of 1500 mg/kg of ammonium sulfate was administered to three rabbits, all of which showed similar symptoms such as mydriasis, irregular respiratory rhythms, local and general convulsions, until they fell into respiratory failure with cardiac arrest. EEG showed slow, suppressive waves and high-amplitude slowing wave pattern, which is generally observed clinically in hyperammonemia in man and animal. There was a remarkable increase in the concentration of ammonium ion and inorganic sulfate ion in serum, and blood gas analysis showed severe metabolic acidosis. These results, mainly findings by EEG, have shown that a rapid increase in ammonium ions in blood can cause damaging the central nervous system without microscopic change. When the cause of death can not be determined, measurement of ammonium ion, inorganic ion and electrolytes in blood as well as in stomach contents at forensic autopsy is necessary.

  19. Effects of salinity induced by ammonium sulfate fertilizer on root and shoot growth of highbush blueberry

    USDA-ARS?s Scientific Manuscript database

    Ammonium sulfate fertilizer is commonly used in highbush blueberry (Vaccinium corymbosum L.), but due to a high salt index, it often causes salt damage, particularly in young plants, when too much of the fertilizer is applied. A study was done to determine the sensitivity of blueberry to ammonium su...

  20. Effects of salinity induced by ammonium sulfate fertilizer on root and shoot growth of highbush blueberry

    USDA-ARS?s Scientific Manuscript database

    Ammonium sulfate fertilizer is commonly used in highbush blueberry, but due to a high relative salinity, it often causes salt damage, particularly in young plants, when too much of the fertilizer is applied. Three experiments were done to determine the sensitivity of ‘Bluecrop’ blueberry to ammonium...

  1. Effects of inhaled ammonium sulfate on benzo(a)pyrene carcinogenesis. [Hamster

    SciTech Connect

    Godleski, J.J.; Melnicoff, M.J.; Sadri, S.; Garbeil, P.


    The effect of inhaled ammonium sulfate on benzo(a)pyrene carcinogenesis in the lungs of Syrian golden hamsters was studied. Exposure to ammonium sulfate at an airborne concentration 20 times average United States ambient levels resulted in a significant depression of benzo(a)pyrene carcinogenesis in the first 6 mo of the study. However, at 2 yr, the termination of the study, there were no differences in cancer incidence between groups receiving benzo(a)pyrene and benzo(a)pyrene plus ammonium sulfate. In addition, at the concentration studied, inhaled ammonium sulfate did not significantly increase the incidence or severity of pneumonitis or pulmonary fibrosis in the hamster. However, this inhalation did increase the incidence of emphysema but not the severity. The decreased incidence of cancer during the first 6 mo of this study in animals receiving both benzo(a)pyrene and ammonium sulfate suggests that interaction between sulfate and benzo(a)pyrene does occur, but is insufficient to afford long-term protection against the development of cancer. No enhancement of carcinogenesis by benzo(a)pyrene occurs in the presence of inhaled sulfate. 31 references, 5 tables, 2 figures.

  2. Preparation of immunoglobulin Y from egg yolk using ammonium sulfate precipitation and ion exchange chromatography.


    Ko, K Y; Ahn, D U


    The objective of this study was to develop an economical, simple, and large-scale separation method for IgY from egg yolk. Egg yolk diluted with 9 volumes of cold water was centrifuged after adjusting the pH to 5.0. The supernatant was added with 0.01% charcoal or 0.01% carrageenan and centrifuged at 2,800 x g for 30 min. The supernatant was filtered through a Whatman no. 1 filter paper and then the filtrate was concentrated to 20% original volume using ultrafiltration. The concentrated solution was further purified using either cation exchange chromatography or ammonium sulfate precipitation. For the cation exchange chromatography method, the concentrated sample was loaded onto a column equilibrated with 20 mM citrate-phosphate buffer at pH 4.8 and eluted with 200 mM citrate-phosphate buffer at pH 6.4. For the ammonium sulfate precipitation method, the concentrated sample was twice precipitated with 40% ammonium sulfate solution at pH 9.0. The yield and purity of IgY were determined by ELISA and electrophoresis. The yield of IgY from the cation exchange chromatography method was 30 to 40%, whereas that of the ammonium sulfate precipitation was 70 to 80%. The purity of IgY from the ammonium sulfate method was higher than that of the cation exchange chromatography. The cation exchange chromatography could handle only a small amount of samples, whereas the ammonium sulfate precipitation could handle a large volume of samples. This suggests that ammonium sulfate precipitation was a more efficient and useful purification method than cation exchange chromatography for the large-scale preparation of IgY from egg yolk.

  3. Manufacture of ammonium sulfate fertilizer from FGD-gypsum. Technical report, September 1--November 30, 1994

    SciTech Connect

    Chou, M.I.M.; Rostam-Abadi, M.; Lytle, J.M.; Hoeft, R.; Blevins, F.Z.; Achron, F.


    The overall goal of this project is to assess the technical and economic feasibility for producing commercial-grade ammonium sulfate fertilizer from gypsum produced as part of limestone flue gas desulfurization (FGD) processes. This is a cooperative effort among the ISGS, the UIUC, AlliedSignal, SE-ME, Henry Fertilizer, Illinois Power Co. (IP), and Central Illinois Public Services (CIPS). Bench-scale experiments will be conducted to obtain process engineering data for manufacture of ammonium sulfate from FGD-gypsum and to help evaluate technical and economical feasibility of the process. Controlled greenhouse experiments will be conducted at UIUC to evaluate the chemical impact of the produced ammonium sulfate on soil properties. A process flow sheet will be proposed and market demand for the products will be established. An engineering team at IP will provide an independent review of the economics of the process. AlliedSignal will be involved in testing and quality evaluation of ammonium sulfate samples and is interested in an agreement to market the finished product. CIPS will provide technical assistance and samples of FGD-gypsum for the project. In this quarter, a literature study that should give detailed insight into the chemistry, process schemes, and costs of producing ammonium sulfate from gypsum is in progress at the ISGS. Acquisition of a high quality FGD-gypsum sample was completed. Collecting of the other lower grade sample was scheduled to be conducted in December. Characterization of these feed materials is in progress.

  4. Volatility of organic aerosol: evaporation of ammonium sulfate/succinic acid aqueous solution droplets.


    Yli-Juuti, Taina; Zardini, Alessandro A; Eriksson, Axel C; Hansen, Anne Maria K; Pagels, Joakim H; Swietlicki, Erik; Svenningsson, Birgitta; Glasius, Marianne; Worsnop, Douglas R; Riipinen, Ilona; Bilde, Merete


    Condensation and evaporation modify the properties and effects of atmospheric aerosol particles. We studied the evaporation of aqueous succinic acid and succinic acid/ammonium sulfate droplets to obtain insights on the effect of ammonium sulfate on the gas/particle partitioning of atmospheric organic acids. Droplet evaporation in a laminar flow tube was measured in a Tandem Differential Mobility Analyzer setup. A wide range of droplet compositions was investigated, and for some of the experiments the composition was tracked using an Aerosol Mass Spectrometer. The measured evaporation was compared to model predictions where the ammonium sulfate was assumed not to directly affect succinic acid evaporation. The model captured the evaporation rates for droplets with large organic content but overestimated the droplet size change when the molar concentration of succinic acid was similar to or lower than that of ammonium sulfate, suggesting that ammonium sulfate enhances the partitioning of dicarboxylic acids to aqueous particles more than currently expected from simple mixture thermodynamics. If extrapolated to the real atmosphere, these results imply enhanced partitioning of secondary organic compounds to particulate phase in environments dominated by inorganic aerosol.

  5. Optical Properties of Internally Mixed Aerosol Particles Composed of Dicarboxylic Acids and Ammonium Sulfate

    NASA Astrophysics Data System (ADS)

    Freedman, Miriam A.; Hasenkopf, Christa A.; Beaver, Melinda R.; Tolbert, Margaret A.


    We have investigated the optical properties of internally mixed aerosol particles composed of dicarboxylic acids and ammonium sulfate using cavity ring-down aerosol extinction spectroscopy at a wavelength of 532 nm. The real refractive indices of these nonabsorbing species were retrieved from the extinction and concentration of the particles using Mie scattering theory. We obtain refractive indices for pure ammonium sulfate and pure dicarboxylic acids that are consistent with literature values, where they exist, to within experimental error. For mixed particles, however, our data deviates significantly from a volume-weighted average of the pure components. Surprisingly, the real refractive indices of internal mixtures of succinic acid and ammonium sulfate are higher than either of the pure components at the highest organic weight fractions. For binary internal mixtures of oxalic or adipic acid with ammonium sulfate, the real refractive indices of the mixtures are approximately the same as ammonium sulfate for all organic weight fractions. Various optical mixing rules for homogeneous and slightly heterogeneous systems fail to explain the experimental real refractive indices. It is likely that complex particle morphologies are responsible for the observed behavior of the mixed particles. Implications of our results for atmospheric modeling and aerosol structure are discussed.

  6. Volatility of Organic Aerosol: Evaporation of Ammonium Sulfate/Succinic Acid Aqueous Solution Droplets

    PubMed Central


    Condensation and evaporation modify the properties and effects of atmospheric aerosol particles. We studied the evaporation of aqueous succinic acid and succinic acid/ammonium sulfate droplets to obtain insights on the effect of ammonium sulfate on the gas/particle partitioning of atmospheric organic acids. Droplet evaporation in a laminar flow tube was measured in a Tandem Differential Mobility Analyzer setup. A wide range of droplet compositions was investigated, and for some of the experiments the composition was tracked using an Aerosol Mass Spectrometer. The measured evaporation was compared to model predictions where the ammonium sulfate was assumed not to directly affect succinic acid evaporation. The model captured the evaporation rates for droplets with large organic content but overestimated the droplet size change when the molar concentration of succinic acid was similar to or lower than that of ammonium sulfate, suggesting that ammonium sulfate enhances the partitioning of dicarboxylic acids to aqueous particles more than currently expected from simple mixture thermodynamics. If extrapolated to the real atmosphere, these results imply enhanced partitioning of secondary organic compounds to particulate phase in environments dominated by inorganic aerosol. PMID:24107221

  7. Synthesis of nano-crystalline hydroxyapatite and ammonium sulfate from phosphogypsum waste

    SciTech Connect

    Mousa, Sahar; Hanna, Adly


    Graphical abstract: TEM micrograph of dried HAP at 800 °C. -- Abstract: Phosphogypsum (PG) waste which is derived from phosphoric acid manufacture by using wet method was converted into hydroxyapatite (HAP) and ammonium sulfate. Very simple method was applied by reacting PG with phosphoric acid in alkaline medium with adjusting pH using ammonia solution. The obtained nano-HAP was dried at 80 °C and calcined at 600 °C and 900 °C for 2 h. Both of HAP and ammonium sulfate were characterized by X-ray diffraction (XRD) and infrared spectroscopy (IR) to study the structural evolution. The thermal behavior of nano-HAP was studied; the particle size and morphology were estimated by using transmission electron microscopy (TEM) and scanning electron microscopy (SEM). All the results showed that HAP nano-crystalline and ammonium sulfate can successfully be produced from phosphogypsum waste.

  8. [13-week subchronic oral toxicity study of ammonium sulfate in rats].


    Takagi, H; Onodera, H; Yun, L; Yasuhara, K; Koujitani, T; Mitsumori, K; Hirose, M


    A 13-week subchronic oral toxicity study of ammonium sulfate was performed in both sexes of F344 rats by feeding them a CRF-1 powder diet containing concentrations of 0%, 0.38%, 0.75%, 1.5%, and 3.0% of the substance. Rats were randomly divided into 5 groups each consisting of 10 males and 10 females. Male animals in the 3% group exhibited diarrhea during the administration period. No changes indicating obvious ammonium sulfate toxicity were observed in the body weights, organ weights, hematological, serum biochemical, or histopathological examinations. Based on these results, the NOEL (no-observed-effect level) of ammonium sulfate for F344 rats was judged to be 1.5% in males (886 mg/kg/day) and 3% in females (1975 mg/kg/day), and the MTD (maximally tolerated dose) for 2-year carcinogenicity studies in F344 rats was concluded to be 3.0% or more in the diet.

  9. Precipitation of phenyl and phenoxypenicillin from solutions using ammonium sulfate.


    Luengo, J M


    An easy, rapid, and available method for separating 6-aminopenicillanic acid (6-APA), benzylpenicillin (penicillin G), and other related molecules from aqueous solutions or complex industrial broths is described. A high concentration of ammonium sulphate induces partially or totally the precipitation of the penicillin present in the solutions, while 6-APA, phenylacetic, and phenoxyacetic acid always remain in the supernatant. The filtration through No. 4 Pyrex glass-fiber filter or Whatman 3MM paper permits the separation of the compounds present in the supernatant from the other ones precipitated. The precipitated product was identified, in all cases, as ammonium penicillin. This method is described here for the first time.

  10. Ice Melting in the Ammonium Sulfate/Malonic Acid/Water Ternary System

    NASA Astrophysics Data System (ADS)

    Beyer, K. D.; Schroeder, J.


    The low temperature phase diagram of ammonium sulfate/malonic acid/water has been investigated using differential scanning calorimetry (DSC) and FTIR of thin films. It is seen that the minimum ice melting point lowers from approximately 254 K in the individual binary systems (malonic acid/water, ammonium sulfate/water) to 242 K in the ternary system. In addition, we have utilized a new technique to measure deliquescence relative humidities at low temperatures for this and other atmospherically relevant aqueous systems. The Humidity-controlled Thermogravimetric Analyser (HTGA) will be described and sample results discussed.

  11. Inconsistency of ammonium-sulfate aerosol ratios with thermodynamic models in the eastern US: a possible role of organic aerosol

    NASA Astrophysics Data System (ADS)

    Silvern, Rachel F.; Jacob, Daniel J.; Kim, Patrick S.; Marais, Eloise A.; Turner, Jay R.; Campuzano-Jost, Pedro; Jimenez, Jose L.


    Thermodynamic models predict that sulfate aerosol (S(VI) ≡ H2SO4(aq) + HSO4-+ SO42-) should take up available ammonia (NH3) quantitatively as ammonium (NH4+) until the ammonium sulfate stoichiometry (NH4)2SO4 is close to being reached. This uptake of ammonia has important implications for aerosol mass, hygroscopicity, and acidity. When ammonia is in excess, the ammonium-sulfate aerosol ratio R = [NH4+] / [S(VI)] should approach 2, with excess ammonia remaining in the gas phase. When ammonia is in deficit, it should be fully taken up by the aerosol as ammonium and no significant ammonia should remain in the gas phase. Here we report that sulfate aerosol in the eastern US in summer has a low ammonium-sulfate ratio despite excess ammonia, and we show that this is at odds with thermodynamic models. The ammonium-sulfate ratio averages only 1.04 ± 0.21 mol mol-1 in the Southeast, even though ammonia is in large excess, as shown by the ammonium-sulfate ratio in wet deposition and by the presence of gas-phase ammonia. It further appears that the ammonium-sulfate aerosol ratio is insensitive to the supply of ammonia, remaining low even as the wet deposition ratio exceeds 6 mol mol-1. While the ammonium-sulfate ratio in wet deposition has increased by 5.8 % yr-1 from 2003 to 2013 in the Southeast, consistent with SO2 emission controls, the ammonium-sulfate aerosol ratio decreased by 1.4-3.0 % yr-1. Thus, the aerosol is becoming more acidic even as SO2 emissions decrease and ammonia emissions stay constant; this is incompatible with simple sulfate-ammonium thermodynamics. A tentative explanation is that sulfate particles are increasingly coated by organic material, retarding the uptake of ammonia. Indeed, the ratio of organic aerosol (OA) to sulfate in the Southeast increased from 1.1 to 2.4 g g-1 over the 2003-2013 period as sulfate decreased. We implement a simple kinetic mass transfer limitation for ammonia uptake to sulfate aerosols in the GEOS-Chem chemical transport

  12. Properties of nitrate, sulfate and ammonium in typical polluted atmospheric aerosols (PM 10) in Beijing

    NASA Astrophysics Data System (ADS)

    Kai, Zhang; Yuesi, Wang; Tianxue, Wen; Yousef, Meslmani; Frank, Murray


    To gain an understanding of the characteristics of nitrate, sulfate and ammonium in the urban atmosphere of Beijing, an experiment was conducted in October 2004, using a method involving the rapid collection of particles and analysis using an ion chromatography system. The study shows that the mean concentration of water soluble ions (WSI) increased during heavily polluted weather, and this change in the concentration of pollutants was related to the meteorological background. The concentration of nitrate, sulfate and ammonium increased 7.9, 4.1 and 5.4 times, respectively, during heavily polluted periods. The concentration of nitrate increased most among the WSI in PM 10. The diurnal variations of nitrate, sulfate and ammonium in more polluted periods were different from those in less polluted periods. The highest concentration of nitrate (NO 3-), sulfate (SO 42-), and ammonium (NH 4+) appeared at 19:00 during more polluted periods. In contrast, the highest concentrations of these compounds occurred at noon during less polluted periods. A correlation analysis showed that NO 3-, SO 42-, NH 4+, nitrogen oxides (NO x) and sulfur dioxide (SO 2) had significant positive correlations in more polluted periods. The transformation ratio from SO 2 and NO x to SO 42- and NO 3- was higher in more polluted than that in less polluted periods.

  13. Use of soybean oil and ammonium sulfate additions to optimize secondary metabolite production.


    Junker, B; Mann, Z; Gailliot, P; Byrne, K; Wilson, J


    A valine-overproducing mutant (MA7040, Streptomyces hygroscopicus) was found to produce 1.5 to 2.0 g/L of the immunoregulant, L-683,590, at the 0.6 m3 fermentation scale in a simple batch process using soybean oil and ammonium sulfate-based GYG5 medium. Levels of both lower (L-683,795) and higher (HH1 and HH2) undesirable homolog levels were controlled adequately. This batch process was utilized to produce broth economically at the 19 m3 fermentation scale. Material of acceptable purity was obtained without the multiple pure crystallizations previously required for an earlier culture, MA6678, requiring valine supplementation for impurity control. Investigations at the 0.6 m3 fermentation scale were conducted, varying agitation, pH, initial soybean oil/ammonium sulfate charges, and initial aeration rate to further improve growth and productivity. Mid-cycle ammonia levels and lipase activity appeared to have an important role. Using mid-cycle soybean oil additions, a titer of 2.3 g/L of L-683,590 was obtained, while titers reached 2.7 g/L using mid-cycle soybean oil and ammonium sulfate additions. Both higher and lower homolog levels remained acceptable during this fed-batch process. Optimal timing of mid-cycle oil and ammonium sulfate additions was considered a critical factor to further titer improvements.

  14. Chronic toxicity and carcinogenicity of dietary administered ammonium sulfate in F344 rats.


    Ota, Y; Hasumura, M; Okamura, M; Takahashi, A; Ueda, M; Onodera, H; Imai, T; Mitsumori, K; Hirose, M


    Chronic toxicity and carcinogenicity studies of ammonium sulfate, used as a food additive in fermentation, were performed in male and female Fisher 344 rats at dietary concentrations of 0%, 0.1%, 0.6% and 3.0% in a 52-week toxicity study and 0%, 1.5% and 3.0% in a 104-week carcinogenicity study. Treatment with ammonium sulfate caused significant increase in kidney and/or liver weights in males and females of the 3.0% diet group, but no effects were found on survival rate, body weights, and hematological, serum biochemical or histopathological parameters at any dose levels in the chronic toxicity study. Regarding carcinogenicity, ammonium sulfate did not exert any significant influence on the incidences of tumors in any of the organs and tissues examined. It was concluded that the no observed adverse effect level of ammonium sulfate was the 0.6% diet, which is equivalent to 256 and 284 mg/kg b.w./day in males and females, respectively, and the compound is non-carcinogenic under the conditions of the study.

  15. 40 CFR 418.60 - Applicability; description of the ammonium sulfate production subcategory.

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 30 2013-07-01 2012-07-01 true Applicability; description of the ammonium sulfate production subcategory. 418.60 Section 418.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS FERTILIZER MANUFACTURING POINT...

  16. 40 CFR 418.60 - Applicability; description of the ammonium sulfate production subcategory.

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 29 2014-07-01 2012-07-01 true Applicability; description of the ammonium sulfate production subcategory. 418.60 Section 418.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS FERTILIZER MANUFACTURING POINT...

  17. 40 CFR 418.60 - Applicability; description of the ammonium sulfate production subcategory.

    Code of Federal Regulations, 2012 CFR


    ... 40 Protection of Environment 30 2012-07-01 2012-07-01 false Applicability; description of the ammonium sulfate production subcategory. 418.60 Section 418.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS FERTILIZER MANUFACTURING POINT...

  18. 40 CFR 418.60 - Applicability; description of the ammonium sulfate production subcategory.

    Code of Federal Regulations, 2010 CFR


    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the ammonium sulfate production subcategory. 418.60 Section 418.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS FERTILIZER MANUFACTURING POINT...

  19. 40 CFR 418.60 - Applicability; description of the ammonium sulfate production subcategory.

    Code of Federal Regulations, 2011 CFR


    ... 40 Protection of Environment 29 2011-07-01 2009-07-01 true Applicability; description of the ammonium sulfate production subcategory. 418.60 Section 418.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS FERTILIZER MANUFACTURING POINT...

  20. Ammonium Sulfate Evaporites Associated With Uranium Mill Tailings Disposal Cells

    NASA Astrophysics Data System (ADS)

    Wendlandt, R. F.; Harrison, W. J.


    The waste products of uranium mill operations are complex and dependent on the ore mineralogy, milling process (e.g., low pH vs. high pH), and operational status of the mill among other things. The White Mesa Mill, Utah, was visited during both quiescent (July 2004) and operational phases (August 2005) to collect liquid and solid samples from the active evaporation and storage ponds environments (Cells 1 and 3). Cell 4, which was unused and being excavated at the times of both samplings, yielded solids accumulated through the history of that cell's use. Raffinate samples are concentrated Na-Mg-Al-Fe-SO4-NO3(-NH4) brines characterized by extreme enrichments in REE and transition elements. Ionic strengths, calculated using the Pitzer activity coefficient model varied from 25M (pH = 1 at 25°C) in Cell 1 and 12M (pH = 2.7) in Cell 3 during July 2004, to 5M (pH = 1.5) in Cell 1 and 1.2M (pH = 2.9) in Cell 3 during August 2005. At the first sampling, the dominant anion was sulfate in Cell 1 and nitrate in Cell 3. At the time of the second sampling, both cells were dominated by sulfate. During July 2004, there was significant evaporative drawdown in the ponds, resulting in 3 variably colored zones (~7m) of mineralogically complex evaporites at the cell margins. During August 2005, the operational nature of the mill and the addition of fresh water had produced high water levels in Cells 1 and 3. Evaporation crusts were recognized around the margins of the cells but they were <2m in extent. XRD analyses document the presence of boussingaultite, (NH4)2Mg(SO4)2.6H2O, which was actively precipitating from Cell 1 during 2004, tschermigite, (NH4)Al(SO4)2.12H2O, gypsum, and polymorphs of Na2SO4 including thenardite. ESEM imaging and EDS analyses of crusts reveal complex parageneses involving the above-mentioned phases and NH4-bearing metavoltine, K2Na6Fe^{+2}Fe6^{+3}(SO4)12O2.18H2O, among others. Ksp calculations and field relations are consistent with a precipitation sequence

  1. Solid/liquid phase diagram of the ammonium sulfate/succinic acid/water system.


    Pearson, Christian S; Beyer, Keith D


    We have studied the low-temperature phase diagram and water activities of the ammonium sulfate/succinic acid/water system using differential scanning calorimetry and infrared spectroscopy of thin films. Using the results from our experiments, we have mapped the solid/liquid ternary phase diagram, determined the water activities based on the freezing point depression, and determined the ice/succinic acid phase boundary as well as the ternary eutectic composition and temperature. We also compared our results to the predictions of the extended AIM aerosol thermodynamics model (E-AIM) and found good agreement for the ice melting points in the ice primary phase field of this system; however, differences were found with respect to succinic acid solubility temperatures. We also compared the results of this study with those of previous studies that we have published on ammonium sulfate/dicarboxylic acid/water systems.

  2. Analysis of ammonium sulfate circulation tank failure -- Possible causes and their remediation

    SciTech Connect

    O`Hearn, R.J.


    Acme steel manufactures a liquid solution of ammonium sulphate by scrubbing the coke oven gas with a dilute solution of sulphuric acid. When the bath reaches a predetermined specific gravity, it is isolated from the system, neutralized with aqua ammonia, pumped to the shipping tanks, re-charged with water and acid, then placed back in service. To improve the ammonia removal efficiency, three circulation tanks are used in this system. In June 1996, the volume of two of the sulfate solution tanks in the ammonia removal plant were increased by two different pressure events. The first tank was damaged by pressure that was not relieved due to a plugged vent line. The second tank was damaged by a pressure event generated during the process of making ammonium sulfate. This paper will discuss the cause of the second tank`s failure, and the design solution to restart the operation of the plant.

  3. Solid/Liquid phase diagram of the ammonium sulfate/maleic acid/water system.


    Beyer, Keith D; Schroeder, Jason R; Pearson, Christian S


    We have studied the low temperature phase diagram and water activities of the ammonium sulfate/maleic acid/water system using differential scanning calorimetry and infrared spectroscopy of thin films. Using the results from our experiments, we have mapped the solid/liquid ternary phase diagram, determined the water activities based on the freezing point depression, and determined the ice/maleic acid phase boundary as well as the ternary eutectic composition and temperature. We also compare our results to the predictions of the extended AIM aerosol thermodynamics model and find good agreement for the ice melting points in the ice primary phase field of this system; however significant differences were found with respect to phase boundaries, maleic acid dissolution, and ammonium sulfate dissolution.

  4. Coefficients of caffeine distribution in aliphatic alcohol-ammonium sulfate-water systems

    NASA Astrophysics Data System (ADS)

    Korenman, Ya. I.; Krivosheeva, O. A.; Mokshina, N. Ya.


    The extraction of caffeine with aliphatic alcohols C3-C9 from aqueous solutions in the presence of a salting-out agent (ammonium sulfate) is studied. Quantitative characteristics of extraction are calculated: the distribution coefficients ( D) and the degree of recovery ( R, %). Relations are found between log D of caffeine and the length of the hydrocarbon radical in the alcohol molecule, along with certain physicochemical properties of the extragents.

  5. Cloud condensation nucleus activity of internally mixed ammonium sulfate/organic acid aerosol particles

    NASA Astrophysics Data System (ADS)

    Abbatt, J. P. D.; Broekhuizen, K.; Pradeep Kumar, P.

    The ability of mixed ammonium sulfate/organic acid particles to act as cloud condensation nuclei (CCN) has been studied in the laboratory using a continuous flow, thermal-gradient diffusion chamber operated at supersaturations between 0.3% and 0.6%. The organic acids studied were malonic acid, azelaic acid, hexanoic acid, cis-pinonic acid, oleic acid and stearic acid, and the particles were largely prepared by condensation of the organic vapor onto a dry ammonium sulfate core. For malonic acid and hexanoic acid, the mixed particles activated as predicted by a simple Köhler theory model where both species are assumed to be fully soluble and the droplet has the surface tension of water. Three low-solubility species, cis-pinonic acid, azelaic acid and oleic acid, are well modeled where the acid was assumed to be either partially or fully insoluble. Interestingly, although thin coats of stearic acid behaved in a manner similar to that displayed by oleic and cis-pinonic acid, we observed that thick coats led to a complete deactivation of the ammonium sulfate, presumably because the water vapor could not diffuse through the solid stearic acid. We observed no CCN behavior that could be clearly attributed to a lowering of the surface tension of the growing droplet by the presence of the organic constituents, some of which are highly surface active.

  6. Selective Precipitation and Purification of Monovalent Proteins Using Oligovalent Ligands and Ammonium Sulfate

    PubMed Central

    Mirica, Katherine A.; Lockett, Matthew R.; Snyder, Phillip W.; Shapiro, Nathan D.; Mack, Eric T.; Nam, Sarah; Whitesides, George M.


    This paper describes a method for the selective precipitation and purification of a monovalent protein (carbonic anhydrase is used as a demonstration) from cellular lysate using ammonium sulfate and oligovalent ligands. The oligovalent ligands induce the formation of protein-ligand aggregates, and at an appropriate concentration of dissolved ammonium sulfate, these complexes precipitate. The purification involves three steps: i) the removal of high-molecular weight impurities through the addition of ammonium sulfate to the crude cell lysate; ii) the introduction of an oligovalent ligand and the selective precipitation of the target protein-ligand aggregates from solution; and iii) the removal of the oligovalent ligand from the precipitate by dialysis to release the target protein. The increase of mass and volume of the proteins upon aggregate formation reduces their solubility, and results in the selective precipitation of these aggregates. We recovered human carbonic anhydrase, from crude cellular lysate, in 82% yield and 95% purity with a trivalent benzene sulfonamide ligand. This method provides a chromatography-free strategy of purifying monovalent proteins—for which appropriate oligovalent ligands can be synthesized—and combines the selectivity of affinity-based purification with the convenience of salt-induced precipitation. PMID:22188202

  7. Manufacture of ammonium sulfate fertilizer from FGD-gypsum. Technical report, March 1--May 31, 1995

    SciTech Connect

    Chou, M.I.M.; Rostam-Abadi, Ml; Lytle, J.M.; Bruinius, J.A.; Li, Y.C.; Hoeft, R.; Dewey, S.; Achorn, F.


    Goal is to assess technical and economic feasibility for producing fertilizer-grade ammonium sulfate from gypsum produced in limestone flue gas desulfurization (FGD). This is the 1st year of a 2-year program among Illinois State Geological Survey, University of Illinois (Urbana-Champaign), Allied-Signal, Marketing Chem. Process Inc., Henry Fertilizer, Illinois Power Co., and Central Illinois Public Services. In previous quarter, chemistry and process conditions were reviewed and a reactor system set up and used to conduct laboratory tests. FGD-gypsum from Abbott power plant was used. The scrubber, a Chiyoda Thoroughbred 121 FGD, produced a filter cake (98.36% gypsum and < 0.01% CaSO{sub 3}). Conversion of FGD- gypsum to ammonium sulfate was tested at 60-70{degree}C for 5-6 hr. Yield up to 82% and purity up to 95% were achieved for the ammonium sulfate production. During this quarter, more bench-scale experiments including a mass balance analysis were conducted; a yield up to 83% and up to 99% purity were achieved. A literature survey was completed and a preliminary process flow sheet was developed. Economics of the process is being estimated.

  8. Synthesis of seaweed based carbon acid catalyst by thermal decomposition of ammonium sulfate for biodiesel production

    NASA Astrophysics Data System (ADS)

    Ee, Tang Zo; Lim, Steven; Ling, Pang Yean; Huei, Wong Kam; Chyuan, Ong Hwai


    Experiment was carried out to study the feasibility of biomass derived solid acid catalyst for the production of biodiesel using Palm Fatty Acid Distillate (PFAD). Malaysia indigenous seaweed was selected as the biomass to be carbonized as the catalyst support. Sulfonation of seaweed based carbon material was carried out by thermal decomposition of ammonium sulfate, (NH4)2SO4. The effects of carbonization temperature at 200 to 600°C on the catalyst physical and chemical properties were studied. The effect of reaction parameters on the fatty acid methyl ester (FAME) yield was studied by varying the concentration of ammonium sulfate (5.0 to 40.0 w/v%) and thermal decomposition time (15 to 90 min). Characterizations of catalyst were carried out to study the catalyst surface morphology with Scanning Electron Microscope (SEM), acid density with back titration and functional group attached with FT-IR. Results showed that when the catalyst sulfonated with 10.0 w/v% ammonium sulfate solution and heated to 235°C for 30 min, the highest FAME yield achieved was 23.7% at the reaction condition of 5.0 wt.% catalyst loading, esterification time of 4 h, methanol to PFAD molar ratio of 20:1 at 100°C reaction temperature.

  9. Selective precipitation and purification of monovalent proteins using oligovalent ligands and ammonium sulfate.


    Mirica, Katherine A; Lockett, Matthew R; Snyder, Phillip W; Shapiro, Nathan D; Mack, Eric T; Nam, Sarah; Whitesides, George M


    This paper describes a method for the selective precipitation and purification of a monovalent protein (carbonic anhydrase is used as a demonstration) from cellular lysate using ammonium sulfate and oligovalent ligands. The oligovalent ligands induce the formation of protein-ligand aggregates, and at an appropriate concentration of dissolved ammonium sulfate, these complexes precipitate. The purification involves three steps: (i) the removal of high-molecular-weight impurities through the addition of ammonium sulfate to the crude cell lysate; (ii) the introduction of an oligovalent ligand and the selective precipitation of the target protein-ligand aggregates from solution; and (iii) the removal of the oligovalent ligand from the precipitate by dialysis to release the target protein. The increase of mass and volume of the proteins upon aggregate formation reduces their solubility, and results in the selective precipitation of these aggregates. We recovered human carbonic anhydrase, from crude cellular lysate, in 82% yield and 95% purity with a trivalent benzene sulfonamide ligand. This method provides a chromatography-free strategy of purifying monovalent proteins--for which appropriate oligovalent ligands can be synthesized--and combines the selectivity of affinity-based purification with the convenience of salt-induced precipitation.

  10. Optimization of tetanus toxoid ammonium sulfate precipitation process using response surface methodology.


    Brgles, Marija; Prebeg, Pero; Kurtović, Tihana; Ranić, Jelena; Marchetti-Deschmann, Martina; Allmaier, Günter; Halassy, Beata


    Tetanus toxoid (TTd) is a highly immunogenic, detoxified form of tetanus toxin, a causative agent of tetanus disease, produced by Clostridium tetani. Since tetanus disease cannot be eradicated but is easily prevented by vaccination, the need for the tetanus vaccine is permanent. The aim of this work was to investigate the possibility of optimizing TTd purification, i.e., ammonium sulfate precipitation process. The influence of the percentage of ammonium sulfate, starting amount of TTd, buffer type, pH, temperature, and starting purity of TTd on the purification process were investigated using optimal design for response surface models. Responses measured for evaluation of the ammonium sulfate precipitation process were TTd amount (Lf/mL) and total protein content. These two parameters were used to calculate purity (Lf/mgPN) and the yield of the process. Results indicate that citrate buffer, lower temperature, and lower starting amount of TTd result in higher purities of precipitates. Gel electrophoresis combined with matrix-assisted laser desorption ionization-mass spectrometric analysis of precipitates revealed that there are no inter-protein cross-links and that all contaminating proteins have pIs similar to TTd, so this is most probably the reason for the limited success of purification by precipitation.

  11. Manufacture of ammonium sulfate fertilizer from gypsum-rich byproduct of flue gas desulfurization - A prefeasibility cost estimate

    USGS Publications Warehouse

    Chou, I.-Ming; Rostam-Abadi, M.; Lytle, J.M.; Achorn, F.P.


    Costs for constructing and operating a conceptual plant based on a proposed process that converts flue gas desulfurization (FGD)-gypsum to ammonium sulfate fertilizer has been calculated and used to estimate a market price for the product. The average market price of granular ammonium sulfate ($138/ton) exceeds the rough estimated cost of ammonium sulfate from the proposed process ($111/ ton), by 25 percent, if granular size ammonium sulfate crystals of 1.2 to 3.3 millimeters in diameters can be produced by the proposed process. However, there was at least ??30% margin in the cost estimate calculations. The additional costs for compaction, if needed to create granules of the required size, would make the process uneconomical unless considerable efficiency gains are achieved to balance the additional costs. This study suggests the need both to refine the crystallization process and to find potential markets for the calcium carbonate produced by the process.

  12. Analysis of reversibility and reaction products of glyoxal uptake onto ammonium sulfate aerosol

    NASA Astrophysics Data System (ADS)

    Galloway, M. M.; Chhabra, P. S.; Chan, A. W.; Surratt, J. D.; Kwan, A. J.; Wennberg, P. O.; Flagan, R. C.; Seinfeld, J. H.; Keutsch, F. N.


    Glyoxal, the smallest alpha-dicarbonyl, is an oxidation product of both biogenic and anthropogenic volatile organic compounds (Fu et al. JGR 113, D15303, 2008). Despite its low molecular weight, its role in secondary organic aerosol (SOA) formation has gained interest and a recent study suggested that it accounts for more than 15% of SOA in Mexico City (Volkamer et al. GRL 34, L19807, 2007). Despite numerous previous studies, questions remain regarding the processes controlling glyoxal uptake onto aerosol, including the role of acid catalysis, degree of reversibility, and identity of aerosol phase reaction products. We present results of chamber aerosol studies (Galloway et al. ACPD 8, 20799, 2008) and laboratory studies of bulk samples aimed at improving the understanding of these processes, in particular formation of oligomers and organosulfates of glyoxal, as well as the formation of imidazoles (carbon-nitrogen containing heterocyclic aromatic compounds) under dark and irradiated conditions. The relevance of these classes of reaction products extends beyond glyoxal, as evidence of oligomers and organosulfates other than those of glyoxal have been found in ambient aerosol (Surratt et al. JPCA 112, 8345, 2008; Denkenberger et al. Environ. Sci. Technol. 41, 5439, 2007). Experiments in which a chamber air mass was diluted after equilibration of glyoxal uptake onto ammonium sulfate seed aerosol (relative humidity 60% and glyoxal mixing ratios of 25-200 ppbv) shows that under these conditions uptake is reversible. The most important condensed phase products are hydrated oligomers of glyoxal, which are also formed reversibly under these conditions. Our studies show that organosulfates were not formed under dark conditions for neutral or acidified aerosol; similarly, Minerath et al. have recently shown that formation of a different class of organosulfates (alkyl sulfates) also proceeds very slowly even under acidic conditions (Environ. Sci. Technol. 42, 4410, 2008). The

  13. Hygroscopicity of organic compounds from biomass burning and their influence on the water uptake of mixed organic ammonium sulfate aerosols

    NASA Astrophysics Data System (ADS)

    Lei, T.; Zuend, A.; Wang, W. G.; Zhang, Y. H.; Ge, M. F.


    Hygroscopic behavior of organic compounds, including levoglucosan, 4-hydroxybenzoic acid, and humic acid, as well as their effects on the hygroscopic properties of ammonium sulfate (AS) in internally mixed particles are studied by a hygroscopicity tandem differential mobility analyzer (HTDMA). The organic compounds used represent pyrolysis products of wood that are emitted from biomass burning sources. It is found that humic acid aerosol particles only slightly take up water, starting at RH (relative humidity) above ~70%. This is contrasted by the continuous water absorption of levoglucosan aerosol particles in the range 5-90% RH. However, no hygroscopic growth is observed for 4-hydroxybenzoic acid aerosol particles. Predicted water uptake using the ideal solution theory, the AIOMFAC model and the E-AIM (with UNIFAC) model are consistent with measured hygroscopic growth factors of levoglucosan. However, the use of these models without consideration of crystalline organic phases is not appropriate to describe the hygroscopicity of organics that do not exhibit continuous water uptake, such as 4-hydroxybenzoic acid and humic acid. Mixed aerosol particles consisting of ammonium sulfate and levoglucosan, 4-hydroxybenzoic acid, or humic acid with different organic mass fractions, take up a reduced amount of water above 80% RH (above AS deliquescence) relative to pure ammonium sulfate aerosol particles of the same mass. Hygroscopic growth of mixtures of ammonium sulfate and levoglucosan with different organic mass fractions agree well with the predictions of the thermodynamic models. Use of the Zdanovskii-Stokes-Robinson (ZSR) relation and AIOMFAC model lead to good agreement with measured growth factors of mixtures of ammonium sulfate with 4-hydroxybenzoic acid assuming an insoluble organic phase. Deviations of model predictions from the HTDMA measurement are mainly due to the occurrence of a microscopical solid phase restructuring at increased humidity (morphology

  14. Formation and transformation of metastable double salts from the crystallization of mixed ammonium nitrate and ammonium sulfate particles.


    Ling, Tsz Yan; Chan, Chak K


    Ammonium nitrate (AN) and ammonium sulfate (AS) are ubiquitous components of atmospheric aerosols. Thermodynamic models predict formation of pure (AN and AS) and double salts (3AN. AS and 2AN. AS) for the AN/AS system. Because of the high supersaturation at which a droplet crystallizes, metastable crystal formation is possible. In this study, the identity of the crystals formed from the crystallization of equimolar AN/AS mixed droplets was investigated in an electrodynamic balance coupled with a Raman spectroscopic system. Raman spectra of bulk AN/AS double salts possibly formed in this system are first reported for comparison with the single particle Raman results. The double-salt 3AN. AS, not predicted from thermodynamics, was observed in the freshly crystallized single particles. The degree of metastability can be different among several crystallization processes of the same particles. The metastable salt 3AN. AS gradually transformed into stable 2AN. AS, and the rate of such transformation increased with increasing relative humidity. This study illustrates the possibility of occurrence of metastable salts in atmospheric aerosols.

  15. Bioleaching of heavy metals from sewage sludge by indigenous iron-oxidizing microorganisms using ammonium ferrous sulfate and ferrous sulfate as energy sources: a comparative study.


    Pathak, Ashish; Dastidar, M G; Sreekrishnan, T R


    The potential of indigenous iron-oxidizing microorganisms enriched at initial neutral pH of the sewage sludge for bioleaching of heavy metals was investigated at initial neutral pH of the sludge using ammonium ferrous sulfate (FAS) and ferrous sulfate (FS) as an energy sources in two different sets of experiments. After 16 days of bioleaching, 56% Cu, 48% Ni, 68% Zn and 42% C were removed from the sludge using ammonium ferrous sulfate as an energy source. On the other hand, 64% Cu, 58% Ni, 76% Zn and 52% Cr were removed using ferrous sulfate. Further, 32% nitrogen and 24% phosphorus were leached from the sludge using ferrous sulfate, whereas only 22% nitrogen and 17% phosphorus were removed using ammonium ferrous sulfate. The BCR sequential extraction study on speciation of metals showed that using ammonium ferrous sulfate and ferrous sulfate, all the metals remained in bioleached sludge as stable form (F4 fraction). The results of the present study indicate that the bioleached sludge would be safer for land application. Also, the fertilizing property was largely conserved in the bioleached sludge using both the substrates.

  16. Ice nucleation in internally mixed ammonium sulfate/dicarboxylic acid particles

    NASA Astrophysics Data System (ADS)

    Wise, Matthew E.; Garland, Rebecca M.; Tolbert, Margaret A.


    Recent studies have shown that tropospheric sulfate aerosols commonly contain 50% or more by mass organic species. The influence of these organics on the chemical and physical properties of sulfate aerosols is not fully established. Using an aerosol flow tube technique, we have determined ice nucleation temperatures for particles composed of ammonium sulfate and mixtures of ammonium sulfate with a series of dicarboxylic acids. A calibration curve was developed to allow us to convert the freezing temperatures to a saturation ratio required for ice nucleation. At levels detectable by our experimental technique we find that the freezing temperatures and critical ice saturation ratios of each system were identical, for a given water activity of the solution, even though the solutions contained varying fractions of inorganic and organic components. Further experiments showed that the freezing behavior of pure dicarboxylic acid particles was identical to that of the other systems studied if the water activity was identical. Although the apparent freezing temperatures reported here are substantially warmer than those predicted by the water activity based nucleation theory of T. Koop et al., we find that solution water activity defined the freezing conditions for the systems studied here.

  17. Wet deposition of ammonium, nitrate and sulfate in the Netherlands over the period 1992-2008

    NASA Astrophysics Data System (ADS)

    van der Swaluw, Eric; Asman, Willem A. H.; van Jaarsveld, Hans; Hoogerbrugge, Ronald


    We present measurements of wet deposition of ammonium, nitrate and sulfate in the Netherlands over the period 1992-2008. These data series are obtained from the Dutch National Precipitation Chemistry Monitoring Network which consists of 11 monitoring stations which are homogeneously spread over the Netherlands. These long-term measurements allow for a trend analysis over this period, which are to a large extent not influenced by the year to year variations in meteorological circumstances. It is shown that the downward trend of ammonium, nitrate and sulfate wet deposition over the period 1992-2008 are statistically significant: the wet deposition in the Netherlands decreased in the period 1992-2008 by 37% for ammonium, 28% for nitrate and 59% for sulfate. A comparison between the measurements and emissions are made in order to check whether the emissions show similar downward trends. Subsequently a comparison is made between measured and calculated wet deposition fluxes. These calculation results were performed with the Operational Priority Substances (OPS-model). The trends in both the emissions and the calculated wet deposition fluxes show good agreement for all three measured components. It is therefore concluded that the downward trends of the wet deposition fluxes are a direct effect of the decrease of emissions. Finally, it is shown that the relative downward trend of the wet deposition fluxes of sulfate in the Netherlands shows a large-scale structure with a gradient running from east to west. A similar pattern is seen in the simulations performed with the OPS-model.

  18. Formation of hexamethylenetetramine by aqueous solutions of formaldehyde and ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Rodriguez, A. A.; De Haan, D. O.; Kua, J.


    Formaldehyde and ammonium sulfate are prominent compounds found in cloudwater. Electronic structure calculations and lab experiments were carried out to explore the oligomerization reactions between formaldehyde and ammonia. Density functional theory calculations along with solvation and thermodynamic corrections were performed to map the kinetic and thermodynamic landscape for the reactions leading to the formation of hexamethylenetetramine (hmta). Three general classes of reactions were considered: nucleophilic addition of amine to formaldehyde, nucleophilic addition of ammonia to imine intermediates ammonia, and dehydration of alkanolamines. The reaction was studied experimentally using bulk-phase aqueous solutions of formaldehyde, ammonium sulfate, and in some experiments, iron (III) sulfate (chosen because Fe3+ forms a brown complex with hmta). Aqueous standard solutions of the reaction product hmta were also made. Reaction mixtures were analyzed using NMR, UV-Vis spectroscopy and LCMS. Compound hmta was the main product observed by both NMR and LCMS. Using LCMS a large peak was observed within minutes of mixing the reactants. The absorbance of the reaction mixture increased strongly below 225 nm but little to no absorbance was observed in the visible spectrum.

  19. Hygroscopic behavior of atmospherically relevant water-soluble carboxylic salts and their influence on the water uptake of ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Wu, Z. J.; Nowak, A.; Poulain, L.; Herrmann, H.; Wiedensohler, A.


    The hygroscopic behavior of atmospherically relevant water-soluble carboxylic salts and their effects on ammonium sulfate were investigated using a hygroscopicity tandem differential mobility analyzer (H-TDMA). No hygroscopic growth is observed for disodium oxalate, while ammonium oxalate shows slight growth (growth factor = 1.05 at 90%). The growth factors at 90% RH for sodium acetate, disodium malonate, disodium succinate, disodium tartrate, diammonium tartrate, sodium pyruvate, disodium maleate, and humic acid sodium salt are 1.79, 1.78, 1.69, 1.54, 1.29, 1.70, 1.78, and 1.19, respectively. The hygroscopic growth of mixtures of organic salts with ammonium sulfate, which are prepared as surrogates of atmospheric aerosols, was determined. A clear shift in deliquescence relative humidity to lower RH with increasing organic mass fraction was observed for these mixtures. Above 80% RH, the contribution to water uptake by the organic salts was close to that of ammonium sulfate for the majority of investigated compounds. The observed hygroscopic growth of the mixed particles at RH above the deliquescence relative humidity of ammonium sulfate agreed well with that predicted using the Zdanovskii-Stokes-Robinson (ZSR) mixing rule. Mixtures of ammonium sulfate with organic salts are more hygroscopic than mixtures with organic acids, indicating that neutralization by gas-phase ammonia and/or association with cations of dicarbonxylic acids may enhance the hygroscopicity of the atmospheric particles.

  20. Solid ammonium sulfate aerosols as ice nuclei: a pathway for cirrus cloud formation.


    Abbatt, J P D; Benz, S; Cziczo, D J; Kanji, Z; Lohmann, U; Möhler, O


    Laboratory measurements support a cirrus cloud formation pathway involving heterogeneous ice nucleation by solid ammonium sulfate aerosols. Ice formation occurs at low ice-saturation ratios consistent with the formation of continental cirrus and an interhemispheric asymmetry observed for cloud onset. In a climate model, this mechanism provides a widespread source of ice nuclei and leads to fewer but larger ice crystals as compared with a homogeneous freezing scenario. This reduces both the cloud albedo and the longwave heating by cirrus. With the global ammonia budget dominated by agricultural practices, this pathway might further couple anthropogenic activity to the climate system.

  1. Removal of hydrogen sulfide as ammonium sulfate from hydropyrolysis product vapors


    Marker, Terry L; Felix, Larry G; Linck, Martin B; Roberts, Michael J


    A system and method for processing biomass into hydrocarbon fuels that includes processing a biomass in a hydropyrolysis reactor resulting in hydrocarbon fuels and a process vapor stream and cooling the process vapor stream to a condensation temperature resulting in an aqueous stream. The aqueous stream is sent to a catalytic reactor where it is oxidized to obtain a product stream containing ammonia and ammonium sulfate. A resulting cooled product vapor stream includes non-condensable process vapors comprising H.sub.2, CH.sub.4, CO, CO.sub.2, ammonia and hydrogen sulfide.

  2. Removal of hydrogen sulfide as ammonium sulfate from hydropyrolysis product vapors


    Marker, Terry L.; Felix, Larry G.; Linck, Martin B.; Roberts, Michael J.


    A system and method for processing biomass into hydrocarbon fuels that includes processing a biomass in a hydropyrolysis reactor resulting in hydrocarbon fuels and a process vapor stream and cooling the process vapor stream to a condensation temperature resulting in an aqueous stream. The aqueous stream is sent to a catalytic reactor where it is oxidized to obtain a product stream containing ammonia and ammonium sulfate. A resulting cooled product vapor stream includes non-condensable process vapors comprising H.sub.2, CH.sub.4, CO, CO.sub.2, ammonia and hydrogen sulfide.

  3. Ammonium sulfate induced nuclear changes in the oocyte of the fish, Channa punctatus (Bl. )

    SciTech Connect

    Ram, R.N.; Sathyanesan, A.G.


    One among the common pollutants present in our riverine and lacustrine system is the commonly used fertilizer ammonium sulfate ((NH/sub 4/)/sub 2/SO/sub 4/). The unionized ammonia (UIA) base in the water is responsible for the toxicity due to its distinctive penetrative properties. Prolonged exposure of the fish Clarias batrachus to (NH/sub 4/)/sub 2/SO/sub 4/ causes endocrine changes. However, the deleterious effect of this fertilizer on the reproduction of fishes is not well recorded. In this study, (NH/sub 4/)/sub 2/SO/sub 4/-induced degenerative changes in the nucleus of early vitellogenic oocytes of C. punctatus are described.

  4. Evaluation of the phenol ammonium sulfate sedimentation smear microscopy method for diagnosis of pulmonary tuberculosis.


    Selvakumar, N; Rahman, Fathima; Garg, Renu; Rajasekaran, S; Mohan, Nalini Sunder; Thyagarajan, K; Sundaram, V; Santha, T; Frieden, Thomas R; Narayanan, P R


    We compared the sensitivity and specificity of the phenol ammonium sulfate (PhAS) sediment smear microscopy method for detection of acid-fast bacilli with those of direct smear microscopy, using culture results for Mycobacterium tuberculosis as the "gold standard." The sensitivities of the PhAS and direct smear methods were 85% (465 of 547) and 83% (454 of 547), respectively, and the specificity of each method was 97%. The PhAS method was better accepted by the laboratory technicians and safer but necessitates an overnight sedimentation, which delays reporting of results until 1 day after sputum collection.

  5. Effect of Sodium Sulfate, Ammonium Chloride, Ammonium Nitrate, and Salt Mixtures on Aqueous Phase Partitioning of Organic Compounds.


    Wang, Chen; Lei, Ying Duan; Wania, Frank


    Dissolved inorganic salts influence the partitioning of organic compounds into the aqueous phase. This influence is especially significant in atmospheric aerosol, which usually contains large amounts of ions, including sodium, ammonium, chloride, sulfate, and nitrate. However, empirical data on this salt effect are very sparse. Here, the partitioning of numerous organic compounds into solutions of Na2SO4, NH4Cl, and NH4NO3 was measured and compared with existing data for NaCl and (NH4)2SO4. Salt mixtures were also tested to establish whether the salt effect is additive. In general, the salt effect showed a decreasing trend of Na2SO4 > (NH)2SO4 > NaCl > NH4Cl > NH4NO3 for the studied organic compounds, implying the following relative strength of the salt effect of individual anions: SO4(2-) > Cl(-) > NO3(-) and of cations: Na(+) > NH4(+). The salt effect of different salts is moderately correlated. Predictive models for the salt effect were developed based on the experimental data. The experimental data indicate that the salt effect of mixtures may not be entirely additive. However, the deviation from additivity, if it exists, is small. Data of very high quality are required to establish whether the effect of constituent ions or salts is additive or not.

  6. Hygroscopic behavior of atmospherically relevant water-soluble carboxylic salts and their influence on the water uptake of ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Wu, Z. J.; Nowak, A.; Poulain, L.; Herrmann, H.; Wiedensohler, A.


    The hygroscopic behavior of atmospherically relevant water-soluble carboxylic salts and their effects on ammonium sulfate was investigated using a hygroscopicity tandem differential mobility analyzer (H-TDMA). No hygroscopic growth is observed for sodium oxalate, while ammonium oxalate shows slight growth (growth factor = 1.05 at 90%). The growth factors at 90% RH for sodium acetate, sodium malonate, sodium succinate, sodium tartrate, ammonium tartrate, sodium pyruvate, sodium maleate, and humic acid sodium salt are 1.79, 1.78, 1.69, 1.54, 1.29, 1.70, 1.78, and 1.19, respectively. The mixtures of organic salts with ammonium sulfate, which are prepared simulating the atmospheric aerosols, are determined. A clear shift in DRH of mixture to lower RH is observed with increasing organic mass fraction. Above RH = 80%, the humidograms of the different mixtures are quite close to that of pure ammonium sulfate. Köhler theory is used to predict the effective hygroscopicity parameter, κ, for mixtures at 90% RH. The results show that Köhler theory underestimated kappa for mixtures without considering the water solubility of ammonium oxalate. However, if the water solubility of ammonium oxalate is taken into account, the results show a much better agreement with those derived from H-TDMA measurements.

  7. Experimental investigation of the homogeneous freezing of aqueous ammonium sulfate droplets.


    Larson, Ben H; Swanson, Brian D


    We have measured the light scattering intensity and homogeneous ice nucleation temperatures from water droplets containing 0-33 wt % ammonium sulfate. In these laboratory experiments, we used a free-fall freezing tube technique to determine the fraction of frozen droplets at a particular droplet temperature by measuring the depolarized light scattering intensity from the droplets in free-fall. Previously reported freezing temperatures for solution concentrations greater than 5 wt % display a larger spread than can be accounted for by the reported experimental errors. We find freezing temperatures in good agreement with the lowest temperature freezing results reported by previous experiments. Our ammonium sulfate freezing temperature data set with water activity less than 0.98 is consistent with a curve that deviates in activity shift by about 5% from the best-fit ice nucleation temperature versus water activity curve found by Koop et al. in 2000, but the significance of this deviation will only be known with further high-precision ice nucleation temperature measurements for other aqueous solutions.

  8. Deliquescence and crystallization of ammonium sulfate-glutaric acid and sodium chloride-glutaric acid particles

    NASA Astrophysics Data System (ADS)

    Pant, Atul; Fok, Abel; Parsons, Matthew T.; Mak, Jackson; Bertram, Allan K.


    In the following, we report the deliquescence relative humidities (DRH) and crystallization relative humidities (CRH) of mixed inorganic-organic particles, specifically ammonium sulfate-glutaric acid and sodium chloride-glutaric acid particles. Knowledge of the DRH and CRH of mixed inorganic-organic particles is crucial for predicting the role of aerosol particles in the atmosphere. Our DRH results are in good agreement with previous measurements, but our CRH results are significantly lower than some of the previous measurements reported in the literature. Our studies show that the DRH and CRH of ammonium sulfate and sodium chloride only decreased slightly when the mole fraction of the acid was less than 0.4. If other organics in the atmosphere behave in a similar manner, then the DRH and CRH of mixed inorganic-organic atmospheric particles will only be slightly less than the DRH and CRH of pure inorganic particles when the organic mole fraction is less than 0.4. Our results also show that if the particles contain a significant amount of organics (mole fraction > 0.5) the crystallization relative humidity decreases significantly and the particles are more likely to remain in the liquid state. Further work is needed to determine if other organics species of atmospheric importance have a similar effect.

  9. Glyoxal in aqueous ammonium sulfate solutions: products, kinetics and hydration effects.


    Yu, Ge; Bayer, Amanda R; Galloway, Melissa M; Korshavn, Kyle J; Fry, Charles G; Keutsch, Frank N


    Reactions and interactions between glyoxal and salts in aqueous solution were studied. Glyoxal was found to react with ammonium to form imidazole, imidazole-2-carboxaldehyde, formic acid, N-glyoxal substituted imidazole, and minor products at very low concentrations. Overall reaction orders and rates for each major product were measured. Sulfate ions have a strong and specific interaction with glyoxal in aqueous solution, which shifts the hydration equilibria of glyoxal from the unhydrated carbonyl form to the hydrated form. This ion-specific effect contributes to the observed enhancement of the effective Henry's law coefficient for glyoxal in sulfate-containing solutions. The results of UV-vis absorption and NMR spectroscopy studies of solutions of glyoxal with ammonium, methylamine, and dimethylamine salts reveal that light absorbing compounds require the formation of nitrogen containing molecules. These findings have implications on the role of glyoxal in the atmosphere, both in models of the contribution of glyoxal to form secondary organic aerosol (SOA), the role of nitrogen containing species for aerosol optical properties and in predictions of the behavior of other carbonyls or dicarbonyls in the atmosphere.

  10. The influence of indoxyl sulfate and ammonium on the autofluorescence of human urine.


    Perinchery, Sandeep Menon; Kuzhiumparambil, Unnikrishnan; Vemulpad, Subramanyam; Goldys, Ewa M


    Despite biological variability the spectral characteristics of undiluted human urine show relatively low autofluorescence at short UV (250-300nm) excitation. However with dilution the fluorescence intensity remarkably increases. This paper examines the mechanisms behind this effect, by using excitation-emission matrices. Corrections for the inner filter effect were made for improved understanding of the spectral patterns. We focused on three major fluorophores (tryptophan, indoxyl sulfate and 5-hydroxyindole-3-acetate) that are excited at these wavelengths, and whose content in urine is strongly linked with various health conditions. Their fluorescence was studied both individually and in combinations. We also examined the effect of ammonium on the fluorescence of these major fluorophores individually and in combinations. Through these studies we have identified the leading effects that reduce the UV fluorescence, namely higher concentration of indoxyl sulfate producing the inner filter effect and concentration quenching and quenching of fluorophores by ammonium. This result will assist in broader utilisation of UV fluorescence in medical diagnostics.

  11. Pharmacokinetics of ammonium sulfate gradient loaded liposome-encapsulated oxymorphone and hydromorphone in healthy dogs

    PubMed Central

    Smith, Lesley J.; Kukanich, Butch K.; Krugner-Higby, Lisa A.; Schmidt, Brynn H.; Heath, Timothy D.


    Objective To evaluate the pharmacokinetics, in dogs, of liposome-encapsulated oxymorphone and hydromorphone made by the ammonium sulfate gradient loading technique (ASG). Animals Four healthy purpose-bred Beagles aged 9.5 ± 3.2 months and weighing 13.4 ± 2.3 kg. Study Design Randomized cross-over design. Methods Each dog was given either 4.0 mg kg−1 of ASG-oxymorphone or 8.0 mg kg−1 of ASG-hydromorphone SC on separate occasions with a 3-month washout period. Blood was collected at baseline and at serial time points up to 1032 hours (43 days) after injection for determination of serum opioid concentrations. Serum opioid concentrations were measured with HPLC-MS and pharmacokinetic parameters were calculated using commercial software and non-compartmental methods. Results Serum concentrations of oxymorphone remained above the limit of quantification for 21 days, while those for hydromorphone remained above the limit of quantification for 29 days. Cmax for ASG-oxymorphone was 7.5 ng mL−1; Cmax for ASG-hydromorphone was 5.7 ng mL−1. Conclusions and clinical relevance Oxymorphone and hydromorphone, when encapsulated into liposomes using the ammonium sulfate gradient loading technique, result in measureable serum concentrations for between 3 to 4 weeks. This formulation may have promise in the convenient use of opioids for clinical treatment of chronically painful conditions in dogs. PMID:23601353

  12. Effect of ammonium sulfate fertilization on bahiagrass quality and copper metabolism in grazing beef cattle.


    Arthington, J D; Rechcigl, J E; Yost, G P; McDowell, L R; Fanning, M D


    To assess the impact of S fertilization on bahiagrass (Paspalum notatum) quality and Cu metabolism in cattle, two studies were conducted during the summer grazing season (1999 and 2000). Pasture replicates (16.2 ha; n = 2/treatment) received the same fertilizer treatment in each growing season, consisting of 1) 67 kg N/ha from ammonium sulfate (AS), 2) 67 kg N/ha from ammonium nitrate (AN), and 3) control (no fertilizer; C). Forage sampling was conducted at 28-d intervals following fertilization by the collection of whole plants (four samples/pasture) in randomly distributed 1-m2 grazing exclusion cages and analyzed for CP, in vitro organic matter digestibility, S, P, Ca, K, Mg, Na, Fe, Al, Mn, Cu, and Zn. To determine the effect of fertilizer treatment on liver trace mineral concentrations in grazing cattle, random liver tissue samples were collected (n = 12; four/treatment) at the start and end of the study period in 2000. Ammonium sulfate fertilization increased (P < 0.001) forage S concentration in both years. Plant tissue N concentrations were increased by N fertilization, regardless of source, in 2000, but not in 1999. Cows grazing AS pastures had lower (P < 0.05) liver Cu concentrations at the end of the study period in 2000 compared to AN and C. In Exp. 2, 37 Cu-deficient heifers grazing AS fertilized pastures were obtained from the same location and allocated to one of two treatments, consisting of supplements providing 123 mg/d of either inorganic (Cu sulfate; n = 12) or organic (Availa-Cu; n = 15) Cu. Treatments were delivered for 83 d. Liver Cu increased over time in all heifers regardless of treatment; however, heifers supplemented with Availa-Cu tended (P = 0.09) to have higher mean liver Cu concentrations than those receiving Cu sulfate. The results of these studies indicate that AS fertilization of bahiagrass increases forage S concentrations. When provided free-choice access to a complete salt-based trace mineral supplement, cows grazing AS

  13. Significant decrease of broth viscosity and glucose consumption in erythromycin fermentation by dynamic regulation of ammonium sulfate and phosphate.


    Chen, Yong; Wang, Zejian; Chu, Ju; Zhuang, Yingping; Zhang, Siliang; Yu, Xiaoguang


    In this study, the effects of nitrogen sources on broth viscosity and glucose consumption in erythromycin fermentation were investigated. By controlling ammonium sulfate concentration, broth viscosity and glucose consumption were decreased by 18.2% and 61.6%, respectively, whereas erythromycin biosynthesis was little affected. Furthermore, erythromycin A production was increased by 8.7% still with characteristics of low broth viscosity and glucose consumption through the rational regulations of phosphate salt, soybean meal and ammonium sulfate. It was found that ammonium sulfate could effectively control proteinase activity, which was correlated with the utilization of soybean meal as well as cell growth. The pollets formation contributed much to the decrease of broth viscosity. The accumulation of extracellular propionate and succinate under the new regulation strategy indicated that higher propanol consumption might increase the concentration of methylmalonyl-CoA and propionyl-CoA and thus could increase the flux leading to erythromycin A. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. A differential protein solubility approach for the depletion of highly abundant proteins in plasma using ammonium sulfate.


    Bollineni, Ravi Chand; Guldvik, Ingrid J; Grönberg, Henrik; Wiklund, Fredrik; Mills, Ian G; Thiede, Bernd


    Depletion of highly abundant proteins is an approved step in blood plasma analysis by mass spectrometry (MS). In this study, we explored a precipitation and differential protein solubility approach as a fractionation strategy for abundant protein removal from plasma. Total proteins from plasma were precipitated with 90% saturated ammonium sulfate, followed by differential solubilization in 55% and 35% saturated ammonium sulfate solutions. Using a four hour liquid chromatography (LC) gradient and an LTQ-Orbitrap XL mass spectrometer, a total of 167 and 224 proteins were identified from the 55% and 35% ammonium sulfate fractions, whereas 235 proteins were found in the remaining protein fractions with at least two unique peptides. SDS-PAGE and exclusive total spectrum counts from LC-MS/MS analyses clearly showed that majority of the abundant plasma proteins were solubilized in 55% and 35% ammonium sulfate solutions, indicating that the remaining protein fraction is of potential interest for identification of less abundant plasma proteins. Serum albumin, serotransferrin, alpha-1-antitrypsin and transthyretin were the abundant proteins that were highly enriched in 55% ammonium sulfate fractions. Immunoglobulins, complement system proteins, and apolipoproteins were among other abundant plasma proteins that were enriched in 35% ammonium sulfate fractions. In the remaining protein fractions a total of 40 unique proteins were identified of which, 32 proteins were identified with at least 10 exclusive spectrum counts. According to PeptideAtlas, 9 of these 32 proteins were estimated to be present at low μg ml(-1) (0.12-1.9 μg ml(-1)) concentrations in the plasma, and 17 at low ng ml(-1) (0.1-55 ng ml(-1)) range.

  15. Role of sucrose in the heterogeneous uptake of dimethylamine by ammonium sulfate aerosol particles

    NASA Astrophysics Data System (ADS)

    Chu, Y.; Chan, C. K.


    Alkyl amines are important alkaline gases besides ammonia in the atmosphere and widely detected in both gas and particle phases. Heterogeneous uptake by pre-existing particles containing acids as well as ammonium salts is one of the major pathways of alkyl amines partitioning into aerosols. Recently, phase state of ammonium salt particles has been revealed to largely affect the degree of alkyl amines uptake. Using an electrodynamic balance coupled with Raman spectroscopy, we extend the study by investigating the alkyl amine uptake by ammonium sulfate (AS) - sucrose mixed particles, since ambient aerosols usually consist of a mixed phase of organics and inorganics. Sucrose is a surrogate of hydrophilic viscous organics that can alter the phase of AS at low relative humidity (RH) and dimethylamine (DMA) is selected for its abundance amongst alkyl amine compounds. DMA uptake occurred effectively at not only 70% RH but also RH as low as 10%, significantly below the AS crystallization point. The net uptake coefficient decreased as RH decreased for fixed initial AS - sucrose particle compositions. Interestingly, it followed a first increasing then decreasing trend as sucrose molar fraction increased from 0 to 0.5, at RH below 30%. Sucrose, albeit inert to DMA vapor, indirectly affected the interaction between DMA and AS - sucrose particles. On one hand, it absorbed water at low RH and delayed the efflorescence of AS to promote DMA uptake. On the other hand, the particle became more viscous with higher sucrose concentration and exhibited an effective mass transport barrier. Hence, the uptake of alkyl amines may occur slowly once ammonium salts are mixed with viscous organics, such as those secondary organic materials formed via the oxidation of biogenic volatile organic compounds, in the particle phase. Acknowledgment This work is supported by Research Grants Council (RGC) of Hong Kong Special Administrative Region, China (GRF 16300214). The grant from Hong Kong RGC Ph

  16. Solubilities and Glass Formation in Aqueous Solutions of the Sodium Salts of Malonic Acid With and Without Ammonium Sulfate.


    Kissinger, Jared A; Buttke, Lukas G; Vinokur, Anastasiya I; Guzei, Ilia A; Beyer, Keith D


    The solubility of sodium hydrogen malonate and sodium malonate in water both with and without ammonium sulfate present has been studied using differential scanning calorimetry and infrared spectroscopy. The crystals that form from sodium hydrogen malonate/water solutions were determined to be sodium hydrogen malonate monohydrate by single-crystal X-ray diffractometry. The crystals formed in sodium malonate/water solutions were determined to be sodium malonate monohydrate, a compound whose structure had not been previously known. When ammonium sulfate is added to these respective aqueous systems, the precipitation solids contain sodium sulfate decahydrate under low to moderate ammonium concentrations and lecontite (NaNH4SO4·2H2O) under high ammonium concentrations, which can be found under dry atmospheric conditions. Thus, it appears the presence of malonate and hydrogen malonate ions does not significantly affect the precipitation of inorganic salts in these systems. The glass transition temperatures of all solutions were also determined, and it was observed that the addition of ammonium sulfate slightly lowers the glass transition temperature in these solutions.

  17. Volatility of mixed atmospheric humic-like substances and ammonium sulfate particles

    NASA Astrophysics Data System (ADS)

    Nie, Wei; Hong, Juan; Häme, Silja A. K.; Ding, Aijun; Li, Yugen; Yan, Chao; Hao, Liqing; Mikkilä, Jyri; Zheng, Longfei; Xie, Yuning; Zhu, Caijun; Xu, Zheng; Chi, Xuguang; Huang, Xin; Zhou, Yang; Lin, Peng; Virtanen, Annele; Worsnop, Douglas R.; Kulmala, Markku; Ehn, Mikael; Yu, Jianzhen; Kerminen, Veli-Matti; Petäjä, Tuukka


    The volatility of organic aerosols remains poorly understood due to the complexity of speciation and multiphase processes. In this study, we extracted humic-like substances (HULIS) from four atmospheric aerosol samples collected at the SORPES station in Nanjing, eastern China, and investigated the volatility behavior of particles at different sizes using a Volatility Tandem Differential Mobility Analyzer (VTDMA). In spite of the large differences in particle mass concentrations, the extracted HULIS from the four samples all revealed very high-oxidation states (O : C > 0.95), indicating secondary formation as the major source of HULIS in Yangtze River Delta (YRD). An overall low volatility was identified for the extracted HULIS, with the volume fraction remaining (VFR) higher than 55 % for all the regenerated HULIS particles at the temperature of 280 °C. A kinetic mass transfer model was applied to the thermodenuder (TD) data to interpret the observed evaporation pattern of HULIS, and to derive the mass fractions of semi-volatile (SVOC), low-volatility (LVOC) and extremely low-volatility components (ELVOC). The results showed that LVOC and ELVOC dominated (more than 80 %) the total volume of HULIS. Atomizing processes led to a size-dependent evaporation of regenerated HULIS particles, and resulted in more ELVOC in smaller particles. In order to understand the role of interaction between inorganic salts and atmospheric organic mixtures in the volatility of an organic aerosol, the evaporation of mixed samples of ammonium sulfate (AS) and HULIS was measured. The results showed a significant but nonlinear influence of ammonium sulfate on the volatility of HULIS. The estimated fraction of ELVOC in the organic part of the largest particles (145 nm) increased from 26 %, in pure HULIS samples, to 93 % in 1 : 3 (mass ratio of HULIS : AS) mixed samples, to 45 % in 2 : 2 mixed samples, and to 70 % in 3 : 1 mixed samples, suggesting that the interaction with ammonium sulfate

  18. Heterogeneous freezing of ammonium sulfate and sodium chloride solutions by long chain alcohols

    NASA Astrophysics Data System (ADS)

    Cantrell, Will; Robinson, Carly


    High molecular weight organic compounds emitted during biomass burning can be transported to high altitudes where they may affect ice processes through heterogeneous nucleation. We show that freezing of solutions of ammonium sulfate and sodium chloride catalyzed by long chain alcohols is roughly consistent with the hypothesis that the water activity at the mean freezing temperature is a constant offset from the water activity at the melting point of the solution, though films of the longer chain alcohols may undergo structural changes at higher salt concentrations which cause a deviation from the constant offset. The heterogeneous nucleation rate coefficient, averaged over all solutions, alcohols, and droplet sizes is 6.0 × 104 +/- 4.0 × 104 cm-2 s-1, with no dependence on any of those parameters.

  19. The optical constants of several atmospheric aerosol species - Ammonium sulfate, aluminum oxide, and sodium chloride

    NASA Technical Reports Server (NTRS)

    Toon, O. B.; Pollack, J. B.; Khare, B. N.


    An investigation is conducted of problems which are related to a use of measured optical constants in the simulation of the optical constants of real atmospheric aerosols. The techniques of measuring optical constants are discussed, taking into account transmission measurements through homogeneous and inhomogeneous materials, the immersion of a material in a liquid of a known refractive index, the consideration of the minimum deviation angle of prism measurement, the interference of multiply reflected light, reflectivity measurements, and aspects of mathematical analysis. Graphs show the real and the imaginary part of the refractive index as a function of wavelength for aluminum oxide, NaCl, and ammonium sulfate. Tables are provided for the dispersion parameters and the optical constants.

  20. Hygroscopic behavior of multicomponent organic aerosols and their internal mixtures with ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Jing, B.; Tong, S. R.; Liu, Q. F.; Li, K.; Wang, W. G.; Zhang, Y. H.; Ge, M. F.


    Water soluble organic compounds (WSOCs) are important components of organics in the atmospheric fine particulate matter. Although WSOCs play an important role in the hygroscopicity of aerosols, water uptake behavior of internally mixed WSOC aerosols remains limited characterization. Here, the hygroscopic properties of single component such as levoglucosan, oxalic acid, malonic acid, succinic acid and phthalic acid and multicomponent WSOC aerosols mainly involving oxalic acid are investigated with the hygroscopicity tandem differential mobility analyzer (HTDMA). The coexisting hygroscopic species including levoglucosan, malonic acid and phthalic acid have strong influence on the hygroscopic growth and phase behavior of oxalic acid, even suppress its crystallization completely. The interactions between oxalic acid and levoglucosan are confirmed by infrared spectra. The discrepancies between measured growth factors and predictions from Extended Aerosol Inorganics Model (E-AIM) with UNIFAC method and Zdanovskii-Stokes-Robinson (ZSR) approach increase at medium and high relative humidity (RH) assuming oxalic acid in a solid state. For the internal mixture of oxalic acid with levoglucosan or succinic acid, there is enhanced water uptake at high RH due to positive chemical interactions between solutes. Organic mixture has more complex effect on the hygroscopicity of ammonium sulfate than single species. Although hygroscopic species such as levoglucosan accounts for a small fraction in the multicomponent aerosols, they may still strongly influence the hygroscopic behavior of ammonium sulfate by changing phase state of oxalic acid which plays the role of "intermediate" species. Considering the abundance of oxalic acid in the atmospheric aerosols, its mixtures with hygroscopic species may significantly promote water uptake under high RH conditions and thus affect the cloud condensation nuclei (CCN) activity, optical properties and chemical reactivity of atmospheric particles.

  1. Hygroscopic behavior of multicomponent organic aerosols and their internal mixtures with ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Jing, Bo; Tong, Shengrui; Liu, Qifan; Li, Kun; Wang, Weigang; Zhang, Yunhong; Ge, Maofa


    Water-soluble organic compounds (WSOCs) are important components of organics in the atmospheric fine particulate matter. Although WSOCs play an important role in the hygroscopicity of aerosols, knowledge on the water uptake behavior of internally mixed WSOC aerosols remains limited. Here, the hygroscopic properties of single components such as levoglucosan, oxalic acid, malonic acid, succinic acid, phthalic acid, and multicomponent WSOC aerosols mainly involving oxalic acid are investigated with the hygroscopicity tandem differential mobility analyzer (HTDMA). The coexisting hygroscopic species including levoglucosan, malonic acid, and phthalic acid have a strong influence on the hygroscopic growth and phase behavior of oxalic acid, even suppressing its crystallization completely during the drying process. The phase behaviors of oxalic acid/levoglucosan mixed particles are confirmed by infrared spectra. The discrepancies between measured growth factors and predictions from Extended Aerosol Inorganics Model (E-AIM) with the Universal Quasi-Chemical Functional Group Activity Coefficient (UNIFAC) method and Zdanovskii-Stokes-Robinson (ZSR) approach increase at medium and high relative humidity (RH) assuming oxalic acid in a crystalline solid state. For the internal mixture of oxalic acid with levoglucosan or succinic acid, there is enhanced water uptake at high RH compared to the model predictions based on reasonable oxalic acid phase assumption. Organic mixture has more complex effects on the hygroscopicity of ammonium sulfate than single species. Although hygroscopic species such as levoglucosan account for a small fraction in the multicomponent aerosols, they may still strongly influence the hygroscopic behavior of ammonium sulfate by changing the phase state of oxalic acid which plays the role of "intermediate" species. Considering the abundance of oxalic acid in the atmospheric aerosols, its mixtures with hygroscopic species may significantly promote water uptake

  2. MICS-Asia II: Model intercomparison and evaluation of particulate sulfate, nitrate and ammonium

    NASA Astrophysics Data System (ADS)

    Hayami, Hiroshi; Sakurai, T.; Han, Z.; Ueda, H.; Carmichael, G. R.; Streets, D.; Holloway, T.; Wang, Z.; Thongboonchoo, N.; Engardt, M.; Bennet, C.; Fung, C.; Chang, A.; Park, S. U.; Kajino, M.; Sartelet, K.; Matsuda, K.; Amann, M.

    Eight chemical transport models participate in a model intercomparison study for East Asia, MICS-Asia II. This paper analyzes calculated results for particulate matter of sulfate, nitrate and ammonium through comparisons with each other and with monthly measurements at EANET (the acid deposition monitoring network in East Asia) and daily measurements at Fukue, Japan. To the EANET measurements, model ensemble means better agree with model individual results for sulfate and total ammonium, although total nitrate is consistently and considerably underestimated. To measurements at Fukue, the models show better agreement than for the EANET measurements. This is likely because Fukue is centered in many of the model domains, whereas the EANET stations are mostly in Southeast Asia and Russia. Moreover, it would be important that Fukue is in Northeast Asia, where the emission inventory is more reliable than Southeast Asia. The model-model comparisons are made in view of the total amount in the atmosphere, vertical profile, coefficient of variation in surface concentrations, and transformation changes with distance. All the models show reasonable tendencies in vertical profiles and composition ratios. However, total amounts in the atmosphere are discrepant among the models. The consistency of the total amount in the atmosphere would influence source-receptor analysis. It seems that model results would be consistent, if the models take into account the primitive processes like emission, advection/diffusion, chemical transformation and dry/wet deposition, no matter the processes are modeled simply or comprehensively. Through the comparison study, we learned that it would be difficult to find any problems from one comparison (model-observation comparison with one data or many but at one station or in a short period). Modelers tend to examine model performances only from model-observation comparisons. However, taking budget in a certain or whole model domain would be important

  3. Hygroscopic and phase separation properties of ammonium sulfate/organics/water ternary solutions

    NASA Astrophysics Data System (ADS)

    Zawadowicz, M. A.; Proud, S. R.; Seppalainen, S. S.; Cziczo, D. J.


    Atmospheric aerosol particles are often partially or completely composed of inorganic salts, such as ammonium sulfate and sodium chloride, and therefore exhibit hygroscopic properties. Many inorganic salts have well-defined deliquescence and efflorescence points at which they take up and lose water, respectively. Field measurements have shown that atmospheric aerosols are not typically pure inorganic salt, instead, they often also contain organic species. There is ample evidence from laboratory studies that suggests that mixed particles exist in a phase-separated state, with an aqueous inorganic core and organic shell. Although phase separation has not been measured in situ, there is no reason it would not also take place in the atmosphere. Here, we investigate the deliquescence and efflorescence points, phase separation and ability to exchange gas-phase components of mixed organic and inorganic aerosol using a flow tube coupled with FTIR (Fourier transform infrared) spectroscopy. Ammonium sulfate aerosol mixed with organic polyols with different O : C ratios, including 1,4-butanediol, glycerol, 1,2,6-hexanetriol, 1,2-hexanediol, and 1,5-pentanediol have been investigated. Those constituents correspond to materials found in the atmosphere in great abundance and, therefore, particles prepared in this study should mimic atmospheric mixed-phase aerosol particles. Some results of this study tend to be in agreement with previous microscopy experiments, but others, such as phase separation properties of 1,2,6-hexanetriol, do not agree with previous work. Because the particles studied in this experiment are of a smaller size than those used in microscopy studies, the discrepancies found could be a size-related effect.

  4. Hygroscopic and phase separation properties of ammonium sulfate/organic/water ternary solutions

    NASA Astrophysics Data System (ADS)

    Zawadowicz, M. A.; Proud, S. R.; Seppalainen, S. S.; Cziczo, D. J.


    Atmospheric aerosol particles are often partially or completely composed of inorganic salts, such as ammonium sulfate and sodium chloride, and therefore exhibit hygroscopic properties. Many inorganic salts have well-defined deliquescence and efflorescence points at which they take up and lose water, respectively. Deliquescence and efflorescence of simple inorganic salt particles have been investigated by a variety of methods, such as IR spectroscopy, tandem mobility analysis and electrodynamic balance. Field measurements have shown that atmospheric aerosols are not typically pure inorganic salt, instead they often also contain organic species. There is ample evidence from laboratory studies that suggests that mixed particles exist in a phase-separated state, with an aqueous inorganic core and organic shell. Although phase separation has not been measured in situ, there is no reason it would not also take place in the atmosphere. Many recent studies have focused on microscopy techniques that require deposition of the aerosol on a glass slide, possibly changing its surface properties. Here, we investigate the deliquescence and efflorescence points, phase separation and ability to exchange gas-phase components of mixed organic and inorganic aerosol using a flow tube coupled with FTIR spectroscopy. Ammonium sulfate aerosol mixed with organic polyols with different O : C ratios, including 1,4-butanediol, glycerol, 1,2,6-hexanetriol, 1,2-hexanediol, and 1,5-pentanediol have been investigated. Those constituents correspond to materials found in the atmosphere in great abundance, and therefore, particles prepared in this study should mimic atmospheric mixed phase aerosol particles. The results of this study tend to be in agreement with previous microscopy experiments, with several key differences, which possibly reveal a size-dependent effect on phase separation in organic/inorganic aerosol particles.

  5. Growth and fruit production of highbush blueberry fertilized with ammonium sulfate and urea applied by fertigation or as granular fertilizer

    USDA-ARS?s Scientific Manuscript database

    The application of granular sources of nitrogen (N) fertilizers, including ammonium sulfate and urea, were compared to fertigation with liquid forms of the fertilizers in northern highbush blueberry during the first 5 years of fruit production. The granular fertilizers were banded on each side of t...

  6. Tree-ring chemistry response in black cherry to ammonium sulfate fertilization at two West Virginia sites


    David R. DeWalle; Jeffrey S. Tepp; Callie J. Pickens; Pamela J. Edwards; William E. Sharpe


    The chemical element content of black cherry (Prunus serotina Ehrh.) tree rings showed significant changes related to annual ammonium sulfate treatments on one watershed (Fernow WS-3) which exhibited a significant increase in streamflow N export due to treatment. However, tree-ring, soil and streamflow chemistry did not respond to the same treatment...

  7. ANAMMOX-like performances for nitrogen removal from ammonium-sulfate-rich wastewater in an anaerobic sequencing batch reactor.


    Prachakittikul, Pensiri; Wantawin, Chalermraj; Noophan, Pongsak Lek; Boonapatcharoen, Nimaradee


    Ammonium removal by the ANaerobic AMonium OXidation (ANAMMOX) process was observed through the Sulfate-Reducing Ammonium Oxidation (SRAO) process. The same concentration of ammonium (100 mg N L(-1)) was applied to two anaerobic sequencing batch reactors (AnSBRs) that were inoculated with the same activated sludge from the Vermicelli wastewater treatment process, while nitrite was fed in ANAMMOX and sulfate in SRAO reactors. In SRAO-AnSBR, in substrates that were fed with a ratio of NH4(+)/SO4(2-) at 1:0.4 ± 0.03, a hydraulic retention time (HRT) of 48 h and without sludge draining, the Ammonium Removal Rate (ARR) was 0.02 ± 0.01 kg N m(-3).d(-1). Adding specific ANAMMOX substrates to SRAO-AnSBR sludge in batch tests results in specific ammonium and nitrite removal rates of 0.198 and 0.139 g N g(-1) VSS.d, respectively, indicating that the ANAMMOX activity contributes to the removal of ammonium in the SRAO process using the nitrite that is produced from SRAO. Nevertheless, the inability of ANAMMOX to utilize sulfate to oxidize ammonium was also investigated in batch tests by augmenting enriched ANAMMOX culture in SRAO-AnSBR sludge and without nitrite supply. The time course of sulfate in a 24-hour cycle of SRAO-AnSBR showed an increase in sulfate after 6 h. For enriched SRAO culture, the uptake molar ratio of NH4(+)/SO4(2-) at 8 hours in a batch test was 1:0.82 lower than the value of 1:0.20 ± 0.09 as obtained in an SRAO-AnSBR effluent, while the stoichiometric ratio of 1:0.5 that includes the ANAMMOX reaction was in this range. After a longer operation of more than 2 years without sludge draining, the accumulation of sulfate and the reduction of ammonium removal were observed, probably due to the gradual increase in the sulfur denitrification rate and the competitive use of nitrite with ANAMMOX. The 16S rRNA gene PCR-DGGE (polymerase chain reaction-denaturing gradient gel electrophoresis) and PCR cloning analyses resulted in the detection of the ANAMMOX

  8. Phase transitions and phase miscibility of mixed particles of ammonium sulfate, toluene-derived secondary organic material, and water.


    Smith, Mackenzie L; You, Yuan; Kuwata, Mikinori; Bertram, Allan K; Martin, Scot T


    The phase states of atmospheric particles influence their roles in physicochemical processes related to air quality and climate. The phases of particles containing secondary organic materials (SOMs) are still uncertain, especially for SOMs produced from aromatic precursor gases. In this work, efflorescence and deliquescence phase transitions, as well as phase separation, in particles composed of toluene-derived SOM, ammonium sulfate, and water were studied by hygroscopic tandem differential mobility analysis (HTDMA) and optical microscopy. The SOM was produced in the Harvard Environmental Chamber by photo-oxidation of toluene at chamber relative humidities of <5 and 40%. The efflorescence and deliquescence relative humidities (ERH and DRH, respectively, studied by HTDMA) of ammonium sulfate decreased as the SOM organic fraction ε in the particle increased, dropping from DRH = 80% and ERH = 31% for ε = 0.0 to DRH = 58% and ERH = 0% for ε = 0.8. For ε < 0.2, the DRH and ERH to first approximation did not change with the organic volume fraction. This observation is consistent with independent behaviors for ε < 0.2 of water-infused toluene-derived SOM and aqueous ammonium sulfate, suggesting phase immiscibility between the two. Optical microscopy of particles prepared for ε = 0.12 confirmed phase separation for RH < 85%. For ε from 0.2 to 0.8, the DRH and ERH values steadily decreased, as studied by HTDMA. This result is consistent with one-phase mixing of ammonium sulfate, SOM, and water. Optical microscopy for particles of ε = 0.8 confirmed this result. Within error, increased exposure times of the aerosol in the HTDMA from 0.5 to 30 s affected neither the ERH(ε) nor DRH(ε) curves, implying an absence of kinetic effects on the observations over the studied time scales. For ε > 0.5, the DRH values of ammonium sulfate in mixtures with SOM produced at <5% RH were offset by -3 to -5% RH compared to the results for SOM produced at 40% RH, suggesting differences

  9. Growth, structural, and spectral characterizations of potassium and ammonium zinc sulfate hydrate single crystals

    NASA Astrophysics Data System (ADS)

    Abu El-Fadl, A.; Nashaat, A. M.


    Single crystals of potassium zinc sulfate hydrate and ammonium zinc sulfate hydrate are grown from solution by slow evaporation technique. The crystals were characterized by different instrumental techniques. Powder X-ray diffraction analysis was carried out to detect the crystal structure and proved that the grown crystals are of the desired chemical and structural properties. The calculated lattice constants are in good agreement with the reported data. Thermal analysis was carried out using DTA and TGA to characterize the thermal stability of the grown crystals. The modes of vibration of different functional groups were assigned and reported by the Fourier transform infrared spectral analysis of the grown crystals. The optical properties are measured in the photon energy range of 190-800 nm and the as-grown single crystals show direct-allowed interband transitions, and the corresponding values of direct optical energy gaps are calculated. The refractive index, the real and imaginary parts of the dielectric permittivity, and the extinction coefficient were also calculated as a function of photon energy, and the results were discussed. The dispersion of the refractive index has been analyzed, and the optical parameters have been estimated.

  10. Atmospheric corrosion of zinc in the presence of ammonium sulfate particles

    SciTech Connect

    Lobnig, R.E.; Siconolfi, D.J.; Psota-Kelty, L.; Frankenthal, R.P.; Sinclair, J.D.; Grundmeier, G.; Stratmann, M.


    The atmospheric corrosion of zinc in the presence of (NH{sub 4}){sub 2}SO{sub 4} particles has been investigated at 300 and 373 K in air-water vapor mixtures. The development of corrosion products was followed by several in situ techniques, including Fourier transform infrared-spectroscopy, X-ray diffraction, pH measurements, and scanning Kelvin probe measurements. Unlike earlier work on copper and aluminum, zinc reacts with the particles below the critical relative humidity (CRH) of (NH{sub 4}){sub 2}SO{sub 4}. At 300 K reaction was observed at 65% relative humidity (RH), but not at 60% /RH. This is attributed to the presence of basic zinc carbonate on the surface, which absorbs sufficient water at this low RH to make electrochemical reactions possible. At and above the CRH of (NH{sub 4}){sub 2}SO{sub 4}, zinc reacts with (NH{sub 4}){sub 2}SO{sub 4} forming mixed ammonium zinc sulfate and later on basic zinc sulfate, and at 373 K additionally zincite (ZnO). Above the CRH of (NH{sub 4}){sub 2}SO{sub 4}, the corrosion potential decreases directly after formation of droplets surrounding the particles and zinc becomes active. Corrosion mechanisms are proposed to explain the observations.

  11. The influence of impurities on crystallization kinetics a case study on ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Rauls, M.; Bartosch, K.; Kind, M.; Kuch, St.; Lacmann, R.; Mersmann, A.


    The influence of impurities on the crystallization kinetics of ammonium sulfate was investigated. MSMPR experiments were conducted with the impurities aluminum sulfate and the azo dyes amaranth and fuchsine. Nucleation and growth rates as well as mean crystal sizes were related to the supersaturation σ and-the width of the metastable zone. It was found that all impurity levels in the system reduce kinetic coefficients for crystal growth and suppress nucleation by adsorption on the crystal surfaces. An increase of supersaturation and metastable zone width compensates for this reduction at low impurity concentrations and allows the growth of larger crystals compared to the pure system. At high impurity concentrations and increasing surface coverage of the crystals, supersaturation rises faster than metastable zone width, causing an increase in nucleation rates and a higher fines content in the product compared to the pure system. A similar interdependence between impurity concentration, crystal size and supersaturation was found for other systems not reported here. The observations made can be explained in terms of adsorption equilibria of the impurities on the crystals. This seemingly general relationship allows the adjustment of crystal sizes in crystallization processes by control of impurity concentrations. A second paper will discuss the changes in crystal morphology in greater depth (Kuch et al., 2000).

  12. Assessment of the first indirect radiative effect of ammonium-sulfate-nitrate aerosols in East Asia

    NASA Astrophysics Data System (ADS)

    Han, Xiao; Zhang, Meigen; Skorokhod, Andrei


    A physically based cloud nucleation parameterization was introduced into an optical properties/radiative transfer module incorporated with the off-line air quality modeling system Regional Atmospheric Modeling System (RAMS)-Models-3 Community Multi Scale Air Quality (CMAQ) to investigate the distribution features of the first indirect radiative effects of sulfate, nitrate, and ammonium-sulfate-nitrate (ASN) over East Asia for the years of 2005, 2010, and 2013. The relationship between aerosol particles and cloud droplet number concentration could be properly described by this parameterization because the simulated cloud fraction and cloud liquid water path were generally reliable compared with Moderate Resolution Imaging Spectroradiometer (MODIS) retrieved data. Simulation results showed that the strong effect of indirect forcing was mainly concentrated in Southeast China, the East China Sea, the Yellow Sea, and the Sea of Japan. The highest indirect radiative forcing of ASN reached -3.47 W m-2 over Southeast China and was obviously larger than the global mean of the indirect forcing of all anthropogenic aerosols. In addition, sulfate provided about half of the contribution to the ASN indirect forcing effect. However, the effect caused by nitrate was weak because the mass burden of nitrate was very low during summer, whereas the cloud fraction was the highest. The analysis indicated that even though the interannual variation of indirect forcing magnitude generally followed the trend of aerosol mass burden from 2005 to 2013, the cloud fraction was an important factor that determined the distribution pattern of indirect forcing. The heaviest aerosol loading in North China did not cause a strong radiative effect because of the low cloud fraction over this region.

  13. Modeling the spectral optical properties of ammonium sulfate and biomass burning aerosols

    SciTech Connect

    Grant, K.E.; Chuang, C.C.; Grossman, A.S.; Penner, J.E.


    The importance of including the global and regional radiative effects of aerosols in climate models has increasingly been realized. Accurate modeling of solar radiative forcing due to aerosols from anthropogenic sulfate and biomass burning emissions requires adequate spectral resolution and treatment of spatial and temporal variability. The variation of aerosol spectral optical properties with local relative humidity and dry aerosol composition must be considered. Because the cost of directly including Mie calculations within a climate model is prohibitive, parameterizations from offline calculations must be used. Starting from a log-normal size distribution of dry ammonium sulfate, we developed optical properties for tropospheric sulfate aerosol at 15 relative humidities up to 99 percent. The resulting aerosol size distributions were then used to calculate bulk optical properties at wavelengths between 0.175 {micro}m and 4 {micro}m. Finally, functional fits of optical properties were made for each of 12 wavelength bands as a function of relative humidity. Significant variations in optical properties occurred across the total solar spectrum. Relative increases in specific extinction and asymmetry factor with increasing relative humidity became larger at longer wavelengths. Significant variation in single-scattering albedo was found only in the longest near-IR band. This is also the band with the lowest albedo. A similar treatment was done for aerosols from biomass burning. In this case, size distributions were taken as having two carbonaceous size modes and a larger dust mode. The two carbonaceous modes were considered to be humidity dependent. Equilibrium size distributions and compositions were calculated for 15 relative humidities and five black carbon fractions. Mie calculations and Chandrasekhar averages of optical properties were done for each of the resulting 75 cases. Finally, fits were made for each of 12 spectral bands as functions of relative humidity

  14. Direct comparison of the hygroscopic properties of ammonium sulfate and sodium chloride aerosol at relative humidities approaching saturation.


    Walker, Jim S; Wills, Jon B; Reid, Jonathan P; Wang, Liangyu; Topping, David O; Butler, Jason R; Zhang, Yun-Hong


    Holographic optical tweezers are used to make comparative measurements of the hygroscopic properties of single component aqueous aerosol containing sodium chloride and ammonium sulfate over a range of relative humidity from 84% to 96%. The change in RH over the course of the experiment is monitored precisely using a sodium chloride probe droplet with accuracy better than ±0.09%. The measurements are used to assess the accuracy of thermodynamic treatments of the relationship between water activity and solute mass fraction with particular attention focused on the dilute solute limit approaching saturation vapor pressure. The consistency of the frequently used Clegg-Brimblecombe-Wexler (CBW) treatment for predicting the hygroscopic properties of sodium chloride and ammonium sulfate aerosol is confirmed. Measurements of the equilibrium size of ammonium sulfate aerosol are found to agree with predictions to within an uncertainty of ±0.2%. Given the accuracy of treating equilibrium composition, the inconsistencies highlighted in recent calibration measurements of critical supersaturations of sodium chloride and ammonium sulfate aerosol cannot be attributed to uncertainties associated with the thermodynamic predictions and must have an alternative origin. It is concluded that the CBW treatment can allow the critical supersaturation to be estimated for sodium chloride and ammonium sulfate aerosol with an accuracy of better than ±0.002% in RH. This corresponds to an uncertainty of ≤1% in the critical supersaturation for typical supersaturations of 0.2% and above. This supports the view that these systems can be used to accurately calibrate instruments that measure cloud condensation nuclei concentrations at selected supersaturations. These measurements represent the first study in which the equilibrium properties of two particles of chemically distinct composition have been compared simultaneously and directly alongside each other in the same environment.

  15. Effects of ammonium sulfate aerosols on vegetation—II. Mode of entry and responses of vegetation

    NASA Astrophysics Data System (ADS)

    Gmur, Nicholas F.; Evans, Lance S.; Cunningham, Elizabeth A.

    These experiments were designed to provide information on the rates of aerosol deposition, mode of entry, and effects of deposition of submicrometer ammonium sulfate aerosols on foliage of Phaseolus vulgaris L. A deposition velocity of 3.2 × 10 3cms-1 was constant during 3-week exposures of plants to aerosol concentrations of 26mg m -3 (i.e. about two orders of magnitude above ambient episode concentrations). Mean deposition rate on foliage was 4.1 × 10 -11 μg cm -2s -1. Visible injury symptoms included leaf chlorosis, necrosis and loss of turgor. Chlorosis was most frequent near leaf margins causing epinasty and near major veins. Internal injury occurred initially in spongy mesophyll cells. Eventually abaxial epidermal and palisade parenchyma cells were injured. These results suggest that submicrometer aerosols enter abaxial stomata and affect more internal cells before affecting leaf surface cells. Exposure to aerosols decreased both abaxial and adaxial leaf resistances markedly. Although visible injury to foliage occurred, no changes in dry mass of roots and shoots or leaf area occurred. These results suggest that for the plant developmental stage studied, while leaf resistances decreased and cellular injury occurred in foliage, these factors were not significantly related to plant growth and development.

  16. Revealing Brown Carbon Chromophores Produced in Reactions of Methylglyoxal with Ammonium Sulfate

    SciTech Connect

    Lin, Peng; Laskin, Julia; Nizkorodov, Sergey A.; Laskin, Alexander


    Atmospheric brown carbon (BrC) is an important contributor to light absorption and climate forcing by aerosols. Reactions between small water-soluble carbonyls and ammonia or amines have been identified as one of the potential pathways of BrC formation. However, detailed chemical characterization of BrC chromophores has been challenging and their formation mechanisms are still poorly understood. Understanding BrC formation is impeded by the lack of suitable methods which can unravel the variability and complexity of BrC mixtures. This study applies high performance liquid chromatography (HPLC) coupled to photodiode array (PDA) detector and high resolution mass spectrometry (HRMS) to investigate optical properties and chemical composition of individual BrC components produced through reactions of methylglyoxal (MG) and ammonium sulfate (AS), both of which are abundant in the atmospheric environment. A direct relationship between optical properties and chemical composition of 30 major BrC chromophores was established. Nearly all of these chromophores are nitrogen-containing compounds that account for >70% of the overall light absorption by the MG+AS system in the 300-500 nm range. These results suggest that reduced-nitrogen organic compounds formed in reactions between atmospheric carbonyls and ammonia/amines are important BrC chromophores. It is also demonstrated that improved separation of BrC chromophores by HPLC will significantly advance understanding of BrC chemistry.

  17. Induced binding of proteins by ammonium sulfate in affinity and ion-exchange column chromatography.


    Arakawa, Tsutomu; Tsumoto, Kouhei; Ejima, Daisuke; Kita, Yoshiko; Yonezawa, Yasushi; Tokunaga, Masao


    In general, proteins bind to affinity or ion-exchange columns at low salt concentrations, and the bound proteins are eluted by raising the salt concentration, changing the solvent pH, or adding competing ligands. Blue-Sepharose is often used to remove bovine serum albumin (BSA) from samples, but when we applied BSA to Blue-Sepharose in 20 mM phosphate, pH 7.0, 50%-60% of the protein flowed through the column; however, complete binding of BSA was achieved by the addition of 2 M ammonium sulfate (AS) to the column equilibration buffer and the sample. The bound protein was eluted by decreasing the AS concentration or by adding 1 M NaCl or arginine. AS at high concentrations resulted in binding of BSA even to an ion-exchange column, Q-Sepharose, at pH 7.0. Thus, although moderate salt concentrations elute proteins from Blue-Sepharose or ion-exchange columns, proteins can be bound to these columns under extreme salting-out conditions. Similar enhanced binding of proteins by AS was observed with an ATP-affinity column.

  18. Joint enhancement of lead accumulation in Brassica plants by EDTA and ammonium sulfate in sand culture.


    Xiong, Zhi-ting; Lu, Ping


    When EDTA was added alone in the Pb-contaminated sand, the plant biomass and the total Pb amount in Plant decreased in both species, Brassica pekinensis and B. juncea var. multiceps, though the shoot Pb amount increased. In contrast, when (NH4)2SO4 was added alone in the Pb-contaminated sand, little effect was observed on the shoot Pb amount, though the root Pb amount was significantly increased in B. juncea var. multiceps. When amending EDTA and (NH4)2SO4 in combination, however, the shoot Pb amount in both species substantially increased, being, on an average, 2 times and 9 times higher than that in EDTA alone or (NH4)2SO4 alone amended treatment, respectively. The two amendments showed antagonism for plant growth, but synergism for Pb bioaccumulation. B. pekinensis showed its highest level of shoot and total Pb amount in the treatment amended with EDTA and (NH4)2SO4 only a half as much as in the other treatments. It is inferred that the mechanisms responsible for the joint-enhanced Pb accumulation might be concerned with the acidification of the growth medium, cation exchange reaction and relieving EDTA induced toxicity as results by amending ammonium sulfate.

  19. Sulfur dioxide and ammonium sulfate effects on pulmonary function and bronchial reactivity in human subjects.


    Kulle, T J; Sauder, L R; Shanty, F; Kerr, H D; Farrell, B P; Miller, W R; Milman, J H


    The effect of exposures to 1 ppm sulfur dioxide (SO2) and 500 micrograms/m3 respirable ammonium sulfate [(NH4)2SO4] was studied in 20 nonsmoking subjects to determine if a response can be measured at these atmospheric levels and if the response is additive or synergistic. Four-hour separate and combined exposures were employed. Each subject acted as his or her own control and performed two light-to-moderate exercise stints (612 kg-m/min) for 15 minutes on each day's confinement in the environmental chamber. Pulmonary function tests (body plethysmography and spirometry) and bronchial reactivity to methacholine were performed to assess the response of these exposures. No significant changes in pulmonary function or bronchial reactivity were observed in the individual exposures [(NH4)2SO4 or SO2], the combined exposure [(NH4)2SO4 and SO2], or 24 hours post-exposure. This study design and the observed results did not demonstrate any readily apparent risk to healthy subjects with these exposures. Since no significant changes were measured, it was not possible to conclude if these two pollutants in combination produce an additive or synergistic response.

  20. Comparison between therapeutic antitoxin F(ab)2 fractionated with ammonium sulfate and caprylic acid.


    Redwan, El-Rashdy M


    To date, animal derived therapeutic antibodies represent the best and only choice source of antitoxins, especially in developing countries. Furthermore, this industry needs to develop a production protocol to achieve safer products. Recently, several laboratories changed their production protocol from ammonium sulfate (AS) protocol to caprylic acid (CA) fractionation. Our results showed that using the CA protocol leads to improvement in the product quality, as assessed by the albumin and protein content decrease (from 4.75 to 3.54 g/dL and 0.64 to 0.18 g/dL, respectively), which yielded a purer antitoxin product. The F(ab)2 protein aggregate formation and turbidity have been significantly reduced, 4.60 versus 2.55 and 0.046 versus 0.021 (p < 0.01), respectively. However, the anti-complementary activity was also reduced, from 42 to 33. The total IgG content was higher in CA fractionated products than AS materials. The endotoxin content was worrisome in some F(ab)2 products.

  1. Simple and efficient liposomal encapsulation of topotecan by ammonium sulfate gradient: stability, pharmacokinetic and therapeutic evaluation.


    Liu, Jun-Jen; Hong, Ruey-Long; Cheng, Wen-Fang; Hong, Keelung; Chang, Fu-Hsiung; Tseng, Yun-Long


    Topotecan (TPT), a topoisomerase I inhibitor, is presently undergoing clinical evaluation worldwide. Previous studies have shown that entrapping TPT within multi-lamellar vesicle liposome can stabilize the lactone moiety, which is structurally important for biological activity. However, low drug:lipid ratios due to the amphipathic character and small entrapment volume in the unilamellar vesicle limits the development of pharmaceutically acceptable liposomal formulation. With an aim to improve on this drawback, we herein describe a method that utilizes the ammonium sulfate gradient to entrap TPT into liposomes. By this method, the encapsulation efficiency was over 90% and a drug:lipid molar ratio as high as 1:5.4 was reached. In comparison with free drug, liposome-encapsulated TPT is more stable in physiological conditions and shows higher in vitro cytotoxicity. Because of increased blood circulation time, the initial plasma concentration and area under the plasma concentration of liposomal drugs were 14 and 40 times, respectively, of those of free drug. Furthermore, liposome encapsulation enhanced the antitumor activity of TPT in syngeneic murine C-26 and human HTB-9 xenograft models in vivo. At a dose of 5 mg/kg, the tumor growth delay of liposomal formulation was significantly than that of free TPT. Based on these results, we believe that this liposomal TPT formulation is worthy of further clinical study.

  2. Brown carbon formation by aqueous-phase carbonyl compound reactions with amines and ammonium sulfate.


    Powelson, Michelle H; Espelien, Brenna M; Hawkins, Lelia N; Galloway, Melissa M; De Haan, David O


    Reactions between small water-soluble carbonyl compounds, ammonium sulfate (AS), and/or amines were evaluated for their ability to form light-absorbing species in aqueous aerosol. Aerosol chemistry was simulated with bulk phase reactions at pH 4, 275 K, initial concentrations of 0.05 to 0.25 M, and UV-vis and fluorescence spectroscopy monitoring. Glycolaldehyde-glycine mixtures produced the most intense absorbance. In carbonyl compound reactions with AS, methylamine, or AS/glycine mixtures, product absorbance followed the order methylglyoxal > glyoxal > glycolaldehyde > hydroxyacetone. Absorbance extended into the visible, with a wavelength dependence fit by absorption Ångstrom coefficients (Å(abs)) of 2 to 11, overlapping the Å(abs) range of atmospheric, water-soluble brown carbon. Many reaction products absorbing between 300 and 400 nm were strongly fluorescent. On a per mole basis, amines are much more effective than AS at producing brown carbon. In addition, methylglyoxal and glyoxal produced more light-absorbing products in reactions with a 5:1 AS-glycine mixture than with AS or glycine alone, illustrating the importance of both organic and inorganic nitrogen in brown carbon formation. Through comparison to biomass burning aerosol, we place an upper limit on the contribution of these aqueous carbonyl-AS-amine reactions of ≤ 10% of global light absorption by brown carbon.

  3. Modified ferrous ammonium sulfate benzoic acid xyelenol orange (MFBX) and thermoluminescent dosimeters--a comparative study.


    Brindha, S; Rose, J V R; Sathyan, S; Singh I, Rabi Raja; Ravindran, B Paul


    Radiation dosimetry deals with the determination of absorbed dose to the medium exposed to ionizing radiation. Chemical dosimetry depends on oxidation or reduction of chemicals by ionizing radiation. A ferrous ammonium sulfate benzoic acid xyelenol orange (FBX) dosimeter based on this principle is being used as a clinical dosimeter at present. Certain modifications were carried out in the preparation and storage of the FBX dosimeter to increase its shelf life. The resulting dosimeter was called a modified FBX (MFBX) dosimeter and has been used in our department for the past few years. An extensive study of the dose, dose rate and energy response of the dosimeter was carried out and compared with a thermoluminescent (LiF7) dosimeter. The results obtained were found to be comparable to the thermoluminescent (LiF7) dosimeter. Hence it was concluded that the MFBX dosimeter could be used for phantom dosimetry, data collection and in vivo measurements. Easier preparation and availability of the reagents are added advantages of using MFBX as a clinical dosimeter in small radiotherapy departments.

  4. Nitrous Oxide and Methane Fluxes Following Ammonium Sulfate and Vinasse Application on Sugar Cane Soil.


    Paredes, Debora da S; Alves, Bruno J R; dos Santos, Marco A; Bolonhezi, Denizart; Sant'Anna, Selenobaldo A C; Urquiaga, Segundo; Lima, Magda A; Boddey, Robert M


    This study aimed to quantify nitrous oxide (N2O) and methane (CH4) emission/sink response from sugar cane soil treated with fertilizer nitrogen (N) and vinasse applied separately or in sequence, the latter being investigated with regard to the time interval between applications for a possible effect on emissions. The study was carried out in a traditional area of unburned sugar cane in São Paulo state, Brazil. Two levels of N fertilization (0 and 100 kg N ha(-1)) with no added vinasse and combined with vinasse additions at different times (100 m(-3) ha(-1) at 3 and 15 days after N fertilization) were evaluated. Methane and N2O fluxes were monitored for 211 days. On average, the soil was a sink for CH4, which was not affected by the treatments. Emissions of N2O were induced by N fertilizer and vinasse applications. For ammonium sulfate, 0.6% of the added N was emitted as N2O, while for vinasse, this ranged from 1.0 to 2.2%. Changes in N2O fluxes were detected the day after application of vinasse on the N fertilized areas, but although the emission factor (EF) was 34% greater, the EF was not significantly different from fertilizer N alone. Nevertheless, we recommend to not apply vinasse after N fertilization to avoid boosting N2O emissions.

  5. Indirect determination of thiocyanate with ammonium sulfate and ethanol by extraction-flotation of copper.


    Li, Q; Wei, W; Liu, Q


    A new method for the indirect determination of thiocyanate with ammonium sulfate and ethanol by extraction-flotation of copper in the presence of ascorbic acid is described. A small amount of Cu(II) is reduced to Cu(I) by ascorbic acid, then Cu(I) is precipitated with SCN-. In the course of phase separation of ethanol from water, the precipitated CuSCN stays in the interface of ethanol and water. A good linear relationship is observed between the flotation yield of Cu(II) and the amount of SCN-. Using 1.0 ml of 1 x 10(-3) M ascorbic acid solution, 50 micrograms of Cu(II), 3.5 g of (NH4)2SO4 and 3.0 ml of ethanol with a total volume of 10 ml, the concentration of thiocyanate could then be determined by determining the flotation yield of Cu(II). The detection limit for thiocyanate is 5 x 10(-5) M. Every parameter was optimized and the reaction mechanism was studied. The method is simple and rapid and it was successfully applied to the determination of thiocyanate in urine and saliva of smokers and non-smokers and in venous blood of patients infused with sodium nitroprusside.

  6. Solid/liquid phase diagram of the ammonium sulfate/glutaric acid/water system.


    Beyer, Keith D; Pearson, Christian S; Henningfield, Drew S


    We have studied the low temperature phase diagram and water activities of the ammonium sulfate/glutaric acid/water system using differential scanning calorimetry, infrared spectroscopy of thin films, and a new technique: differential scanning calorimetry-video microscopy. Using these techniques, we have determined that there is a temperature-dependent kinetic effect to the dissolution of glutaric acid in aqueous solution. We have mapped the solid/liquid ternary phase diagram, determined the water activities based on the freezing point depression, and determined the ice/glutaric acid phase boundary as well as the ternary eutectic composition and temperature. We have also modified our glutaric acid/water binary phase diagram previously published based on these new results. We compare our results for the ternary system to the predictions of the Extended AIM Aerosol Thermodynamics Model (E-AIM), and find good agreement for the ice melting points in the ice primary phase field of this system; however, significant differences were found with respect to phase boundaries, concentration and temperature of the ternary eutectic, and glutaric acid dissolution.

  7. Manufacture of ammonium sulfate fertilizer from FGD-gypsum. Quarterly report, 1 December 1994--28 February 1995

    SciTech Connect

    Chou, M.I.M.; Rostam-Abadi, M.; Lytle, J.M.; Bruinius, J.A.; Hoeft, R.; Dewey, S.; Achorn, F.


    The overall goal of this project is to assess the technical and economic feasibility for producing feasibility-grade ammonium sulfate from gypsum produced as part of limestone flue gas desulfurization (FGD) processes. This is a cooperative effort among the ISGS, the UIUC, AlliedSignal, SE-ME, Henry Fertilizer, Illinois Power Co. (IP), and Central Illinois Public Services (CIPS). Bench-scale experiments will be conducted to obtain process engineering data for the manufacture of ammonium sulfate from FGD-gypsum and to help evaluate technical and economic feasibility of the process. Controlled greenhouse experiments will be conducted at UIUC to evaluate the chemical impact of coal-derived impurities in ammonium sulfate produced from FGD-gypsum on soil properties. A process flow sheet will be proposed and market demand for the products will be established. An engineering team at IP will provide an independent review of the economics of the process. AlliedSignal will be involved in testing and quality evaluation of ammonium sulfate samples and is interested in an agreement to market the finished product. CIPS will provide technical assistance and samples of FGD -gypsum for the project. In this quarter, with an exception of the neutron activation analysis, analyses of FGD-gypsum samples that were generated by two power stations were completed. The high quality FGD-gypsum sample produced from the Abbott power plant in Champaign, IL was 98.36% gypsum, CaSO{sub 4}{center_dot}2H{sub 2}O, and less than 0.01% calcium`` sulfite, CaSO{sub 3}. The low quality sample from CIPS`s Newton Power Plant at Jasper, Illinois, was only 7.36% of gypsum. It was 87.54% calcium sulfite. A literature search provided the information to set up a batch, bench-scale reactor system. Reactions were conducted at 70{degrees}C for a range of times which resulted in 82% conversion of calcium sulfate to ammonium sulfate.

  8. Distribution coefficients of purine alkaloids in water-ammonium sulfate-alkyl acetate-dialkyl phthalate systems

    NASA Astrophysics Data System (ADS)

    Korenman, Ya. I.; Krivosheeva, O. A.; Mokshina, N. Ya.


    The distribution of purine alkaloids (caffeine, theobromine, theophylline) was studied in the systems: alkyl acetates-dialkyl phtalate-salting-out agent (ammonium sulfate). The quantitative characteristics of the extraction-distribution coefficients ( D) and the degree of extraction ( R, %) are calculated. The relationships between the distribution coefficients of alkaloids and the length of the hydrocarbon radical in the molecule of alkyl acetate (dialkyl phtalate) are determined. The possibility of predicting the distribution coefficients is demonstrated.

  9. Effect of particle size and ammonium sulfate concentration on rice bran fermentation with the fungus Rhizopus oryzae.


    Schmidt, Cristiano Gautério; Furlong, Eliana Badiale


    The effects of rice bran particle size (0.18-0.39mm) and ammonium sulfate concentration in the nutrient solution (2-8g/L) on biomass production, protein and phenolic content generated by solid state fermentation with the fungus Rhizopus oryzae (CCT 1217) were studied. Particle size had a positive effect on biomass production and a negative effect (p⩽0.05) on protein and phenolic contents. Ammonium sulfate concentration had a positive effect (p⩽0.05) on biomass and phenolic content gain. Cultivation of fungus in rice bran with particle size of 0.18mm and in the presence of 8g/L ammonium sulfate, resulted in protein levels of 20g/100g dry wt and phenolics content of 4mg/g dry wt. These values were 53 and 65% higher than those achieved with unfermented rice bran. The results demonstrate that the fermentation process increased the value of compounds recovered for potential use in food formulations. Copyright © 2012 Elsevier Ltd. All rights reserved.

  10. Separation of polysaccharides from Spirulina platensis by HSCCC with ethanol-ammonium sulfate ATPS and their antioxidant activities.


    Wu, Xueyan; Li, Ruichang; Zhao, Yongjie; Liu, Yang


    Three separation methods for water-soluble polysaccharides from Spirulina platensis (PSP) were compared, including sevage deproteinization and column chromatography, ethanol-ammonium sulfate aqueous two-phase system (ATPS) and column chromatography, and one-step high speed counter-current chromatography (HSCCC) with ethanol-ammonium sulfate ATPS. ATPS was confirmed as an efficient alternative method of protein removal for PSP purification. For the HSCCC with ethanol-ammonium sulfate ATPS, the stationary retention reached to 50.8% at the optimized rotation speed and flow rate. Moreover, the yield of PSP purified by one-step HSCCC rose nearly five times to 12.45mg/g(dry algae powder), it was higher than PSP yield by two-step column chromatography separation methods. PSP purified by HSCCC has the same purity as PSP obtained by traditional methods, which was proved by a single symmetrical peak of purified PSP with molecular weight of 12.33kDa through gel chromatography. Purified PSP was an α-acidic polysaccharide, composed of major glucose, slight rhamnose and mannose, which were detected within GC and FT-IR spectra. The antioxidation activity experiment showed that HSCCC-purified PSP had strong scavenging effects on hydroxyl free radical and DPPH free radical. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Effects of Sodium Citrate on the Ammonium Sulfate Recycled Leaching of Low-Grade Zinc Oxide Ores

    NASA Astrophysics Data System (ADS)

    Yang, Kun; Li, Shi-wei; Zhang, Li-bo; Peng, Jin-hui; Ma, Ai-yuan; Wang, Bao-bao


    The effects of sodium citrate on ammonium sulfate recycled leaching of low-grade zinc oxide ores were studied. By applying various kinds of detection and analysis techniques such as chemical composition analysis, chemical phase method, scanning electron microscopy and energy dispersive spectrum (SEM/EDS), X-ray diffraction (XRD) and Fourier-transforming infrared spectrum (FT-IR), zinc raw ore, its leaching slag and the functional mechanism of sodium citrate were investigated. Based on a comprehensive analysis, it can be concluded that in contrast to hemimorphite (Zn4Si2O7(OH)2 · H2O), amorphous smithsonite (ZnCO3) and zinc silicate (Zn2SiO4) prove to be refractory phases under ammonium sulfate leaching, while sodium citrate has a better chelating action with the refractory phases, resulting in a higher zinc leaching rate. Under conditions of [NH3]/[NH3]T molar ratio being 0.5, [NH3]T being 7.5 mol/L, [Na3C6H5O7] being 0.2 mol/L, S/L ratio being 1:5, temperature being 303 K, holding time being 1 h in each of the two stages, and stirring rate being 300 rpm, the leaching rate of zinc reached 93.4%. In this article, sulfate ammonium recycled technology also reveals its unique advantage in processing low-grade zinc oxide ores accompanied by high silicon and high alkaline gangue.

  12. Aluminum ammonium sulfate dodecahydrate purified from traditional Chinese medicinal herb Korean monkshood root is a potent matrix metalloproteinase inhibitor.


    Shen, Yehua; Liu, Sen; Jin, Fenghai; Mu, Tianyang; Li, Cong; Jiang, Kun; Tian, Weihua; Yu, Dahai; Zhang, Yingqi; Fang, Xuexun


    Matrix metalloproteinases (MMPs) are zinc-dependent endopeptidases and key regulators for many physiological and pathological functions. The MMP inhibitors have been shown to modulate diseases such as cancer, inflammation, and cardiovascular diseases. In this paper we tracked the MMP inhibitory activities of the traditional Chinese medicinal herb Korean Monkshood Root. The purified active ingredient was identified by the elemental analysis, infrared spectrum (IR) and X-ray diffraction as aluminum ammonium sulfate dodecahydrate. This inorganic compound showed inhibitory activities toward a number of MMP family members. In particular, it has a strong inhibitory effect toward MMP-2 and MMP-9, with IC50 values of 0.54 and 0.50 μM, respectively. Further analysis suggested that the MMP inhibitory activity is mainly due to Al(3+). Cell viability assays using human fibrosarcoma HT1080 cells showed aluminum ammonium sulfate had minimal cyto-toxicity with a concentration up to 500 μM. However, within 50 μM, it exhibited significant inhibition of cell invasion. To our knowledge, there has been no previous report of inorganic form of the MMP inhibitor with strong inhibitory activity. Our results for the first time showed that aluminum ammonium sulfate is an inorganic form of MMP inhibitor with high potency, and can be used to interfere with MMP related cellular processes.

  13. Hygroscopicity of organic compounds from biomass burning and their influence on the water uptake of mixed organic-ammonium sulfate aerosols

    NASA Astrophysics Data System (ADS)

    Lei, T.; Zuend, A.; Wang, W. G.; Zhang, Y. H.; Ge, M. F.


    Hygroscopic behavior of organic compounds, including levoglucosan, 4-hydroxybenzoic acid and humic acid, and their effects on the hygroscopic properties of ammonium sulfate (AS) in internally mixed particles are studied by a hygroscopicity tandem differential mobility analyzer (HTDMA). The organic compounds used represent pyrolysis products of wood that are emitted from biomass burning sources. It is found that humic acid aerosol particles only slightly take up water, starting at RH above ∼70%. This is contrasted by the continuous water absorption of levoglucosan aerosol particles in the range 5-90% RH. However, no hygroscopic growth is observed for 4-hydroxybenzoic acid aerosol particles. Predicted water uptake using the ideal solution theory, the AIOMFAC model and the E-AIM (with UNIFAC) model are consistent with measured hygroscopic growth factors of levoglucosan. However, the use of these models without consideration of crystalline organic phases is not appropriate to describe the hygroscopicity of organics that do not exhibit continuous water uptake, such as 4-hydroxybenzoic acid and humic acid. Mixed aerosol particles consisting of ammonium sulfate and levoglucosan, 4-hydroxybenzoic acid, or humic acid with different organic mass fractions, take up a reduced amount of water above 80% RH (above AS deliquescence) relative to pure ammonium sulfate aerosol particles of the same mass. Hygroscopic growth of mixtures of ammonium sulfate and levoglucosan with different organic mass fractions agree well with the predictions of the thermodynamic models. Use of the Zdanovskii-Stokes-Robinson (ZSR) relation and AIOMFAC model lead to good agreement with measured growth factors of mixtures of ammonium sulfate with 4-hydrobenxybenzoic acid assuming an insoluble organic phase. Deviations of model predictions from the HTDMA measurement are mainly due to the occurrence of a microscopical solid phase restructuring at increased humidity (morphology effects), which are not

  14. Effects of chronic ammonium sulfate treatment on the forest at the Bear Brook Watershed in Maine.


    Elvir, Jose Alexander; Wiersma, G Bruce; Bethers, Suzanne; Kenlan, Peter


    At the Bear Brook Watershed in Maine (BBWM), the forest tree composition was characterized and the effects of the chronic ammonium sulfate ((NH(4))(2)SO(4)) treatment on basal area growth, foliar chemistry, and gas exchange were investigated on forest species. The BBWM is a paired watershed forest ecosystem study with one watershed, West Bear (WB), treated since 1989 with 26.6 kg N ha(-1) year(-1) and 30 kg S ha(-1) year(-1)applied bimonthly as (NH(4))(2)SO(4), while the other watershed, East Bear (EB), serves as a reference. Tree species richness, density, and mortality were found to be similar between watersheds. Basal area increment was estimated from red spruce and sugar maple, showing that, for the first 7 years of treatment, it was significantly higher for sugar maple growing in WB compared to EB, but no differences were observed for red spruce between watersheds. However, the initial higher sugar maple basal area growth in WB subsequently decreased after 8 years of treatment. Foliar chemical analysis performed in trees, saplings, and ground flora showed higher N concentrations in the treated WB compared to the reference EB. But, foliar cation concentrations, especially Ca and Mg, were significantly lower for most of the species growing in WB compared with those growing in EB. For sugar maple, foliar N was higher on WB, but there were no differences in foliar Ca and Mg concentrations between treated and reference watersheds. In addition, only sugar maple trees in the treated WB showed significantly higher photosynthetic rates compared to reference EB trees.

  15. Identification and Characterization of Visible Absorption Components in Aqueous Methylglyoxal-Ammonium Sulfate Mixtures

    NASA Astrophysics Data System (ADS)

    McGivern, W. S.; Allison, T. C.; Radney, J. G.; Zangmeister, C. D.


    The aqueous reaction of methylglyoxal (MG) with ammonium sulfate has been suggested as a source of atmospheric ``brown carbon.'' We have utilized high-performance liquid chromatography coupled to ultraviolet-visible spectroscopy and tandem mass spectrometry to study the products of this reaction at high concentrations. The overall product spectrum shows a large number of distinct components; however, the visible absorption from this mixture is derived a very small number of components. The largest contributor is an imine-substituted (C=N-H) product of aldol condensation/facile dehydration reaction between the parent MG and a hydrated product of the MG + ammonia reaction. The asymmetric nature of this compound relative to the aldol condensation of two MG results in a sufficiently large redshift of the UV absorption spectrum that absorption of visible radiation can occur in the long-wavelength tail. The simplicity of the imine products is a result of a strong bias toward ketimine products due to the extensive hydration of the aldehydic moiety in the parent in aqueous solution. In addition, a strong pH dependence of the absorption cross section was observed with significantly greater absorption under more basic conditions. We have performed time-dependent density functional theory calculations to evaluate the absorption spectra of all of the possible condensation products and their respective ions, and the results are consistent with the experimental observations. We have also observed smaller concentrations of other condensation products of the imine-substituted parent species that do not contribute significantly to the visible absorption but have not been previously discussed.

  16. Partial crystallization and deliquescence of particles containing ammonium sulfate and dicarboxylic acids

    NASA Astrophysics Data System (ADS)

    Ling, Tsz Yan; Chan, Chak K.


    The partial crystallization and deliquescence of ammonium sulfate (AS) particles internally mixed with malonic acid (MA), glutaric acid (GA), and succinic acid (SA) were studied. Hygroscopic properties, elastic light scattering, and Raman spectra were measured during water uptake and evaporation of single particles suspended in an electrodynamic balance. AS/MA particles remained partially crystallized at RHs as low as 16%, while AS/GA and AS/SA particles became completely dry at about 30-36% RH and below. Partial deliquescence was observed at intermediate RHs of <10% to 79%, 70% to 80%, and 80% to >90% for the AS/MA, AS/GA, and AS/SA particles, respectively. Solid inclusions in various amounts were in equilibrium with the aqueous solutions. The Raman spectra show solid inclusions of both AS and MA in AS/MA particles, suggesting the heterogeneous crystallization of MA on solid AS. AS was found to deliquesce first at 76% RH in the AS/GA system, followed by GA at 78% RH. In the SA/AS system, AS was observed to dissolve at 80% RH, while SA remained as solid for RH as high as 90%. Comparisons to the thermodynamic model E-AIM demonstrated the necessity to correctly predict the solid phase during partial deliquescence for accurate water content estimation. The Raman spectra also revealed the formation of metastable forms of organic acids upon crystallization from supersaturated droplets of AS/GA and AS/SA. Transformation of metastable solids to stable forms was observed before water uptake in the AS/GA particles, while the SA in AS/SA particles transformed in the presence of water.

  17. Measuring and modeling the salting-out effect in ammonium sulfate solutions.


    Wang, Chen; Lei, Ying Duan; Endo, Satoshi; Wania, Frank


    The presence of inorganic salts significantly influences the partitioning behavior of organic compounds between environmentally relevant aqueous phases, such as seawater or aqueous aerosol, and other, nonaqueous phases (gas phase, organic phase, etc.). In this study, salting-out coefficients (or Setschenow constants) (KS [M(-1)]) for 38 diverse neutral compounds in ammonium sulfate ((NH4)2SO4) solutions were measured using a shared headspace passive dosing method and a negligible depletion solid phase microextraction technique. The measured KS were all positive, varied from 0.216 to 0.729, and had standard errors in the range of 0.006-0.060. Compared to KS for sodium chloride (NaCl) in the literature, KS values for (NH4)2SO4 are always higher for the same compound, suggesting a higher salting-out effect of (NH4)2SO4. A polyparameter linear free energy relationship (pp-LFER) for predicting KS in (NH4)2SO4 solutions was generated using the experimental data for calibration. pp-LFER predicted KS agreed well with measured KS reported in the literature. KS for (NH4)2SO4 was also predicted using the quantum-chemical COSMOtherm software and the thermodynamic model AIOMFAC. While COSMOtherm generally overpredicted the experimental KS, predicted and experimental values were correlated. Therefore, a fitting factor needs to be applied when using the current version of COSMOtherm to predict KS. AIOMFAC tends to underpredict the measured KS((NH4)2SO4) but always overpredicts KS(NaCl). The prediction error is generally larger for KS(NaCl) than for KS((NH4)2SO4). AIOMFAC also predicted a dependence of KS on the salt concentrations, which is not observed in the experimental data. In order to demonstrate that the models developed and calibrated in this study can be applied to estimate Setschenow coefficients for atmospherically relevant compounds involved in secondary organic aerosol formation based on chemical structure alone, we predicted and compared KS for selected

  18. NMR chemical shift pattern changed by ammonium sulfate precipitation in cyanobacterial phytochrome Cph1.


    Song, Chen; Lang, Christina; Kopycki, Jakub; Hughes, Jon; Matysik, Jörg


    Phytochromes are dimeric biliprotein photoreceptors exhibiting characteristic red/far-red photocycles. Full-length cyanobacterial phytochrome Cph1 from Synechocystis 6803 is soluble initially but tends to aggregate in a concentration-dependent manner, hampering attempts to solve the structure using NMR and crystallization methods. Otherwise, the Cph1 sensory module (Cph1Δ2), photochemically indistinguishable from the native protein and used extensively in structural and other studies, can be purified to homogeneity in >10 mg amounts at mM concentrations quite easily. Bulk precipitation of full-length Cph1 by ammonium sulfate (AmS) was expected to allow us to produce samples for solid-state magic-angle spinning (MAS) NMR from dilute solutions before significant aggregation began. It was not clear, however, what effects the process of partial dehydration might have on the molecular structure. Here we test this by running solid-state MAS NMR experiments on AmS-precipitated Cph1Δ2 in its red-absorbing Pr state carrying uniformly (13)C/(15)N-labeled phycocyanobilin (PCB) chromophore. 2D (13)C-(13)C correlation experiments allowed a complete assignment of (13)C responses of the chromophore. Upon precipitation, (13)C chemical shifts for most of PCB carbons move upfield, in which we found major changes for C4 and C6 atoms associated with the A-ring positioning. Further, the broad spectral lines seen in the AmS (13)C spectrum reflect primarily the extensive inhomogeneous broadening presumably due to an increase in the distribution of conformational states in the protein, in which less free water is available to partake in the hydration shells. Our data suggest that the effect of dehydration process indeed leads to changes of electronic structure of the bilin chromophore and a decrease in its mobility within the binding pocket, but not restricted to the protein surface. The extent of the changes induced differs from the freezing process of the solution samples routinely

  19. NMR chemical shift pattern changed by ammonium sulfate precipitation in cyanobacterial phytochrome Cph1

    PubMed Central

    Song, Chen; Lang, Christina; Kopycki, Jakub; Hughes, Jon; Matysik, Jörg


    Phytochromes are dimeric biliprotein photoreceptors exhibiting characteristic red/far-red photocycles. Full-length cyanobacterial phytochrome Cph1 from Synechocystis 6803 is soluble initially but tends to aggregate in a concentration-dependent manner, hampering attempts to solve the structure using NMR and crystallization methods. Otherwise, the Cph1 sensory module (Cph1Δ2), photochemically indistinguishable from the native protein and used extensively in structural and other studies, can be purified to homogeneity in >10 mg amounts at mM concentrations quite easily. Bulk precipitation of full-length Cph1 by ammonium sulfate (AmS) was expected to allow us to produce samples for solid-state magic-angle spinning (MAS) NMR from dilute solutions before significant aggregation began. It was not clear, however, what effects the process of partial dehydration might have on the molecular structure. Here we test this by running solid-state MAS NMR experiments on AmS-precipitated Cph1Δ2 in its red-absorbing Pr state carrying uniformly 13C/15N-labeled phycocyanobilin (PCB) chromophore. 2D 13C–13C correlation experiments allowed a complete assignment of 13C responses of the chromophore. Upon precipitation, 13C chemical shifts for most of PCB carbons move upfield, in which we found major changes for C4 and C6 atoms associated with the A-ring positioning. Further, the broad spectral lines seen in the AmS 13C spectrum reflect primarily the extensive inhomogeneous broadening presumably due to an increase in the distribution of conformational states in the protein, in which less free water is available to partake in the hydration shells. Our data suggest that the effect of dehydration process indeed leads to changes of electronic structure of the bilin chromophore and a decrease in its mobility within the binding pocket, but not restricted to the protein surface. The extent of the changes induced differs from the freezing process of the solution samples routinely used in

  20. Simulations of Sulfate-Nitrate-Ammonium (SNA) aerosols during the extreme haze events over Northern China in 2014

    SciTech Connect

    Chen, Dan; Liu, Zhiquan; Fast, Jerome D.; Ban, Junmei


    Extreme haze events have occurred frequently over China in recent years. Although many studies have investigated the formation mechanisms associated with PM2.5 for heavily polluted regions in China based on observational data, adequately predicting peak PM2.5 concentrations is still challenging for regional air quality models. In this study, we evaluate the performance of one configuration of the Weather Research and Forecasting model coupled with chemistry (WRF-Chem) and use the model to investigate the sensitivity of heterogeneous reactions on simulated peak sulfate, nitrate, and ammonium concentrations in the vicinity of Beijing during four extreme haze episodes in October 2014 over the North China Plain. The highest observed PM2.5 concentration of 469 μg m-3 occurred in Beijing. Comparisons with observations show that the model reproduced the temporal variability in PM2.5 with the highest PM2.5 values on polluted days (defined as days in which observed PM2.5 is greater than 75 μg m-3), but predictions of sulfate, nitrate, and ammonium were too low on days with the highest observed concentrations. Observational data indicate that the sulfur/nitric oxidation rates are strongly correlated with relative humidity during periods of peak PM2.5; however, the model failed to reproduce the highest PM2.5 concentrations due to missing heterogeneous reactions. As the parameterizations of those reactions is not well established yet, estimates of SO2-to-H2SO4 and NO2/NO3-to-HNO3 reaction rates that depend on relative humidity were applied which improved the simulation of sulfate, nitrate, and ammonium enhancement on polluted days in terms of both concentrations and partitioning among those species. Sensitivity simulations showed that the extremely high heterogeneous reaction rates and also higher emission rates than those reported in the emission inventory

  1. Simulations of sulfate-nitrate-ammonium (SNA) aerosols during the extreme haze events over northern China in October 2014

    NASA Astrophysics Data System (ADS)

    Chen, Dan; Liu, Zhiquan; Fast, Jerome; Ban, Junmei


    Extreme haze events have occurred frequently over China in recent years. Although many studies have investigated the formation mechanisms associated with PM2.5 for heavily polluted regions in China based on observational data, adequately predicting peak PM2.5 concentrations is still challenging for regional air quality models. In this study, we evaluate the performance of one configuration of the Weather Research and Forecasting model coupled with chemistry (WRF-Chem) and use the model to investigate the sensitivity of heterogeneous reactions on simulated peak sulfate, nitrate, and ammonium concentrations in the vicinity of Beijing during four extreme haze episodes in October 2014 over the North China Plain. The highest observed PM2.5 concentration of 469 µg m-3 occurred in Beijing. Comparisons with observations show that the model reproduced the temporal variability in PM2.5 with the highest PM2.5 values on polluted days (defined as days in which observed PM2.5 is greater than 75 µg m-3), but predictions of sulfate, nitrate, and ammonium were too low on days with the highest observed concentrations. Observational data indicate that the sulfur/nitric oxidation rates are strongly correlated with relative humidity during periods of peak PM2.5; however, the model failed to reproduce the highest PM2.5 concentrations due to missing heterogeneous/aqueous reactions. As the parameterizations of those heterogeneous reactions are not well established yet, estimates of SO2-to-H2SO4 and NO2/NO3-to-HNO3 reaction rates that depend on relative humidity were applied, which improved the simulation of sulfate, nitrate, and ammonium enhancement on polluted days in terms of both concentrations and partitioning among those species. Sensitivity simulations showed that the extremely high heterogeneous reaction rates and also higher emission rates than those reported in the emission inventory were likely important factors contributing to those peak PM2.5 concentrations.

  2. Regeneration of FGD waste liquors: Production of ammonium and potassium sulfate mixed fertilizer. Quarterly technical report, July 1993--September 1993

    SciTech Connect

    Randolph, A.D.; Kwon, T.M.


    Regeneration of the Fe{sup II}-EDTA scrubbing liquors for simultaneous removal of SO{sub 2} and NO{sub x} in flue gas involves removing the nitrogen-sulfur (N-S) compounds accumulated in the liquor. In this paper, the authors investigated a simple regeneration process which selectively precipitates the N-S compounds as potassium salts and then hydrolyzes them to yield ammonium/potassium sulfate as a marketable byproduct. They believe this is the first report on precipitation and hydrolysis characteristics of the N-S compounds in actual waste scrubbing liquor. Precipitation of the N-S compounds was achieved by adding K{sub 2}SO{sub 4} to the scrubbing liquor. Effects of the amount of added K{sub 2}SO{sub 4} on the amount of removed N-S compounds, precipitated crystals, and the potassium left over in the scrubbing liquor were studied. Hydrolysis of the precipitated N-S compounds to ammonium sulfate was performed in a sulfuric acid environment. Effects of acidity, concentration of N-S compounds, and temperature on the hydrolysis are discussed. Analysis of the observed hydrolysis pattern showed that the reaction proceeded following first order kinetics in terms of N-S compound concentration.

  3. Effects of ammonium sulfate and sodium chloride concentration on PEG/protein liquid-liquid phase separation.


    Dumetz, André C; Lewus, Rachael A; Lenhoff, Abraham M; Kaler, Eric W


    When added to protein solutions, poly(ethylene glycol) (PEG) creates an effective attraction between protein molecules due to depletion forces. This effect has been widely used to crystallize proteins, and PEG is among the most successful crystallization agents in current use. However, PEG is almost always used in combination with a salt at either low or relatively high concentrations. Here the effects of sodium chloride and ammonium sulfate concentration on PEG 8000/ovalbumin liquid-liquid (L-L) phase separation are investigated. At low salt the L-L phase separation occurs at decreasing protein concentration with increasing salt concentration, presumably due to repulsive electrostatic interactions between proteins. At high salt concentration, the behavior depends on the nature of the salt. Sodium chloride has little effect on the L-L phase separation, but ammonium sulfate decreases the protein concentration at which the L-L phase separation occurs. This trend is attributed to the effects of critical fluctuations on depletion forces. The implications of these results for designing solution conditions optimal for protein crystallization are discussed.

  4. Recovery and purification of limonin from pummelo [Citrus grandis] peel using water extraction, ammonium sulfate precipitation and resin adsorption.


    Yang, Yuan Fan; Zhang, Liang Zheng; Du, Xi Ping; Zhang, Su Fang; Li, Li Jun; Jiang, Ze Dong; Wu, Li Ming; Ni, Hui; Chen, Feng


    Limonin is a bioactive compound that is traditionally extracted from citrus seeds using organic solvents or alkaline/metal ion solutions. In the present study, pummelo [Citrus grandis] peel was investigated for limonin preparation using a novel process consisting of water extraction, ammonium sulfate precipitation and resin adsorption. The pummelo peel was determined to have 4.7mg/g limonin, which could be extracted by water and further recovered by ammonium sulfate precipitation with a yield of 2.4mg/g, which was similar to that of traditional process using ethanol extraction and vacuumed evaporation. The precipitated limonin was purified by resin adsorption and crystallization with a purity of 96.4%. In addition, the limonin was identified via the analyses of retention time, infrared spectrum and nuclear magnetic resonance. This study indicates a novel and eco-friendly process for recovering limonin, providing a new candidate for limonin preparation. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Life cycle energy and greenhouse gas profile of a process for the production of ammonium sulfate from nitrogen-fixing photosynthetic cyanobacteria.


    Razon, Luis F


    In this paper, an alternative means for nitrogen fixation that may consume less energy and release less greenhouse gases than the Haber-Bosch process is explored. A life-cycle assessment was conducted on a process to: culture the cyanobacterium, Anabaena sp. ATCC 33047, in open ponds; harvest the biomass and exopolysaccharides and convert these to biogas; strip and convert the ammonia from the biogas residue to ammonium sulfate; dry the ammonium sulfate solution to ammonium sulfate crystals and transport the finished product. The results suggest that substantial reductions in non-renewable energy use and greenhouse gas emissions may be realized. The study opens the possibility that Haber-Bosch ammonia may be replaced with ammonia from a biomass process which simultaneously generates renewable energy. The process is intrinsically safer than the Haber-Bosch process. However, there are trade-offs in terms of land use and possibly, water.

  6. [Serodiagnosis of schistosomiasis mansoni using an egg extract semi-purified by precipitation with ammonium sulfate].


    Ouattara, S A; Sauneron, M F; Tribouley-Duret, J; Tribouley, J


    Fifty one sera from bilharziosis patients and thirty control sera were examined with a Schistosoma mansoni egg antigen purified by precipitation with ammonium sulphate at 50% saturation. Sensitivity and specificity were good and showed a good correlation with results obtained by MSA1 antigen, but antigen tested is far more easier to prepare than MSA1.

  7. The size effect of hematite and corundum inclusions on the efflorescence relative humidities of aqueous ammonium sulfate particles

    NASA Astrophysics Data System (ADS)

    Martin, Scot T.; Han, Jeong-Ho; Hung, Hui-Ming

    Mineral dusts inside aqueous atmospheric particles provide surfaces that induce crystallization during episodes of decreasing relative humidity (RH). Submicron aqueous ammonium sulfate particles containing hematite (α-Fe2O3) and corundum (α-Al2O3) inclusions are investigated in an aerosol flow tube at 298 K. As compared to 35% RH where homogeneous nucleation is rapid, the heterogeneous nuclei regulate the RH from 35% up to 60% RH as the inclusion size varies from 50 to 450 nm. The strong size dependence can be rationalized by an active site model. Model optimization yields 1010.4 sites cm-2 and m < 0 for α-Al2O3 and 109 sites cm-2 and m=0.04 for α-Fe2O3 particles.

  8. Inferring ammonium and sulfate aerosol concentrations using laser particle counters and condensation nuclei counters at summit, Greenland

    SciTech Connect

    Kuhns, H.; Davidson, C.; Bergin, M.


    Atmospheric measurements have been conducted in central Greenland over the last 10 years in connection with ice core research. While the primary objective of this research is to facilitate the quantitative interpretation of ice cores, interesting findings are being made in the field of Arctic air chemistry. In recent years, aerosol filters were run simultaneously with laser particle counters (LPC`s) and condensation nuclei counters (CNC`s). The LPC`s used in the this study count particles with diameters greater than 0.5 {mu}m, while the CNC`s count particles larger than approximately 0.01 {mu}m. Results from summertime aerosol sampling at Summit, Greenland are presented from the 1994 field season. Excellent agreement is observed between LPC data and particulate ammonium and sulfate. The correlation between ammonium and LPC data is r=0.88. Of all of the ionic species measured on the filters, the CNC results are in best agreement with MSA. The correlation for CNC and MSA is r=0.58. The relationship between the real-time particle sensor data and the aerosol chemistry has significant implications. The link between MSA and CNC supports the theory that marine biological activity enhances the production of cloud condensation nuclei. Also, this technique shows promise for remote sensing applications since once calibrated, the real time particle count data could be used to infer high temporal resolution aerosol chemistry.

  9. Crystal structure of bis-(di-methyl-ammonium) hexa-aqua-nickel(II) bis-(sulfate) dihydrate.


    Held, Peter


    In the title salt, (C2H8N)2[Ni(H2O)6)](SO4)2·2H2O, the Ni(II) cation is located on a centre of inversion and exhibits a slightly distorted octa-hedral arrangement of water mol-ecules. The Ni-O bond lengths in the complex [Ni(H2O)6](2+) cation show a distribution as in the related Tutton salt (NH4)2[Ni(H2O)6](SO4)2, but are longer in average [2.056 (13) versus 2.037 (12) Å]. The noncoordinating water mol-ecules and di-methyl-ammonium cations connect the sulfate and [Ni(H2O)6](2+) octa-hedra via O-H⋯O and N-H⋯O hydrogen bonds from weak up to medium strength into a three-dimensional framework whereby the complex metal cations and sulfate anions are arranged in sheets parallel (001).

  10. The requirement of ammonium or other cations linked with p-cresol sulfate for cross-reactivity with a peptide of myelin basic protein.


    Jackson, Patricia L; Cao, Ligong; Blalock, J Edwin; Whitaker, John N


    Urinary myelin basic protein-like material (MBPLM), so designated because of its immunoreactivity with a polyclonal antibody directed against a cryptic epitope located in residues 83-89 of myelin basic protein (MBP), exists in humans normally but increases in concentration in patients with multiple sclerosis who have progressive disease. Given its possible role in reflecting events of neural tissue destruction occurring in multiple sclerosis, urinary MBPLM is a candidate surrogate marker for this phase of the disease. Previously, it has been demonstrated that p-cresol sulfate (PCS) is the dominant component of MBPLM; however, another component(s) was essential in enabling p-cresol sulfate to have molecular mimicry with MBP peptide 83-89 detected by immunoreactivity. In the present investigation, this remaining component(s) was characterized by a combination of high performance size exclusion chromatography followed by nuclear magnetic resonance spectroscopy and shown to be ammonium. The monovalent cation ammonium could be substituted in vitro by several different monovalent and divalent cations, most notably zinc, in restoring to deprotonated p-cresol sulfate its immunoreactivity as MBPLM. These findings indicate the basis for the unexpected molecular mimicry between an epitope of an encephalitogenic protein and a complex containing a small organic molecule, p-cresol sulfate. Furthermore, the reaction of either ammonium or other cations with p-cresol sulfate may represent an in vivo process directly related to damage of axonal membranes.

  11. Oxidation of sulfur dioxide in aqueous ammonium sulfate aerosols containing manganese as a catalyst

    NASA Astrophysics Data System (ADS)

    Kaplan, D. J.; Himmelblau, D. M.; Kanaoka, C.

    The pseudo-first order reaction rate coefficient for the oxidation of SO 2 in air-borne water droplets containing (NH 4) 2SO 4 and MnSO 4 H 2O has been evaluated in a laminar gas flow apparatus. The sulfate and bisulfate formed in the reaction were detected using 35S as a radioactive tracer. Droplet diameters ranged from 1 to 10 μm. The gas phase SO 2 concentrations ranged from 0.1 to 1.0 ppm. Initial measurements yielded a value of the rate coefficient as defined in Equation (2) of about 0.04s -1 for the Mn 2+ catalyzed reaction system at a manganese concentration of about 0.1 mol dm -3, at a temperature of 25°C, and at a relative humidity of 90%.

  12. Infrared and polarized Raman spectra of tetramethyl ammonium cerium(III) bis(sulfate) trihydrate

    SciTech Connect

    Jayasree, R.S.; Nayar, V.U.; Jordanovska, V.


    Infrared and polarized Raman spectra of (CH{sub 3}){sub 4}NCe(SO{sub 4}){sub 2}{center_dot}3H{sub 2}O are recorded and analyzed. Bands are assigned on the basis on (CH{sub 3}){sub 4}N{sup +}, SO{sub 4}{sup 2-}, and H{sub 2}O vibrations. Methyl rotational modes and tetramethyl skeletal bending modes are not observed in the IR spectrum confirming the X-ray data that the tetramethyl ammonium ion retains its T{sub d} symmetry in the crystal. Small splitting observed in the nondegenerate modes of SO{sub 4}{sup 2-} ions implies slight distortion of the anions in the crystal. The existence of two types of SO{sub 4}{sup 2-} ions cannot be confirmed. The shifting of the stretching and bending vibrations of the water molecules from the free state value confirms the formation of hydrogen bonds of varying strengths in the crystal.

  13. Crystal structure of bis-(di-methyl-ammonium) hexa-aqua-cobalt(II) bis-(sulfate) dihydrate.


    Held, Peter


    The title salt, (C2H8N)2[Co(H2O)6)](SO4)2·2H2O, is isotypic with (C2H8N)2[Ni(H2O)6)](SO4)2·2H2O. The Co-O bond lengths in the [Co(H2O)6](2+) complex cation show very similar distances as in the related Tutton salt (NH4)2[Co(H2O)6)](SO4)2 [average 2.093 (17) Å], but are significantly longer than in the isotypic Ni(II) compound (Δd ≃ 0.04 Å). The cobalt cation reaches an overall bond-valence sum of 1.97 valence units. The S-O distances are nearly equal, ranging from 1.454 (4) to 1.470 (3) Å [mean 1.465 (12) Å]; however, the O-S-O angles vary clearly from 108.1 (2) to 110.2 (2)° [average bond angle 109.5 (9)°]. The non-coordinating water mol-ecules and di-methyl-ammonium cations connect the sulfate tetrahedra and the [Co(H2O)6](2+) octa-hedron via O-H⋯O and N-H⋯O hydrogen bonds of weak up to medium strength into a three-dimensional framework whereby the complex metal cations and sulfate anions are arranged in sheets parallel to (001).

  14. A simple method for isolating chicken egg yolk immunoglobulin using effective delipidation solution and ammonium sulfate.


    Tong, Chenyao; Geng, Fang; He, Zhenjiao; Cai, Zhaoxia; Ma, Meihu


    Chicken egg yolk immunoglobulin (IgY) is a superior alternative to mammalian immunoglobulin. However, the practical application of IgY in research, diagnostics, and functional food is limited due to complex or time-consuming purification procedures. The objective of this study was to develop a simple, safe, large-scale separation method for IgY from egg yolk. Egg yolk was diluted with 6-fold delipidation solutions made of different types (pectin, λ-carrageenan, carboxymethylcellulose, methylcellulose, and dextran sulfate) and concentrations (0.01, 0.05, 0.1, 0.15, and 0.2%) of polysaccharides, respectively. The yolk solution was adjusted to pH 5.0, and then kept overnight at 4°C before being centrifuged at 4°C. The resulting supernatant was added to 35% (w/v) (NH4)2SO4 and then centrifuged. The precipitant, which contained IgY, was dissolved in distilled water and then dialyzed. SDS-PAGE and Western blotting were utilized to conduct qualitative analysis of IgY; high-performance liquid chromatography (HPLC) was used for quantitative analysis. The immunoreactivity of IgY was measured by ELISA. The results showed that yield, purity, and immunoreactivity varied with types and concentrations of polysaccharides. The optimal isolation of IgY for pectin, λ-carrageenan, dextran sulfate, and carboxymethylcellulose was at the concentration of 0.1%; for methylcellulose, optimal isolation was at 0.15%. The best results were obtained in the presence of 0.1% pectin. In this condition, yield and purity can reach 8.36 mg/mL egg yolk and 83.3%, respectively, and the negative effect of IgY on immunoreactivity can be minimized. The procedure of isolation was simplified to 2 steps with a higher yield of IgY, avoiding energy- and time-consuming methods. Therefore, the isolation condition under study has a great potential for food industry production of IgY on a large scale. © 2014 Poultry Science Association Inc.

  15. A method for the preparation of curcumin by ultrasonic-assisted ammonium sulfate/ethanol aqueous two phase extraction.


    Xu, Guangkuan; Hao, Changchun; Tian, Suyang; Gao, Feng; Sun, Wenyuan; Sun, Runguang


    This study investigated a new and easy-to-industrialized extracting method for curcumin from Curcuma longa rhizomes using ultrasonic extraction technology combined with ammonium sulfate/ethanol aqueous two-phase system (ATPS), and the preparation of curcumin using the semi-preparative HPLC. The single-factor experiments and response surface methodology (RSM) were utilized to determine the optimal material-solvent ratio, ultrasonic intensity (UI) and ultrasonic time. The optimum extraction conditions were finally determined to be material-solvent rate of 3.29:100, ultrasonic intensity of 33.63W/cm(2) and ultrasonic time of 17min. At these optimum conditions, the extraction yield could reach 46.91mg/g. And the extraction yields of curcumin remained stable in the case of amplification, which indicated that scale-up extraction was feasible and efficient. Afterwards, the semi-preparative HPLC experiment was carried out, in which optimal preparation conditions were elected according to the single factor experiment. The prepared curcumin was obtained and the purity could up to 85.58% by the semi-preparative HPLC.

  16. 1,3-Bis(3-ammonium-propyl)tetramethyldisiloxane-sulfate: Structural characterization and evaluation of some properties

    NASA Astrophysics Data System (ADS)

    Nistor, Alexandra; Soroceanu, Alina; Shova, Sergiu; Cazacu, Maria


    1,3-Bis(3-ammonium-propyl)tetramethyldisiloxane sulfate resulted from the reaction between 1,3-bis(3-aminopropyl)tetramethyldisiloxane with a proper transition metal (iron(III) or vanadium(IV) oxide) salt as anion generator and a carbonylic compound (4-imidazole carboxaldehyde or 2-hydroxybenzaldehyde) as a metal collector, in methanol, was thoroughly characterized. The compound's structure was proved by single-crystal X-ray diffraction and spectral (FT-IR, 1H NMR) analysis, while the thermal behavior was evaluated by thermogravimetry. Water vapor sorption capacity on the crystalline compound was measured in dynamic regime. The co-existence of hydrophobic bis(propyl)tetramethyldisiloxane moiety and telechelic hydrophilic groups constitutes a premise for surface activity, as confirmed by tensiometry. Formation of micelles and aggregates in solution was emphasized by dynamic light scattering and confirmed by AFM images taken on the spin coated films, both revealing closed values for size of the micelles (100-200 nm).

  17. Effects of ammonium sulfate aerosol exposure on lung structure of normal and elastase-impaired rats and guinea pigs

    SciTech Connect

    Busch, R.H.; Buschbom, R.L.; Cannon, W.C.; Lauhala, K.E.; Miller, F.J.; Graham, J.A.; Smith, L.G.


    Rats and guinea pigs, pretreated with intratracheally administered elastase or saline, were exposed to 1.03 mg/m/sup 3/ (NH/sub 4/)/sub 2/SO/sub 4/; MMAD, 0.42 Identically treated controls were sham exposed. Measurements and evaluation of structural changes were conducted using morphometric techniques on SEM photographs and by applying subjective ratings. Pathology studies were conducted by light and electron microscopy. All examination methods confirmed elastase-induced emphysema, which was aggravated by (NH/sub 4/)/sub 2/SO/sub 4/ exposure in the rat. Ammonium sulfate exposure of saline-treated animals produced measurable degrees of enlargement of alveoli, and alveolar ducts and sacs. Electron microscopy revealed increased interstitial collagen in affected lung areas of elastase-treated, (NH/sub 4/)/sub 2/SO/sub 4/-exposed animals. Alveolar-pore size was significantly increased in elastase-treated animals (control and exposed) but not in saline-treated, exposed animals. The data suggest a possible difference between elastase and (NH/sub 4/)/sub 2/SO/sub 4/ in the mechanisms responsible for the increased diameter of alveolar structures. Hypertrophy and hyperplasia of nonciliated epithelial cells of the small airways and of the Type II alveolar cells were observed in otherwise untreated guinea pigs exposed to (NH/sub 4/)/sub 2/SO/sub 4/ but not in elastase-treated guinea pigs, nor in any of the rats. 12 references.

  18. Production of a Pseudomonas lipase in n-alkane substrate and its isolation using an improved ammonium sulfate precipitation technique.


    Kanwar, Lambit; Gogoi, Binod Kumar; Goswami, Pranab


    Among the various lipidic and non-lipidic substances, normal alkanes within the chain lengths of C-12 to C-20 served as the best carbon substrates for the production of extracellular lipase by Pseudomonas species G6. Maximum lipase production of 25 U/ml of the culture broth was obtained by using n-hexadecane as the sole carbon substrate. The optimum pH of 8 and temperature of 34 + 1 degrees C were demonstrated for the production of lipase in n-hexadecane substrate. The optimum concentration of iron, which played a critical role on the lipase production, was found to be 0.25 mg/l. Lipase production could be enhanced to nearly 2.4-fold by using tributyrin at a concentration of 0.05% (v/v) in the culture medium. High recovery of the lipase protein (83%) from the culture broth was achieved by treating the culture supernatant with Silicone 21 Defoamer followed by ammonium sulfate (60% saturation) fractionation.

  19. Isolation and purification of recombinant human plasminogen Kringle 5 by liquid chromatography and ammonium sulfate salting-out.


    Bian, Liujiao; Ji, Xu; Hu, Wei


    In this work, a novel method was established to isolate and purify Human plasminogen Kringle 5 (HPK5) as a histidine-tagged fusion protein expressed in Escherichia coli BL21 (DE3). This method consisted of sample extraction using a Ni-chelated Sepharose Fast-Flow affinity column, ammonium sulfate salting-out and Sephadex G-75 size-exclusion column in turn. The purity analysis by SDS-PAGE, high-performance size-exclusion and reversed-phase chromatographies showed that the obtained recombinant fusion HPK5 was homogeneous and its purity was higher than 96%; the activity analysis by chorioallantoic membrane model of chicken embryos revealed that the purified recombinant HPK5 exhibited an obvious anti-angiogenic activity under the effective range of 5.0-25.0 µg/mL. Through this procedure, about 19 mg purified recombinant fusion HPK5 can be obtained from 1 L of original fermentation solution. Approximate 32% of the total recombinant fusion HPK5 can be captured and the total yield was approximately 11%.

  20. Study of the dose response of the system ferrous ammonium sulfate-sucrose-xylenol orange in acid aqueous solution

    NASA Astrophysics Data System (ADS)

    Juarez-Calderon, J. M.; Negron-Mendoza, A.; Ramos-Bernal, S.


    An aqueous solution of ammonium ferrous sulfate-sucrose-xylenol orange in sulfuric acid (FSX) is proposed as a dosimetric system for the processes of gamma irradiation in a range between 0.3 and 6 Gy. This system is based on the indirect oxidation of ferrous ion by an organic compound (sucrose) to ferric ion and on the formation of a color complex of Fe3+ in an acidic medium with xylenol orange (a dye). After gamma radiation, an observable change occurs in the color of the system. Irradiation was executed at three different temperatures (13 °C, 22 °C, and 40 °C). A spectrometric readout method at 585 nm was employed to evaluate the system's dose response. In all of the cases analyzed, the responses had a linear behavior, and a slight effect of irradiation temperature was observed. Post-irradiation response was also evaluated and showed the stability of the solutions 24 h after the irradiation. The results obtained suggest that FSX might be used as a dosimeter for low doses of gamma irradiation because it provides a stable signal, good reproducibility, and an accessible technique for analysis.

  1. Infrared spectroscopic study of the effect of oleic acid on the deliquescence behaviour of ammonium sulfate aerosol particles.


    Nájera, Juan J; Horn, Andrew B


    In order to accurately assess the impact of fatty acids on the hygroscopic properties of atmospheric aerosol particles, (NH4)2SO4 (ammonium sulfate) and oleic acid (cis-9-octadecenoic acid) were chosen to perform this study as components of the particle phase. Micron-sized (700-900 nm) particles containing (NH4)2SO4 and oleic acid were generated by nebulising aqueous solutions of (NH4)2SO4 and sodium oleate. In this study, the effect of oleic acid on the deliquescence phase transition of particles was investigated in a room temperature aerosol flow tube (AFT) system using Fourier transform infrared (FTIR) spectroscopy. Particles morphologies and their chemical compositions were also analysed using a variety of techniques, including attenuated total reflection Fourier transform infrared (ATR-FTIR) spectroscopy and scanning electron microscopy/energy dispersive X-ray analysis (SEM/EDX). The deliquescence relative humidity (DRH) of the (NH4)2SO4 component, determined at 81+/-2%, was slightly lowered or not affected by the presence of different thickness of oleic acid (21 nm, 44 nm and 109 nm) present in the particles. Analyses of the results presented here are consistent with earlier studies about the possible effects of water-insoluble fatty acids coatings on the phase transitions of atmospheric aerosol particles.

  2. Responses of Ammonium Sulfate Particles Coated with Water-Soluble Glutaric Acid to Cyclic Changes in Relative Humidity: Hygroscopicity

    NASA Astrophysics Data System (ADS)

    Chan, M.; Chan, C.


    Atmospheric particles, which may have organic coating, exhibit cyclical change in physical state and size in response to ambient relative humidity (RH) change. We measured the hygroscopicity of solid ammonium sulfate (AS) particles initially coated with water-soluble glutaric acid in two consecutive cycles of deliquescence and crystallization utilizing an electrodynamic balance. We also give an analysis on the kinetic and chemical effects of glutaric acid coating on aerosol hygroscopicity. We found that AS particles with glutaric acid coating had different hygroscopicity upon repeated humidification and dehumidification. Once the particles deliquesced, the dissolution of the solid AS core and the glutaric acid coating formed mixed AS/Vglutaric acid solution droplets, which was confirmed by Raman characterization. Glutaric acid coating does not impede the evaporation and condensation rates of water molecules compared to the rates of AS particles. The coating likely affects the aerosol hygroscopicity through dissolution and its interactions with AS. Coating studies with either deliquescence or crystallization measurements, or one complete cycle of these two measurements may not fully assess the effects of the organic coatings on aerosol hygroscopicity.

  3. Cryo-transmission electron microscopy imaging of the morphology of submicrometer aerosol containing organic acids and ammonium sulfate.


    Veghte, Daniel P; Bittner, Danielle Rae; Freedman, Miriam Arak


    The effects of aerosol particles on heterogeneous atmospheric chemistry and climate are determined in part by the internal arrangement of compounds within the particles. To characterize the morphology of internally mixed aerosol particles in the accumulation mode size regime, we have used cryo-transmission electron microscopy to investigate the phase separation behavior of dry, submicrometer particles composed of ammonium sulfate mixed with carboxylic acids (adipic, azelaic, citric, glutaric, malonic, pimelic, suberic, and succinic acid). Determining the morphology of dry particles is important for understanding laboratory studies of aerosol optical properties, reactivity, and cloud condensation nucleus activity, results from field instruments where aerosol particles are dried prior to analysis, and atmospheric processes like deposition mode heterogeneous ice nucleation that occur on dried particles. We observe homogeneous morphologies for highly soluble organic compounds. For organic compounds with limited aqueous solubility, partially engulfed structures are observed. At intermediate aqueous solubilities, small particles are homogeneous and larger particles are partially engulfed. Results are compared to previous studies of liquid-liquid phase separation in supermicrometer particles and the impact of these dry particle morphologies on aerosol-climate interactions are discussed.

  4. Optimization of Ammonium Sulfate Concentration for Purification of Colorectal Cancer Vaccine Candidate Recombinant Protein GA733-FcK Isolated from Plants.


    Park, Se-Ra; Lim, Chae-Yeon; Kim, Deuk-Su; Ko, Kisung


    A protein purification procedure is required to obtain high-value recombinant injectable vaccine proteins produced in plants as a bioreactor. However, existing purification procedures for plant-derived recombinant proteins are often not optimized and are inefficient, with low recovery rates. In our previous study, we used 25-30% ammonium sulfate to precipitate total soluble proteins (TSPs) in purification process for recombinant proteins from plant leaf biomass which has not been optimized. Thus, the objective in this study is to optimize the conditions for plant-derived protein purification procedures. Various ammonium sulfate concentrations (15-80%) were compared to determine their effects on TSPs yield. With 50% ammonium sulfate, the yield of precipitated TSP was the highest, and that of the plant-derived colorectal cancer-specific surface glycoprotein GA733 fused to the Fc fragment of human IgG tagged with endoplasmic reticulum retention signal KDEL (GA733(P)-FcK) protein significantly increased 1.8-fold. SDS-PAGE analysis showed that the purity of GA733(P)-FcK protein band appeared to be similar to that of an equal dose of mammalian-derived GA733-Fc (GA733(M)-Fc). The binding activity of purified GA733(P)-FcK to anti-GA733 mAb was as efficient as the native GA733(M)-Fc. Thus, the purification process was effectively optimized for obtaining a high yield of plant-derived antigenic protein with good quality. In conclusion, the purification recovery rate of large quantities of recombinant protein from plant expression systems can be enhanced via optimization of ammonium sulfate concentration during downstream processes, thereby offering a promising solution for production of recombinant GA733-Fc protein in plants.

  5. The use of a polymer inclusion membrane as a sorbent for online preconcentration in the flow injection determination of thiocyanate impurity in ammonium sulfate fertilizer.


    Ohshima, Takumi; Kagaya, Shigehiro; Gemmei-Ide, Makoto; Cattrall, Robert W; Kolev, Spas D


    A polymer inclusion membrane (PIM) is used for the first time as a sorbent in the construction of a preconcentration column to enhance the sensitivity in flow injection analysis (FIA). The PIM-coated column is readily prepared by coating the PIM containing poly(vinyl chloride), Aliquat 336, and 1-tetradecanol onto glass beads packed in a glass tube. The determination of trace amounts of thiocyanate in ammonium sulfate fertilizer demonstrates the potential of the proposed PIM-coated column in FIA. Thiocyanate standards or samples of relatively large volume (e.g. up to 2000 µL) are injected into a nitrate carrier stream. The sample zone passes through the proposed preconcentration column where thiocyanate is concentrated in a smaller volume of a carrier solution thus resulting in up to 7.4 fold increase in sensitivity. Thiocyanate is detected spectrophotometrically after its reaction with Fe(III) downstream of the preconcentration column. The limits of detection of thiocyanate in the absence and presence of 20 g L(-1) ammonium sulfate (S/N=2) are 0.014 and 0.024 mg L(-1), respectively. Thiocyanate was successfully determined in several samples of ammonium sulfate fertilizer. Copyright © 2014 Elsevier B.V. All rights reserved.

  6. Catalytic-Oxidative Leaching of Low-Grade Complex Zinc Ore by Cu (II) Ions Produced from Copper Ore in Ammonia-Ammonium Sulfate Solution

    NASA Astrophysics Data System (ADS)

    Liu, Zhi Xiong; Yin, Zhou Lan; Hu, Hui Ping; Chen, Qi Yuan


    The catalytic-oxidative leaching of a mixed ore, which consists of low-grade oxide copper ore and oxide zinc ore containing ZnS, was investigated in ammonia-ammonium sulfate solution. The effect of the main parameters, such as mass ratio of copper ore to zinc ore, liquid-to-solid ratio, concentration of lixivant, leaching time, and temperature, was studied. The optimal leaching conditions with a maximum extraction of Cu 92.6 pct and Zn 85.5 pct were determined as follows: the mass ratio of copper ore to zinc ore 4/10 g/g, temperature 323.15 K (50 °C), leaching time 6 hours, stirring speed 500 r/min, liquid-to-solid ratio 3.6/1 cm3/g, concentration of lixivant including ammonia 2.0 mol/dm3, ammonium sulfate 1.0 mol/dm3, and ammonium persulfate 0.3 mol/dm3. It was found that ZnS in the oxide zinc ore could be extracted with Cu(II) ion, which was produced from copper ore and was used as the catalyst in the presence of ammonium persulfate.

  7. Polyethylene glycol method is superior to ammonium sulfate and protein-A sepharose-4B method in fractionating thyroid stimulating immunoglobulin in Graves' disease.


    Jap, T S; Jenq, S F; Wong, M C; Chiang, H


    The purpose of this study is to compare the performance of three methods, i.e., ammonium sulfate, polyethylene glycol (PEG) and protein A sepharose 4B in fractionation of thyroid stimulating immunoglobulin. Twelve patients with Graves' disease and twelve age-, sex-matched normal controls were recruited. 0.9 ml of saturated ammonium sulfate was added slowly to 1.1 ml of sera of all subjects and was stirred until reaching 45% saturation. The precipitation was allowed to form at 4 degrees C overnight. The solution was centrifuged at 10,000 x g for 5 minutes. The precipitate was washed twice with 45% ammonium sulfate, dissolved in 0.55 ml of distilled water equal to half of the initial volume of the serum and dialyzed against 200 volumes of phosphate-buffered saline (PBS) for 48 hours. Another 0.5 ml of serum sample from the same patients was mixed with 1.5 ml of 20% polyethylene, followed by centrifugation at 2,800 g for 20 minutes. The pellet was dissolved in 0.6 ml of Hanks' medium without NaCl containing 1.5% bovine serum albumin, 20mM HEPES: 1 ml of sera was applied to 0.75 g of protein A sepharose-4B in PBS buffer and eluted with glycine, pH 2.3. By adding immunoglobulin (Ig) from the different methods to the FRTL-5 tissue culture, we determined the cAMP generation. Patients with Graves' disease were found to have higher serum thyroxine and triiodothyronine concentrations (p < 0.001) and significantly higher free thyroxine concentration than normal subjects. Ig elicited stronger response in cyclic AMP generation when prepared with PEG method, as compared with the other two methods (p < 0.001). With sepharose-4B Ig preparation, 10 out 12 patients (83.33%) showed positive thyroid stimulating immunoglobulin (TSI) while with ammonium sulfate precipitation, nine out 12 patients (75%) showed positive TSI. On the other hand, all patients showed positive TSI with PEG precipitation. When the degree of thyrotoxicosis was classified in terms of thyroid hormone

  8. Formation mechanisms of channels on Titan through dissolution by ammonium sulfate and erosion by liquid ammonia and ethane

    NASA Astrophysics Data System (ADS)

    Gilliam, Ashley E.; Lerman, Abraham


    Data obtained from the Cassini Visual and Infrared Mapping Spectrometer (VIMS), Imaging Science Subsystem (ISS), and Synthetic Aperture Radar (SAR) instruments have revealed an array of fluvial channels on Titan's surface, often several hundreds of kilometers in length. The paucity of impact craters on Titan's surface suggests a formation by fluvial erosion into the water-ice bedrock. Additionally, at the landing site, the Huygens Probe Descent Imager and Spectral Radiometer (DISR) imaged Earth-like rounded cobbles 0.3-15 cm in diameter composed of water ice, reminiscent of rounded stream clasts on Earth. In this paper we examine different fluvial features on Titan, identified by the Cassini spacecraft, and evaluate the possibilities of channel formation by dissolution of ice by a concentrated solution of ammonium sulfate, and by mechanical erosion by flow of liquid ammonia and liquid ethane. We find that chemical erosion of Titan's channels could be completed in 280 to 1100 years (all units of time in this paper are Terrestrial, not Titanian), much shorter than the period of about 84,000 years that a concentrated (NH4)2SO4-H2O solution could exist as a liquid on the Titan surface. Mechanical erosion of Titan's channels is generally a much slower process, on the order of 102 to 105 years to completion, and is also slower than mechanical erosion of a model river on Earth, averaging 103 to 104 years. The erosional sequence of the channels on Titan may have started after the formation of water-ice on the surface by the process of chemical dissolution by (NH4)2SO4-H2O, overlapping, or followed by, a period of mechanical erosion by liquid NH3. A final stage on the cooling surface of Titan might have been characterized by liquid C2H6 as an agent of mechanical erosion.

  9. Experimental additions of aluminum sulfate and ammonium nitrate to in situ mesocosms to reduce cyanobacterial biovolume and microcystin concentration

    USGS Publications Warehouse

    Harris, Ted D.; Wilhelm, Frank M.; Graham, Jennifer L.; Loftin, Keith A.


    Recent studies suggest that nitrogen additions to increase the total nitrogen:total phosphorus (TN:TP) ratio may reduce cyanobacterial biovolume and microcystin concentration in reservoirs. In systems where TP is >100 μg/L, however, nitrogen additions to increase the TN:TP ratio could cause ammonia, nitrate, or nitrite toxicity to terrestrial and aquatic organisms. Reducing phosphorus via aluminum sulfate (alum) may be needed prior to nitrogen additions aimed at increasing the TN:TP ratio. We experimentally tested this sequential management approach in large in situ mesocosms (70.7 m3) to examine effects on cyanobacteria and microcystin concentration. Because alum removes nutrients and most seston from the water column, alum treatment reduced both TN and TP, leaving post-treatment TN:TP ratios similar to pre-treatment ratios. Cyanobacterial biovolume was reduced after alum addition, but the percent composition (i.e., relative) cyanobacterial abundance remained unchanged. A single ammonium nitrate (nitrogen) addition increased the TN:TP ratio 7-fold. After the TN:TP ratio was >50 (by weight), cyanobacterial biovolume and abundance were reduced, and chrysophyte and cryptophyte biovolume and abundance increased compared to the alum treatment. Microcystin was not detectable until the TN:TP ratio was <50. Although both treatments reduced cyanobacteria, only the nitrogen treatment seemed to stimulate energy flow from primary producers to zooplankton, which suggests that combining alum and nitrogen treatments may be a viable in-lake management strategy to reduce cyanobacteria and possibly microcystin concentrations in high-phosphorus systems. Additional studies are needed to define best management practices before combined alum and nitrogen additions are implemented as a reservoir management strategy.

  10. Evaluation of the reproductive and developmental toxicity of aluminium ammonium sulfate in a two-generation study in rats.


    Hirata-Koizumi, Mutsuko; Fujii, Sakiko; Ono, Atsushi; Hirose, Akihiko; Imai, Toshio; Ogawa, Kumiko; Ema, Makoto; Nishikawa, Akiyoshi


    Aluminium ammonium sulfate (AAS) was tested for reproductive/developmental toxicity in a two-generation study. Male and female rats were continuously given AAS in drinking water at 0, 50, 500 or 5000 ppm. Water consumption was decreased in all AAS-treated groups, and the body weight of parental animals transiently decreased in the 5000 ppm group. In either generation, no compound-related changes were found in estrous cyclicity, sperm parameters, copulation, fertility and gestation index, number of implantations and live birth pups, sex ratios of pups or viability during the preweaning period. Male and female F1 pups in the 5000 ppm group showed a lower body weight on postnatal day 21, while there were no differences in the birth weight of F1 and F2 pups between the control and AAS-treated groups. Preweaning body weight gain in F2 males and females indicated a similar decreasing tendency at 5000 ppm. In F1 and F2 weanlings, the weight of the liver, spleen and thymus decreased at 5000 ppm, but no histopathological changes were found in these organs. In F1 females in the 5000 ppm group, vaginal opening was delayed slightly. There were no compound-related changes in male preputial separation or in other developmental landmarks. In behavioral tests conducted for F1 animals at 4-6 weeks of age, no compound-related changes were found in spontaneous locomotor activity and performance in a water-filled multiple T-maze. In conclusion, the NOAEL of AAS for two-generation reproductive/developmental toxicity was considered to be 500 ppm in rats. Considering the aluminium content in the basal diet, the total ingested dose of aluminium from drinking water and food in this 500 ppm group was calculated to be 5.35 mgAl/kgbw/day.

  11. Importance of including ammonium sulfate ((NH4)2SO4) aerosols for ice cloud parameterization in GCMs

    NASA Astrophysics Data System (ADS)

    Bhattacharjee, P. S.; Sud, Y. C.; Liu, X.; Walker, G. K.; Yang, R.; Wang, J.


    A common deficiency of many cloud-physics parameterizations including the NASA's microphysics of clouds with aerosol-cloud interactions (hereafter called McRAS-AC) is that they simulate lesser (larger) than the observed ice cloud particle number (size). A single column model (SCM) of McRAS-AC physics of the GEOS4 Global Circulation Model (GCM) together with an adiabatic parcel model (APM) for ice-cloud nucleation (IN) of aerosols were used to systematically examine the influence of introducing ammonium sulfate (NH4)2SO4 aerosols in McRAS-AC and its influence on the optical properties of both liquid and ice clouds. First an (NH4)2SO4 parameterization was included in the APM to assess its effect on clouds vis-à-vis that of the other aerosols. Subsequently, several evaluation tests were conducted over the ARM Southern Great Plain (SGP) and thirteen other locations (sorted into pristine and polluted conditions) distributed over marine and continental sites with the SCM. The statistics of the simulated cloud climatology were evaluated against the available ground and satellite data. The results showed that inclusion of (NH4)2SO4 into McRAS-AC of the SCM made a remarkable improvement in the simulated effective radius of ice cloud particulates. However, the corresponding ice-cloud optical thickness increased even more than the observed. This can be caused by lack of horizontal cloud advection not performed in the SCM. Adjusting the other tunable parameters such as precipitation efficiency can mitigate this deficiency. Inclusion of ice cloud particle splintering invoked empirically further reduced simulation biases. Overall, these changes make a substantial improvement in simulated cloud optical properties and cloud distribution particularly over the Intertropical Convergence Zone (ITCZ) in the GCM.

  12. Cooperativity between Volatilization of NH3, Evaporation of Water and Crystallization of Na2SO4 in Internally Mixed Sodium Succinate/Ammonium Sulfate Aerosols

    NASA Astrophysics Data System (ADS)

    Wang, Pan; Pang, Shu-Feng; Zhang, Yun-Hong


    Gas-to-particle partitioning is one of the most important physicochemical process in atmospheric aerosols. The chemical reaction in the internally mixed organic/inorganic aerosols attracts much attention on the volatility and hygroscopicity. In this study, FTIR spectra evolution with time were observed by FTIR-ATR technique at constant relative humidity for the internally mixed sodium succinate/ammonium sulfate aerosols with molar ratio of 1:1. The results showed that sodium succinate and ammonium sulfate in the mixed aerosols could react to form succinate acid and sodium sulfate accompanying NH3 volatile as followings: NaOOCCH2CH2COONa (aq) + (NH4)2SO4 (aq) → HOOCCH2CH2COOH (aq) + Na2SO4 (aq or crystal) + NH3 (g) The volatilization of NH3 speeded up the evaporation of water, and indirectly accelerated the crystallization of Na2SO4 in the mixed aerosols, which synergistically accelerated release of NH3. The complex reaction between dicarboxylic salt and (NH4)2SO4 could help us to understand the cooperativity between the gas-to-particle equilibrium, phase transition, atmospheric composition and volatility, which could reveal the formation mechanism of the secondary organic aerosols.

  13. Hygroscopic properties and cloud condensation nuclei activation of limonene-derived organosulfates and their mixtures with ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Hansen, A. M. K.; Hong, J.; Raatikainen, T.; Kristensen, K.; Ylisirniö, A.; Virtanen, A.; Petäjä, T.; Glasius, M.; Prisle, N. L.


    Even though organosulfates have been observed as constituents of atmospheric aerosols in a wide range of environments spanning from the subtropics to the high Arctic, their hygroscopic properties have not been investigated prior to this study. Here, limonene-derived organosulfates with a molecular weight of 250 Da (L-OS 250) were synthesized and used for simultaneous measurements with a Hygroscopicity Tandem Differential Mobility Analyzer (H-TDMA) and a Cloud Condensation Nuclei Counter (CCNC) to determine the hygroscopicity parameter, κ, for pure L-OS 250 and mixtures of L-OS 250 with ammonium sulfate (AS) over a wide range of humidity conditions. The κ values derived from measurements with H-TDMA decreased with increasing particle dry size for all chemical compositions investigated, indicating size dependency and/or surface effects. For pure L-OS 250, κ was found to increase with increasing relative humidity, indicating dilution/solubility effects to be significant. Discrepancies in κ between the sub- and supersaturated measurements were observed for L-OS 250, whereas κ of AS and mixed L-OS 250/AS were similar. This discrepancy was primarily ascribed to limited dissolution of L-OS 250 at subsaturated conditions. In general, hygroscopic growth factor, critical activation diameter and κ for the mixed L-OS 250/AS particles converged towards the values of pure AS for mixtures with ≥ 20 % w/w AS. Surface tension measurements of bulk aqueous L-OS 250/AS solutions showed that L-OS 250 was indeed surface active, as expected from its molecular structure, decreasing the surface tension of solutions with 24 % from the pure water-value at a L-OS 250 concentration of 0.0025 mol L-1. Based on these surface tension measurements, we present the first concentration-dependent parametrisation of surface tension for aqueous L-OS 250, which was implemented to different process-level models of L-OS 250 hygroscopicity and CCN activation. The values of κ obtained from the

  14. Hygroscopic properties and cloud condensation nuclei activation of limonene-derived organosulfates and their mixtures with ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Hansen, A. M. K.; Hong, J.; Raatikainen, T.; Kristensen, K.; Ylisirniö, A.; Virtanen, A.; Petäjä, T.; Glasius, M.; Prisle, N. L.


    Organosulfates have been observed as constituents of atmospheric aerosols in a wide range of environments; however their hygroscopic properties remain uncharacterised. Here, limonene-derived organosulfates with a molecular weight of 250 Da (L-OS 250) were synthesised and used for simultaneous measurements with a hygroscopicity tandem differential mobility analyser (H-TDMA) and a cloud condensation nuclei counter (CCNC) to determine the hygroscopicity parameter, κ, for pure L-OS 250 and mixtures of L-OS 250 with ammonium sulfate (AS) over a wide range of humidity conditions. The κ values derived from measurements with H-TDMA decreased with increasing particle dry diameter for all chemical compositions investigated, indicating that κH-TDMA depends on particle diameter and/or surface effects; however, it is not clear if this trend is statistically significant. For pure L-OS 250, κ was found to increase with increasing relative humidity, indicating dilution/solubility effects to be significant. Discrepancies in κ between the sub- and supersaturated measurements were observed for L-OS 250, whereas κ of AS and mixed L-OS 250/AS were similar. This discrepancy was primarily ascribed to limited dissolution of L-OS 250 at subsaturated conditions. In general, hygroscopic growth factor, critical particle diameter and κ for the mixed L-OS 250/AS particles converged towards the values of pure AS for mixtures with ≥ 20 % w / w AS. Surface tension measurements of bulk aqueous L-OS 250/AS solutions showed that L-OS 250 was indeed surface active, as expected from its molecular structure, decreasing the surface tension of solutions with 24 % from the pure water value at a L-OS 250 concentration of 0.0025 mol L-1. Based on these surface tension measurements, we present the first concentration-dependent parametrisation of surface tension for aqueous L-OS 250, which was implemented to different process-level models of L-OS 250 hygroscopicity and CCN activation. The values of κ

  15. Synergistic interaction of ozone and respirable aerosols on rat lungs. II. Synergy between ammonium sulfate aerosol and various concentrations of ozone

    SciTech Connect

    Warren, D.L.; Guth, D.J.; Last, J.A.


    Pulmonary responses after continuous exposure of rats to concentrations of ozone (O3) ranging from 0.12 to 0.64 ppm were quantified by measuring tissue collagen synthesis rate, tissue protein and DNA content, and various constituents of bronchoalveolar lavage fluid. After 7 days of exposure to 0.64 ppm of O3, lung collagen synthesis rate and tissue content of protein and DNA were elevated. After shorter durations of exposure to 0.64 ppm of O3, significant elevations were observed in the protein content and the activities of lactate dehydrogenase, acid phosphatase, and N-acetyl-beta-D-glucosaminidase from lavage fluid. After exposure of rats to 0.20 ppm of O3 for 7 days, changes could be detected in both lung collagen synthesis rate and tissue protein content. Total lavagable protein content, a sensitive indicator for O3-induced effects upon the lung, was significantly elevated in lungs of rats exposed to 0.12 or 0.20 ppm of O3. To examine whether a synergistic interaction occurred between 0.20 or 0.64 ppm of O3 and acid aerosols, rats were continuously exposed to O3 with and without concurrent exposure to 5 mg/m3 of ammonium sulfate. A synergistic interaction between 0.20 ppm of O3 and ammonium sulfate aerosol was observed by measurement of total lavagable protein and of lung collagen synthesis rate. These results demonstrate that ammonium sulfate aerosol interacts synergistically with O3 at concentrations of O3 that approach ambient levels.

  16. Fine-tuning key parameters of an integrated reactor system for the simultaneous removal of COD, sulfate and ammonium and elemental sulfur reclamation.


    Yuan, Ye; Chen, Chuan; Liang, Bin; Huang, Cong; Zhao, Youkang; Xu, Xijun; Tan, Wenbo; Zhou, Xu; Gao, Shuang; Sun, Dezhi; Lee, Duujong; Zhou, Jizhong; Wang, Aijie


    In this paper, we proposed an integrated reactor system for simultaneous removal of COD, sulfate and ammonium (integrated C-S-N removal system) and investigated the key parameters of the system for a high level of elemental sulfur (S(0)) production. The system consisted of 4 main units: sulfate reduction and organic carbon removal (SR-CR), autotrophic and heterotrophic denitrifying sulfide removal (A&H-DSR), sulfur reclamation (SR), and aerated filter for aerobic nitrification (AN). In the system, the effects of key operational parameters on production of elemental sulfur were investigated, including hydraulic retention time (HRT) of each unit, sulfide/nitrate (S(2-)-S/NO3(-)-N) ratios, reflux ratios between the A&H-DSR and AN units, and loading rates of chemical oxygen demand (COD), sulfate and ammonium. Physico-chemical characteristics of biosulfur were studied for acquiring efficient S(0) recovery. The experiments successfully explored the optimum parameters for each unit and demonstrated 98% COD, 98% sulfate and 78% nitrogen removal efficiency. The optimum HRTs for SR-CR, A&H-DSR and AN were 12h, 3h and 3h, respectively. The reflux ratio of 3 could provide adequate S(2-)-S/NO3(-)-N ratio (approximately 1:1) to the A&H-DSR unit for obtaining maximum sulfur production. In this system, the maximum production of S(0) reached 90%, but only 60% S(0) was reclaimed from effluent. The S(0) that adhered to the outer layer of granules was deposited in the bottom of the A&H-DSR unit. Finally, the microbial community structure of the corresponding unit at different operational stage were analyzed by 16S rRNA gene based high throughput Illumina MiSeq sequencing and the potential function of dominant species were discussed. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Isotopic characterization of nitrate, ammonium and sulfate in stack PM2.5 emissions in the Athabasca Oil Sands Region, Alberta, Canada

    NASA Astrophysics Data System (ADS)

    Proemse, Bernadette C.; Mayer, Bernhard; Chow, Judith C.; Watson, John G.


    Stable isotope techniques may be a suitable tool for tracing industrial emissions in the atmosphere and the environment provided that the isotopic compositions of industrial emissions are distinct. We determined the isotopic compositions of nitrate, ammonium and sulfate in PM2.5 emitted from two industrial stacks at a large upgrader site in the Athabasca oil sands region (AOSR), northeastern Alberta, Canada, and compared them to the nitrogen and sulfur isotopic compositions of source materials and upgrading by-products. We found distinct isotopic compositions of nitrate and ammonium in PM2.5 compared to those reported for atmospheric nitrate and ammonium in the literature. Nitrate in PM2.5 had δ15N values of 9.4‰ (Stack A) and 16.1 ± 1.2‰ (Stack B) that were significantly enriched in 15N compared to the feedstock materials (˜2.5‰), by-products of upgrading (-0.3-1.3‰), and atmospheric N2 (0‰). δ15N of ammonium in PM2.5 showed a large range with values between - 4.5 to +20.1‰ (Stack B). We report the first measurements of the triple oxygen isotopic composition of industrial emitted nitrate. Nitrate emitted as PM2.5 is not mass-independently enriched in 17O resulting in Δ17O = 0.5 ± 0.9‰ (Stack B) and is therefore distinct from atmospheric nitrate, constituting an excellent indicator of industrial derived nitrate. δ18O values of nitrate in PM2.5 (36.0 and 17.6 ± 1.8‰ for Stack A and B, respectively) were also significantly lower than δ18O values of atmospheric nitrates and hence isotopically distinct. δ34S values of sulfate in PM2.5 were with 7.3 ± 0.3‰ (Stack A) and 9.4 ± 2.0‰ (Stack B) slightly enriched in 34S compared to δ34S in bitumen (4.3 ± 0.3‰) and coke (3.9 ± 0.2‰). δ18O values of sulfate in PM2.5 were 18.9 ± 2.9‰ and 14.2 ± 2.8‰ for Stack A and Stack B, respectively. The isotopic composition of sulfate in PM2.5 was not sufficiently different from δ34S and δ18O values of sulfate in long-range atmospheric

  18. Ferrous ammonium phosphate (FeNH₄PO₄) as a new food fortificant: iron bioavailability compared to ferrous sulfate and ferric pyrophosphate from an instant milk drink.


    Walczyk, Thomas; Kastenmayer, Peter; Storcksdieck Genannt Bonsmann, Stefan; Zeder, Christophe; Grathwohl, Dominik; Hurrell, Richard F


    The main purpose of this study was to establish bioavailability data in humans for the new (Fe) fortification compound ferrous ammonium phosphate (FAP), which was specially developed for fortification of difficult-to-fortify foods where soluble Fe compounds cannot be used due to their negative impact on product stability. A double-blind, randomized clinical trial with cross-over design was conducted to obtain bioavailability data for FAP in humans. In this trial, Fe absorption from FAP-fortified full-cream milk powder was compared to that from ferric pyrophosphate (FPP) and ferrous sulfate. Fe absorption was determined in 38 young women using the erythrocyte incorporation dual stable isotope technique (⁵⁷Fe, ⁵⁸Fe). Geometric mean Fe absorption from ferrous sulfate, FAP and FPP was 10.4, 7.4 and 3.3 %, respectively. Fe from FAP was significantly better absorbed from milk than Fe from FPP (p < 0.0001). Fe absorption from FAP was significantly lower than Fe absorption from ferrous sulfate, which was used as water-soluble reference compound (p = 0.0002). Absorption ratios of FAP and FPP relative to ferrous sulfate as a measure of relative bioavailability were 0.71 and 0.32, respectively. The results of the present studies show that replacing FPP with FAP in full-cream milk could significantly improve iron bioavailability.

  19. Development of an on-line source-tagged model for sulfate, nitrate and ammonium: A modeling study for highly polluted periods in Shanghai, China.


    Wu, Jian-Bin; Wang, Zifa; Wang, Qian; Li, Jie; Xu, Jianming; Chen, HuanSheng; Ge, Baozhu; Zhou, Guangqiang; Chang, Luyu


    An on-line source-tagged model coupled with an air quality model (Nested Air Quality Prediction Model System, NAQPMS) was applied to estimate source contributions of primary and secondary sulfate, nitrate and ammonium (SNA) during a representative winter period in Shanghai. This source-tagged model system could simultaneously track spatial and temporal sources of SNA, which were apportioned to their respective primary precursors in a simulation run. The results indicate that in the study period, local emissions in Shanghai accounted for over 20% of SNA contributions and that Jiangsu and Shandong were the two major non-local sources. In particular, non-local emissions had higher contributions during recorded pollution periods. This suggests that the transportation of pollutants plays a key role in air pollution in Shanghai. The temporal contributions show that the emissions from the "current day" (emission contribution from the current day during which the model was simulating) contributed 60%-70% of the sulfate and ammonium concentrations but only 10%-20% of the nitrate concentration, while the previous days' contributions increased during the recorded pollution periods. Emissions that were released within three days contributed over 85% averagely for SNA in January 2013. To evaluate the source-tagged model system, the results were compared by sensitivity analysis (emission perturbation of -30%) and backward trajectory analysis. The consistency of the comparison results indicated that the source-tagged model system can track sources of SNA with reasonable accuracy.

  20. Characteristics of a high-concentration-ammonium sulfate-requiring ammonia-oxidizing bacterium isolated from deodorization plants of chicken farms.


    Hatayama, R; Chiba, K; Noda, K; Takahashi, R; Kanehira, T; Serata, K; Shinohara, M; Tokuyama, T


    A high-concentration-ammonium sulfate-requiring, ammonia-oxidizing bacterium, strain K1, was newly isolated from packed tower biological deodorization plants of chicken farms. The cells of strain K1 are rods (0.1-1.0 x 1.0-2.0 microm), gram negative, obligately aerobic, and nonmotile. Colonies (1-2 mm in diameter) on a plate culture are reddish, circular, and smooth. Intracytoplasmic membranes characteristic of nitrifying bacteria are present. The G+C content of the total DNA is 48.5 mol%. The similarity of 16S rRNA (%) to N. europaea ATCC 25978T (type strain) is 93.77%. This bacterium has a higher optimal growth temperature (35 degrees C) than is usually the case and tolerance up to 40 degrees C. The optimum concentration of ammonium sulfate in the medium is 303 mM, which should make it applicable for use in deodorization plants for enhancing the efficiency of deodorization. Phosphoglycerate kinase (PGK) and triosephosphate isomerase (TIM) were found to possess high specific activities (5700 and 4 x 10(5) U/mg, respectively) compared to the activities of these enzymes in strain ATCC 25978T (300 and 14 U/mg).

  1. Salting-out extraction of allicin from garlic (Allium sativum L.) based on ethanol/ammonium sulfate in laboratory and pilot scale.


    Li, Fenfang; Li, Qiao; Wu, Shuanggen; Tan, Zhijian


    Salting-out extraction (SOE) based on lower molecular organic solvent and inorganic salt was considered as a good substitute for conventional polymers aqueous two-phase extraction (ATPE) used for the extraction of some bioactive compounds from natural plants resources. In this study, the ethanol/ammonium sulfate was screened as the optimal SOE system for the extraction and preliminary purification of allicin from garlic. Response surface methodology (RSM) was developed to optimize the major conditions. The maximum extraction efficiency of 94.17% was obtained at the optimized conditions for routine use: 23% (w/w) ethanol concentration and 24% (w/w) salt concentration, 31g/L loaded sample at 25°C with pH being not adjusted. The extraction efficiency had no obvious decrease after amplification of the extraction. This ethanol/ammonium sulfate SOE is much simpler, cheaper, and effective, which has the potentiality of scale-up production for the extraction and purification of other compounds from plant resources.

  2. Crystallization of aqueous inorganic-malonic acid particles: nucleation rates, dependence on size, and dependence on the ammonium-to-sulfate ratio.


    Parsons, Matthew T; Riffell, Jenna L; Bertram, Allan K


    Using an electrodynamic balance, we determined the relative humidity (RH) at which aqueous inorganic-malonic acid particles crystallized, with ammonium sulfate ((NH(4))(2)SO(4)), letovicite ((NH(4))(3)H(SO(4))(2)), or ammonium bisulfate (NH(4)HSO(4)) as the inorganic component. The results for (NH(4))(2)SO(4)-malonic acid particles and (NH(4))(3)H(SO(4))(2)-malonic acid particles show that malonic acid decreases the crystallization RH of the inorganic particles by less than 7% RH when the dry malonic acid mole fraction is less than 0.25. At a dry malonic acid mole fraction of about 0.5, the presence of malonic acid can decrease the crystallization RH of the inorganic particles by up to 35% RH. For the NH(4)HSO(4)-malonic acid particles, the presence of malonic acid does not significantly modify the crystallization RH of the inorganic particles for the entire range of dry malonic acid mole fractions studied; in all cases, either the particles did not crystallize or the crystallization RH was close to 0% RH. Size dependent measurements show that the crystallization RH of aqueous (NH(4))(2)SO(4) particles is not a strong function of particle volume. However, for aqueous (NH(4))(2)SO(4)-malonic acid particles (with dry malonic acid mole fraction = 0.36), the crystallization RH is a stronger function of particle volume, with the crystallization RH decreasing by 6 +/- 3% RH when the particle volume decreases by an order of magnitude. To our knowledge, these are the first size dependent measurements of the crystallization RH of atmospherically relevant inorganic-organic particles. These results suggest that for certain organic mole fractions the particle size and observation time need to be considered when extrapolating laboratory crystallization results to atmospheric scenarios. For aqueous (NH(4))(2)SO(4) particles, the homogeneous nucleation rate data are a strong function of RH, but for aqueous (NH(4))(2)SO(4)-malonic acid particles (with dry organic mole fraction = 0

  3. The effects of fuel composition and ammonium sulfate addition on PCDD, PCDF, PCN and PCB concentrations during the combustion of biomass and paper production residuals.


    Lundin, Lisa; Jansson, Stina


    The use of waste wood as an energy carrier has increased during the last decade. However, the higher levels of alkali metals and chlorine in waste wood compared to virgin biomass can promote the formation of deposits and organic pollutants. Here, the effect of fuel composition and the inhibitory effects of ammonium sulfate, (NH4)2SO4, on the concentrations of persistent organic pollutants (POPs) in the flue gas of a lab-scale combustor was investigated. Ammonium sulfate is often used as a corrosion-preventing additive and may also inhibit formation of polychlorinated dibenzo-p-dioxins (PCDDs) and dibenzofurans (PCDFs). In addition to PCDDs and PCDFs, polychlorinated naphthalenes (PCN) and biphenyls (PCB) were also analyzed. It was found that the flue gas composition changed dramatically when (NH4)2SO4 was added: CO, SO2, and NH3 levels increased, while those of HCl decreased to almost zero. However, the additive's effects on POP formation were less pronounced. When (NH4)2SO4 was added to give an S:Cl ratio of 3, only the PCDF concentration was reduced, indicating that this ratio was not sufficient to achieve a general reduction in POP emissions. Conversely, at an S:Cl ratio of 6, significant reductions in the WHO-TEQ value and the PCDD and PCDF contents of the flue gas were observed. The effect on the PCDF concentration was especially pronounced. PCN formation seemed to be promoted by the elevated CO concentrations caused by adding (NH4)2SO4.

  4. Effect of ammonium-based, non-sulfate fertilizers on CH 4 emissions from a paddy field with a typical Chinese water management regime

    NASA Astrophysics Data System (ADS)

    Dong, Haibo; Yao, Zhisheng; Zheng, Xunhua; Mei, Baoling; Xie, Baohua; Wang, Rui; Deng, Jia; Cui, Feng; Zhu, Jianguo


    The effects of ammonium-based, non-sulfate fertilizers, such as urea and/or ammonium phosphate (NH 4H 2PO 4), on methane (CH 4) emissions from paddy rice fields deserve attention, as they are being used increasingly for rice cultivation. A four-year field campaign was conducted in the Yangtze River Delta from 2004 to 2007 to assess the effects of different application rates of urea plus NH 4H 2PO 4 on the CH 4 emissions from a paddy rice field. The experimental field was under a typical Chinese water regime that follows a flooding-midseason drainage-reflooding-moist irrigation mode. Over the course of four years, the mean cumulative CH 4 emissions during the rice seasons were 221, 136 and 112 kg C ha -1 for nitrogen addition rates of 0, 150 and 250 kg N ha -1, respectively. Compared to the treatment without nitrogen amendments, the 150 kg N ha -1 decreased the CH 4 emissions by 6-59% ( P < 0.01 in one year, but not statistically significant in the others). When the addition rate was further increased to 250 kg N ha -1, the CH 4 emissions were significantly reduced by 35-53% ( P < 0.01) compared to the no-nitrogen treatment. Thus, an addition rate of 250 kg N ha -1, which has been commonly adopted in the delta region in the past two decades, can be regarded as an effective management measure as regards increasing rice yields while reducing CH 4 emissions. Considering that doses of ammonium-based, non-sulfate fertilizers higher than 250 kg N ha -1 currently are, and most likely will continue to be, commonly applied for paddy rice cultivation in the Yangtze River Delta and other parts of China, the inhibitory effects on CH 4 emissions from rice production are expected to be pronounced at the regional scale. However, further studies are required to provide more concrete evidence about this issue. Moreover, further research is needed to determine whether N management measures are also effective in view of net greenhouse gas fluxes (including CH 4, nitrous oxide, ammonia

  5. Temperature- and pH-dependent aqueous-phase kinetics of the reactions of glyoxal and methylglyoxal with atmospheric amines and ammonium sulfate

    NASA Astrophysics Data System (ADS)

    Sedehi, Nahzaneen; Takano, Hiromi; Blasic, Vanessa A.; Sullivan, Kristin A.; De Haan, David O.


    Reactions of glyoxal (Glx) and methylglyoxal (MG) with primary amines and ammonium salts may produce brown carbon and N-containing oligomers in aqueous aerosol. 1H NMR monitoring of reactant losses and product appearance in bulk aqueous reactions were used to derive rate constants and quantify competing reaction pathways as a function of pH and temperature. Glx + ammonium sulfate (AS) and amine reactions generate products containing C-N bonds, with rates depending directly on pH: rate = (70 ± 60) M-1 s-1fAld [Glx]totfAm [Am]tot, where fAld is the fraction of aldehyde with a dehydrated aldehyde functional group, and fAm is the fraction of amine or ammonia that is deprotonated at a given pH. MG + amine reactions generate mostly aldol condensation products and exhibit less pH dependence: rate = 10[(0.36 ± 0.06) × pH - (3.6 ± 0.3)] M-1 s-1fAld [MG]tot [Am]tot. Aldehyde + AS reactions are less temperature-dependent (Ea = 18 ± 8 kJ mol-1) than corresponding amine reactions (Ea = 50 ± 11 kJ mol-1). Using aerosol concentrations of [OH] = 10-12 M, [amine]tot = [AS] = 0.1 M, fGlx = 0.046 and fMG = 0.09, we estimate that OH radical reactions are normally the major aerosol-phase sink for both dicarbonyl compounds. However, reactions with AS and amines together can account for up to 12 and 45% of daytime aerosol-phase glyoxal and methylglyoxal reactivity, respectively, in marine aerosol at pH 5.5. Reactions with AS and amines become less important in acidic or non-marine aerosol, but may still be significant atmospheric sources of brown carbon, imidazoles, and nitrogen-containing oligomers.

  6. Extraction and separation of tungsten (VI) from aqueous media with Triton X-100-ammonium sulfate-water aqueous two-phase system without any extractant.


    Yongqiang Zhang; Tichang Sun; Tieqiang Lu; Chunhuan Yan


    An aqueous two-phase system composed of Triton X-100-(NH4)2SO4-H2O was proposed for extraction and separation of tungsten(VI) from aqueous solution without using any extractant. The effects of aqueous pH, concentration of ammonium sulfate, Triton X-100 and tungsten, extracting temperature on the extraction of tungsten were investigated. The extraction of tungsten has remarkable relationship with aqueous pH and are to above 90% at pH=1.0-3.0 under studied pH range (pH=1.0-7.0) and increases gradually with increasing Triton X-100 concentration, but decreases slightly with increasing ammonium sulfate concentration. The extraction percentage of tungsten is hardly relevant to temperature but its distribution coefficient linearly increases with increasing temperature within 303.15-343.15K. The distribution coefficient of tungsten increases with the increase of initial tungsten concentration (0.1-3%) and temperature (303.15 K-333.15K). The solubilization capacity of tungsten in Triton X-100 micellar phase is independent of temperature. FT-IR analysis reveals that there is no evident interaction between polytungstate anion and ether oxygen unit in Triton X-100, and DLS analysis indicates that zeta potential of Triton X-100 micellar phase have a little change from positive to negative after extracting tungsten. Based on the above-mentioned results, it can be deduced that polytungstate anions are solubilized in hydrophilic outer shell of Triton X-100 micelles by electrostatic attraction depending on its relatively high hydrophobic nature. The stripping of tungsten is mainly influenced by temperature and can be easily achieved to 95% in single stage stripping. The tungsten (VI) is separated out from solution containing Fe(III), Co(II), Ni(II), Cu(II), Zn(II), Al(III), Cr(III) and Mn(II) under the suitable conditions. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Effects of long-term exposure to ammonium sulfate particles on growth and gas exchange rates of Fagus crenata, Castanopsis sieboldii, Larix kaempferi and Cryptomeria japonica seedlings

    NASA Astrophysics Data System (ADS)

    Yamaguchi, Masahiro; Otani, Yoko; Li, Peiran; Nagao, Hiroshi; Lenggoro, I. Wuled; Ishida, Atsushi; Yazaki, Kenichi; Noguchi, Kyotaro; Nakaba, Satoshi; Yamane, Kenichi; Kuroda, Katsushi; Sano, Yuzou; Funada, Ryo; Izuta, Takeshi


    To clarify the effects of long-term exposure to ammonium sulfate (AS) particles on growth and physiological functions of forest tree species, seedlings of Fagus crenata, Castanopsis sieboldii, Larix kaempferi and Cryptomeria japonica were exposed to submicron-size AS particles during two growing seasons from 3 June 2011 to 8 October 2012. The mean sulfate concentration in PM2.5 increased during the exposure inside the chamber in 2011 and 2012 by 2.73 and 4.32 μg SO42- m-3, respectively. No significant effects of exposure to AS particles were detected on the whole-plant dry mass of the seedlings. These results indicate that the exposure to submicrometer AS particles at the ambient level for two growing seasons did not significantly affect the growth of the seedlings. No significant effects of exposure to AS particles were found on the net photosynthetic rate in the leaves or needles of F. crenata, C. sieboldii and L. kaempferi seedlings. Also, in the previous-year needles of C. japonica seedlings, exposure to AS particles significantly reduced the net photosynthetic rate, which may be caused by the reduction in the concentration of ribulose-1, 5-bisphosphate carboxylase/oxygenase (Rubisco). On the contrary, in current-year needles of C. japonica seedlings, net photosynthetic rate significantly increased with exposure to AS particles, which may be the result of increases in stomatal conductance and concentrations of Rubisco and chlorophyll. Furthermore, exposure to AS particles correlated with an increase in concentrations of NH4+, free amino acid and total soluble protein, suggesting that AS particles may be deliquesced, absorbed into the leaves and metabolized into amino acid and protein. These results suggest that net photosynthesis in the needles of C. japonica is relatively sensitive to submicron-size AS particles as compared with the other three tree species.

  8. Final report on the safety assessment of sodium cetearyl sulfate and related alkyl sulfates as used in cosmetics.


    Fiume, Monice; Bergfeld, Wilma F; Belsito, Donald V; Klaassen, Curtis D; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Alan Andersen, F


    Sodium cetearyl sulfate is the sodium salt of a mixture of cetyl and stearyl sulfate. The other ingredients in this safety assessment are also alkyl salts, including ammonium coco-sulfate, ammonium myristyl sulfate, magnesium coco-sulfate, sodium cetyl sulfate, sodium coco/hydrogenated tallow sulfate, sodium coco-sulfate, sodium decyl sulfate, sodium ethylhexyl sulfate, sodium myristyl sulfate, sodium oleyl sulfate, sodium stearyl sulfate, sodium tallow sulfate, sodium tridecyl sulfate, and zinc coco-sulfate. These ingredients are surfactants used at concentrations from 0.1% to 29%, primarily in soaps and shampoos. Many of these ingredients are not in current use. The Cosmetic Ingredient Review (CIR) Expert Panel previously completed a safety assessment of sodium and ammonium lauryl sulfate. The data available for sodium lauryl sulfate and ammonium lauryl sulfate provide sufficient basis for concluding that sodium cetearyl sulfate and related alkyl sulfates are safe in the practices of use and concentration described in the safety assessment.

  9. Development of an Ammonium Sulfate DNA Extraction Method for Obtaining Amplifiable DNA in a Small Number of Cells and Its Application to Clinical Specimens

    PubMed Central

    Oh, Seo Young; Kim, Wook Youn; Hwang, Tae Sook; Han, Hye Seung; Lim, So Dug; Kim, Wan Seop


    DNA extraction from microdissected cells has become essential for handling clinical specimens with advances in molecular pathology. Conventional methods have limitations for extracting amplifiable DNA from specimens containing a small number of cells. We developed an ammonium sulfate DNA extraction method (A) and compared it with two other methods (B and C). DNA quality and quantity, β-globin amplification, and detectability of two cancer associated gene mutations were evaluated. Method A showed the best DNA yield, particularly when the cell number was very low. Amplification of the β-globin gene using DNA from the SNU 790 cell line and papillary thyroid carcinoma (PTC) cells extracted with Method A demonstrated the strongest band. BRAF V600E mutation analysis using ethanol-fixed PTC cells from a patient demonstrated both a “T” peak increase and an adjacent “A” peak decrease when 25 and 50 cells were extracted, whereas mutant peaks were too low to be analyzed using the other two methods. EGFR mutation analysis using formalin-fixed paraffin-embedded lung cancer tissues demonstrated a mutant peak with Method A, whereas the mutant peak was undetectable with Methods B or C. Method A yielded the best DNA quantity and quality with outstanding efficiency, particularly when paucicellular specimens were used. PMID:23691506

  10. Determination of ultra-trace formaldehyde in air using ammonium sulfate as derivatization reagent and capillary electrophoresis coupled with on-line electrochemiluminescence detection.


    Deng, Biyang; Liu, Yang; Yin, Huihui; Ning, Xi; Lu, Hua; Ye, Li; Xu, Quanxiu


    The reaction between formaldehyde and ammonium ion to produce hexamethylenetetramine is well known. The reaction conditions are very easily controlled in situ and the experiment operation is very simple. However, such derivatization reaction for trace formaldehyde determination using capillary electrophoresis (CE) electrochemiluminescence (ECL) has not been reported before. In this study, the application of ammoniun sulfate as derivatization reagent to in-situ determination of formaldehyde in air was reported. Based on ECL enhancement of tris(2,2'-bipyridyl)ruthenium(II) with hexamethylenetetramine, a novel approach for the determination of ultra-trace formaldehyde in air using CE coupled with on-line ECL of tris(2,2'-bipyridyl)ruthenium(II) has been developed. The parameters affecting separation and detection such as detection potential, concentration and pH of phosphate buffer, and electrokinetic voltage, were investigated. Under the optimal conditions, the linear concentration range of formaldehyde in air was from 0.48 μg/m(3) to 96 mg/m(3) (linear range covering 5 orders of magnitude). The limit of detection (3σ) was 0.15 μg/m(3). The relative standard deviations of peak height and migration time for six consecutive injection of 1 ng/mL formaldehyde derivative were 0.9% and 0.8%, respectively. The recoveries of formaldehyde in air were between 99.3% and 101%. Copyright © 2012 Elsevier B.V. All rights reserved.

  11. Influence of the Salting-out Effect of Ammonium Sulfate on the Gas-Particle Partitioning of Organic Compounds in the Atmosphere

    NASA Astrophysics Data System (ADS)

    Wang, C.; Lei, Y. D.; Endo, S.; Wania, F.


    As one of the major salts in the atmosphere, ammonium sulfate ((NH4)2SO4) influences significantly the partitioning of organic compounds into atmospheric aqueous phases. This salting out effect has important implications regarding the reactivity, transport and fate of organic compounds in atmospheric waters, particularly in aerosol particles because of the relatively large amount of salts present. However, very few studies have quantified the salting out effect of (NH4)2SO4. For the first time, we measured salting-out coefficients (or Setschenow constants) (KS [M-1]) for a large and diverse group of organic compounds in (NH4)2SO4 solutions at a wide range of salt concentrations, providing a reliable database for model development. KS values for (NH4)2SO4 are correlated with and always higher than KS for sodium chloride (NaCl), suggesting a higher salting-out effect of (NH4)2SO4. Three modeling approaches: a poly-parameter linear free energy relationship (pp-LFER), the quantum-chemical COSMOtherm software and the group contribution method AIMOFAC, were calibrated and evaluated in terms of their capability to predict KS. Relative merits of the prediction methods were identified. These models can be applied to estimate Setschenow constants for atmospherically relevant compounds involved in secondary organic aerosol formation based on chemical structure alone.

  12. A study on the use of caprylic acid and ammonium sulfate in combination for the fractionation of equine antivenom F(ab')(2).


    Simsiriwong, Pavinee; Eursakun, Sukanya; Ratanabanangkoon, Kavi


    This study involved the fractionation of equine antivenom F(ab')(2) by combined stepwise ammonium sulfate (AS) and caprylic acid (CA) precipitation without intermediate separation of precipitate. Using a microplate format, 55 conditions with combinations of AS (0-20% saturation) and CA (0-5% v/v), were tested. AS significantly reduced the turbidity raised by CA. High specific antibody activity was observed in the area containing 2-5% CA and 10-20% AS. From these results, 12 precipitation conditions were selected for detailed quantitative studies. Two combinations, one with 4% CA and 15% AS and another with 5% CA and 20% AS, gave the highest fold-purification (1.79 and 1.83) with antibody recoveries at 68% and 59%, respectively. These combinations offered a benefit over CA alone in reducing the turbidity and in increasing the purity but not the recovery of antibody. The conditions giving more favorable overall results were with 2% CA alone and another with a combination of 1.5% CA and 10% AS. These preparations of F(ab')(2) were homogeneous and without protein aggregate under size-exclusion HPLC. Lastly, 1 h precipitation showed better results than those of overnight precipitation. These results could be useful for the production of therapeutic antivenoms.

  13. Development of an ammonium sulfate DNA extraction method for obtaining amplifiable DNA in a small number of cells and its application to clinical specimens.


    Oh, Seo Young; Kim, Wook Youn; Hwang, Tae Sook; Han, Hye Seung; Lim, So Dug; Kim, Wan Seop


    DNA extraction from microdissected cells has become essential for handling clinical specimens with advances in molecular pathology. Conventional methods have limitations for extracting amplifiable DNA from specimens containing a small number of cells. We developed an ammonium sulfate DNA extraction method (A) and compared it with two other methods (B and C). DNA quality and quantity, β-globin amplification, and detectability of two cancer associated gene mutations were evaluated. Method A showed the best DNA yield, particularly when the cell number was very low. Amplification of the β-globin gene using DNA from the SNU 790 cell line and papillary thyroid carcinoma (PTC) cells extracted with Method A demonstrated the strongest band. BRAF(V600E) mutation analysis using ethanol-fixed PTC cells from a patient demonstrated both a "T" peak increase and an adjacent "A" peak decrease when 25 and 50 cells were extracted, whereas mutant peaks were too low to be analyzed using the other two methods. EGFR mutation analysis using formalin-fixed paraffin-embedded lung cancer tissues demonstrated a mutant peak with Method A, whereas the mutant peak was undetectable with Methods B or C. Method A yielded the best DNA quantity and quality with outstanding efficiency, particularly when paucicellular specimens were used.

  14. 21 CFR 184.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2011 CFR


    ...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...

  15. 21 CFR 184.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2012 CFR


    ...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...

  16. 21 CFR 184.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2013 CFR


    ...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...

  17. 21 CFR 184.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2010 CFR


    ...). It is prepared by the sublimation of a mixture of ammonium sulfate and calcium carbonate and occurs... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium carbonate. 184.1137 Section 184.1137 Food... Specific Substances Affirmed as GRAS § 184.1137 Ammonium carbonate. (a) Ammonium carbonate ((NH4)2CO3, CAS...

  18. Online and offline mass spectrometric study of the impact of oxidation and ageing on glyoxal chemistry and uptake onto ammonium sulfate aerosols.


    Hamilton, Jacqueline F; Baeza-Romero, M Teresa; Finessi, Emanuela; Rickard, Andrew R; Healy, Robert M; Peppe, Salvatore; Adams, Thomas J; Daniels, Mark J S; Ball, Stephen M; Goodall, Iain C A; Monks, Paul S; Borrás, Esther; Muñoz, Amalia


    Recent laboratory and modelling studies have shown that reactive uptake of low molecular weight alpha-dicarbonyls such as glyoxal (GLY) by aerosols is a potentially significant source of secondary organic aerosol (SOA). However, previous studies disagree in the magnitude of the uptake of GLY, the mechanism involved and the physicochemical factors affecting particle formation. In this study, the chemistry of GLY with ammonium sulfate (AS) in both bulk laboratory solutions and in aerosol particles is investigated. For the first time, Aerosol Time of Flight Mass Spectrometry (ATOFMS), a single particle technique, is used together with offline (ESI-MS and LC-MS2) mass spectrometric techniques to investigate the change in composition of bulk solutions of GLY and AS resulting from aqueous photooxidation by OH and from ageing of the solutions in the dark. The mass spectral ions obtained in these laboratory studies were used as tracers of GLY uptake and chemistry in AS seed particles in a series of experiments carried out under dark and natural irradiated conditions at the outdoor European Photo-reactor (EUPHORE). Glyoxal oligomers formed were not detected by the ATOFMS, perhaps due to inefficient absorption at the laser wavelength. However, the presence of organic nitrogen compounds, formed by reaction of GLY with ammonia was confirmed, resulting in an increase in the absorption efficiency of the aerosol, and this increased the number of particles successfully ionised by the ATOFMS. A number of light absorbing organic nitrogen species, including 1H-imidazole, 1H-imidazole-2-carboxaldehyde, 2,2'-bis-imidazole and a glyoxal substituted 2,2'-bisimidazole, previously identified in aqueous laboratory solutions, were also identified in chamber aerosol and formed on atmospherically relevant timescales. An additional compound, predicted to be 1,2,5-oxadiazole, had an enhanced formation rate when the chamber was open and is predicted to be formed via a light activated pathway


    EPA Science Inventory

    Ammonium-nitrogen fertilizers are used in large quantities in agricultural areas of the United States, including the grass-seed fields of the Willamette Valley of western Oregon, and are a potential threat to larval amphibians living in the treat areas (Edwards and Daniel 1994, M...


    EPA Science Inventory

    Ammonium-nitrogen fertilizers are used in large quantities in agricultural areas of the United States, including the grass-seed fields of the Willamette Valley of western Oregon, and are a potential threat to larval amphibians living in the treat areas (Edwards and Daniel 1994, M...

  1. Crystal and molecular structure of ammonium beryllium sulfate dihydrate, (NH4)2Be(SO4)2·2H2O

    NASA Astrophysics Data System (ADS)

    Wildner, M.; Karadjova, V.; Marinova, D.; Georgiev, M.; Stoilova, D.


    In this paper we report the crystal and molecular structure of the title compound, (NH4)2Be(SO4)2·2H2O, as determined by single-crystal X-ray diffraction and vibrational spectroscopy data. (NH4)2Be(SO4)2·2H2O crystallizes in the monoclinic space group P21/c (a = 11.448(2), b = 11.876(2), c = 7.439(1) Å, β = 96.64(1)°, V = 1004.6 Å3, Z = 4, R1 = 0.036 for 3753 Fo > 4σ(Fo) and 185 variables), and is isotypic with the respective potassium and rubidium sulfates and the potassium selenate. The crystal structure is built from three-membered tetrahedral chain fragments, consisting of a central BeO2(H2O)2 group and two adjacent SO4 tetrahedra. These building blocks are linked by rather strong hydrogen bonds of the water molecules (O⋯O = 2.66-2.77 Å) and by moderate to weak hydrogen bonds of the NH4 groups (N⋯O ≥ 2.78 Å) to a three-dimensional framework structure. The infrared bands corresponding to the stretching modes ν3 and ν1 as well as the Raman band corresponding to ν1 of the SO42- ions are observed in the spectra as doublets, thus reflecting the existence of two crystallographically different sulfate ions. The spectroscopic experiments reveal that the sulfate tetrahedra exhibit a remarkably large extent of energetic distortion as deduced from the values of Δν3 (site group splitting) and Δνmax (the difference between the highest and the lowest wavenumbered component of the stretching modes) (111 and 183.5 cm-1, respectively), which could not be predicted from the structural data. The comparison of the spectral region widths of the stretching and bending modes of the SO42- ions allows us to assume that these ions undergo a stronger energetic distortion with respect to the Ssbnd O bond lengths than that with respect to the Osbnd Ssbnd O bond angles. The water librations couple intensively with both the translatory modes of the Be2+ cations (BeO4 skeleton vibrations) and the normal modes of the sulfate ions, thus producing small isotopic

  2. [Characteristics of the precipitation of the antigenic structures of the tick-borne encephalitis virus using polyethylene glycol and ammonium sulfate].


    Liapustin, V N; Gritsun, T S; Lashkevich, V A


    When immunoelectrophoretic methods were used for analysis of tick-borne encephalitis (TBE) virus antigens, TBE virus virion antigen (VA) from the virus-containing tissue culture fluid sedimented upon addition of polyethylene glycol (PEG) up to 7% whereas upon addition of ammonium sulphate (AS) the bulk of VA sedimented in the range of 40-70% salt saturation. The non-virion antigens (NA) sedimented at all PEG (up to 22%) and AS (up to 70% saturation) concentrations. In stringent ultracentrifugation procedure (12-13 X 10(6) g X min), the bulk of VA and a small portion of NA are pelleted. Repeated ultracentrifugation results in sedimentation of additional amounts of VA and NA. The sedimentable NA are pelleted by low PEG (up to 5-7%) and AS (up to 20-30%) concentrations and differ in their interaction with antibodies in the course of immunoelectrophoresis from nonprecipitatable ("soluble") NA. Combined sedimentation of antigens with AS (in the range of 40-70% saturation), intensive dialysis and subsequent sedimentation with low and high PEG concentrations produces homogeneous antigenic preparations containing VA or "soluble" NA.

  3. Ammonium sulfamate

    Integrated Risk Information System (IRIS)

    Ammonium sulfamate ; CASRN 7773 - 06 - 0 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogen

  4. Ammonium methacrylate

    Integrated Risk Information System (IRIS)

    Ammonium methacrylate ; CASRN 16325 - 47 - 6 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcin

  5. Ammonium acetate

    Integrated Risk Information System (IRIS)

    Ammonium acetate ; CASRN 631 - 61 - 8 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic

  6. Glucosamine sulfate


    ... Glucosamine Sulphate KCl, Glucosamine-6-Phosphate, GS, Mono-Sulfated Saccharide, Poly-(1->3)-N-Acetyl-2-Amino- ... Sulfate de Glucosamine, Sulfate de Glucosamine 2KCl, SG, Sulfated Monosaccharide, Sulfated Saccharide, Sulfato de Glucosamina. Glucosamine Hydrochloride ...

  7. Modeling dry and wet deposition of sulfate, nitrate, and ammonium ions in Jiuzhaigou National Nature Reserve, China using a source-oriented CMAQ model: Part II. Emission sector and source region contributions.


    Qiao, Xue; Tang, Ya; Kota, Sri Harsha; Li, Jingyi; Wu, Li; Hu, Jianlin; Zhang, Hongliang; Ying, Qi


    A source-oriented Community Multiscale Air Quality (CMAQ) model driven by the meteorological fields generated by the Weather Research and Forecasting (WRF) model was used to study the dry and wet deposition of nitrate (NO3(-)), sulfate (SO4(2-)), and ammonium (NH4(+)) ions in the Jiuzhaigou National Nature Reserve (JNNR), China from June to August 2010 and to identify the contributions of different emission sectors and source regions that were responsible for the deposition fluxes. Contributions from power plants, industry, transportation, domestic, biogenic, windblown dust, open burning, fertilizer, and manure management sources to deposition fluxes in JNNR watershed and four EANET sites are determined. In JNNR, 96%, 82%, and 87% of the SO4(2-), NO3(-) and NH4(+) deposition fluxes are in the form of wet deposition of the corresponding aerosol species. Industry and power plants are the two major sources of SO4(2-) deposition flux, accounting for 86% of the total wet deposition of SO4(2-), and industry has a higher contribution (56%) than that of power plants (30%). Power plants and industry are also the top sources that are responsible for NO3(-) wet deposition, and contributions from power plants (30%) are generally higher than those from industries (21%). The major sources of NH4(+) wet deposition flux in JNNR are fertilizer (48%) and manure management (39%). Source-region apportionment confirms that SO2 and NOx emissions from local and two nearest counties do not have a significant impact on predicted wet deposition fluxes in JNNR, with contributions less than 10%. While local NH3 emissions account for a higher fraction of the NH4(+) deposition, approximately 70% of NH4(+) wet deposition in JNNR originated from other source regions. This study demonstrates that S and N deposition in JNNR is mostly from long-range transport rather than from local emissions, and to protect JNNR, regional emission reduction controls are needed.

  8. An Inhibitor of the δPKC Interaction with the d Subunit of F1Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique

    PubMed Central

    Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.


    We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451

  9. An inhibitor of the δPKC interaction with the d subunit of F1Fo ATP synthase reduces cardiac troponin I release from ischemic rat hearts: utility of a novel ammonium sulfate precipitation technique.


    Ogbi, Mourad; Obi, Ijeoma; Johnson, John A


    We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n=5) percentage of maximal cTnI release was 30 ± 7 and 60 ± 17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60-150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts.

  10. Solubilities of carbon dioxide and oxygen in the ionic liquids methyl trioctyl ammonium bis(trifluoromethylsulfonyl)imide, 1-butyl-3-methyl imidazolium bis(trifluoromethylsulfonyl)imide, and 1-butyl-3-methyl imidazolium methyl sulfate.


    Bahadur, Indra; Osman, Khalid; Coquelet, Christophe; Naidoo, Paramespri; Ramjugernath, Deresh


    Ionic liquids (ILs) are being considered as solvents for gas absorption processes as they have the potential, in general, for improved efficiency of gas separations, as well as lower capital and operating costs compared to current commercial processes. In this study the solvent properties of ILs are investigated for use in the absorption of carbon dioxide (CO2) and oxygen (O2). The absorption of these gases in ILs was measured in the temperature range 303.15-333.15 K and at pressures up to 1.5 MPa by gravimetric analysis. The ILs used were methyl trioctyl ammonium bis (trifluoromethylsulfonyl) imide ([MOA][Tf2N]), 1-butyl-3-methyl imidazolium bis (trifluoromethylsulfonyl) imide ([BMIM][Tf2N]), and 1-butyl-3-methyl imidazolium methyl sulfate ([BMIM][MeSO4]). The measurement technique employed in this study is fast and accurate, and requires small quantities of solvent. The results indicated that absorption of both gases increased with a decrease in operating temperature and an increase in pressure. [MOA][Tf2N] had the highest CO2 and O2 solubility. [BMIM][Tf2N] was determined to have the highest selectivity for CO2 absorption. [BMIM][MeSO4] achieved the lowest CO2 absorption with a moderate O2 absorption, revealing this IL to be the least desirable for CO2 and O2 absorption. Calculation of Henry's law constants for all systems confirmed the deductions made from absorption data analysis. Calculation of enthalpy and entropy of absorption for each system revealed CO2 absorption in [MOA][Tf2N] to be the least sensitive to temperature increases. The absorption data was modeled using the generic Redlich-Kwong cubic equation of state (RK-EOS) coupled with a group contribution method.

  11. Modeling dry and wet deposition of sulfate, nitrate, and ammonium ions in Jiuzhaigou National Nature Reserve, China using a source-oriented CMAQ model: Part I. Base case model results.


    Qiao, Xue; Tang, Ya; Hu, Jianlin; Zhang, Shuai; Li, Jingyi; Kota, Sri Harsha; Wu, Li; Gao, Huilin; Zhang, Hongliang; Ying, Qi


    A source-oriented Community Multiscale Air Quality (CMAQ) model driven by the meteorological fields generated by the Weather Research and Forecasting (WRF) model was used to study the dry and wet deposition of nitrate (NO3(-)), sulfate (SO4(2-)), and ammonium (NH4(+)) ions in the Jiuzhaigou National Nature Reserve (JNNR), China from June to August 2010 and to identify the contributions of different emission sectors and source regions that were responsible for the deposition fluxes. The model performance is evaluated in this paper and the source contribution analyses are presented in a companion paper. The results show that WRF is capable of reproducing the observed precipitation rates with a Mean Normalized Gross Error (MNGE) of 8.1%. Predicted wet deposition fluxes of SO4(2-) and NO3(-) at the Long Lake (LL) site (3100 m a.s.l.) during the three-month episode are 2.75 and 0.34 kg S(N) ha(-1), which agree well with the observed wet deposition fluxes of 2.42 and 0.39 kg S(N) ha(-1), respectively. Temporal variations in the weekly deposition fluxes at LL are also well predicted. Wet deposition flux of NH4(+) at LL is over-predicted by approximately a factor of 3 (1.60 kg N ha(-1)vs. 0.56 kg N ha(-1)), likely due to missing alkaline earth cations such as Ca(2+) in the current CMAQ simulations. Predicted wet deposition fluxes are also in general agreement with observations at four Acid Deposition Monitoring Network in East Asia (EANET) sites in western China. Predicted dry deposition fluxes of SO4(2-) (including gas deposition of SO2) and NO3(-) (including gas deposition of HNO3) are 0.12 and 0.12 kg S(N) h a(-1) at LL and 0.07 and 0.08 kg S(N) ha(-1) at Jiuzhaigou Bureau (JB) in JNNR, respectively, which are much lower than the corresponding wet deposition fluxes. Dry deposition flux of NH4(+) (including gas deposition of NH3) is 0.21 kg N ha(-1) at LL, and is also much lower than the predicted wet deposition flux. For both dry and wet deposition fluxes, predictions

  12. Electricity production coupled to ammonium in a microbial fuel cell.


    He, Zhen; Kan, Jinjun; Wang, Yanbing; Huang, Yuelong; Mansfeld, Florian; Nealson, Kenneth H


    The production of electricity from ammonium was examined using a rotating-cathode microbial fuel cell (MFC). The addition of ammonium chloride, ammonium sulfate, or ammonium phosphate (monobasic) resulted in electricity generation, while adding sodium chloride, nitrate, or nitrite did not cause any increase in current production. The peak current increased with increasing amount of ammonium addition up to 62.3 mM of ammonium chloride, suggesting that ammonium was involved in electricity generation either directly as the anodic fuel or indirectly as substrates for nitrifiers to produce organic compounds for heterotrophs. Adding nitrate or nitrite with ammonium increased current production compared to solely ammonium addition. Using 16S rRNA-linked molecular analyses, we found ammonium-oxidizing bacteria and denitrifying bacteria on both the anode and cathode electrodes, whereas no anammox bacteria were detected. The dominant ammonium-oxidizing bacteria were closely related to Nitrosomonas europaea. The present MFC achieved an ammonium removal efficiency of 49.2 +/- 5.9 or 69.7 +/- 3.6%, depending on hydraulic retention time, but exhibited a very low Coulombic efficiency.

  13. Insensitive Ammonium Nitrate.

    DTIC Science & Technology

    is reduced by replacing the ammonium nitrate with a solid solution of potassium nitrate in form III ammonium nitrate wherein the potassium nitrate...constitutes from more than zero to less than 50 weight percent of the solid solution . (Author)

  14. Chondroitin sulfate


    ... Kashin-Beck disease, and itchy and scaly skin (psoriasis). Chondroitin sulfate is also used in a complex ... or recurrent heart attack. Skin redness and irritation (psoriasis). Early research suggests that taking chondroitin sulfate for ...

  15. Effective Synthesis of Sulfate Metabolites of Chlorinated Phenols

    PubMed Central

    Lehmler, Hans-Joachim; He, Xianran; Li, Xueshu; Duffel, Michael W.; Parkin, Sean


    Chlorophenols are an important class of persistent environmental contaminants and have been implicated in a range of adverse health effects, including cancer. They are readily conjugated and excreted as the corresponding glucuronides and sulfates in the urine of humans and other species. Here we report the synthesis and characterization of a series of ten chlorophenol sulfates by sulfation of the corresponding chlorophenols with 2,2,2-trichloroethyl (TCE) chlorosulfate using N,N-dimethylaminopyridine (DMAP) as base. Deprotection of the chlorophenol diesters with zinc powder/ammonium formate yielded the respective chlorophenol sulfate ammonium salts in good yield. The molecular structure of three TCE-protected chlorophenol sulfate diesters and one chlorophenol sulfate monoester were confirmed by X-ray crystal structure analysis. The chlorophenol sulfates were stable for several months if stored at −20 °C and, thus, are useful for future toxicological, environmental and human biomonitoring studies. PMID:23906814

  16. Effective synthesis of sulfate metabolites of chlorinated phenols.


    Lehmler, Hans-Joachim; He, Xianran; Li, Xueshu; Duffel, Michael W; Parkin, Sean


    Chlorophenols are an important class of persistent environmental contaminants and have been implicated in a range of adverse health effects, including cancer. They are readily conjugated and excreted as the corresponding glucuronides and sulfates in the urine of humans and other species. Here we report the synthesis and characterization of a series of ten chlorophenol sulfates by sulfation of the corresponding chlorophenols with 2,2,2-trichloroethyl (TCE) chlorosulfate using N,N-dimethylaminopyridine (DMAP) as base. Deprotection of the chlorophenol diesters with zinc powder/ammonium formate yielded the respective chlorophenol sulfate ammonium salts in good yield. The molecular structure of three TCE-protected chlorophenol sulfate diesters and one chlorophenol sulfate monoester were confirmed by X-ray crystal structure analysis. The chlorophenol sulfates were stable for several months if stored at -20 °C and, thus, are useful for future toxicological, environmental and human biomonitoring studies. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. Crystallization of Chicken Egg White Lysozyme from Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth; Pusey, Marc


    It has been "known" that chicken egg white lysozyme does not crystallize from sulfate, particularly ammonium sulfate, salts, but instead gives amorphous precipitates. This has been the basis of several studies using lysozyme comparing macromolecule crystal nucleation and amorphous precipitation. Recently Ries-Kautt et al (Acta Cryst D50, (1994) 366) have shown that purified isoionic CEWL could be crystallized from low concentrations of sulfate at basic pH, and we subsequently showed that in fact CEWL could be purified in both the tetragonal and orthorhombic forms using ammonium sulfate over the pH range 4.0 to 7.8 (Acta Cryst D53, (1997) 795). We have now extended these observations to include a range of common sulfate salts, specifically sodium, potassium, rubidium, magnesium, and manganese sulfates. In all cases but the manganese sulfates both the familiar tetragonal and orthorhombic forms were obtained, with unit cell dimensions close to those known for the "classic" sodium chloride crystallized forms. Manganese sulfate has only yielded orthorhombic crystals to date. All crystallizations were carried out using low (typically less than or equal to 6 M) salt and high (greater than approximately 90 mg/ml) protein concentrations. As with ammonium sulfate, the tetragonal - orthorhombic phase shift appears to be a function of both the temperature and the protein concentration, with higher temperatures and concentrations favoring the orthorhombic and lower the tetragonal form. The phase change range is somewhat reduced for the sulfate salts, depending upon conditions being typically between approximately 15 - 20 C. Both the magnesium and manganese sulfates gave crystals at salt concentrations over 0.6 M as well, with magnesium sulfate giving a very slowly nucleating and growing hexagonal form. A triclinic crystal form, characterized by aggressively small crystals (typically 0.1 mm in size) has been occasionally obtained from ammonium sulfate. Finally, preliminary spot

  18. Crystallization of Chicken Egg White Lysozyme from Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth; Pusey, Marc


    It has been "known" that chicken egg white lysozyme does not crystallize from sulfate, particularly ammonium sulfate, salts, but instead gives amorphous precipitates. This has been the basis of several studies using lysozyme comparing macromolecule crystal nucleation and amorphous precipitation. Recently Ries-Kautt et al (Acta Cryst D50, (1994) 366) have shown that purified isoionic CEWL could be crystallized from low concentrations of sulfate at basic pH, and we subsequently showed that in fact CEWL could be purified in both the tetragonal and orthorhombic forms using ammonium sulfate over the pH range 4.0 to 7.8 (Acta Cryst D53, (1997) 795). We have now extended these observations to include a range of common sulfate salts, specifically sodium, potassium, rubidium, magnesium, and manganese sulfates. In all cases but the manganese sulfates both the familiar tetragonal and orthorhombic forms were obtained, with unit cell dimensions close to those known for the "classic" sodium chloride crystallized forms. Manganese sulfate has only yielded orthorhombic crystals to date. All crystallizations were carried out using low (typically less than or equal to 6 M) salt and high (greater than approximately 90 mg/ml) protein concentrations. As with ammonium sulfate, the tetragonal - orthorhombic phase shift appears to be a function of both the temperature and the protein concentration, with higher temperatures and concentrations favoring the orthorhombic and lower the tetragonal form. The phase change range is somewhat reduced for the sulfate salts, depending upon conditions being typically between approximately 15 - 20 C. Both the magnesium and manganese sulfates gave crystals at salt concentrations over 0.6 M as well, with magnesium sulfate giving a very slowly nucleating and growing hexagonal form. A triclinic crystal form, characterized by aggressively small crystals (typically 0.1 mm in size) has been occasionally obtained from ammonium sulfate. Finally, preliminary spot

  19. Ammonium nitrate explosive systems


    Stinecipher, Mary M.; Coburn, Michael D.


    Novel explosives which comprise mixtures of ammonium nitrate and an ammonium salt of a nitroazole in desired ratios are disclosed. A preferred nitroazole is 3,5-dinitro-1,2,4-triazole. The explosive and physical properties of these explosives may readily be varied by the addition of other explosives and oxidizers. Certain of these mixtures have been found to act as ideal explosives.

  20. Effects of Ammonium and Non-Ammonium Salt Additions on Methane Oxidation by Methylosinus trichosporium OB3b and Maine Forest Soils.


    King, G M; Schnell, S


    Additions of ammonium and non-ammonium salts inhibit atmospheric methane consumption by soil at salt concentrations that do not significantly affect the soil water potential. The response of soils to non-ammonium salts has previously raised questions about the mechanism of ammonium inhibition. Results presented here show that inhibition of methane consumption by non-ammonium salts can be explained in part by ion-exchange reactions: cations desorb ammonium, with the level of desorption varying as a function of both the cation and anion added; differential desorption results in differential inhibition levels. Differences in the extent of inhibition among ammonium salts can also be explained in part by the effects of anions on ammonium exchange. In contrast, only minimal effects of cations and anions are observed in liquid cultures of Methylosinus trichosporium OB3b. The comparable level of inhibition by equinormal concentrations of NH(4)Cl and (NH(4))(2)SO(4) and the insensitivity of salt inhibition to increasing methane concentrations (from 10 to 100 ppm) are of particular interest, since both of these patterns are in contrast to results for soils. The greater inhibition of methane consumption for NH(4)Cl than (NH(4))(2)SO(4) in soils can be attributed to increased ammonium adsorption by sulfate; increasing inhibition by non-ammonium salts with increasing methane concentrations can be attributed to desorbed ammonium and a physiological mechanism proposed previously for pure cultures.

  1. Effects of Ammonium and Non-Ammonium Salt Additions on Methane Oxidation by Methylosinus trichosporium OB3b and Maine Forest Soils†

    PubMed Central

    King, G. M.; Schnell, S.


    Additions of ammonium and non-ammonium salts inhibit atmospheric methane consumption by soil at salt concentrations that do not significantly affect the soil water potential. The response of soils to non-ammonium salts has previously raised questions about the mechanism of ammonium inhibition. Results presented here show that inhibition of methane consumption by non-ammonium salts can be explained in part by ion-exchange reactions: cations desorb ammonium, with the level of desorption varying as a function of both the cation and anion added; differential desorption results in differential inhibition levels. Differences in the extent of inhibition among ammonium salts can also be explained in part by the effects of anions on ammonium exchange. In contrast, only minimal effects of cations and anions are observed in liquid cultures of Methylosinus trichosporium OB3b. The comparable level of inhibition by equinormal concentrations of NH4Cl and (NH4)2SO4 and the insensitivity of salt inhibition to increasing methane concentrations (from 10 to 100 ppm) are of particular interest, since both of these patterns are in contrast to results for soils. The greater inhibition of methane consumption for NH4Cl than (NH4)2SO4 in soils can be attributed to increased ammonium adsorption by sulfate; increasing inhibition by non-ammonium salts with increasing methane concentrations can be attributed to desorbed ammonium and a physiological mechanism proposed previously for pure cultures. PMID:16349485

  2. Size-dependent reactions of ammonium bisulfate clusters with dimethylamine.


    Bzdek, Bryan R; Ridge, Douglas P; Johnston, Murray V


    The reaction kinetics of ammonium bisulfate clusters with dimethylamine (DMA) gas were investigated using Fourier transform ion cyclotron resonance mass spectrometry (FTICR-MS). Clusters ranged in size from 1 to 10 bisulfate ions. Although displacement of the first several ammonium ions by DMA occurred with near unit efficiency, displacement of the final ammonium ion was cluster size dependent. For small clusters, all ammonium ions are exposed to incoming DMA molecules, allowing for facile exchange ("surface" exchange). However, with increasing cluster size, an ammonium ion can be trapped in an inaccessible region of the cluster ("core" exchange), thereby rendering exchange difficult. DMA was also observed to add onto existing dimethylaminium bisulfate clusters above a critical size, whereas ammonia did not add onto ammonium bisulfate clusters. The results suggest that as the cluster size increases, di-dimethylaminium sulfate formation becomes more favorable. The results of this study give further evidence to suggest that ambient sub-3 nm diameter particles are likely to contain aminium salts rather than ammonium salts.

  3. Diethyl sulfate

    Integrated Risk Information System (IRIS)

    Diethyl sulfate ; CASRN 64 - 67 - 5 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic Ef

  4. Dimethyl sulfate

    Integrated Risk Information System (IRIS)

    Dimethyl sulfate ; CASRN 77 - 78 - 1 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic E


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    70. INTERIOR VIEW OF AMMONIUM NITRATE HOUSE, LOOKING AT AMMONIUM NITRATE IN STORAGE. APRIL 18, 1919. - United States Nitrate Plant No. 2, Reservation Road, Muscle Shoals, Muscle Shoals, Colbert County, AL

  6. Acute ammonium dichromate poisoning.


    Meert, K L; Ellis, J; Aronow, R; Perrin, E


    We report the ingestion of ammonium dichromate by a child that resulted in multiple-organ-system failure and death. Exchange transfusion and hemodialysis were ineffective in removing significant amounts of chromium or causing sustained clinical improvement. We suggest that immediate, large doses of the reducing agent ascorbic acid would allow effective reduction of hexavalent chromium with less cellular toxicity.

  7. Relative toxicity of inhaled metal sulfate salts for pulmonary macrophages

    SciTech Connect

    Skornik, W.A.; Brain, J.D.


    The effects of metal sulfate aerosols on respiratory defense mechanisms in hamsters were studied. Pulmonary macrophage phagocytic rates were measured by determining the in vivo uptake of radioactive colloidal gold (/sup 198/Au) 1, 24, or 48 h after a single 4-h exposure. The concentrations of sulfate aerosols causing a 50% inhibition in pulmonary macrophage endocytosis (EC/sub 50/) were determined. When hamsters were exposed for 4 h to cupric sulfate (greater than or equal to 4.8 mg/m/sup 3/), zinc sulfate (greater than or equal to 3.1 mg/m/sup 3/), ferric sulfate (greater than or equal to 7.8 mg/m/sup 3/), or zinc ammonium sulfate (greater than or equal to 10.0 mg/m/sup 3/), macrophage endocytosis was significantly reduced 1 h after exposure compared with that in unexposed control animals. Although the response was variable, 24 h after exposures to the higher sulfate concentrations the percent of gold ingested by pulmonary macrophages remained depressed. By 48 h, the rate of macrophage endocytosis in hamsters had returned to normal control values except in hamsters exposed to 4.8 mg/m/sup 3/ cupric sulfate or 9.8 mg/m/sup 3/ ferric sulfate. These hamsters showed significant increases in phagocytosis. The EC/sub 50/ values in milligrams of sulfate per cubic meter for cupric sulfate, zinc sulfate, ferric sulfate, and zinc ammonium sulfate were 2.7, 4.5, 7.5, and 17.9, respectively. These results are negatively correlated with the ranking of sulfates using the criteria of relative irritant potency, as measured by increases in pulmonary flow resistance. Thus, rankings of related chemical structures are not absolute. Their relative toxicities vary depending on the end point selected.

  8. Relative toxicity of inhaled metal sulfate salts for pulmonary macrophages.


    Skornik, W A; Brain, J D


    The effects of metal sulfate aerosols on respiratory defense mechanisms in hamsters were studied. Pulmonary macrophage phagocytic rates were measured by determining the in vivo uptake of radioactive colloidal gold (198Au) 1, 24, or 48 h after a single 4-h exposure. The concentrations of sulfate aerosols causing a 50% inhibition in pulmonary macrophage endocytosis (EC50) were determined. When hamsters were exposed for 4 h to cupric sulfate (greater than or equal to 4.8 mg/m3), zinc sulfate (greater than or equal to 3.1 mg/m3), ferric sulfate (greater than or equal to 7.8 mg/m3), or zinc ammonium sulfate (greater than or equal to 10.0 mg/m3), macrophage endocytosis was significantly reduced 1 h after exposure compared with that in unexposed control animals. Although the response was variable, 24 h after exposures to the higher sulfate concentrations the percent of gold ingested by pulmonary macrophages remained depressed. By 48 h, the rate of macrophage endocytosis in hamsters had returned to normal control values except in hamsters exposed to 4.8 mg/m3 cupric sulfate or 9.8 mg/m3 ferric sulfate. These hamsters showed significant increases in phagocytosis. The EC50 values in milligrams of sulfate per cubic meter for cupric sulfate, zinc sulfate, ferric sulfate, and zinc ammonium sulfate were 2.7, 4.5, 7.5, and 17.9, respectively. These results are negatively correlated with the ranking of sulfates using the criteria of relative irritant potency, as measured by increases in pulmonary flow resistance. Thus, rankings of related chemical structures are not absolute. Their relative toxicities vary depending on the end point selected.

  9. Comparative study of various methods used for determining health effects of inhaled sulfates

    SciTech Connect

    Drummond, J.G.; Aranyi, C.; Schiff, L.J.; Fenters, J.D.; Graham, J.A.


    Various health-effect parameters were compared to determine which tests were the most-sensitive indicators of toxic effects of exposure to metallic sulfate aerosols. Inhalation studies were conducted involving either single 3-hr exposure to various concentrations of cupric sulfate (o.43-2.64 mg/m/sup 3/ SO/sub 4/), and aluminum ammonium sulfate (1.47-3.81 mg/m/sup 3/ SO/sub 4/) or multiple (five and ten) daily 3-hr exposures to cupric sulfate (0.1 mg/m/sup 3/ SO/sub 4/). Cupric sulfate was the most toxic of the three sulfates, but the differences between the toxicity of the aluminum sulfate and aluminum ammonium sulfate were less clear.

  10. The toxicity of ammonia/ammonium to the vermifiltration wastewater treatment process.


    Hughes, R J; Nair, J; Ho, G


    This study was undertaken to assess the toxicity of ammonia/ammonium to key species within the vermifiltration process. The key species, the earthworm Eisenia fetida, was subjected to a series of tests in solid phase mesocosms and full-scale units. The solid phase tests showed a relatively low toxicity to ammonium with ammonium chloride having an LC50 for ammonium of 1.49 g/kg. Ammonium sulfate did not show an effect on mortality at 2 g/kg ammonium. The full-scale units showed that ammonia hydroxide can change the pH and concentration of ammonia in wastewater and while it caused some mortality to the worms its overall affect on system functioning was minimal with no significant difference in terms of worm survival found between treatments. The affect on nitrifying bacteria was also minimal with no linear trend shown with ammonia concentration.

  11. Evaluating Ammonium, Nitrate and Sulfate Aerosols in 3-Dimensions

    NASA Technical Reports Server (NTRS)

    Mezuman, Keren; Bauer, Susanne E.; Tsigaridis, Kostas


    The effect aerosols have on climate and air quality is a func-on of their chemical composi-on, concentra-on and spa-al distribu-on. These parameters are controlled by emissions, heterogeneous and homogeneous chemistry, where thermodynamics plays a key role, transport, which includes stratospheric-­- tropospheric exchange, and deposi-onal sinks. In this work we demonstrate the effect of some of these processes on the SO4-NH4­-NO3 system using the GISS ModelE2 Global Circula-on Model (GCM).

  12. The transformation of outdoor ammonium nitrate aerosols in theindoor environment

    SciTech Connect

    Lunden, Melissa M.; Thatcher, Tracy L.; Littlejohn, David; Fischer, Marc L.; Hering, Susanne V.; Sextro, Richard G.; Brown, Nancy J.


    Recent studies associate particulate air pollution with adverse health effects; however, the exposure to indoor particles of outdoor origin is not well characterized, particularly for individual chemical species. In response to this, a field study in an unoccupied, single-story residence in Clovis, California has been conducted. Real-time particle monitors were used both outdoors and indoors to quantify PM2.5 nitrate, sulfate, and carbon. The results show that reduced indoor sulfate and carbon levels are primarily due to deposition and penetration losses. However, measured indoor ammonium nitrate levels were often observed to be at significantly lower levels than expected based solely on penetration and deposition losses. The additional reduction appears to be due to the transformation of ammonium nitrate into ammonia and nitric acid indoors, which are subsequently lost by deposition and sorption to indoor surfaces. The size of the effect is dependent upon factors such as temperature, relative humidity, and ventilation rate.

  13. Global modeling of nitrate and ammonium aerosols using EQSAM3

    NASA Astrophysics Data System (ADS)

    Xu, L.; Penner, J. E.


    Atmospheric aerosols, particles suspending in air, are important as they affect human health, air quality, and visibility as well as climate. Sulfate, nitrate, ammonium, chloride and sodium are among the most important inorganic aerosol species in the atmosphere. These compounds are hygroscopic and absorb water under almost all ambient environmental conditions. The uptake of water alters the aerosol size, and causes water to become the constituent with the largest atmospheric aerosol mass, especially when the aerosols grow into fog, haze or clouds. Furthermore, several global model studies have demonstrated that rapid increases in nitrogen emissions could produce enough nitrate in aerosols to offset the expected decline in sulfate forcing by 2100 for the extreme IPCC A2 scenario (Bauer et al., 2007). Although nitrate and ammonium were identified as significant anthropogenic sources of aerosols by a number of modeling studies, most global aerosol models still exclude ammonium-nitrate when the direct aerosol forcing is studied. In this study, the computationally efficient equilibrium model, EQSAM3, is incorporated into the UMICH-IMPACT-nitrate model using the hybrid dynamical solution method (Feng and Penner, 2007). The partitioning of nitrate and ammonium along with the corresponding water uptake is evaluated by comparing the model to the EQUISOLVE II method used in Feng and Penner (2007). The model is also evaluated by comparison with the AERONET data base and satellite-based aerosol optical depths.

  14. Ammonium imidazolium dichromate.


    Zhu, Run-Qiang


    In the crystal structure of the title compound, (C(3)H(5)N(2))(NH(4))[Cr(2)O(7)], the anions and cations are linked through N-H⋯O hydrogen bonds, resulting in a three-dimensional structure which contains three kinds of layers parallel to (001). One layer contains imidazole cations, the other two layers the ammonium cations and dichromate anions. The dichromate anion has an eclipsed conformation with a dihedral angle of 14.65 (18)° between the mean planes of the O-P-O-P-O backbone.

  15. Adjusting ammonium uptake via phosphorylation.


    Lanquar, Viviane; Frommer, Wolf B


    In plants, AMT/MEP/Rh superfamily mediates high affinity ammonium uptake. AMT/MEP transporters form a trimeric complex, which requires a productive interaction between subunits in order to be functional. The AMT/MEP C-terminal domain is highly conserved in more than 700 AMT homologs from cyanobacteria to higher plants with no cases found to be lacking this domain. AMT1;1 exists in active and inactive states, probably controlled by the spatial positioning of the C-terminus. Ammonium triggers the phosphorylation of a conserved threonine residue (T460) in the C-terminus of AMT1;1 in a time- and concentration-dependent manner. The T460 phosphorylation level correlates with a decrease of root ammonium uptake. We propose that ammonium-induced phosphorylation modulates ammonium uptake as a general mechanism to protect against ammonium toxicity.

  16. Adjusting ammonium uptake via phosphorylation

    PubMed Central

    Lanquar, Viviane


    In plants, AMT/MEP/Rh superfamily mediates high affinity ammonium uptake. AMT/MEP transporters form a trimeric complex, which requires a productive interaction between subunits in order to be functional. The AMT/MEP C-terminal domain is highly conserved in more than 700 AMT homologs from cyanobacteria to higher plants with no cases found to be lacking this domain. AMT1;1 exists in active and inactive states, probably controlled by the spatial positioning of the C-terminus. Ammonium triggers the phosphorylation of a conserved threonine residue (T460) in the C-terminus of AMT1;1 in a time- and concentration-dependent manner. The T460 phosphorylation level correlates with a decrease of root ammonium uptake. We propose that ammonium-induced phosphorylation modulates ammonium uptake as a general mechanism to protect against ammonium toxicity. PMID:20418663

  17. Hydrothermal synthesis of ammonium illite

    USGS Publications Warehouse

    Sucha, V.; Elsass, F.; Eberl, D.D.; Kuchta, L'.; Madejova, J.; Gates, W.P.; Komadel, P.


    Synthetic gel and glass of illitic composition, natural kaolinite, and mixed-layer illite-smectite were used as starting materials for hydrothermal synthesis of ammonium illite. Ammonium illite was prepared from synthetic gel by hydrothermal treatment at 300??C. The onset of crystallization began within 3 h, and well-crystallized ammonium illite appeared at 24 h. Increasing reaction time (up to four weeks) led to many illite layers per crystal. In the presence of equivalent proportions of potassium and ammonium, the gel was transformed to illite with equimolar contents of K and NH4. In contrast, synthesis using glass under the same conditions resulted in a mixture of mixed-layer ammonium illite-smectite with large expandability and discrete illite. Hydrothermal treatments of the fine fractions of natural kaolinite and illite-smectite produced ammonium illite from kaolinite but the illite-smectite remained unchanged.

  18. Size fractionated speciation of nitrate and sulfate aerosols in a sub-tropical industrial environment.


    Pandey, Sudhir Kumar; Tripathi, B D; Mishra, V K; Prajapati, S K


    Size fractionated chemical speciation of acidic aerosols were performed for ammonium sulfate, other sulfates, ammonium nitrate and other nitrates in a sub-tropical industrial area, Bina, India during December 2003 to November 2004. Analysis of variance (ANOVA) revealed highly significant temporal variations (p > .001) in the concentrations of nitrate and sulfate aerosols in all the three size fractions (fine, mid-size and coarse). Winter demonstrated utmost concentrations of ammonium sulfate, which ranged from 3.2 to 26.4 microg m(-3) in fine particles and 0.20-0.34 microg m(-3) in coarse particles. Ammonium sulfate was chiefly in fine mode (43.77% of total particulate sulfate) as compared to coarse particles (28.60% of total particulate sulfate). The major fraction Ammonium sulfate existed in different forms in atmospheric aerosols, for example NH4Fe(SO4)2, (NH4)2SO4, (NH4)3H(SO4)2 in fine particles, and (NH4)4(NO3)SO4+ in coarse particles. Other sulfate concentrations were also higher during winter ranging from 1.89 to 14.3 microg m(-3) in fine particles and 0.12-0.65microg m(-3) in coarse particles. Ammonium nitrate constituted the major fraction of total particulate nitrate all through the year and was principally in fine particles (the highest concentration in January i.e. 14.2 microg m(-3)). Other nitrates were mainly distributed in the fine particles (highest concentration in January i.e. 11.2 microg m(-3)) All the sulfate and nitrate species were mainly distributed in fine mode and have significant impact on human health.

  19. Ammonium assimilation in cyanobacteria.


    Muro-Pastor, M Isabel; Reyes, Jose C; Florencio, Francisco J


    In cyanobacteria, after transport by specific permeases, ammonium is incorporated into carbon skeletons by the sequential action of glutamine synthetase (GS) and glutamate synthase (GOGAT). Two types of GS (GSI and GSIII) and two types of GOGAT (ferredoxin-GOGAT and NADH-GOGAT) have been characterized in cyanobacteria. The carbon skeleton substrate of the GS-GOGAT pathway is 2-oxoglutarate that is synthesized by the isocitrate dehydrogenase (IDH). In order to maintain the C-N balance and the amino acid pools homeostasis, ammonium assimilation is tightly regulated. The key regulatory point is the GS, which is controlled at transcriptional and posttranscriptional levels. The transcription factor NtcA plays a critical role regulating the expression of the GS and the IDH encoding genes. In the unicellular cyanobacterium Synechocystis sp. PCC 6803, NtcA controls also the expression of two small proteins (IF7 and IF17) that inhibit the activity of GS by direct protein-protein interaction. Cyanobacteria perceive nitrogen status by sensing the intracellular concentration of 2-oxoglutarate, a signaling metabolite that is able to modulate allosterically the function of NtcA, in vitro. In vivo, a functional dependence between NtcA and the signal transduction protein PII in controlling NtcA-dependent genes has been also shown.

  20. An Efficient Approach to Sulfate Metabolites of Polychlorinated Biphenyls

    PubMed Central

    Li, Xueshu; Parkin, Sean; Duffel, Michael W.; Robertson, Larry W.; Lehmler, Hans-Joachim


    Polychlorinated biphenyls (PCBs), a major class of persistent organic pollutants, are metabolized to hydroxylated PCBs. Several hydroxylated PCBs are substrates of cytosolic phase II enzymes, such as phenol and hydroxysteroid (alcohol) sulfotransferases; however, the corresponding sulfation products have not been isolated and characterized. Here we describe a straightforward synthesis of a series of ten PCB sulfate monoesters from the corresponding hydroxylated PCBs. The hydroxylated PCBs were synthesized by coupling chlorinated benzene boronic acids with appropriate brominated (chloro-)anisoles, followed by demethylation with boron tribromide. The hydroxylated PCBs were sulfated with 2,2,2-trichloroethyl chlorosulfate using DMAP as base. Deprotection with zinc powder/ammonium formate yielded the ammonium salts of the desired PCB sulfate monoesters in good yields when the sulfated phenyl ring contained no or one chlorine substituent. However, no PCB sulfate monoesters were isolated when two chlorines were present ortho to the sulfated hydroxyl group. To aid with future quantitative structure activity relationship studies, the structures of two 2,2,2-trichloroethyl-protected PCB sulfates were verified by X-ray diffraction. PMID:19345419

  1. Ammonium Regulation in Aspergillus nidulans

    PubMed Central

    Pateman, J. A.; Kinghorn, J. R.; Dunn, Etta; Forbes, E.


    l-Glutamate uptake, thiourea uptake, and methylammonium uptake and the intracellular ammonium concentration were measured in wild-type and mutant cells of Aspergillus nidulans held in various concentrations of ammonium and urea. The levels of l-glutamate uptake, thiourea uptake, nitrate reductase, and hypoxanthine dehydrogenase activity are determined by the extracellular ammonium concentration. The level of methylammonium uptake is determined by the intracellular ammonium concentration. The uptake and enzyme characteristics of the ammonium-derepressed mutants, meaA8, meaB6, DER3, amrA1, xprD1, and gdhA1, are described. The gdhA mutants lack normal nicotinamide adenine dinucleotide phosphate-glutamate dehydrogenase (NADP-GDH) activity and are derepressed with respect to both external and internal ammonium. The other mutant classes are derepressed only with respect to external ammonium. The mutants meaA8, DER3, amrA1, and xprD1 have low levels of one or more of the l-glutamate, thiourea, and methylammonium uptake systems. A model for ammonium regulation in A. nidulans is put forward which suggests: (i) NADP-GDH located in the cell membrane complexes with extracellular ammonium. This first regulatory complex determines the level of l-glutamate uptake, thiourea uptake, nitrate reductase, and xanthine dehydrogenase by repression or inhibition, or both. (ii) NADP-GDH also complexes with intracellular ammonium. This second and different form of regulatory complex determines the level of methylammonium uptake by repression or inhibition, or both. PMID:4145865

  2. Relations of ammonium minerals at several hydrothermal systems in the western U.S.

    NASA Astrophysics Data System (ADS)

    Krohn, M. Dennis; Kendall, Carol; Evans, John R.; Fries, Terry L.


    Ammonium bound to silicate and sulfate minerals has recently been located at several major hydrothermal systems in the western U.S. utilizing newly-discovered near-infrared spectral properties. Knowledge of the origin and mineralogic relations of ammonium minerals at known hydrothermal systems is critical for the proper interpretation of remote sensing data and for testing of possible links to mineralization. Submicroscopic analysis of ammonium minerals from two mercury- and gold-bearing hot-springs deposits at Ivanhoe, Nevada and McLaughlin, California shows that the ammonium feldspar, buddingtonite, occurs as fine-grained euhedral crystals coating larger sulfide and quartz crystals. Ammonium feldspar seems to precipitate relatively late in the crystallization sequence and shows evidence for replacement of NH 4 + by K + or other monovalent cations. Some buddingtonite is observed in close association with mercury, but not with gold. Ammonioalunite is found in a variety of isolated crystal forms at both deposits. Nitrogen isotopic values for ammonium-bearing minerals show a 14‰ range in composition, precluding assignment of a specific provenance to the nitrogen. The correlations of nitrogen isotopic values with depth and ammonium content suggest some loss of nitrogen in the oxidizing supergene environment, possibly as a metastable mineral. The high ammonium content in these hydrothermal systems, the close association to mercury, and the small crystal size of the ammonium-bearing minerals all suggest that ammonium may be transported in a late-stage vapor phase or as an organic volatile. Such a process could lead to the formation of a non-carbonaceous organic aureole above a buried geothermal source. The discovery of a 10-km outcrop of ammonium minerals confirms that significant substitution of ammonium in minerals is possible over an extensive area and that remote sensing is a feasible means to detect such aureoles.

  3. Relations of ammonium minerals at several hydrothermal systems in the western U.S.

    USGS Publications Warehouse

    Krohn, M.D.; Kendall, C.; Evans, J.R.; Fries, T.L.


    Ammonium bound to silicate and sulfate minerals has recently been located at several major hydrothermal systems in the western U.S. utilizing newly-discovered near-infrared spectral properties. Knowledge of the origin and mineralogic relations of ammonium minerals at known hydrothermal systems is critical for the proper interpretation of remote sensing data and for testing of possible links to mineralization. Submicroscopic analysis of ammonium minerals from two mercury- and gold-bearing hot-springs deposits at Ivanhoe, Nevada and McLaughlin, California shows that the ammonium feldspar, buddingtonite, occurs as fine-grained euhedral crystals coating larger sulfide and quartz crystals. Ammonium feldspar seems to precipitate relatively late in the crystallization sequence and shows evidence for replacement of NH4+ by K+ or other monovalent cations. Some buddingtonite is observed in close association with mercury, but not with gold. Ammonioalunite is found in a variety of isolated crystal forms at both deposits. Nitrogen isotopic values for ammonium-bearing minerals show a 14??? range in composition, precluding assignment of a specific provenance to the nitrogen. The correlations of nitrogen isotopic values with depth and ammonium content suggest some loss of nitrogen in the oxidizing supergene environment, possibly as a metastable mineral. The high ammonium content in these hydrothermal systems, the close association to mercury, and the small crystal size of the ammonium-bearing minerals all suggest that ammonium may be transported in a late-stage vapor phase or as an organic volatile. Such a process could lead to the formation of a non-carbonaceous organic aureole above a buried geothermal source. The discovery of a 10-km outcrop of ammonium minerals confirms that significant substitution of ammonium in minerals is possible over an extensive area and that remote sensing is a feasible means to detect such aureoles. ?? 1993.

  4. Sulfate adsorption on goethite

    SciTech Connect

    Rietra, R.P.J.J.; Hiemstra, T.; Riemsdijk, W.H. van


    Recent spectroscopic work has suggested that only one surface species of sulfate is dominant on hematite. Sulfate is therefore a very suitable anion to test and develop adsorption models for variable charge minerals. The authors have studied sulfate adsorption on goethite covering a large range of sulfate concentrations, surface coverages, pH values, and electrolyte concentrations. Four different techniques were used to cover the entire range of conditions. For characterization at low sulfate concentrations, below the detection limit of sulfate with ICP-AES, the authors used proton-sulfate titrations at constant pH. Adsorption isotherms were studied for the intermediate sulfate concentration range. Acid-base titrations in sodium sulfate and electromobility were used for high sulfate concentrations. All the data can be modeled with one adsorbed species if it is assumed that the charge of adsorbed sulfate is spatially distributed in the interface. The charge distribution of sulfate follows directly from modeling the proton-sulfate adsorption stoichoimemtry sine this stoichiometry is independent of the intrinsic affinity constant of sulfate. The charge distribution can be related to the structure of the surface complex by use of the Pauling bond valence concept and is in accordance with the microscopic structure found by spectroscopy. The intrinsic affinity constant follows from the other measurements. Modeling of the proton-ion stoichoimetry with the commonly used 2-pK models, where adsorbed ions are treated as point charges, is possible only if at least two surface species for sulfate are used.

  5. Toxicokinetics of ammonium perfluorohexanoate.


    Iwai, Hiroyuki


    Excretion patterns and rates of ammonium perfluorohexanoate (APFHx) after administration of a single and multiple (14 days) oral dose(s) at 50 mg/kg to male and female mice and rats were examined. The test substance was [(14)C]-labeled APFHx. After a single oral administration, total excretion was rapid, with mean recoveries of over 90% of the dose at 24 hours after administration, irrespective of gender or species. The major route of elimination was via the urine (means of percentage recovery between 73.0 and 90.2% of the dose), followed by the feces (means of percentage recovery between 7.0 and 15.5% of the dose). Elimination via expired air was negligible. For the multiple dose tests, multiple (13 daily doses) oral administration of APFHx was followed by a single oral administration of [(14)C]-APFHx. Excretion was rapid, with mean recoveries of over 90% of the administered dose (mean values >95% of the ultimately recovered material) at 24 hours after dosing, irrespective of gender or species. The major route of elimination was via the urine (means of percentage recovery between 77.8 and 83.4% of the dose), followed by the feces (means of percentage recovery between 9.6 and 12.9% of the dose).


    EPA Science Inventory

    The paper presents one year of ambient ammonia (NH3), ammonium (NH4+), hydrochloric acid (HCI), chloride (CI¯), nitric acid (HNO3), nitrate (NO3¯), nitrous acid (HONO), sulfur dioxide (SO2), and sulfate (SO4


    EPA Science Inventory

    In this study, we present approximately 1 year (October 1998 - September 1999) of 12-hour mean ammonia [NH3], ammonium [NH4(+)], hydrochloric acid [HCl], nitrate [NO3(-)], nitric acid [HNO3], nitrous acid [HNO2], sulfate [SO4(- -)], and sulfur dioxide [SO2] concentrations measure...


    EPA Science Inventory

    The paper presents one year of ambient ammonia (NH3), ammonium (NH4+), hydrochloric acid (HCI), chloride (CI¯), nitric acid (HNO3), nitrate (NO3¯), nitrous acid (HONO), sulfur dioxide (SO2), and sulfate (SO4


    EPA Science Inventory

    In this study, we present approximately 1 year (October 1998 - September 1999) of 12-hour mean ammonia [NH3], ammonium [NH4(+)], hydrochloric acid [HCl], nitrate [NO3(-)], nitric acid [HNO3], nitrous acid [HNO2], sulfate [SO4(- -)], and sulfur dioxide [SO2] concentrations measure...

  10. Final report of the amended safety assessment of sodium laureth sulfate and related salts of sulfated ethoxylated alcohols.


    Robinson, Valerie C; Bergfeld, Wilma F; Belsito, Donald V; Hill, Ronald A; Klaassen, Curtis D; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Alan Andersen, F


    Sodium laureth sulfate is a member of a group of salts of sulfated ethoxylated alcohols, the safety of which was evaluated by the Cosmetic Ingredient Review (CIR) Expert Panel for use in cosmetics. Sodium and ammonium laureth sulfate have not evoked adverse responses in any toxicological testing. Sodium laureth sulfate was demonstrated to be a dermal and ocular irritant but not a sensitizer. The Expert Panel recognized that there are data gaps regarding use and concentration of these ingredients. However, the overall information available on the types of products in which these ingredients are used and at what concentrations indicates a pattern of use. The potential to produce irritation exists with these salts of sulfated ethoxylated alcohols, but in practice they are not regularly seen to be irritating because of the formulations in which they are used. These ingredients should be used only when they can be formulated to be nonirritating.

  11. Ammonium nitrate cold pack ingestion.


    Challoner, K R; McCarron, M M


    Disposable ammonium nitrate cold packs are widely used in emergency departments instead of ice bags. Five confused or suicidal patients who tore open a pack and ingested from 64 to 234 grams of ammonium nitrate in a single dose, and another patient who attempted to do so, are reported. It is known that chronic ingestion of 6 to 12 grams/day of ammonium nitrate may cause gastritis, acidosis, isosmotic diuresis, and nitrite toxicity manifesting as methemoglobinemia or vasodilatation. None of these patients developed severe toxicity, although three had symptoms of gastritis, three had slight methemoglobinemia, and two had mild hypotension. The product was removed from the stomach promptly in three of the five patients. None had pre-existing renal or intestinal dysfunction, which are known to enhance ammonium nitrate toxicity.

  12. Hygroscopic properties of aminium sulfate aerosols

    NASA Astrophysics Data System (ADS)

    Rovelli, Grazia; Miles, Rachael E. H.; Reid, Jonathan P.; Clegg, Simon L.


    Alkylaminium sulfates originate from the neutralisation reaction between short-chained amines and sulfuric acid and have been detected in atmospheric aerosol particles. Their physicochemical behaviour is less well characterised than their inorganic equivalent, ammonium sulfate, even though they play a role in atmospheric processes such as the nucleation and growth of new particles and cloud droplet formation. In this work, a comparative evaporation kinetics experimental technique using a cylindrical electrodynamic balance is applied to determine the hygroscopic properties of six short-chained alkylaminium sulfates, specifically mono-, di-, and tri-methylaminium sulfate and mono-, di-, and tri-ethyl aminium sulfate. This approach allows for the retrieval of a water-activity-dependent growth curve in less than 10 s, avoiding the uncertainties that can arise from the volatilisation of semi-volatile components. Measurements are made on particles > 5 µm in radius, avoiding the need to correct equilibrium measurements for droplet-surface curvature with assumed values of the droplet-surface tension. Variations in equilibrium solution droplet composition with varying water activity are reported over the range 0.5 to > 0.98, along with accurate parameterisations of solution density and refractive index. The uncertainties in water activities associated with the hygroscopicity measurements are typically < ±0.2 % at water activities > 0.9 and ˜ ±1 % below 0.9, with maximum uncertainties in diameter growth factors of ±0.7 %. Comparison with previously reported measurements show deviation across the entire water activity range.

  13. High performance ammonium nitrate propellant

    NASA Technical Reports Server (NTRS)

    Anderson, F. A. (Inventor)


    A high performance propellant having greatly reduced hydrogen chloride emission is presented. It is comprised of: (1) a minor amount of hydrocarbon binder (10-15%), (2) at least 85% solids including ammonium nitrate as the primary oxidizer (about 40% to 70%), (3) a significant amount (5-25%) powdered metal fuel, such as aluminum, (4) a small amount (5-25%) of ammonium perchlorate as a supplementary oxidizer, and (5) optionally a small amount (0-20%) of a nitramine.

  14. Determination of aerosol ammonium using an aerodyne aerosol mass spectrometer

    NASA Astrophysics Data System (ADS)

    Delia, A. E.; Toohey, D. W.; Worsnop, D. R.


    The chemical composition of fine aerosols is a significant issue both because it influences the chemical and radiative properties of the aerosols, which in turn impact the regional and global climate and human health, and because it is difficult to measure accurately. The Aerosol Mass Spectrometer (AMS) developed by Aerodyne Research measures both chemical composition and aerodynamic size of submicron aerosols quantitatively. However, the measurement of aerosol ammonium is more difficult than that of the other major inorganic species, nitrate and sulfate, because of interferences in the mass spectrum from air and water. This presentation will describe the successful procedure developed for dealing with these interferences and accurately determining the ammonium mass. In addition, the application of this procedure to aerosols from a range of ambient conditions will be demonstrated using data from several field studies.

  15. 21 CFR 184.1138 - Ammonium chloride.

    Code of Federal Regulations, 2014 CFR


    ... GRAS § 184.1138 Ammonium chloride. (a) Ammonium chloride (NH4Cl, CAS Reg. No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The less soluble sodium salt... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium chloride. 184.1138 Section 184.1138...

  16. 21 CFR 184.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium bicarbonate. 184.1135 Section 184.1135... Listing of Specific Substances Affirmed as GRAS § 184.1135 Ammonium bicarbonate. (a) Ammonium bicarbonate.... Crystals of ammonium bicarbonate are precipitated from solution and subsequently washed and dried. (b) The...

  17. 21 CFR 184.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium bicarbonate. 184.1135 Section 184.1135... Listing of Specific Substances Affirmed as GRAS § 184.1135 Ammonium bicarbonate. (a) Ammonium bicarbonate.... Crystals of ammonium bicarbonate are precipitated from solution and subsequently washed and dried. (b) The...

  18. 21 CFR 184.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium bicarbonate. 184.1135 Section 184.1135... Listing of Specific Substances Affirmed as GRAS § 184.1135 Ammonium bicarbonate. (a) Ammonium bicarbonate.... Crystals of ammonium bicarbonate are precipitated from solution and subsequently washed and dried. (b) The...

  19. 21 CFR 184.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium bicarbonate. 184.1135 Section 184.1135... Listing of Specific Substances Affirmed as GRAS § 184.1135 Ammonium bicarbonate. (a) Ammonium bicarbonate.... Crystals of ammonium bicarbonate are precipitated from solution and subsequently washed and dried. (b) The...

  20. 46 CFR 148.205 - Ammonium nitrate and ammonium nitrate fertilizers.

    Code of Federal Regulations, 2012 CFR


    ... 46 Shipping 5 2012-10-01 2012-10-01 false Ammonium nitrate and ammonium nitrate fertilizers. 148... Materials § 148.205 Ammonium nitrate and ammonium nitrate fertilizers. (a) This section applies to the stowage and transportation in bulk of ammonium nitrate and the following fertilizers composed of...

  1. 46 CFR 148.205 - Ammonium nitrate and ammonium nitrate fertilizers.

    Code of Federal Regulations, 2014 CFR


    ... 46 Shipping 5 2014-10-01 2014-10-01 false Ammonium nitrate and ammonium nitrate fertilizers. 148... Materials § 148.205 Ammonium nitrate and ammonium nitrate fertilizers. (a) This section applies to the stowage and transportation in bulk of ammonium nitrate and the following fertilizers composed of...

  2. 46 CFR 148.205 - Ammonium nitrate and ammonium nitrate fertilizers.

    Code of Federal Regulations, 2011 CFR


    ... 46 Shipping 5 2011-10-01 2011-10-01 false Ammonium nitrate and ammonium nitrate fertilizers. 148... Materials § 148.205 Ammonium nitrate and ammonium nitrate fertilizers. (a) This section applies to the stowage and transportation in bulk of ammonium nitrate and the following fertilizers composed of...

  3. 46 CFR 148.205 - Ammonium nitrate and ammonium nitrate fertilizers.

    Code of Federal Regulations, 2013 CFR


    ... 46 Shipping 5 2013-10-01 2013-10-01 false Ammonium nitrate and ammonium nitrate fertilizers. 148... Materials § 148.205 Ammonium nitrate and ammonium nitrate fertilizers. (a) This section applies to the stowage and transportation in bulk of ammonium nitrate and the following fertilizers composed of...

  4. Sulfide and ammonium oxidation, acetate mineralization by denitrification in a multipurpose UASB reactor.


    Beristain-Cardoso, Ricardo; Gómez, Jorge; Méndez-Pampín, Ramón


    The physiological and kinetic behavior of a denitrifying granular sludge exposed to different sulfide loading rates (55-295 mg/L d) were evaluated in a UASB reactor fed with acetate, ammonium and nitrate. At any sulfide loading rates, the consumption efficiencies of sulfide, acetate and ammonium were above 95%, while nitrate consumption efficiencies were around 62-72%. At the highest sulfide loading rate the ammonium was used as electron donor for N(2) production. The increase of sulfide loading rate also affected the fate of sulfide oxidation, since elemental sulfur was the main end product instead of sulfate. However, the lithotrophic denitrifying kinetic was not affected. FISH oligonucleotide probes for Thiobacillus denitrificans, Thiomiscropira denitrificans, genus Paracoccus and Pseudomonas spp. were used to follow the microbial ecology. The results of this work have shown that four pollutants could simultaneously be removed, namely, sulfide, ammonium, acetate and nitrate under well defined denitrifying conditions. Copyright © 2010 Elsevier Ltd. All rights reserved.



    Boyer, T.W.; MacHutchin, J.G.; Yaffe, L.


    The treatment of waste solutions obtained in the processing of neutron- irradiated uranium containing fission products and ammonium nitrate is described. The object of this process is to provide a method whereby the ammonium nitrate is destroyed and removed from the solution so as to permit subsequent concentration of the solution.. In accordance with the process the residual nitrate solutions are treated with an excess of alkyl acid anhydride, such as acetic anhydride. Preferably, the residual nitrate solution is added to an excess of the acetic anhydride at such a rate that external heat is not required. The result of this operation is that the ammonium nitrate and acetic anhydride react to form N/sub 2/ O and acetic acid.

  6. Hygroscopicity and optical properties of alkylaminium sulfates.


    Hu, Dawei; Li, Chunlin; Chen, Hui; Chen, Jianmin; Ye, Xingnan; Li, Ling; Yang, Xin; Wang, Xinming; Mellouki, Abdelwahid; Hu, Zhongyang


    The hygroscopicity and optical properties of alkylaminium sulfates (AASs) were investigated using a hygroscopicity tandem differential mobility analyzer coupled to a cavity ring-down spectrometer and a nephelometer. AAS particles do not exhibit a deliquescence phenomenon and show a monotonic increase in diameter as the relative humidity (RH) ascends. Hygroscopic growth factors (GFs) for 40, 100 and 150 nm alkylaminium sulfate particles do not show an apparent Kelvin effect when RH is less than 45%, whereas GFs of the salt aerosols increase with initial particle size when RH is higher than 45%. Calculation using the Zdanovskii-Stokes-Robinson mixing rule suggests that hygroscopic growth of triethylaminium sulfate-ammonium sulfate mixtures is non-deliquescent, occurring at very low RH, implying that the displacement of ammonia by amine will significantly enhance the hygroscopicity of (NH4)2SO4 aerosols. In addition, light extinction of AAS particles is a combined effect of both scattering and absorption under dry conditions, but is dominated by scattering under wet conditions.

  7. Sulfate in fetal development.


    Dawson, Paul A


    Sulfate (SO(4)(2-)) is an important nutrient for human growth and development, and is obtained from the diet and the intra-cellular metabolism of sulfur-containing amino acids, including methionine and cysteine. During pregnancy, fetal tissues have a limited capacity to produce sulfate, and rely on sulfate obtained from the maternal circulation. Sulfate enters and exits placental and fetal cells via transporters on the plasma membrane, which maintain a sufficient intracellular supply of sulfate and its universal sulfonate donor 3'-phosphoadenosine 5'-phosphosulfate (PAPS) for sulfate conjugation (sulfonation) reactions to function effectively. Sulfotransferases mediate sulfonation of numerous endogenous compounds, including proteins and steroids, which biotransforms their biological activities. In addition, sulfonation of proteoglycans is important for maintaining normal structure and development of tissues, as shown for reduced sulfonation of cartilage proteoglycans that leads to developmental dwarfism disorders and four different osteochondrodysplasias (diastrophic dysplasia, atelosteogenesis type II, achondrogenesis type IB and multiple epiphyseal dysplasia). The removal of sulfate via sulfatases is an important step in proteoglycan degradation, and defects in several sulfatases are linked to perturbed fetal bone development, including mesomelia-synostoses syndrome and chondrodysplasia punctata 1. In recent years, interest in sulfate and its role in developmental biology has expanded following the characterisation of sulfate transporters, sulfotransferases and sulfatases and their involvement in fetal growth. This review will focus on the physiological roles of sulfate in fetal development, with links to human and animal pathophysiologies.

  8. Thermochemical, cloud condensation nucleation ability and optical properties of alkyl aminium sulfate aerosols

    NASA Astrophysics Data System (ADS)

    Lavi, A.; Bluvshtein, N.; Segre, E.; Segev, L.; Flores, J.; Rudich, Y.


    The increased interest in the chemistry of alkylamines and their possible roles in the atmosphere increased recently due to field observations of the correlation between new particle formation and post nucleation growth events and the presence of alkylamines in their cationic form. Due to their high saturation vapor pressure it is unlikely that short chain alkylamines will contribute to particle formation or growth by condensation. Therefore, it was previously suggested that their contribution to particulate phase is the result of acid-base reactions between the basic alkylamines and atmospherically relevant acids such as sulfuric and nitric acid. In this study we present laboratory data on the thermochemical, CCN activity and optical properties of selected atmospherically relevant alkyl aminium sulfate salts: Monomethyl aminium sulfate (MMAS), dimethyaminium sulfate (DMAS), trimethylaminium sulfate, monoethylaminium sulfate (MEAS), diethylaminium sulfate (DEAS) and triethylaminium sulfate (TEAS)). We found that the vapor pressure of these aminium salts is 1-3 orders of magnitude lower than that of ammonium sulfate and as such they can contribute to new aerosols and secondary aerosols formation. We infer that these species have very high CCN activity, with hygroscopicity parameter that is lower but close to that ammonium sulfate. Finally, we present the optical properties of these alkyl aminium sulfate salts between 360 and 420 nm. These compounds are less scattering than ammonium sulfate and show minimal wavelength dependence in this range. These compounds also do not absorb light. These derived parameters can contribute to the better understanding and characterization of the role that these compounds play in atmospheric chemical reactions, gas-solid partitioning and their possible contribution to the microphysical and radiative effects of atmospheric aerosols.

  9. Benzylic Ammonium Ylide Mediated Epoxidations

    PubMed Central

    Roiser, Lukas; Robiette, Raphaël; Waser, Mario


    A high yielding synthesis of stilbene oxides using ammonium ylides has been developed. It turned out that the amine leaving group plays a crucial role as trimethylamine gives higher yields than DABCO or quinuclidine. The amine group also influences the diastereoselectivity, and detailed DFT calculations to understand the key parameters of these reactions have been carried out. PMID:27766017

  10. Comparative study of various methods used for determining health effects of inhaled sulfates

    SciTech Connect

    Drummond, J.G.; Aranyi, C.; Schiff, L.J.; Fenters, J.D.; Graham, J.A.


    Various health effect parameters were compared to determine which tests were the most sensitive indicators of toxic effects of exposure to metallic sulfate aerosols. Inhalation studies were conducted involving either single 3-hr exposure to various concentrations of cupric sulfate (0.43-2.64 mg/m3 SO/sub 4/), aluminum sulfate (1.65-2.75 mg/m3 SO/sub 4/), and aluminum ammonium sulfate (1.47-3.81 mg/m3 SO/sub 4/) or multiple (five and ten) daily 3-hr exposures to cupric sulfate (0.1 mg/m3 SO/sub 4/). The test parameters studied in male and female CD1 mice were changes in mortality after respiratory infection with Group C Streptococcus zooepidemicus; pulmonary bactericidal activity; pulmonary cell number, type, viability, and ATP content; and pulmonary morphology by scanning electron microscopy. Tracheal ciliary beating frequency and morphology were also studied in both CD1 mice and Syrian golden hamsters. Differences in bacteria-induced mortality rate appeared to be the most sensitive and consistent indicators of pollutant damage. The other parameters produced evidence of damage but generally only at the higher pollutant concentrations. Cupric sulfate was the most toxic of the three sulfates, but the differences between the toxicity of the aluminum sulfate and aluminum ammonium sulfate were less clear.

  11. Comparative study of various methods used for determined health effects of inhaled sulfates

    SciTech Connect

    Drummond, J.G.; Aranyi, C.; Schiff, L.J.; Fenters, J.D.; Graham, J.A.


    Various health effect parameters were compared to determine which tests were the most sensitive indicators of toxic effects of exposure to metallic sulfate aerosols. Inhalation studies were conducted involving either single 3-hr exposure to various concentrations of cupric sulfate (0.43-2.64 mg/m/sup 3/ SO/sub 4/), aluminum sulfate (1.65-2.75 mg/m/sup 3/ SO/sub 4/), and aluminum ammonium sulfate (1.47-3.81 mg/m/sup 3/ SO/sub 4/) or multiple (five and ten) daily 3-hr exposures to cupric sulfate (0.1 mg/m/sup 3/ SO/sub 4/). The test parameters studied in male and female CD/sub 1/ mice were changes in mortality after respiratory infection with Group C Streptococcus zooepidemicus; pulmonary bactericidal activity; pulmonary cell number, type, viability, and ATP content; and pulmonary morphology by scanning electron microscopy. Tracheal ciliary beating frequency and morphology were also studied in both CD/sup 1/ mice and Syrian golden hamsters. Differences in bacteria-induced mortality rate appeared to be the most sensitive and consistent indicators of pollutant damage. The other parameters produced evidence of damage but generally only at the higher pollutant concentrations. Cupric sulfate was the most toxic of the three sulfates, but the differences between the toxicity of the aluminum sulfate and aluminum ammonium sulfate were less clear.

  12. Sulfation pathways in plants.


    Koprivova, Anna; Kopriva, Stanislav


    Plants take up sulfur in the form of sulfate. Sulfate is activated to adenosine 5'-phosphosulfate (APS) and reduced to sulfite and then to sulfide when it is assimilated into amino acid cysteine. Alternatively, APS is phosphorylated to 3'-phosphoadenosine 5'-phosphosulfate (PAPS), and sulfate from PAPS is transferred onto diverse metabolites in its oxidized form. Traditionally, these pathways are referred to as primary and secondary sulfate metabolism, respectively. However, the synthesis of PAPS is essential for plants and even its reduced provision leads to dwarfism. Here the current knowledge of enzymes involved in sulfation pathways of plants will be summarized, the similarities and differences between different kingdoms will be highlighted, and major open questions in the research of plant sulfation will be formulated.

  13. 21 CFR 582.1139 - Ammonium hydroxide.

    Code of Federal Regulations, 2014 CFR


    ... Additives § 582.1139 Ammonium hydroxide. (a) Product. Ammonium hydroxide. (b) Conditions of use. This substance is generally recognized as safe when used in accordance with good manufacturing or feeding...

  14. 21 CFR 582.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2014 CFR


    ... Additives § 582.1137 Ammonium carbonate. (a) Product. Ammonium carbonate. (b) Conditions of use. This substance is generally recognized as safe when used in accordance with good manufacturing or feeding...

  15. 21 CFR 582.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2014 CFR


    ... Additives § 582.1135 Ammonium bicarbonate. (a) Product. Ammonium bicarbonate. (b) Conditions of use. This substance is generally recognized as safe when used in accordance with good manufacturing or feeding...

  16. 76 FR 62311 - Ammonium Nitrate Security Program

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... to best notify agents (AN Agents) when ammonium nitrate purchasers (AN Purchasers) submit those AN... directly to ammonium nitrate sellers (AN Sellers) when it is not possible for an AN Seller to verify the...

  17. Comparative toxicity of ammonium and nitrate compounds to Pacific treefrog and African clawed frog tadpoles

    SciTech Connect

    Schuytema, G.S.; Nebeker, A.V.


    The effects of ammonium nitrate, ammonium chloride, ammonium sulfate, and sodium nitrate on survival and growth of Pacific treefrog (Pseudacris regilla [Baird and Girard]) and African clawed frog (Xenopus laevis [Daudin]) tadpoles were determined in static-renewal tests. The 10-d ammonium nitrate and ammonium sulfate LC50s for P. regilla were 55.2 and 89.7 mg/L NH{sub 4}-N, respectively. The 10-d LC50s for X. laevis for the three ammonium compounds ranged from 45 to 64 mg/L NH{sub 4}-N. The 10-d sodium nitrate LC50s were 266.2 mg/L NO{sub 3}-N for P. regilla and 1,236.2 mg/L NO{sub 3}-N for X. laevis. The lowest observed adverse effect level (LOAEL) of ammonium compound based on reduced length or weight was 24.6 mg/L NH{sub 4}-N for P. regilla and 99.5 mg/L NH{sub 4}-N for X. laevis. The lowest sodium nitrate LOAELs based on reduced length or weight were {lt}30.1 mg/L NO{sub 3}-N for P. regilla and 126.3 mg/L NO{sub 3}-N for X. laevis. Calculated un-ionized NH{sub 3} comprised 0.3 to 1.0% of measured NH{sub 4}-N concentrations. Potential harm to amphibians could occur if sensitive life stages were impacted by NH{sub 4}-N and NO{sub 3}-N in agricultural runoff or drainage for a sufficiently long period.

  18. Heparan Sulfate Proteoglycans

    PubMed Central

    Sarrazin, Stephane; Lamanna, William C.; Esko, Jeffrey D.


    Heparan sulfate proteoglycans are found at the cell surface and in the extracellular matrix, where they interact with a plethora of ligands. Over the last decade, new insights have emerged regarding the mechanism and biological significance of these interactions. Here, we discuss changing views on the specificity of protein–heparan sulfate binding and the activity of HSPGs as receptors and coreceptors. Although few in number, heparan sulfate proteoglycans have profound effects at the cellular, tissue, and organismal level. PMID:21690215

  19. 21 CFR 582.7133 - Ammonium alginate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammonium alginate. 582.7133 Section 582.7133 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Ammonium alginate. (a) Product. Ammonium alginate. (b) Conditions of use. This substance is...

  20. 21 CFR 556.375 - Maduramicin ammonium.

    Code of Federal Regulations, 2014 CFR


    ... residues of maduramicin ammonium in chickens as follows: (a) A tolerance for maduramicin ammonium (marker residue) in chickens is 0.38 parts per million in fat (target tissue). A tolerance refers to the... animals. (b) The safe concentrations for total maduramicin ammonium residues in uncooked edible...

  1. 21 CFR 184.1138 - Ammonium chloride.

    Code of Federal Regulations, 2012 CFR


    .... No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The less soluble sodium salt separates out at elevated temperatures, and ammonium chloride is recovered... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium chloride. 184.1138 Section 184.1138...

  2. 21 CFR 184.1138 - Ammonium chloride.

    Code of Federal Regulations, 2013 CFR


    .... No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The less soluble sodium salt separates out at elevated temperatures, and ammonium chloride is recovered... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium chloride. 184.1138 Section 184.1138...

  3. 21 CFR 184.1138 - Ammonium chloride.

    Code of Federal Regulations, 2010 CFR


    .... No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The less soluble sodium salt separates out at elevated temperatures, and ammonium chloride is recovered... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium chloride. 184.1138 Section 184.1138...

  4. 21 CFR 184.1138 - Ammonium chloride.

    Code of Federal Regulations, 2011 CFR


    .... No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The less soluble sodium salt separates out at elevated temperatures, and ammonium chloride is recovered... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium chloride. 184.1138 Section 184.1138...

  5. 76 FR 47238 - Ammonium Nitrate From Russia

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... COMMISSION Ammonium Nitrate From Russia Determination On the basis of the record \\1\\ developed in the subject... order on ammonium nitrate from Russia would be likely to lead to continuation or recurrence of material... Commission are contained in USITC Publication 4249 (August 2011), entitled Ammonium Nitrate from...

  6. 76 FR 11273 - Ammonium Nitrate From Russia

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... COMMISSION Ammonium Nitrate From Russia AGENCY: United States International Trade Commission. ACTION: Institution of a five-year review concerning the suspended investigation on ammonium nitrate from Russia... investigation on ammonium nitrate from Russia would be likely to lead to continuation or recurrence of...

  7. 21 CFR 582.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Ammonium bicarbonate. 582.1135 Section 582.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1135 Ammonium bicarbonate. (a) Product. Ammonium bicarbonate. (b) Conditions of use. This...

  8. 21 CFR 582.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Ammonium bicarbonate. 582.1135 Section 582.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1135 Ammonium bicarbonate. (a) Product. Ammonium bicarbonate. (b) Conditions of use. This...

  9. 21 CFR 582.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Ammonium bicarbonate. 582.1135 Section 582.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1135 Ammonium bicarbonate. (a) Product. Ammonium bicarbonate. (b) Conditions of use. This...

  10. 21 CFR 582.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammonium bicarbonate. 582.1135 Section 582.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1135 Ammonium bicarbonate. (a) Product. Ammonium bicarbonate. (b) Conditions of use. This...

  11. Extraction of urea and ammonium ion

    NASA Technical Reports Server (NTRS)

    Anselmi, R. T.; Husted, R. R.; Schulz, J. R.


    Water purification system keeps urea and ammonium ion concentration below toxic limits in recirculated water of closed loop aquatic habitat. Urea is first converted to ammonium ions and carbon dioxide by enzygmatic action. Ammonium ions are removed by ion exchange. Bioburden is controlled by filtration through 0.45 micron millipore filters.

  12. Extraction of urea and ammonium ion

    NASA Technical Reports Server (NTRS)

    Anselmi, R. T.; Husted, R. R.; Schulz, J. R.


    Water purification system keeps urea and ammonium ion concentration below toxic limits in recirculated water of closed loop aquatic habitat. Urea is first converted to ammonium ions and carbon dioxide by enzygmatic action. Ammonium ions are removed by ion exchange. Bioburden is controlled by filtration through 0.45 micron millipore filters.

  13. 21 CFR 582.1141 - Ammonium phosphate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Ammonium phosphate. 582.1141 Section 582.1141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1141 Ammonium phosphate. (a) Product. Ammonium phosphate (mono- and dibasic). (b) Conditions...

  14. 21 CFR 582.1141 - Ammonium phosphate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Ammonium phosphate. 582.1141 Section 582.1141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1141 Ammonium phosphate. (a) Product. Ammonium phosphate (mono- and dibasic). (b) Conditions...

  15. 21 CFR 582.1141 - Ammonium phosphate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Ammonium phosphate. 582.1141 Section 582.1141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1141 Ammonium phosphate. (a) Product. Ammonium phosphate (mono- and dibasic). (b) Conditions...

  16. 21 CFR 582.1141 - Ammonium phosphate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammonium phosphate. 582.1141 Section 582.1141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1141 Ammonium phosphate. (a) Product. Ammonium phosphate (mono- and dibasic). (b) Conditions...

  17. 21 CFR 582.1141 - Ammonium phosphate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Ammonium phosphate. 582.1141 Section 582.1141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1141 Ammonium phosphate. (a) Product. Ammonium phosphate (mono- and dibasic). (b) Conditions...

  18. Ammonium removal from aqueous solutions by using natural Chinese (Chende) zeolite as adsorbent.


    Huang, Haiming; Xiao, Xianming; Yan, Bo; Yang, Liping


    This paper presents a study of the removal of ammonium ion from aqueous solutions using natural Chinese (Chende) zeolite. A series of experiments was conducted to examine the effects of solution pH, particle size, contact time, adsorbent dosage, and the presence of other cation- and anion species on ammonium removal. The findings indicated that these parameters named had a significant effect on the removal of ammonium by the zeolite. The effect of other cations on the removal of ammonium followed the order of preference Na(+)>K(+)>Ca(2+)>Mg(2+) at identical mass concentrations, and the effect of the presence of individual anions followed the order of preference carbonate>chloride>sulfate>phosphate at identical mass concentrations of ammonium ions. Kinetic analysis showed that the adsorption of ammonium on zeolite at different ranges of particle size well followed the pseudo-second-order model and followed the intra-particle diffusion model only during the initial 60 min of the adsorption process. Equilibrium isotherm data was fitted to the linear Langmuir- and Freundlich models with the latter model providing the better description of the process (R(2)=0.991-0.997) compared to the former (R(2)=0.902-0.989).

  19. Phase diagram of ammonium nitrate

    NASA Astrophysics Data System (ADS)

    Dunuwille, M.; Yoo, C. S.


    Ammonium Nitrate (AN) has often subjected to uses in improvised explosive devices, due to its wide availability as a fertilizer and its capability of becoming explosive with slight additions of organic and inorganic compounds. Yet, the origin of enhanced energetic properties of impure AN (or AN mixtures) is neither chemically unique nor well understood -resulting in rather catastrophic disasters in the past1 and thereby a significant burden on safety in using ammonium nitrates even today. To remedy this situation, we have carried out an extensive study to investigate the phase stability of AN at high pressure and temperature, using diamond anvil cells and micro-Raman spectroscopy. The present results confirm the recently proposed phase IV-to-IV' transition above 17 GPa2 and provide new constraints for the melting and phase diagram of AN to 40 GPa and 400 °C.

  20. Automotive sulfate emission data.

    PubMed Central

    Somers, J H


    This paper discusses automotive sulfate emission results obtained by the Office of Mobile Source Air Pollution Control of EPA, General Motors, Ford, Chrysler, and Esso. This work has been directed towards obtaining sulfate emission factors for cars with and without catalyst. While the EPA and Chrysler investigations have found significant sulfate formation in noncatalyst cars, GM, Ford, and Esso have found only trace levels from noncatalyst cars. All of these investigators agree that much higher quantities of sulfate are emitted from catalyst cars. The work done to date shows pelleted catalysts to have much lower sulfate emissions over the low speed-EPA Federal Test Procedures than monolith catalysts. This is probably due to temporary storage of sulfates on the catalyst due to chemical interaction with the alumina pellets. The sulfate compounds are, to a large degree, emitted later under higher speed conditions which result in higher catalyst temperatures which decompose the alumina salt. Future work will be directed towards further elucidation of this storage mechanism as well as determining in detail how factors such as air injection rate and catalyst location affect sulfate emissions. PMID:50932

  1. Effects of iron and nitrogen limitation on sulfur isotope fractionation during microbial sulfate reduction.


    Sim, Min Sub; Ono, Shuhei; Bosak, Tanja


    Sulfate-reducing microbes utilize sulfate as an electron acceptor and produce sulfide that is depleted in heavy isotopes of sulfur relative to sulfate. Thus, the distribution of sulfur isotopes in sediments can trace microbial sulfate reduction (MSR), and it also has the potential to reflect the physiology of sulfate-reducing microbes. This study investigates the relationship between the availability of iron and reduced nitrogen and the magnitude of S-isotope fractionation during MSR by a marine sulfate-reducing bacterium, DMSS-1, a Desulfovibrio species, isolated from salt marsh in Cape Cod, MA. Submicromolar levels of iron increase sulfur isotope fractionation by about 50% relative to iron-replete cultures of DMSS-1. Iron-limited cultures also exhibit decreased cytochrome c-to-total protein ratios and cell-specific sulfate reduction rates (csSRR), implying changes in the electron transport chain that couples carbon and sulfur metabolisms. When DMSS-1 fixes nitrogen in ammonium-deficient medium, it also produces larger fractionation, but it occurs at faster csSRRs than in the ammonium-replete control cultures. The energy and reducing power required for nitrogen fixation may be responsible for the reverse trend between S-isotope fractionation and csSRR in this case. Iron deficiency and nitrogen fixation by sulfate-reducing microbes may lead to the large observed S-isotope effects in some euxinic basins and various anoxic sediments.

  2. Effects of Iron and Nitrogen Limitation on Sulfur Isotope Fractionation during Microbial Sulfate Reduction

    PubMed Central

    Ono, Shuhei; Bosak, Tanja


    Sulfate-reducing microbes utilize sulfate as an electron acceptor and produce sulfide that is depleted in heavy isotopes of sulfur relative to sulfate. Thus, the distribution of sulfur isotopes in sediments can trace microbial sulfate reduction (MSR), and it also has the potential to reflect the physiology of sulfate-reducing microbes. This study investigates the relationship between the availability of iron and reduced nitrogen and the magnitude of S-isotope fractionation during MSR by a marine sulfate-reducing bacterium, DMSS-1, a Desulfovibrio species, isolated from salt marsh in Cape Cod, MA. Submicromolar levels of iron increase sulfur isotope fractionation by about 50% relative to iron-replete cultures of DMSS-1. Iron-limited cultures also exhibit decreased cytochrome c-to-total protein ratios and cell-specific sulfate reduction rates (csSRR), implying changes in the electron transport chain that couples carbon and sulfur metabolisms. When DMSS-1 fixes nitrogen in ammonium-deficient medium, it also produces larger fractionation, but it occurs at faster csSRRs than in the ammonium-replete control cultures. The energy and reducing power required for nitrogen fixation may be responsible for the reverse trend between S-isotope fractionation and csSRR in this case. Iron deficiency and nitrogen fixation by sulfate-reducing microbes may lead to the large observed S-isotope effects in some euxinic basins and various anoxic sediments. PMID:23001667

  3. Investigating uncultured microbes and their role in a deep subseafloor ammonium sink

    NASA Astrophysics Data System (ADS)

    Kirkpatrick, J. B.; Spivack, A. J.; Smith, D. C.; D'Hondt, S. L.


    The marine deep biosphere is thought to hold a large reservoir of both microbial cells and untapped genetic diversity. One potential driving force behind the vast amount of uncultured organisms are unconventional redox pairs which may not be favorable at benchtop conditions, but can support life in other circumstances. One instance of this is the previously documented thermodynamic favorability of ammonium oxidation with sulfate in sediments such as those investigated here from the Indian Ocean. Using 454 tag sequencing of 16S DNA, we identified uncultured archaea and bacteria potentially playing key roles at the sulfate and ammonium interface. First, the phylogenetic identity of organisms potentially involved in this reaction is inferred, as well as thermodynamic considerations of potential pathways. Several novel phyla, as well as Clostridiales, appear over-represented at the reaction zone. Secondly, to understand the metabolic capability of these target organisms, these sequences have been cross-referenced with assemblies from metagenomic data sets, and connections to functional genes are being elucidated. Finally, we discuss parallels with near-shore coastal sediment from Narragansett Bay, Rhode Island, where geochemical similarities have been found. While the thermodynamic regime is similar to the Indian Ocean, suggesting the potential for a broad geographic distribution, accessibility provides the opportunity to construct bioreactors to test rates and pathways of ammonium and sulfate fluxes. Iron content may be a key factor in determining reaction favorability. We present ongoing work in this area and the pros and cons of different bioreactor designs.

  4. In vitro and in vivo evaluation of sanguinarine liposomes prepared by a remote loading method with three different ammonium salts.


    Ke, X; Bei, J H; Zhang, Y; Li, J


    Sanguinarine liposomes were prepared by a remote loading method using three different ammonium salts. A series of studies, including in vitro release, in vitro and in vivo anti-tumor effects and pharmacokinetics in rats, were conducted. The three liposomes showed pH-sensitive release characteristics in vitro, but there were obvious variations in their release profiles. Among the three liposomes, the liposomes made using ammonium citrate and phosphate possessed better anti-tumor activity in vitro and in vivo, compared with the liposome using ammonium sulfate. Pharmacokinetics test results in rats indicated that sanguinarine liposomes have notably elevated AUC (P<0.05) and markedly lower CL (P<0.05) compared with the solution, but there were no obvious differences between the three liposomes. The present study may be useful for better understanding and better choice of a suitable ammonium salt for the remote loading method.

  5. Isolation and stable nitrogen isotope analysis of ammonium ions in ammonium nitrate prills using sodium tetraphenylborate.


    Howa, John D; Lott, Michael J; Ehleringer, James R


    Because of the threat of bombings using improvised explosives containing ammonium nitrate (AN), law enforcement and intelligence communities have been interested in stable isotope techniques for tracking and discriminating AN sources. Separate analysis of the AN component ions ammonium and nitrate would add discriminatory power to these techniques. Ammonium ions in dissolved AN solution were isolated from samples by precipitation using sodium tetraphenylborate solution. We tested the isolation of ammonium from nitrates using solutions of ammonium and nitrate salts with different (15)N/(14)N isotope ratios. Ammonium tetraphenylborate and AN were separately analyzed for their (15)N/(14)N isotope ratios using EA-ConFlo-IRMS, and the (15)N/(14)N isotope ratios of the nitrate ions were calculated using mass balance. Ammonium and nitrate nitrogen isotope ratios were plotted as two separate variables. Isolation of ammonium precipitate from solutions containing dissolved nitrates did not influence the nitrogen isotope ratios of test ammonium salts. A survey set of 42 AN samples showed that the ammonium and nitrate (15)N/(14)N isotope ratios were not significantly correlated, and the paired mean differences were not statistically significant. Both ammonium and nitrate were depleted in (15)N relative to their theoretical atmospheric sources. Isolation of the ammonium ion from AN adds another dimension for the discrimination of forensic AN samples. This technique using sodium tetraphenylborate is robust and does not require specialized equipment. Our observations indicated that ammonium nitrogen and nitrate nitrogen have independent sources of isotopic variation. Copyright © 2014 John Wiley & Sons, Ltd.

  6. Electron Paramagnetic Resonance Studies of Single Crystals of Manganese Ion-Doped Ammonium Sulfate, Gadolinium Ion-Doped Ammonium Praseodymium SULFATE.WATER, Vanadium Oxide Ion-Doped M Ammonium SULFATE.WATER

    NASA Astrophysics Data System (ADS)

    Sun, Jiansheng

    Detailed X-band electron paramagnetic resonance (EPR) measurements on single crystals of Mn^ {2+}-doped (NH_4)_2 SO_4, Gd^ {3+}-doped NH_4Pr(SO _4)_2cdot4H _2O, VO^{2+} -doped M(NH_4)_2(SO _4)_2cdot6H_2 O (M = Cd, Co, Mg, Fe, Zn) and Mg(ND_4) _2(SO_4)_2cdot 6D_2O, and Cu^ {2+}-doped MNa_2(SO _4)_2cdot4H _2O (M = Mg, Co) are made at variable temperatures. The spin-Hamiltonian parameters for Mn^{2+ }, Gd^{3+}, VO^{2+} and Cu ^{2+} ions are evaluated using a least-squares-fitting procedure. The positions and local symmetries of the impurity ions in these hosts have been well deduced. The ferroelectric transition in (NH_4) _2SO_4 has been extensively studied via the splittings of Mn^{2+ } EPR lines, leading to the determination of the critical exponent beta. The existence of two inequivalent sublattices in the (NH _4)_2SO_4 crystal is confirmed. Temperature variation of Gd^{3+ } EPR spectra reveal two first-order phase transitions in the NH_4Pr(SO _4)_2cdot4H_2 O crystal. The host-ion spin-lattice relaxation (SLR) times (tau) of Pr^ {3+} have been estimated via the EPR linewidths of Gd^{3+} impurity ions using an appropriate expression. The predominant processes of SLR of Pr^{3+} host -ions have been deduced. The superhyperfine structures of VO^ {2+} EPR spectra in the hydrated Tutton -salt hosts M(NH_4)_2(SO _4)_2cdot6H_2 O have been well explained by comparison with the VO^{2+} EPR spectra in the deuterated host crystal Mg(ND_4)_2 (SO_4)_2cdot6D _2O. Using the VO^ {2+} EPR and optical-absorption spectra, the bonding coefficients of the (VO(H_2 O)_5]^{2+ } complex have been estimated. The systematics of EPR of the VO^{2+} ion in this series of Tutton salts is analyzed. The impurity-host exchange-interaction constant of VO^{2+}-Fe ^{2+} pair is determined in the Fe(NH_4)_2(SO_4) _2cdot6H_2O host, using the g-shift due to the exchange interaction and the shape of the crystal at liquid-helium temperature. The tau values of Fe^ {2+} and Co^{2+} in the Fe(NH_4)_2(SO _4)_2cdot6H _2O and Co(NH_4)_2 (SO_4)_2cdot6H _2O hosts, respectively, have been estimated. The symmetry of the g matrix and temperature dependence of the g principal values of Cu^{2+ } in the MNa_2(SO _4)_2cdot4H_2 O hosts have been explained by taking into account the pseudo-static Jahn-Teller effect (JTE) at room and lower temperatures, and dynamic JTE at higher temperatures, experienced by the CuO_2(H _2O)_4 complex.

  7. Structural study of ammonium metatungstate

    SciTech Connect

    Christian, Joel B. Whittingham, M. Stanley


    Several techniques have been used to study the structure of the Keggin-type polyoxometalate salt ammonium metatungstate (AMT)-(NH{sub 4}){sub 6}[H{sub 2}W{sub 12}O{sub 40}]*nH{sub 2}O, a potential fuel cell catalyst. The dehydrated salt is comprised of a mixture of crystallites of different unit cells in a centered eutactic cubic configuration, with an average unit cell of a{approx_equal}12.295. Varied orientations of the Keggin ions in the cubic arrangement create the differences, and orientational variation within each unit cell size represents an energy well. Progressive hydration of each crystallite leads to expansion of the lattice, with the degree of expansion depending on the locations of the water added in relation to the Keggin ion, which is influenced by cation location and hydrogen bonding. The structural hypothesis is supported by electron diffraction of single and multicrystal samples, by powder density measurements, X-ray powder diffraction studies, synchrotron powder X-ray diffraction, and a priori structural modeling studies. Based on the structure, projected active site densities are compared with nanostructured platinum catalysts for fuel cell application. - Graphical abstract: The structure of ammonium metatungstate powders are highly dependent on hydration and POM molecule rotation, with cation and hydrogen bonding forces directing a mixture of structures that have been studied with bulk and single-crystal methods. The illustration shows Monte Carlo simulated anion structural disorder for the fully dehydrated form of the title compound.

  8. Phase Diagram of Ammonium Nitrate

    NASA Astrophysics Data System (ADS)

    Dunuwille, Mihindra; Yoo, Choong-Shik


    Ammonium Nitrate (AN) has often been subjected to uses in improvised explosive devices, due to its wide availability as a fertilizer and its capability of becoming explosive with slight additions of organic and inorganic compounds. Yet, the origin of enhanced energetic properties of impure AN (or AN mixtures) is neither chemically unique nor well understood - resulting in rather catastrophic disasters in the past1 and thereby a significant burden on safety, in using ammonium nitrates even today. To remedy this situation, we have carried out an extensive study to investigate the phase stability of AN, in different chemical environments, at high pressure and temperature, using diamond anvil cells and micro-Raman spectroscopy. The present results confirm the recently proposed phase IV-to-IV' transition above 15 GPa2 and provide new constraints for the melting and phase diagram of AN to 40 GPa and 673 K. The present study has been supported by the U.S. DHS under Award Number 2008-ST-061-ED0001.

  9. Comparison of normal and asthmatic subjects' responses to sulfate pollutant aerosols

    SciTech Connect

    Utell, M.J.; Morrow, P.E.; Hyde, R.W.


    Epidemiological studies support an association between elevated levels of sulfates and acute respiratory disease. To determine if these pollutants produce airway hyperreactivity, 16 normal and 17 asthmatic subjects inhaled a control NaCl aerosol and the following sulfates: ammonium sulfate, sodium bisulfate, ammonium bisulfate, and sulfuric acid. A Lovelace generator produced particles with an average MMAD of approx. 1.0 (sigma/sub g/ approx. = 2.0) and concentrations of 0.1 and 1.0 mg/m/sup 3/. By double-blind randomization, all subjects breathed these aerosols for a 16-minute period. To determine if sulfate inhalation caused increased reactivity to a known bronchoconstrictor, all subjects inhaled carbachol following each 16-minute exposure. Before, during, and after exposure, pulmonary function studies were performed. When compared to NaCl, sulfate (1 mg/m/sup 3/) produced significant reductions in airway conductance and flow rates in asthmatics. The two most sensitive asthmatics demonstrated changes even at 0.1 mg/m/sup 3/ sulfate. To a far more significant degree, the bronchoconstrictor action of carbachol was potentiated by sulfates more or less in relation to their acidity in normals and asthmatics.

  10. Fate and Role of Ammonium Ions during Fermentation of Citric Acid by Aspergillus niger

    PubMed Central

    Papagianni, Maria; Wayman, Frank; Mattey, Michael


    Stoichiometric modeling of the early stages of the citric acid fermentation process by Aspergillus niger revealed that ammonium ions combine with a carbon-containing metabolite inside the cell, in a ratio 1:1, to form a nitrogen compound which is then excreted by the mycelium. High-performance liquid chromatography analysis identified glucosamine as the product of the relationship between glucose and ammonium during the early stages of the citric acid fermentation process. Slightly acidic internal pHs, extremely low ammonium ion concentrations inside the cell, and glucosamine synthesis come into direct contradiction with the earlier theory of the ammonium pool inside the cell, regarded as responsible for inhibition of the enzyme phosphofructokinase. At later fermentation stages, when the mycelium is involved in a process of fragmentation and regrowth, the addition of ammonium sulfate leads to a series of events: the formation and secretion of glucosamine in elevated amounts, the short inhibition of citrate synthesis, growth enhancement, the utilization of glucosamine, and finally, the enhancement of citric acid production rates. Obviously, the enzymatic processes underlining the phenomena need to be reexamined. As a by-product of the citric acid fermentation, glucosamine is reported for the first time here. Suitable process manipulations of the system described in this work could lead to successful glucosamine recovery at the point of its highest yield before degradation by the fungus occurs. PMID:16269757

  11. Comparative effects of ammonium and nitrate compounds on Pacific treefrog and African clawed frog embryos.


    Schuytema, G S; Nebeker, A V


    The effects of ammonium nitrate, ammonium chloride, ammonium sulfate, and sodium nitrate on survival and growth of Pacific treefrog (Pseudacris regilla) and African clawed frog (Xenopus laevis) embryos were determined in static-renewal tests. The 10-day LC50s for the three ammonium compounds for P. regilla ranged from 25.0-32. 4 mg/L NH4 -N. The 10-day sodium nitrate LC50 for P. regilla was 578. 0 mg/L NO3-N. LC50s for X. laevis exposed for 4 or 5 days to the three ammonium compounds ranged from 27.5-60.2 mg/L NH4-N. The sodium nitrate LC50 for X. laevis ranged from 438.4-871.6 mg/L NO3-N. The lowest LOAEL based on length or weight was 6.1 mg/L NH4-N for the two species. The lowest LOAELs for NO3-N were 111.1 mg/L for P. regilla and 56.7 mg/L for X. laevis. Calculated unionized NH3 comprised 0.5-1.8% of measured NH4-N concentrations. Potential harm to amphibian populations could occur if NH4-N and NO3-N in agricultural runoff or drainage impacts sensitive life stages for a sufficiently long period.

  12. Enhanced sulfidation xanthate flotation of malachite using ammonium ions as activator.


    Wu, Dandan; Ma, Wenhui; Mao, Yingbo; Deng, Jiushuai; Wen, Shuming


    In this study, ammonium ion was used to enhance the sulfidation flotation of malachite. The effect of ammonium ion on the sulfidation flotation of malachite was investigated using microflotation test, inductively coupled plasma (ICP) analysis, zeta potential measurements, and scanning electron microscope analysis (SEM). The results of microflotation test show that the addition of sodium sulfide and ammonium sulfate resulted in better sulfidation than the addition of sodium sulfide alone. The results of ICP analysis indicate that the dissolution of enhanced sulfurized malachite surface is significantly decreased. Zeta potential measurements indicate that a smaller isoelectric point value and a large number of copper-sulfide films formed on the malachite surface by enhancing sulfidation resulted in a large amount of sodium butyl xanthate absorbed onto the enhanced sulfurized malachite surface. EDS semi-quantitative analysis and XPS analysis show that malachite was easily sulfurized by sodium sulfide with ammonium ion. These results show that the addition of ammonium ion plays a significant role in the sulfidation of malachite and results in improved flotation performance.

  13. Effect of ammonium sulfate, ammonium chloride and root-zone acidity on inorganic ion content of tobacco

    NASA Technical Reports Server (NTRS)

    Vessey, J. K.; Raper, C. D. Jr; Henry, L. T.; Raper CD, J. r. (Principal Investigator)


    Tobacco plants (Nicotiana tabacum L. cv NC82) were supplied with (NH4)2SO4 or NH4Cl at root-zone pH of 6.0 and 4.5 in hydroponic culture for 28 days. Dry matter accumulation, total N and C content, and leaf area and number were not affected by the NH4+ source or root-zone pH. Plants supplied with NH4Cl accumulated up to 1.2 mM Cl g DW-1, but accumulated 37% less inorganic H2PO4- and 47% less SO4(2-) than plants supplied with (NH4)2SO4. The large Cl- accumulation resulted in NH4Cl- supplied plants having a 31% higher inorganic anion (NO3-, H2, PO4-, SO4(2-), and Cl-) charge. This higher inorganic anion charge in the NH4Cl-supplied plants was balanced by a similar increase in K+ charge. Plants supplied with NH4Cl accumulated greater concentrations of Cl- in leaves (up to 5.1% of DW) than plants supplied with (NH4)2SO4 (less than -% DW). Despite the high Cl- concentration of leaves in NH4Cl supplied plants, these plants showed no symptoms of Cl- toxicity. This demonstrates that toxicity symptoms are not due solely to an interaction between high Cl- concentration in tissue and NH4+ nutrition. The increase in root-zone acidity to pH 4.5 from 6.0 did not induce toxicity symptoms.

  14. Effect of ammonium sulfate, ammonium chloride and root-zone acidity on inorganic ion content of tobacco

    NASA Technical Reports Server (NTRS)

    Vessey, J. K.; Raper, C. D. Jr; Henry, L. T.; Raper CD, J. r. (Principal Investigator)


    Tobacco plants (Nicotiana tabacum L. cv NC82) were supplied with (NH4)2SO4 or NH4Cl at root-zone pH of 6.0 and 4.5 in hydroponic culture for 28 days. Dry matter accumulation, total N and C content, and leaf area and number were not affected by the NH4+ source or root-zone pH. Plants supplied with NH4Cl accumulated up to 1.2 mM Cl g DW-1, but accumulated 37% less inorganic H2PO4- and 47% less SO4(2-) than plants supplied with (NH4)2SO4. The large Cl- accumulation resulted in NH4Cl- supplied plants having a 31% higher inorganic anion (NO3-, H2, PO4-, SO4(2-), and Cl-) charge. This higher inorganic anion charge in the NH4Cl-supplied plants was balanced by a similar increase in K+ charge. Plants supplied with NH4Cl accumulated greater concentrations of Cl- in leaves (up to 5.1% of DW) than plants supplied with (NH4)2SO4 (less than -% DW). Despite the high Cl- concentration of leaves in NH4Cl supplied plants, these plants showed no symptoms of Cl- toxicity. This demonstrates that toxicity symptoms are not due solely to an interaction between high Cl- concentration in tissue and NH4+ nutrition. The increase in root-zone acidity to pH 4.5 from 6.0 did not induce toxicity symptoms.

  15. 49 CFR 176.410 - Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures.

    Code of Federal Regulations, 2012 CFR


    ... 49 Transportation 2 2012-10-01 2012-10-01 false Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures. 176.410 Section 176.410 Transportation Other Regulations Relating to... nitrate and ammonium nitrate mixtures. (a) This section prescribes requirements to be observed...

  16. 49 CFR 176.410 - Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures.

    Code of Federal Regulations, 2011 CFR


    ... 49 Transportation 2 2011-10-01 2011-10-01 false Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures. 176.410 Section 176.410 Transportation Other Regulations Relating to... nitrate and ammonium nitrate mixtures. (a) This section prescribes requirements to be observed...

  17. 49 CFR 176.410 - Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures.

    Code of Federal Regulations, 2010 CFR


    ... 49 Transportation 2 2010-10-01 2010-10-01 false Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures. 176.410 Section 176.410 Transportation Other Regulations Relating to... nitrate and ammonium nitrate mixtures. (a) This section prescribes requirements to be observed...

  18. 33 CFR 126.28 - Ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate...

    Code of Federal Regulations, 2012 CFR


    ... nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. 126.28 Section 126..., ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. (a) When any item of ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo...

  19. 33 CFR 126.28 - Ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate...

    Code of Federal Regulations, 2011 CFR


    ... nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. 126.28 Section 126..., ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. (a) When any item of ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo...

  20. 33 CFR 126.28 - Ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate...

    Code of Federal Regulations, 2014 CFR


    ... nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. 126.28 Section 126..., ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. (a) When any item of ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo...

  1. 33 CFR 126.28 - Ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate...

    Code of Federal Regulations, 2013 CFR


    ... nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. 126.28 Section 126..., ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo nitrate; general provisions. (a) When any item of ammonium nitrate, ammonium nitrate fertilizers, fertilizer mixtures, or nitro carbo...

  2. Impacts of Sulfate Seed Acidity and Water Content on Isoprene Secondary Organic Aerosol Formation.


    Wong, Jenny P S; Lee, Alex K Y; Abbatt, Jonathan P D


    The effects of particle-phase water and the acidity of pre-existing sulfate seed particles on the formation of isoprene secondary organic aerosol (SOA) was investigated. SOA was generated from the photo-oxidation of isoprene in a flow tube reactor at 70% relative humidity (RH) and room temperature in the presence of three different sulfate seeds (effloresced and deliquesced ammonium sulfate and ammonium bisulfate) under low NOx conditions. High OH exposure conditions lead to little isoprene epoxydiol (IEPOX) SOA being generated. The primary result is that particle-phase water had the largest effect on the amount of SOA formed, with 60% more SOA formation occurring with deliquesced ammonium sulfate seeds as compared to that on effloresced ones. The additional organic material was highly oxidized. Although the amount of SOA formed did not exhibit a dependence on the range of seed particle acidity examined, perhaps because of the low amount of IEPOX SOA, the levels of high-molecular-weight material increased with acidity. While the uptake of organics was partially reversible under drying, the results nevertheless indicate that particle-phase water enhanced the amount of organic aerosol material formed and that the RH cycling of sulfate particles may mediate the extent of isoprene SOA formation in the atmosphere.

  3. Phase diagram of ammonium nitrate

    NASA Astrophysics Data System (ADS)

    Dunuwille, Mihindra; Yoo, Choong-Shik


    Ammonium Nitrate (AN) is a fertilizer, yet becomes an explosive upon a small addition of chemical impurities. The origin of enhanced chemical sensitivity in impure AN (or AN mixtures) is not well understood, posing significant safety issues in using AN even today. To remedy the situation, we have carried out an extensive study to investigate the phase stability of AN and its mixtures with hexane (ANFO-AN mixed with fuel oil) and Aluminum (Ammonal) at high pressures and temperatures, using diamond anvil cells (DAC) and micro-Raman spectroscopy. The results indicate that pure AN decomposes to N2, N2O, and H2O at the onset of the melt, whereas the mixtures, ANFO and Ammonal, decompose at substantially lower temperatures. The present results also confirm the recently proposed phase IV-IV' transition above 17 GPa and provide new constraints for the melting and phase diagram of AN to 40 GPa and 400°C.

  4. 76 FR 46907 - Ammonium Nitrate Security Program

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... comments. SUMMARY: This proposed rule would implement anti-terrorism measures to better secure the homeland... purpose of preventing the use of ammonium nitrate in an act of terrorism. This proposed rule seeks comment... Regulations Addressing Ammonium Nitrate a. Chemical Facility Anti-Terrorism Standards b. U.S. Coast...

  5. Biodegradation of rocket propellant waste, ammonium perchlorate

    NASA Technical Reports Server (NTRS)

    Naqvi, S. M. Z.; Latif, A.


    The short term effects of ammonium perchlorate on selected organisms were studied. A long term experiment was also designed to assess the changes incurred by ammonium perchlorate on the nitrogen and chloride contents of soil within a period of 3 years. In addition, an attempt was made to produce methane gas from anaerobic fermentation of the aquatic weed, Alternanthera philoxeroides.

  6. Dielectric relaxations in partly deuterated ammonium dichromate

    NASA Astrophysics Data System (ADS)

    Gilchrist, John le G.


    Two dielectric relaxations in partly deuterated ammonium dichromate are attributed to reorientations of mixed-isotope ammonium ions. Loss peaks were observed between 20 and 40 K and obey the Arrhenius law with activation energy 1.5 kcal/mol for the stronger relaxation. The dipole moment is of the order of 0.015 D.

  7. Ammonium nonanoate broadcast application over onions

    USDA-ARS?s Scientific Manuscript database

    Ammonium nonanoate occurs in nature and is primarily formed from biodegradation of higher fatty acids. Racer (40% ammonium nonaoate) is a potential contact herbicide for weed control in organic crop production. Field research was conducted in southeast Oklahoma (Atoka County, Lane, OK) to determin...

  8. Evolution of Electrogenic Ammonium Transporters (AMTs)


    McDonald, Tami R.; Ward, John M.


    The ammonium transporter gene family consists of three main clades, AMT, MEP, and Rh. The evolutionary history of the AMT/MEP/Rh gene family is characterized by multiple horizontal gene transfer events, gene family expansion and contraction, and gene loss; thus the gene tree for this family of transporters is unlike the organismal tree. The genomes of angiosperms contain genes for both electrogenic and electroneutral ammonium transporters, but it is not clear how far back in the land plant lineage electrogenic ammonium transporters occur. Here, we place Marchantia polymorpha ammonium transporters in the AMT/MEP/Rh phylogeny and we show that AMTs from themore » liverwort M. polymorpha are electrogenic. This information suggests that electrogenic ammonium transport evolved at least as early as the divergence of bryophytes in the land plant lineage.« less

  9. Evolution of Electrogenic Ammonium Transporters (AMTs)

    SciTech Connect

    McDonald, Tami R.; Ward, John M.


    The ammonium transporter gene family consists of three main clades, AMT, MEP, and Rh. The evolutionary history of the AMT/MEP/Rh gene family is characterized by multiple horizontal gene transfer events, gene family expansion and contraction, and gene loss; thus the gene tree for this family of transporters is unlike the organismal tree. The genomes of angiosperms contain genes for both electrogenic and electroneutral ammonium transporters, but it is not clear how far back in the land plant lineage electrogenic ammonium transporters occur. Here, we place Marchantia polymorpha ammonium transporters in the AMT/MEP/Rh phylogeny and we show that AMTs from the liverwort M. polymorpha are electrogenic. This information suggests that electrogenic ammonium transport evolved at least as early as the divergence of bryophytes in the land plant lineage.

  10. Evolution of Electrogenic Ammonium Transporters (AMTs)

    PubMed Central

    McDonald, Tami R.; Ward, John M.


    The ammonium transporter gene family consists of three main clades, AMT, MEP, and Rh. The evolutionary history of the AMT/MEP/Rh gene family is characterized by multiple horizontal gene transfer events, gene family expansion and contraction, and gene loss; thus the gene tree for this family of transporters is unlike the organismal tree. The genomes of angiosperms contain genes for both electrogenic and electroneutral ammonium transporters, but it is not clear how far back in the land plant lineage electrogenic ammonium transporters occur. Here, we place Marchantia polymorpha ammonium transporters in the AMT/MEP/Rh phylogeny and we show that AMTs from the liverwort M. polymorpha are electrogenic. This information suggests that electrogenic ammonium transport evolved at least as early as the divergence of bryophytes in the land plant lineage. PMID:27066024

  11. 49 CFR 176.415 - Permit requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers.

    Code of Federal Regulations, 2012 CFR


    ... nitrates, and certain ammonium nitrate fertilizers. 176.415 Section 176.415 Transportation Other... requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers. (a) Except as... Captain of the Port (COTP). (1) Ammonium nitrate UN1942, ammonium nitrate fertilizers containing more...

  12. 49 CFR 176.415 - Permit requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers.

    Code of Federal Regulations, 2013 CFR


    ... nitrates, and certain ammonium nitrate fertilizers. 176.415 Section 176.415 Transportation Other... requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers. (a) Except as... Captain of the Port (COTP). (1) Ammonium nitrate UN1942, ammonium nitrate fertilizers containing more...

  13. 49 CFR 176.415 - Permit requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers.

    Code of Federal Regulations, 2014 CFR


    ... nitrates, and certain ammonium nitrate fertilizers. 176.415 Section 176.415 Transportation Other... requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers. (a) Except as... Captain of the Port (COTP). (1) Ammonium nitrate UN1942, ammonium nitrate fertilizers containing more...

  14. Sulfate attack expansion mechanisms

    SciTech Connect

    Müllauer, Wolfram Beddoe, Robin E.; Heinz, Detlef


    A specially constructed stress cell was used to measure the stress generated in thin-walled Portland cement mortar cylinders caused by external sulfate attack. The effects of sulfate concentration of the storage solution and C{sub 3}A content of the cement were studied. Changes in mineralogical composition and pore size distribution were investigated by X-ray diffraction and mercury intrusion porosimetry, respectively. Damage is due to the formation of ettringite in small pores (10–50 nm) which generates stresses up to 8 MPa exceeding the tensile strength of the binder matrix. Higher sulfate concentrations and C{sub 3}A contents result in higher stresses. The results can be understood in terms of the effect of crystal surface energy and size on supersaturation and crystal growth pressure.

  15. Recovery of discarded sulfated lead-acid batteries

    NASA Astrophysics Data System (ADS)

    Karami, Hassan; Asadi, Raziyeh

    The aim of this research is to recover discarded sulfated lead-acid batteries. In this work, the effect of two methods (inverse charge and chemical charge) on the reactivation of sulfated active materials was investigated. At the inverse charge, the battery is deeply discharged and the electrolyte of battery is replaced with a new sulfuric acid solution of 1.28 g cm -3. Then, the battery is inversely charged with constant current method (2 A for the battery with the nominal capacity of 40 Ah) for 24 h. At the final stage, the inversely charged battery is directly charged for 48 h. Through these processes, a discarded battery can recover its capacity to more than 80% of a similar fresh and non-sulfated battery. At the chemical charge method, there are some effective parameters that including ammonium persulfate [(NH 4) 2S 2O 8] concentration, recovery temperature and recovery time. The effect of all parameters was optimized by one at a time method. The sulfated battery is deeply discharged and then, its electrolyte was replaced by a 40% ammonium persulfate solution (as oxidant) at temperature of 50 °C. By adding of oxidant solution, the chemical charging of positive and negative plates was performed for optimum time of 1 h. The chemically charged batteries were charged with constant voltage method (2.66 V for the battery with nominal voltage and nominal capacity of 2 V and 10 Ah, respectively) for 24 h. By performing of these processes, a discarded battery can recovers its capacity to more than 84% of the similar fresh and non-sulfated battery. Discharge and cyclelife behaviors of the recovered batteries were investigated and compared with similar healthy battery. The morphology and structure of plates was studied by scanning electron microscopy (SEM) before and after recovery.

  16. Crystallization of Chicken Egg White Lysozyme from Assorted Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Malone, Christine C.; Pusey, Marc L.


    Chicken egg white lysozyme has been found to crystallize from ammonium, sodium, potassium, rubidium, magnesium, and manganese sulfates at acidic and basic pH, with protein concentrations from 60 to 190 mg/ml. Four different crystal morphologies have been obtained, depending upon the temperature, protein concentration, and precipitating salt employed, Crystals grown at 15 C were generally tetragonal, with space group P43212. Crystallization at 20 C typically resulted in the formation of orthorhombic crystals, space group P21212 1. The tetragonal much less than orthorhombic morphology transition appeared to be a function of both the temperature and protein concentration, occurring between 15 and 20 C and between 100 and 125 mg/ml protein concentration. Crystallization from 0.8 -1.2M magnesium sulfate at pH 7.6 - 8.0 gave a hexagonal (trigonal) crystal form, space group P3121, which diffracted to 2.8 A. Ammonium sulfate was also found to result in a monoclinic form, space group C2. Small twinned monoclinic crystals of approx. 0.2 mm on edge were grown by dialysis followed by seeded sitting drop crystallization.

  17. Crystallization of Chicken Egg White Lysozyme from Assorted Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Malone, Christine C.; Pusey, Marc L.


    Chicken egg white lysozyme has been found to crystallize from ammonium, sodium, potassium, rubidium, magnesium, and manganese sulfates at acidic and basic pH, with protein concentrations from 60 to 190 mg/ml. Four different crystal morphologies have been obtained, depending upon the temperature, protein concentration, and precipitating salt employed, Crystals grown at 15 C were generally tetragonal, with space group P43212. Crystallization at 20 C typically resulted in the formation of orthorhombic crystals, space group P21212 1. The tetragonal much less than orthorhombic morphology transition appeared to be a function of both the temperature and protein concentration, occurring between 15 and 20 C and between 100 and 125 mg/ml protein concentration. Crystallization from 0.8 -1.2M magnesium sulfate at pH 7.6 - 8.0 gave a hexagonal (trigonal) crystal form, space group P3121, which diffracted to 2.8 A. Ammonium sulfate was also found to result in a monoclinic form, space group C2. Small twinned monoclinic crystals of approx. 0.2 mm on edge were grown by dialysis followed by seeded sitting drop crystallization.

  18. The nucleation kinetics of ammonium metavanadate precipitated by ammonium chloride

    NASA Astrophysics Data System (ADS)

    Du, Guangchao; Sun, Zhaohui; Xian, Yong; Jing, Han; Chen, Haijun; Yin, Danfeng


    The nucleation kinetics of ammonium metavanadate (NH4VO3) was investigated under conditions of the simulated process for precipitation of NH4VO3 from the vanadium-containing solution. Induction periods for the nucleation of NH4VO3 were experimentally determined as a function of supersaturation at temperatures from 30 to 45 °C. Using the classical nucleation theory, the interfacial tension between NH4VO3 and supersaturated solution, the nucleation rate and critical radius of nucleus for the homogeneous nucleation of NH4VO3 were estimated. With temperature increasing, the calculated interfacial tension gradually decreased from 29.78 mJ/m2 at 30 °C to 23.66 mJ/m2 at 45 °C. The nucleation rate was found to proportionally increase but the critical radius of nucleus exponentially decreased, with increase in supersaturation ratio at a constant temperature. The activation energy for NH4VO3 nucleation was obtained from the relationship between temperature and induction period, ranging from 79.17 kJ/mol at S=25 to 115.50 kJ/mol at S=15. FT-IR and Raman spectrum indicated that the crystals obtained in the precipitation process were NH4VO3.

  19. 21 CFR 73.1298 - Ferric ammonium ferrocyanide.

    Code of Federal Regulations, 2013 CFR


    ...) Identity. (1) The color additive ferric ammonium ferrocyanide is the blue pigment obtained by oxidizing... product is filtered, washed, and dried. The pigment consists principally of ferric ammonium...

  20. 21 CFR 73.1298 - Ferric ammonium ferrocyanide.

    Code of Federal Regulations, 2010 CFR


    ...) Identity. (1) The color additive ferric ammonium ferrocyanide is the blue pigment obtained by oxidizing... product is filtered, washed, and dried. The pigment consists principally of ferric ammonium...

  1. 21 CFR 73.1298 - Ferric ammonium ferrocyanide.

    Code of Federal Regulations, 2014 CFR


    ...) Identity. (1) The color additive ferric ammonium ferrocyanide is the blue pigment obtained by oxidizing... product is filtered, washed, and dried. The pigment consists principally of ferric ammonium...

  2. 21 CFR 73.1298 - Ferric ammonium ferrocyanide.

    Code of Federal Regulations, 2012 CFR


    ...) Identity. (1) The color additive ferric ammonium ferrocyanide is the blue pigment obtained by oxidizing... product is filtered, washed, and dried. The pigment consists principally of ferric ammonium...

  3. Aluminum Sulfate 18 Hydrate

    ERIC Educational Resources Information Center

    Young, Jay A.


    A chemical laboratory information profile (CLIP) of the chemical, aluminum sulfate 18 hydrate, is presented. The profile lists physical and harmful properties, exposure limits, reactivity risks, and symptoms of major exposure for the benefit of teachers and students using the chemical in the laboratory.

  4. Hydrazine/Hydrazine sulfate

    Integrated Risk Information System (IRIS)

    Hydrazine / Hydrazine sulfate ; CASRN 302 - 01 - 2 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Non

  5. Aluminum Sulfate 18 Hydrate

    ERIC Educational Resources Information Center

    Young, Jay A.


    A chemical laboratory information profile (CLIP) of the chemical, aluminum sulfate 18 hydrate, is presented. The profile lists physical and harmful properties, exposure limits, reactivity risks, and symptoms of major exposure for the benefit of teachers and students using the chemical in the laboratory.

  6. Phase diagram of ammonium nitrate

    SciTech Connect

    Dunuwille, Mihindra; Yoo, Choong-Shik


    Ammonium Nitrate (AN) is a fertilizer, yet becomes an explosive upon a small addition of chemical impurities. The origin of enhanced chemical sensitivity in impure AN (or AN mixtures) is not well understood, posing significant safety issues in using AN even today. To remedy the situation, we have carried out an extensive study to investigate the phase stability of AN and its mixtures with hexane (ANFO–AN mixed with fuel oil) and Aluminum (Ammonal) at high pressures and temperatures, using diamond anvil cells (DAC) and micro-Raman spectroscopy. The results indicate that pure AN decomposes to N{sub 2}, N{sub 2}O, and H{sub 2}O at the onset of the melt, whereas the mixtures, ANFO and Ammonal, decompose at substantially lower temperatures. The present results also confirm the recently proposed phase IV-IV{sup ′} transition above 17 GPa and provide new constraints for the melting and phase diagram of AN to 40 GPa and 400°C.

  7. Substrate specificity of Rhbg: ammonium and methyl ammonium transport

    PubMed Central

    Abdulnour-Nakhoul, Solange M.; Boulpaep, Emile L.; Rabon, Edd; Schmidt, Eric; Hamm, L. Lee


    Rhbg is a nonerythroid membrane glycoprotein belonging to the Rh antigen family. In the kidney, Rhbg is expressed at the basolateral membrane of intercalated cells of the distal nephron and is involved in NH4+ transport. We investigated the substrate specificity of Rhbg by comparing transport of NH3/NH4+ with that of methyl amine (hydrochloride) (MA/MA+), often used to replace NH3/NH4+, in oocytes expressing Rhbg. Methyl amine (HCl) in solution exists as neutral methyl amine (MA) in equilibrium with the protonated methyl ammonium (MA+). To assess transport, we used ion-selective microelectrodes and voltage-clamp experiments to measure NH3/NH4+- and MA/MA+-induced intracellular pH (pHi) changes and whole cell currents. Our data showed that in Rhbg oocytes, NH3/NH4+ caused an inward current and decrease in pHi consistent with electrogenic NH4+ transport. These changes were significantly larger than in H2O-injected oocytes. The NH3/NH4+-induced current was not inhibited in the presence of barium or in the absence of Na+. In Rhbg oocytes, MA/MA+ caused an inward current but an increase (rather than a decrease) in pHi. MA/MA+ did not cause any changes in H2O-injected oocytes. The MA/MA+-induced current and pHi increase were saturated at higher concentrations of MA/MA+. Amiloride inhibited MA/MA+-induced current and the increase in pHi in oocytes expressing Rhbg but had no effect on control oocytes. These results indicate that MA/MA+ is transported by Rhbg but differently than NH3/NH4+. The protonated MA+ is likely a direct substrate whose transport resembles that of NH4+. Transport of electroneutral MA is also enhanced by expression of Rhbg. PMID:20592240

  8. Substrate specificity of Rhbg: ammonium and methyl ammonium transport.


    Nakhoul, Nazih L; Abdulnour-Nakhoul, Solange M; Boulpaep, Emile L; Rabon, Edd; Schmidt, Eric; Hamm, L Lee


    Rhbg is a nonerythroid membrane glycoprotein belonging to the Rh antigen family. In the kidney, Rhbg is expressed at the basolateral membrane of intercalated cells of the distal nephron and is involved in NH4+ transport. We investigated the substrate specificity of Rhbg by comparing transport of NH3/NH4+ with that of methyl amine (hydrochloride) (MA/MA+), often used to replace NH3/NH4+, in oocytes expressing Rhbg. Methyl amine (HCl) in solution exists as neutral methyl amine (MA) in equilibrium with the protonated methyl ammonium (MA+). To assess transport, we used ion-selective microelectrodes and voltage-clamp experiments to measure NH3/NH4+- and MA/MA+-induced intracellular pH (pH(i)) changes and whole cell currents. Our data showed that in Rhbg oocytes, NH3/NH4+ caused an inward current and decrease in pH(i) consistent with electrogenic NH4+ transport. These changes were significantly larger than in H2O-injected oocytes. The NH3/NH4+-induced current was not inhibited in the presence of barium or in the absence of Na+. In Rhbg oocytes, MA/MA+ caused an inward current but an increase (rather than a decrease) in pH(i). MA/MA+ did not cause any changes in H2O-injected oocytes. The MA/MA+-induced current and pH(i) increase were saturated at higher concentrations of MA/MA+. Amiloride inhibited MA/MA+-induced current and the increase in pH(i) in oocytes expressing Rhbg but had no effect on control oocytes. These results indicate that MA/MA+ is transported by Rhbg but differently than NH3/NH4+. The protonated MA+ is likely a direct substrate whose transport resembles that of NH4+. Transport of electroneutral MA is also enhanced by expression of Rhbg.

  9. Sulfate metabolism. I. Sulfate uptake and redistribution of acid rain sulfate by edible plants

    SciTech Connect

    Dallam, R.D.


    Sulfur is the major component of polluted air in industrialized societies. Atmospheric sulfur is converted to sulfuric acid through a series of chemical reactions which can eventually reenter many ecosystems. When edible plants are grown in soils containing varying amounts of sulfate, the roots take up and transport inorganic sulfate to the stems and leaves. The sulfate taken up by the roots and the amount transported to the stem and leaves was found to be a function of the concentration of sulfate in the soil. Inorganic sulfate taken up by a corn plant seedling can be rapidly converted to organic sulfate by the root system. Nine days after one of a pair of pea plants was inoculated with artificial acid rain sulfate (dilute H/sub 2//sup 35/SO/sub 4/) it was found that the sulfate was translocated not only in the inoculated plant, but also to the uninoculated pea plant in the same container. Also, when the leaves of a mature potato plant were inoculated with artificial acid rain sulfate it was found that the sulfate was translocated into the edible potatoes. Fractionation of the potatoes showed that most of the sulfate was water soluble of which 30% was inorganic sulfate and 70% was in the form of organic sulfur. One third of the non-water soluble translocated acid rain sulfate was equally divided between lipid and non-lipid organic sulfur of the potato. 9 references, 2 figures, 5 tables.

  10. The mechanism of ammonium bisulfate formation and decomposition over V/WTi catalysts for NH3-selective catalytic reduction at various temperatures.


    Li, Chenxu; Shen, Meiqing; Yu, Tie; Wang, Jianqiang; Wang, Jun; Zhai, Yanping


    In this study, the mechanism of ammonium bisulfate (ABS) formation and decomposition over V/WTi for the NH3-selective catalytic reduction (SCR) at various temperatures was deeply investigated. Bridged bidentate, chelating bidentate, and tridentate sulfates bound to TiO2 were formed as dominant intermediates at 200, 250, and 300 °C, respectively. These sulfates reacted with affinitive ammonium species to form ammonium (bi)sulfate species and also covered the active sites and embedded the VOSO4 intermediates, which resulted in an inferior intrinsic NH3-SCR conversion rate at 200 °C and 250 °C. At 300 °C, trace amounts of ABS on TiO2 presented no influence on the NH3-SCR performance. The electrons deviating towards sulfates through the bond between ABS and metal oxides (WO3 and TiO2) weakened the stability of ABS and lowered its decomposition temperature, whereas the vanadia species played the opposite role due to the sulfur species existing in an electron saturation state with the formation of the VOSO4 intermediate. The presence of NO + O2 could break the bonds inside ABS and it could react with the ammonium species originating from ABS, which pulls NH3 out of the ABS formation equilibrium and accelerates its decomposition and competitively inhibits its formation. Correspondingly, the faster NH3-SCR conversion rate and higher N2 selectivity improve the ABS poisoning resistance of the V/WTi catalyst at low temperatures.

  11. Ammonium deficiency caused by heterogeneous reactions during a super Asian dust episode

    NASA Astrophysics Data System (ADS)

    Hsu, Shih-Chieh; Lee, Celine Siu Lan; Huh, Chih-An; Shaheen, Robina; Lin, Fei-Jan; Liu, Shaw Chen; Liang, Mao-Chang; Tao, Jun


    Mineral dust particles exert profound impacts on air quality, visibility, and ocean biogeochemistry. Interactions between dust particles and other anthropogenic pollutants modify not only the size spectrum and morphology but also physicochemical properties of dust particles, thereby affecting their radiative properties and ability to act as cloud condensation nuclei and in turn their impact on climate. Here we report field observations on the surface chemical transformations in a super Asian dust plume captured in coastal areas of China and the adjacent marginal seas. The dust plume showed enhanced concentrations of sulfate, nitrate, and calcium along with a decrease in ammonium. The percentages of total Ca in water-soluble form increased from an intrinsic value of ~5% to 25-40% at four stations along the path of the dust plume. From these increases, we estimated the extent to which carbonate was modified by heterogeneous reactions and calculated that the enhanced sulfate and nitrate could account for 40-60% of the observed concentrations. Our observation suggests that the formation of ammonium sulfate via the H2SO4-NH3-H2O ternary system was impeded by heterogeneous reactions in the marine boundary layer when dust loads exceeded a certain threshold. A conceptual model is proposed to elucidate the heterogeneous reactions during the super Asian dust event and their impacts on atmospheric chemistry.

  12. Identification and Functional Analysis of an Ammonium Transporter in Streptococcus mutans

    PubMed Central

    Ardin, Arifah Chieko; Fujita, Kazuyo; Nagayama, Kayoko; Takashima, Yukiko; Nomura, Ryota; Nakano, Kazuhiko; Ooshima, Takashi; Matsumoto-Nakano, Michiyo


    Streptococcus mutans, a Gram-positive bacterium, is considered to be a major etiologic agent of human dental caries and reported to form biofilms known as dental plaque on tooth surfaces. This organism is also known to possess a large number of transport proteins in the cell membrane for export and import of molecules. Nitrogen is an essential nutrient for Gram-positive bacteria, though alternative sources such as ammonium can also be utilized. In order to obtain nitrogen for macromolecular synthesis, nitrogen-containing compounds must be transported into the cell. However, the ammonium transporter in S. mutans remains to be characterized. The present study focused on characterizing the ammonium transporter gene of S. mutans and its operon, while related regulatory genes were also analyzed. The SMU.1658 gene corresponding to nrgA in S. mutans is homologous to the ammonium transporter gene in Bacillus subtilis and SMU.1657, located upstream of the nrgA gene and predicted to be glnB, is a member of the PII protein family. Using a nrgA-deficient mutant strain (NRGD), we examined bacterial growth in the presence of ammonium, calcium chloride, and manganese sulfate. Fluorescent efflux assays were also performed to reveal export molecules associated with the ammonium transporter. The growth rate of NRGD was lower, while its fluorescent intensity was much higher as compared to the parental strain. In addition, confocal laser scanning microscopy revealed that the structure of biofilms formed by NRGD was drastically different than that of the parental strain. Furthermore, transcriptional analysis showed that the nrgA gene was co-transcribed with the glnB gene. These results suggest that the nrgA gene in S. mutans is essential for export of molecules and biofilm formation. PMID:25229891

  13. Impact of sulfate pollution on anaerobic biogeochemical cycles in a wetland sediment.


    Baldwin, Darren S; Mitchell, Alison


    The impact of sulfate pollution is increasingly being seen as an issue in the management of inland aquatic ecosystems. In this study we use sediment slurry experiments to explore the addition of sulfate, with or without added carbon, on the anaerobic biogeochemical cycles in a wetland sediment that previously had not been exposed to high levels of sulfate. Specifically we looked at the cycling of S (sulfate, dissolved and particulate sulfide--the latter measured as acid volatile sulfide; AVS), C (carbon dioxide, bicarbonate, methane and the short chain volatile fatty acids formate, acetate, butyrate and propionate), N (dinitrogen, ammonium, nitrate and nitrite) and redox active metals (Fe(II) and Mn(II)). Sulfate had the largest effects on the cycling of S and C. All the added S at lower loadings were converted to AVS over the course of the experiment (30 days). At the highest loading (8 mmol) less than 50% of consumed S was converted to AVS, however this is believed to be a kinetic effect. Although sulfate reduction was occurring in sediments with added sulfate, dissolved sulfide concentrations remained low throughout the study. Sulfate addition affected methanogenesis. In the absence of added carbon, addition of sulfate, even at a loading of 1 mmol, resulted in a halving of methane formation. The initial rate of formation of methane was not affected by sulfate if additional carbon was added to the sediment. However, there was evidence for anaerobic methane oxidation in those sediments with added sulfate and carbon, but not in those sediments treated only with carbon. Surprisingly, sulfate addition had little apparent impact on N dynamics; previous studies have shown that sulfide can inhibit denitrification and stimulate dissimilatory nitrate reduction to ammonia. We propose that because most of the reduced sulfur was in particulate form, levels of dissolved sulfide were too low to interfere with the N cycle. Crown Copyright © 2011. Published by Elsevier Ltd. All

  14. 21 CFR 184.1307 - Ferric sulfate.

    Code of Federal Regulations, 2014 CFR


    ....1307 Ferric sulfate. (a) Ferric sulfate (iron (III) sulfate, Fe2(SO4)3 CAS Reg. No. 10028-22-5) is a yellow substance that may be prepared by oxidizing iron (II) sulfate or by treating ferric oxide...

  15. 76 FR 70366 - Ammonium Nitrate Security Program

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...- accessible Internet access could obtain the access necessary to register online. 3. How to best notify... ammonium nitrate sellers (AN Sellers) when it is not possible for an AN Seller to verify the identity of...

  16. Biodegradation of rocket propellent waste, ammonium perchlorate

    NASA Technical Reports Server (NTRS)

    Naqui, S. M. Z.


    The impact of the biodegradation rate of ammonium perchlorate on the environment was studied in terms of growth, metabolic rate, and total biomass of selected animal and plant species. Brief methodology and detailed results are presented.

  17. Electrochemically and Bioelectrochemically Induced Ammonium Recovery

    PubMed Central

    Gildemyn, Sylvia; Luther, Amanda K.; Andersen, Stephen J.; Desloover, Joachim; Rabaey, Korneel


    Streams such as urine and manure can contain high levels of ammonium, which could be recovered for reuse in agriculture or chemistry. The extraction of ammonium from an ammonium-rich stream is demonstrated using an electrochemical and a bioelectrochemical system. Both systems are controlled by a potentiostat to either fix the current (for the electrochemical cell) or fix the potential of the working electrode (for the bioelectrochemical cell). In the bioelectrochemical cell, electroactive bacteria catalyze the anodic reaction, whereas in the electrochemical cell the potentiostat applies a higher voltage to produce a current. The current and consequent restoration of the charge balance across the cell allow the transport of cations, such as ammonium, across a cation exchange membrane from the anolyte to the catholyte. The high pH of the catholyte leads to formation of ammonia, which can be stripped from the medium and captured in an acid solution, thus enabling the recovery of a valuable nutrient. The flux of ammonium across the membrane is characterized at different anolyte ammonium concentrations and currents for both the abiotic and biotic reactor systems. Both systems are compared based on current and removal efficiencies for ammonium, as well as the energy input required to drive ammonium transfer across the cation exchange membrane. Finally, a comparative analysis considering key aspects such as reliability, electrode cost, and rate is made. This video article and protocol provide the necessary information to conduct electrochemical and bioelectrochemical ammonia recovery experiments. The reactor setup for the two cases is explained, as well as the reactor operation. We elaborate on data analysis for both reactor types and on the advantages and disadvantages of bioelectrochemical and electrochemical systems. PMID:25651406

  18. Electrochemically and bioelectrochemically induced ammonium recovery.


    Gildemyn, Sylvia; Luther, Amanda K; Andersen, Stephen J; Desloover, Joachim; Rabaey, Korneel


    Streams such as urine and manure can contain high levels of ammonium, which could be recovered for reuse in agriculture or chemistry. The extraction of ammonium from an ammonium-rich stream is demonstrated using an electrochemical and a bioelectrochemical system. Both systems are controlled by a potentiostat to either fix the current (for the electrochemical cell) or fix the potential of the working electrode (for the bioelectrochemical cell). In the bioelectrochemical cell, electroactive bacteria catalyze the anodic reaction, whereas in the electrochemical cell the potentiostat applies a higher voltage to produce a current. The current and consequent restoration of the charge balance across the cell allow the transport of cations, such as ammonium, across a cation exchange membrane from the anolyte to the catholyte. The high pH of the catholyte leads to formation of ammonia, which can be stripped from the medium and captured in an acid solution, thus enabling the recovery of a valuable nutrient. The flux of ammonium across the membrane is characterized at different anolyte ammonium concentrations and currents for both the abiotic and biotic reactor systems. Both systems are compared based on current and removal efficiencies for ammonium, as well as the energy input required to drive ammonium transfer across the cation exchange membrane. Finally, a comparative analysis considering key aspects such as reliability, electrode cost, and rate is made. This video article and protocol provide the necessary information to conduct electrochemical and bioelectrochemical ammonia recovery experiments. The reactor setup for the two cases is explained, as well as the reactor operation. We elaborate on data analysis for both reactor types and on the advantages and disadvantages of bioelectrochemical and electrochemical systems.

  19. Novel diffusive gradients in thin films technique to assess labile sulfate in soil.


    Hanousek, Ondrej; Mason, Sean; Santner, Jakob; Chowdhury, Md Mobaroqul Ahsan; Berger, Torsten W; Prohaska, Thomas


    A novel diffusive gradients in thin films (DGT) technique for sampling labile soil sulfate was developed, based on a strong basic anion exchange resin (Amberlite IRA-400) for sulfate immobilization on the binding gel. For reducing the sulfate background on the resin gels, photopolymerization was applied instead of ammonium persulfate-induced polymerization. Agarose cross-linked polyacrylamide (APA) hydrogels were used as diffusive layer. The sulfate diffusion coefficient in APA gel was determined as 9.83 × 10(-6) ± 0.35 × 10(-6) cm(2) s(-1) at 25 °C. The accumulated sulfate was eluted in 1 mol L(-1) HNO3 with a recovery of 90.9 ± 1.6 %. The developed method was tested against two standard extraction methods for soil sulfate measurement. The obtained low correlation coefficients indicate that DGT and conventional soil test methods assess differential soil sulfate pools, rendering DGT a potentially important tool for measuring labile soil sulfate.

  20. Temperature variation of the optical absorption edge for ammonium aluminum alum

    NASA Astrophysics Data System (ADS)

    Korchak, Yu. M.; Kapustyanyk, V. B.; Partyka, M. V.; Rudyk, V. P.


    We have studied the absorption spectra of NH4Al(SO4)2·12H2O crystal hydrates in the visible region of the spectrum, near the low-temperature phase transition at Tc = 76 K. We have shown that the absorption edge in these materials has an exponential shape, following the empirical Urbach’s rule as a result of exciton-phonon interaction. The relatively strong exciton-phonon interaction is associated with a band formed by self-localized (self-trapped) excitons. The experimental data obtained support the presence of a phase transition in the studied ammonium alum at 76 K. We have shown that ammonium aluminum sulfate dodecahydrate crystals are promising materials for fabricating laser frequency converters.

  1. Complex Refractive Index of Ammonium Nitrate in the 2-20 micron Spectral Range

    NASA Technical Reports Server (NTRS)

    Jarzembski, Maurice A.; Norman, Mark L.; Fuller, Kirk A.; Srivastava, Vandana; Cutten, Dean R.


    Using high resolution Fourier Transform Infrared Spectroscopy (FTIR) absorbance/transmittance spectral data for ammonium sulfate (AMS), calcium carbonate (CAC) and ammonium nitrate (AMN), comparisons were made with previously published complex refractive indices data for AMS and CAC to infer experimental parameters to determine the imaginary refractive index for AMN in the infrared wavelength range from 2 to 20 microns. Kramers-Kronig mathematical relations were applied to calculate the real refractive index for the three compositions. Excellent agreement for AMS and CAC with the published values was found, validating the complex refractive indices obtained for AMN. Backscatter calculations using a lognormal size distribution for AMS, AMN, and CAC aerosols were performed to show differences in their backscattered spectra.

  2. Complex Refractive Index of Ammonium Nitrate in the 2-20 micron Spectral Range

    NASA Technical Reports Server (NTRS)

    Jarzembski, Maurice A.; Norman, Mark L.; Fuller, Kirk A.; Srivastava, Vandana; Cutten, Dean R.


    Using high resolution Fourier Transform Infrared Spectroscopy (FTIR) absorbance/transmittance spectral data for ammonium sulfate (AMS), calcium carbonate (CAC) and ammonium nitrate (AMN), comparisons were made with previously published complex refractive indices data for AMS and CAC to infer experimental parameters to determine the imaginary refractive index for AMN in the infrared wavelength range from 2 to 20 microns. Kramers-Kronig mathematical relations were applied to calculate the real refractive index for the three compositions. Excellent agreement for AMS and CAC with the published values was found, validating the complex refractive indices obtained for AMN. Backscatter calculations using a lognormal size distribution for AMS, AMN, and CAC aerosols were performed to show differences in their backscattered spectra.

  3. Bipyrrole-Strapped Calix[4]pyrroles: Strong Anion Receptors That Extract the Sulfate Anion

    SciTech Connect

    Kim, Sung Kuk; Lee, Juhoon; Williams, Neil J; Lynch, Vincent M.; Hay, Benjamin; Moyer, Bruce A; Sessler, Jonathan L.


    Cage-type calix[4]pyrroles 2 and 3 bearing two additional pyrrole groups on the strap have been synthesized. Compared with the parent calix[4]pyrrole (1), they were found to exhibit remarkably enhanced affinities for anions, including the sulfate anion (TBA+ salts), in organic media (CD2Cl2). This increase is ascribed to participation of the bipyrrole units in anion binding. Receptors 2 and 3 extract the hydrophilic sulfate anion (as the methyltrialkyl(C8-10)ammonium (A336+) salt)) from aqueous media into a chloroform phase with significantly improved efficiency (>10-fold relative to calix[4]pyrrole 1). These two receptors also solubilize into chloroform the otherwise insoluble sulfate salt, (TMA)2SO4 (tetramethylammonium sulfate).

  4. Sulfation of chondroitin. Specificity, degree of sulfation, and detergent effects with 4-sulfating and 6-sulfating microsomal systems

    SciTech Connect

    Sugumaran, G.; Silbert, J.E.


    Microsomal preparations from chondroitin 6-sulfate-producing chick embryo epiphyseal cartilage, and from chondroitin 4-sulfate-producing mouse mastocytoma cells, were incubated with UDP-(14C)glucuronic acid and UDP-N-acetylgalactosamine to form non-sulfated proteo(14C)chondroitin. Aliquots of the incubations were then incubated with 3'-phosphoadenylylphosphosulfate (PAPS) in the presence or absence of various detergents. In the absence of detergents, there was good sulfation of this endogenous proteo(14C)chondroitin by the original microsomes from both sources. Detergents, with the exception of Triton X-100, markedly inhibited sulfation in the mast cell system but not in the chick cartilage system. These results indicate that sulfation and polymerization are closely linked on cell membranes and that in some cases this organization can be disrupted by detergents. When aliquots of the original incubation were heat inactivated, and then reincubated with new microsomes from chick cartilage and/or mouse mastocytoma cells plus PAPS, there was no significant sulfation of this exogenous proteo(14C) chondroitin with either system unless Triton X-100 was added. Sulfation of exogenous chondroitin and chondroitin hexasaccharide was compared with sulfation of endogenous and exogenous proteo(14C)chondroitin. Sulfate incorporation into hexasaccharide and chondroitin decreased as their concentrations (based on uronic acid) approached that of the proteo(14C)chondroitin. At the same time, the degree of sulfation in percent of substituted hexosamine increased. However, the degree of sulfation did not reach that of the endogenous proteo(14C)chondroitin. Hexasaccharide and chondroitin sulfation were stimulated by the presence of Triton X-100. However, in contrast to the exogenous proteo(14C)chondroitin, there was some sulfation of hexasaccharide and chondroitin in the absence of this detergent.

  5. 21 CFR 172.430 - Iron ammonium citrate.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Iron ammonium citrate. 172.430 Section 172.430... CONSUMPTION Anticaking Agents § 172.430 Iron ammonium citrate. Iron ammonium citrate may be safely used in... human consumption so that the level of iron ammonium citrate does not exceed 25 parts per million (0...

  6. 21 CFR 172.430 - Iron ammonium citrate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Iron ammonium citrate. 172.430 Section 172.430 Food... Anticaking Agents § 172.430 Iron ammonium citrate. Iron ammonium citrate may be safely used in food in... consumption so that the level of iron ammonium citrate does not exceed 25 parts per million (0.0025 percent...

  7. 21 CFR 172.430 - Iron ammonium citrate.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Iron ammonium citrate. 172.430 Section 172.430... CONSUMPTION Anticaking Agents § 172.430 Iron ammonium citrate. Iron ammonium citrate may be safely used in... human consumption so that the level of iron ammonium citrate does not exceed 25 parts per million (0...

  8. 21 CFR 172.430 - Iron ammonium citrate.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Iron ammonium citrate. 172.430 Section 172.430... CONSUMPTION Anticaking Agents § 172.430 Iron ammonium citrate. Iron ammonium citrate may be safely used in... human consumption so that the level of iron ammonium citrate does not exceed 25 parts per million (0...

  9. Off limits: sulfate below the sulfate-methane transition

    NASA Astrophysics Data System (ADS)

    Brunner, Benjamin; Arnold, Gail; Røy, Hans; Müller, Inigo; Jørgensen, Bo


    One of the most intriguing recent discoveries in biogeochemistry is the ubiquity of cryptic sulfur cycling. From subglacial lakes to marine oxygen minimum zones, and in marine sediments, cryptic sulfur cycling - the simultaneous sulfate consumption and production - has been observed. Though this process does not leave an imprint in the sulfur budget of the ambient environment - thus the term cryptic - it may have a massive impact on other element cycles and fundamentally change our understanding of biogeochemical processes in the subsurface. Classically, the sulfate-methane transition (SMT) in marine sediments is considered to be the boundary that delimits sulfate reduction from methanogenesis as the predominant terminal pathway of organic matter mineralization. Two sediment cores from Aarhus Bay, Denmark reveal the constant presence of sulfate (generally 0.1 to 0.2 mM) below the SMT. The sulfur and oxygen isotope signature of this deep sulfate (34S = 18.9‰, 18O = 7.7‰) was close to the isotope signature of bottom-seawater collected from the sampling site (34S = 19.8‰, 18O = 7.3‰). In one of the cores, oxygen isotope values of sulfate at the transition from the base of the SMT to the deep sulfate pool (18O = 4.5‰ to 6.8‰) were distinctly lighter than the deep sulfate pool. Our findings are consistent with a scenario where sulfate enriched in 34S and 18O is removed at the base of the SMT and replaced with isotopically light sulfate below. Here, we explore scenarios that explain this observation, ranging from sampling artifacts, such as contamination with seawater or auto-oxidation of sulfide - to the potential of sulfate generation in a section of the sediment column where sulfate is expected to be absent which enables reductive sulfur cycling, creating the conditions under which sulfate respiration can persist in the methanic zone.

  10. Surface Enrichment by Conventional and Polymerizable Sulfated Nonylphenol Ethoxylate Emulsifiers in Water-Based Pressure-Sensitive Adhesive


    Jilin Zhang; Yuxi Zhao; Matthew R. Dubay; Steven J. Severtson; Larry E. Gwin; Carl J. Houtman


    Comparisons of properties are made for pressure-sensitive adhesives (PSAs) generated via emulsion polymerization using both conventional and reactive emulsifiers. The emulsifiers are ammonium salts of sulfated nonylphenol ethoxylates with similar chemical structures and hydrophilic−lipophilic balances. The polymerizable surfactant possesses a reactive double...

  11. The nitrogen cycle in anaerobic methanotrophic mats of the Black Sea is linked to sulfate reduction and biomass decomposition.


    Siegert, Michael; Taubert, Martin; Seifert, Jana; von Bergen-Tomm, Martin; Basen, Mirko; Bastida, Felipe; Gehre, Matthias; Richnow, Hans-Hermann; Krüger, Martin


    Anaerobic methanotrophic (ANME) mats host methane-oxidizing archaea and sulfate-reducing prokaryotes. Little is known about the nitrogen cycle in these communities. Here, we link the anaerobic oxidation of methane (AOM) to the nitrogen cycle in microbial mats of the Black Sea by using stable isotope probing. We used four different (15)N-labeled sources of nitrogen: dinitrogen, nitrate, nitrite and ammonium. We estimated the nitrogen incorporation rates into the total biomass and the methyl coenzyme M reductase (MCR). Dinitrogen played an insignificant role as nitrogen source. Assimilatory and dissimilatory nitrate reduction occurred. High rates of nitrate reduction to dinitrogen were stimulated by methane and sulfate, suggesting that oxidation of reduced sulfur compounds such as sulfides was necessary for AOM with nitrate as electron acceptor. Nitrate reduction to dinitrogen occurred also in the absence of methane as electron donor but at six times slower rates. Dissimilatory nitrate reduction to ammonium was independent of AOM. Ammonium was used for biomass synthesis under all conditions. The pivotal enzyme in AOM coupled to sulfate reduction, MCR, was synthesized from nitrate and ammonium. Results show that AOM coupled to sulfate reduction along with biomass decomposition drive the nitrogen cycle in the ANME mats of the Black Sea and that MCR enzymes are involved in this process.

  12. 77 FR 65532 - Solid Fertilizer Grade Ammonium Nitrate From the Russian Federation: Notice of Rescission of...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... International Trade Administration Solid Fertilizer Grade Ammonium Nitrate From the Russian Federation: Notice... the antidumping duty order on solid fertilizer grade ammonium nitrate (ammonium nitrate) from the... Administrative Review: Solid Fertilizer Grade Ammonium Nitrate (Ammonium Nitrate) from the Russian...

  13. Transcription Factor OsDOF18 Controls Ammonium Uptake by Inducing Ammonium Transporters in Rice Roots

    PubMed Central

    Wu, Yunfei; Yang, Wenzhu; Wei, Jinhuan; Yoon, Hyeryung; An, Gynheung


    Nitrogen is one of the most important mineral elements for plant growth. We studied the functional roles of Oryza sativa DNA BINDING WITH ONE FINGER 18 (OsDOF18) in controlling ammonium uptake. The growth of null mutants of OsDOF18 was retarded in a medium containing ammonium as the sole nitrogen source. In contrast, those mutants grew normally in a medium with nitrate as the sole nitrogen source. The gene expression was induced by ammonium but not by nitrate. Uptake of ammonium was lower in osdof18 mutants than in the wild type, while that of nitrate was not affected by the mutation. This indicated that OsDOF18 is involved in regulating ammonium transport. Among the 10 ammonium transporter genes examined here, expression of OsAMT1;1, OsAMT1;3, OsAMT2;1, and OsAMT4;1 was reduced in osdof18 mutants, demonstrating that the ammonium transporter genes function downstream of OsDOF18. Genes for nitrogen assimilation were also affected in the mutants. These results provide evidence that OsDOF18 mediates ammonium transport and nitrogen distribution, which then affects nitrogen use efficiency. PMID:28292004

  14. High aerosol acidity despite declining atmospheric sulfate concentrations over the past 15 years

    NASA Astrophysics Data System (ADS)

    Weber, Rodney J.; Guo, Hongyu; Russell, Armistead G.; Nenes, Athanasios


    Particle acidity affects aerosol concentrations, chemical composition and toxicity. Sulfate is often the main acid component of aerosols, and largely determines the acidity of fine particles under 2.5 μm in diameter, PM2.5. Over the past 15 years, atmospheric sulfate concentrations in the southeastern United States have decreased by 70%, whereas ammonia concentrations have been steady. Similar trends are occurring in many regions globally. Aerosol ammonium nitrate concentrations were assumed to increase to compensate for decreasing sulfate, which would result from increasing neutrality. Here we use observed gas and aerosol composition, humidity, and temperature data collected at a rural southeastern US site in June and July 2013 (ref. ), and a thermodynamic model that predicts pH and the gas-particle equilibrium concentrations of inorganic species from the observations to show that PM2.5 at the site is acidic. pH buffering by partitioning of ammonia between the gas and particle phases produced a relatively constant particle pH of 0-2 throughout the 15 years of decreasing atmospheric sulfate concentrations, and little change in particle ammonium nitrate concentrations. We conclude that the reductions in aerosol acidity widely anticipated from sulfur reductions, and expected acidity-related health and climate benefits, are unlikely to occur until atmospheric sulfate concentrations reach near pre-anthropogenic levels.

  15. Crystal structure of tris-(piperidinium) hydrogen sulfate sulfate.


    Lukianova, Tamara J; Kinzhybalo, Vasyl; Pietraszko, Adam


    In the title molecular salt, 3C5H12N(+)·HSO4 (-)·SO4 (2-), each cation adopts a chair conformation. In the crystal, the hydrogen sulfate ion is connected to the sulfate ion by a strong O-H⋯O hydrogen bond. The packing also features a number of N-H⋯O hydrogen bonds, which lead to a three-dimensional network structure. The hydrogen sulfate anion accepts four hydrogen bonds from two cations, whereas the sulfate ion, as an acceptor, binds to five separate piperidinium cations, forming seven hydrogen bonds.

  16. Crystallization characteristics of ammonium uranyl carbonate (AUC) in ammonium carbonate solutions

    NASA Astrophysics Data System (ADS)

    Tae-Joon, Kim; Kyung-Chai, Jeong; Jin-Ho, Park; In-Soon, Chang; Cheong-Song, Choi


    Ammonium carbonate solutions with an excessive amount of NH 3 were produced in a commercial AUC (ammonium uranyl carbonate) conversion plant. In this study the AUC crystals, precipitated with uranyl nitrate and ammonium carbonate solutions prepared in the laboratory, were characterized to determine the feasibility of recycling ammonium carbonate solution. The AUC crystals were easily agglomerated with the increasing concentration of CO 32- and mole ratio of {NH 4+}/{CO 32-} in ammonium carbonate solution. Effects of a mixing system for the solution in the AUC crystallizer and the feed location of the solution on the agglomeration of AUC crystals were also studied along with the effects of agglomerated AUC powders on UO 2 powders. Finally, the feasibility of manufacturing UO 2 fuel with a sintered pellet density of 10.52 g/cm 3, using the AUC powders generated in this experiment, was demonstrated.

  17. Calcium sulphate in ammonium sulphate solution

    USGS Publications Warehouse

    Sullivan, E.C.


    Calcium sulphate, at 25?? C., is two-thirds as soluble in dilute (o.i mol per liter) and twice as soluble in concentrated (3 mois per liter) ammonium sulphate solution as in water. The specific electric conductivity of concentrated ammonium sulphate solutions is lessened by saturating with calcium sulphate. Assuming that dissociation of ammonium sulphate takes place into 2NH4?? and SO4" and of calcium sulphate into Ca and SO4" only, and that the conductivity is a measure of such dissociation, the solubility of calcium sulphate in dilute ammonium sulphate solutions is greater than required by the mass-law. The conductivity of the dilute mixtures may be accurately calculated by means of Arrhenius' principle of isohydric solutions. In the data obtained in these calculations, the concentration of non-dissociated calcium sulphate decreases with increasing ammonium sulphate. The work as a whole is additional evidence of the fact that we are not yet in possession of all the factors necessary for reconciling the mass-law to the behavior of electrolytes. The measurements above described were made in the chemical laboratory of the University of Michigan.

  18. Ferric sulfates on Mars

    NASA Technical Reports Server (NTRS)

    Burns, Roger G.


    Evidence is presented for the possible existence of ferric sulfato complexes and hydroxo ferric sulfate minerals in the permafrost of Mars. A sequential combination of ten unique conditions during the cooling history of Mars is suggested which is believed to have generated an environment within Martian permafrost that has stabilized Fe(3+)-SO4(2-)-bearing species. It is argued that minerals belonging to the jarosite and copiapite groups could be present in Martian regolith analyzed in the Viking XRF measurements at Chryse and Utopia, and that maghemite suspected to be coating the Viking magnet arrays is a hydrolysate of dissolved ferric sulfato complexes from exposed Martian permafrost.

  19. Glucosamine and chondroitin sulfate.


    Miller, Karla L; Clegg, Daniel O


    Glucosamine and chondroitin sulfate, components of normal cartilage that are marketed as dietary supplements in the United States, have been evaluated for their potential role in the treatment of osteoarthritis. Due to claims of efficacy, increased prevalence of osteoarthritis, and a lack of other effective therapies, there has been substantial interest in using these dietary supplements as therapeutic agents for osteoarthritis. Though pharmacokinetic and bioavailability data are limited, use of these supplements has been evaluated for management of osteoarthritis symptoms and modification of disease progression. Relevant clinical trial efficacy and safety data are reviewed and summarized.

  20. Sulfate scale dissolution

    SciTech Connect

    Morris, R.L.; Paul, J.M.


    This patent describes a method for removing barium sulfate scale. It comprises contacting the scale with an aqueous solution having a pH of about 8 to about 14 and consisting essentially of a chelating agent comprising a polyaminopolycarboxylic acid or salt of such an acid in a concentration of 0.1 to 1.0 M, and anions of a monocarboxylic acid selected form mercaptoacetic acid, hydroxyacetic acid, aminoacetic acid, or salicyclic acid in a concentration of 0.1 to 1.0 M and which is soluble in the solution under the selected pH conditions, to dissolve the scale.

  1. Pathophysiological and physicochemical basis of ammonium urate stone formation in dolphins

    PubMed Central

    Smith, Cynthia R.; Poindexter, John R.; Meegan, Jennifer M.; Bobulescu, I. Alexandru; Jensen, Eric D.; Venn-Watson, Stephanie; Sakhaee, Khashayar


    Purpose Nephrolithiasis has been increasingly reported in bottlenose dolphins, with all cases to date being ammonium urate nephrolithiasis. Materials and Methods A case-control study was conducted in dolphins with and without evidence of nephrolithiasis, aiming to identify biomarkers and risk factors associated with stone formation in a managed population. Dolphins were sampled in both fasting and postprandial states in order to study the effect of dietary factors on serum and urinary biochemistry. Urine was continuously collected over a 6-hr period via catheter and divided into three 2-hour collections, with a bolus fish meal given after completion of the first collection. Blood was sampled at the beginning of the fasting period and end of the postprandial period. Results There were no significant differences in serum and urine chemistries and acid base profiles between dolphins with and without stones, at baseline or postprandially, suggesting that case and control animals in this study represent a continuum of stone risk. In analyses combining the case and control dolphins in a single cohort, we noted significant postprandial increases in urinary uric acid, sulfate and net acid excretion, accompanied by increased urinary ammonium excretion and a commensurate rise in urine pH. The supersaturation index of ammonium urate increased postprandially by more than twofold. Conclusion These findings suggest that dolphins are susceptible to ammonium urate nephrolithiasis at least in part because a high dietary load of acid and purines results in a transient but marked increase in the urinary supersaturation of the sparingly soluble ammonium urate salt. PMID:24518786

  2. Controlled exposures of human volunteers to sulfate aerosols. Health effects and aerosol characterization.


    Avol, E L; Jones, M P; Bailey, R M; Chang, N M; Kleinman, M T; Linn, W S; Bell, K A; Hackney, J D


    Our laboratory has undertaken the study of possible acute adverse health effects of sulfate aerosols through controlled exposures of volunteer human subjects. Both healthy and asthmatic adult men were exposed for 2-hour periods (with intermittent exercise) to ammonium sulfate, ammonium bisulfate, and sulfuric acid of particle size distributions and concentrations intended to simulate "worst case" exposures during Los Angeles smog episodes. Lung function tests were performed by the subjects on entering and before exiting from a carefully controlled environmental chamber. Subject symptoms were evluated in a standardized manner. Aerosol concentrations and size distributions were determined by an on-line computer/aerometric monitoring system; gravimetric and chemical analyses were performed on impactor and total filter samples after test exposures. We found little or no evidence of adverse health effects from 2-hour multiple-day exposures to any of the compounds at "worst case" ambient concentrations.

  3. Near-real time infrared observations of acidic sulfates in /open quotes/clean/close quotes/ air at Mauna Loa, Hawaii

    SciTech Connect

    Johnson, S.A.; Kumar, R.


    Sulfuric acid and its partially or completely neutralized salts with ammonia are believed to result from the oxidation of sulfur dioxide in cloud water and in other heterogeneous media present in the atmosphere. Due to the natural abundance of ammonia and the ubiquitous presence of sulfur in the atmosphere, (NH/sub 4/)/sub 2/SO/sub 4/ is commonly the dominant chemical species in the ambient aerosol. The amounts of ammonium sulfates are expected to be very low in areas far removed from anthropogenic emissions of sulfur dioxide. The chemical composition of submicrometer aerosol particles was determined at the Mauna Loa Observatory (MLO) on Mauna Loa in Hawaii during an eight-day period in August 1986. The MLO site was selected for this measurement because it is the only ground-based aerosol observatory in the remote Pacific Ocean that allows extended sampling of aerosols in the free troposphere. Measurements were made using an attenuated total internal reflection (ATR) impactor system. The impactor collects size-fractionated submicrometer particles for analysis by ATR infrared spectroscopy. The collected samples were analyzed using an on-site Perkin Elmer dispersive infrared spectrophotometer. Infrared absorption spectra (4000 to 250 cm/sup /minus/1/) of the samples were obtained within minutes after the ATR substrates were removed from the impactor. Absorbances were measured for sulfate, nitrate, and ammonium. Acidic sulfate showed infrared absorbances at 600 cm/sup /minus/1/ and 1210 cm/sup /minus/1/ in addition. Results showed that ammonium sulfate was the dominant chemical species in the submicrometer particles. Over half of the nearly 40 samples collected showed an acidic sulfate component. Consecutive samples were found to change from completely neutralized ammonium sulfate to acidic ammonium sulfates in a two-hour time interval. 5 refs., 1 tab.

  4. Urinary chondroitin sulfates, heparan sulfate and total sulfated glycosaminoglycans in interstitial cystitis.


    Erickson, D R; Ordille, S; Martin, A; Bhavanandan, V P


    We compared urinary glycosaminoglycan levels in patients with interstitial cystitis and healthy controls. Total sulfated glycosaminoglycans assayed by dimethylmethylene blue binding and individual glycosaminoglycans analyzed by cellulose acetate electrophoresis were compared in patients with interstitial cystitis and healthy controls. Also, multiple urine samples were obtained from healthy female controls for 2 months to assess the relationship of urinary glycosaminoglycan and creatinine concentrations, and to determine whether glycosaminoglycan excretion changes during the menstrual cycle. Total sulfated glycosaminoglycan and creatinine concentrations correlated well in random voided samples. Menstrual cycle day did not affect total sulfated glycosaminoglycan levels. Cellulose acetate electrophoresis revealed 3 bands corresponding to chondroitin sulfates, heparan sulfate and acidic glycoprotein. Patients with interstitial cystitis had decreased urinary concentrations of each of these individual components and total sulfated glycosaminoglycans. However, glycosaminoglycan-to-creatinine ratios were similar in interstitial cystitis and control urine. Using these assays total and individual urinary glycosaminoglycan levels normalized to creatinine were not altered in interstitial cystitis.

  5. Intensification of sonochemical degradation of ammonium perfluorooctanoate by persulfate oxidant.


    Hao, Feifei; Guo, Weilin; Wang, Anqi; Leng, Yanqiu; Li, Helian


    Ammonium perfluorooctanoate (APFO) is an emerging environmental pollutant attracting significant attention due to its global distribution, high persistence, and bioaccumulation properties. The decomposition of APFO in aqueous solution with a combination of persulfate oxidant and ultrasonic irradiation was investigated. The effects of operating parameters, such as ultrasonic power, persulfate concentration, APFO concentration, and initial media pH on APFO degradation were discussed. In the absence of persulfate, 35.5% of initial APFO in 46.4 μmol/L solution under ultrasound irradiation, was decomposed rapidly after 120 min with the defluorination ratio reaching 6.73%. In contrast, when 10 mmol/L persulfate was used, 51.2% of initial APFO (46.4 μmol/L) was decomposed and the defluorination ratio reached 11.15% within 120 min reaction time. Enhancement of the decomposition of APFO can be explained by acceleration of substrate decarboxylation, induced by sulfate radical anions formed from the persulfate during ultrasonic irradiation. The SO4(-•)/APFO reactions at the bubble-water interface appear to be the primary pathway for the sonochemical degradation of the perfluorinated surfactants.

  6. Sulfated polysaccharides (chondroitin sulfate and carrageenan) plus glucosamine sulfate are potent inhibitors of HIV.


    Konlee, M


    Chondroitin sulfate, a fusion inhibitor found in human milk, appears to work by blocking the ability of a virus, such as HIV, to infect a cell. There are questions about whether cow or goat milk can offer the same fusion-inhibiting benefits. One sulfated monosaccharide, glucosamine 6-sulfate, appears to have significant anti-HIV activity. Carrageenan, a seaweed derivative, shows promise as a vaginal microbicide, and should be tested further to determine its effectiveness against HIV transmission.

  7. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ferrous sulfate. 184.1315 Section 184.1315 Food and... Substances Affirmed as GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II) sulfate... as pale, bluish-green crystals or granules. Progressive heating of ferrous sulfate heptahydrate...

  8. Final report on the safety assessment of sodium sulfite, potassium sulfite, ammonium sulfite, sodium bisulfite, ammonium bisulfite, sodium metabisulfite and potassium metabisulfite.


    Nair, Bindu; Elmore, Amy R


    Sodium Sulfite, Ammonium Sulfite, Sodium Bisulfite, Potassium Bisulfite, Ammonium Bisulfite, Sodium Metabisulfite, and Potassium Metabisulfite are inorganic salts that function as reducing agents in cosmetic formulations. All except Sodium Metabisulfite also function as hair-waving/straightening agents. In addition, Sodium Sulfite, Potassium Sulfite, Sodium Bisulfite, and Sodium Metabisulfite function as antioxidants. Although Ammonium Sulfite is not in current use, the others are widely used in hair care products. Sulfites that enter mammals via ingestion, inhalation, or injection are metabolized by sulfite oxidase to sulfate. In oral-dose animal toxicity studies, hyperplastic changes in the gastric mucosa were the most common findings at high doses. Ammonium Sulfite aerosol had an acute LC(50) of >400 mg/m(3) in guinea pigs. A single exposure to low concentrations of a Sodium Sulfite fine aerosol produced dose-related changes in the lung capacity parameters of guinea pigs. A 3-day exposure of rats to a Sodium Sulfite fine aerosol produced mild pulmonary edema and irritation of the tracheal epithelium. Severe epithelial changes were observed in dogs exposed for 290 days to 1 mg/m(3) of a Sodium Metabisulfite fine aerosol. These fine aerosols contained fine respirable particle sizes that are not found in cosmetic aerosols or pump sprays. None of the cosmetic product types, however, in which these ingredients are used are aerosolized. Sodium Bisulfite (tested at 38%) and Sodium Metabisulfite (undiluted) were not irritants to rabbits following occlusive exposures. Sodium Metabisulfite (tested at 50%) was irritating to guinea pigs following repeated exposure. In rats, Sodium Sulfite heptahydrate at large doses (up to 3.3 g/kg) produced fetal toxicity but not teratogenicity. Sodium Bisulfite, Sodium Metabisulfite, and Potassium Metabisulfite were not teratogenic for mice, rats, hamsters, or rabbits at doses up to 160 mg/kg. Generally, Sodium Sulfite, Sodium


    EPA Science Inventory

    Airborne fine particulate matter across the United States is monitored by different networks, the three prevalent ones presently being the Clean Air Status and Trend Network (CASTNet), the Interagency Monitoring of PROtected Visual Environment Network (IMPROVE) and the Speciati...

  10. Synthesis of ammonium and sulfate ion-functionalized titanium dioxide for photocatalytic applications

    NASA Astrophysics Data System (ADS)

    Cheng, J. L.; Mi, J. Y.; Miao, H.; Sharifah Fatanah, B. S. A.; Wong, S. F.; Tay, B. K.


    Due to high band gap energy the optimum photocatalytic activities can only be achieved under UV light, thus limiting the practical application of TiO2. In this study, a method combining NH4 +/SO4 2--functionalization technique and post-treatment was developed and successfully applied to synthesize photoactive TiO2 samples which showed higher photocatalytic activity than the commercial P25 TiO2 under visible light radiation. The results also showed that the addition of (NH4)2SO4 surface functionalization on TiO2 increased the photocatalytic activity, which could be due to the combined effect of crystallinity and band gap energies. Moreover, the results showed that calcination temperature was inversely proportional to photocatalytic activity. The degradation efficiency for methylene blue under visible light was improved by 2 times from 10.7% for P25 nano Degussa TiO2 to 20.2% for the synthesized sample. The band gap energies were also reduced from 3.7 to 3.4 eV (under UV-Vis direct transition mode) indicating a red shift towards higher wavelength.

  11. Synthesis of ammonium and sulfate ion-functionalized titanium dioxide for photocatalytic applications

    NASA Astrophysics Data System (ADS)

    Cheng, J. L.; Mi, J. Y.; Miao, H.; Sharifah Fatanah, B. S. A.; Wong, S. F.; Tay, B. K.


    Due to high band gap energy the optimum photocatalytic activities can only be achieved under UV light, thus limiting the practical application of TiO2. In this study, a method combining NH4 +/SO4 2--functionalization technique and post-treatment was developed and successfully applied to synthesize photoactive TiO2 samples which showed higher photocatalytic activity than the commercial P25 TiO2 under visible light radiation. The results also showed that the addition of (NH4)2SO4 surface functionalization on TiO2 increased the photocatalytic activity, which could be due to the combined effect of crystallinity and band gap energies. Moreover, the results showed that calcination temperature was inversely proportional to photocatalytic activity. The degradation efficiency for methylene blue under visible light was improved by 2 times from 10.7% for P25 nano Degussa TiO2 to 20.2% for the synthesized sample. The band gap energies were also reduced from 3.7 to 3.4 eV (under UV-Vis direct transition mode) indicating a red shift towards higher wavelength.

  12. Interactions of proteins in aqueous ammonium-sulfate solutions:Mixtures of lysozyme and ovalbumin

    SciTech Connect

    Anderson, Camille O.; Prausnitz, John M.; Blanch, Harvey W.


    We present a three-dimensional, time-dependent simulation of a laboratory-scale rod-stabilized premixed turbulent V-flame. The simulations are performed using an adaptive time-dependent low Mach number model with detailed chemical kinetics and a mixture model for differential species diffusion. The algorithm is based on a second-order projection formulation and does not require an explicit sub grid model for turbulence or turbulence chemistry interaction. Adaptive mesh refinement is used to dynamically resolve the flame and turbulent structures. Here, we briefly discuss the numerical procedure and present detailed comparisons with experimental measurements showing that the computation is able to accurately capture the basic flame morphology and associated mean velocity field. Finally, we discuss key issues that arise in performing these types of simulations and the implications of these issues for using computation to form a bridge between turbulent flame experiments and basic combustion chemistry.


    EPA Science Inventory

    Airborne fine particulate matter across the United States is monitored by different networks, the three prevalent ones presently being the Clean Air Status and Trend Network (CASTNet), the Interagency Monitoring of PROtected Visual Environment Network (IMPROVE) and the Speciati...

  14. Effects of sulfuric acid and ammonium sulfate coatings on the ice nucleation properties of kaolinite particles

    NASA Astrophysics Data System (ADS)

    Eastwood, Michael L.; Cremel, Sebastien; Wheeler, Michael; Murray, Benjamin J.; Girard, Eric; Bertram, Allan K.


    The onset conditions for ice nucleation on H2SO4 coated, (NH4)2SO4 coated, and uncoated kaolinite particles at temperatures ranging from 233 to 246 K were studied. We define the onset conditions as the relative humidity and temperature at which the first ice nucleation event was observed. Uncoated particles were excellent ice nuclei; the onset relative humidity with respect to ice (RHi) was below 110% at all temperatures studied, consistent with previous measurements. H2SO4 coatings, however, drastically altered the ice nucleating ability of kaolinite particles, increasing the RHi required for ice nucleation by approximately 30%, similar to the recent measurements by Möhler et al. [2008b]. (NH4)2SO4 coated particles were poor ice nuclei at 245 K, but effective ice nuclei at 236 K. The differences between H2SO4 and (NH4)2SO4 coatings may be explained by the deliquescence and efflorescence properties of (NH4)2SO4. These results support the idea that emissions of SO2 and NH3 may influence the ice nucleating properties of mineral dust particles.

  15. Thermodynamics and kinetics of extracting zinc from zinc oxide ore by the ammonium sulfate roasting method

    NASA Astrophysics Data System (ADS)

    Sun, Yi; Shen, Xiao-yi; Zhai, Yu-chun


    Thermodynamic analyses and kinetic studies were performed on zinc oxide ore treatment by (NH4)2SO4 roasting technology. The results show that it is theoretically feasible to realize a roasting reaction between the zinc oxide ore and (NH4)2SO4 in a temperature range of 573-723 K. The effects of reaction temperature and particle size on the extraction rate of zinc were also examined. It is found that a surface chemical reaction is the rate-controlling step in roasting kinetics. The calculated activation energy of this process is about 45.57 kJ/mol, and the kinetic model can be expressed as follows: 1 - (1 - α)1/3 = 30.85 exp(-45.57/ RT)· t. An extraction ratio of zinc as high as 92% could be achieved under the optimum conditions.

  16. Disguised as a Sulfate Reducer: Growth of the Deltaproteobacterium Desulfurivibrio alkaliphilus by Sulfide Oxidation with Nitrate.


    Thorup, Casper; Schramm, Andreas; Findlay, Alyssa J; Finster, Kai W; Schreiber, Lars


    This study demonstrates that the deltaproteobacterium Desulfurivibrio alkaliphilus can grow chemolithotrophically by coupling sulfide oxidation to the dissimilatory reduction of nitrate and nitrite to ammonium. Key genes of known sulfide oxidation pathways are absent from the genome of D. alkaliphilus Instead, the genome contains all of the genes necessary for sulfate reduction, including a gene for a reductive-type dissimilatory bisulfite reductase (DSR). Despite this, growth by sulfate reduction was not observed. Transcriptomic analysis revealed a very high expression level of sulfate-reduction genes during growth by sulfide oxidation, while inhibition experiments with molybdate pointed to elemental sulfur/polysulfides as intermediates. Consequently, we propose that D. alkaliphilus initially oxidizes sulfide to elemental sulfur, which is then either disproportionated, or oxidized by a reversal of the sulfate reduction pathway. This is the first study providing evidence that a reductive-type DSR is involved in a sulfide oxidation pathway. Transcriptome sequencing further suggests that nitrate reduction to ammonium is performed by a novel type of periplasmic nitrate reductase and an unusual membrane-anchored nitrite reductase.IMPORTANCE Sulfide oxidation and sulfate reduction, the two major branches of the sulfur cycle, are usually ascribed to distinct sets of microbes with distinct diagnostic genes. Here we show a more complex picture, as D. alkaliphilus, with the genomic setup of a sulfate reducer, grows by sulfide oxidation. The high expression of genes typically involved in the sulfate reduction pathway suggests that these genes, including the reductive-type dissimilatory bisulfite reductases, are also involved in as-yet-unresolved sulfide oxidation pathways. Finally, D. alkaliphilus is closely related to cable bacteria, which grow by electrogenic sulfide oxidation. Since there are no pure cultures of cable bacteria, D. alkaliphilus may represent an

  17. Evidence of ammonium ion-exchange properties of natural bentonite and application to ammonium detection.


    Zazoua, A; Kazane, I; Khedimallah, N; Dernane, C; Errachid, A; Jaffrezic-Renault, N


    Ammonium exchange with hybrid PVC-bentonite (mineral montmorillonite clay) thin film was revealed using FTIR spectroscopy, EDX, cyclic voltammetry and electrochemical impedance spectroscopy. The effect of ammonium exchange on the charge transfer resistance of PVC-bentonite hybrid thin film was attributed to a modification of the intersheet distance and hydration of bentonite crystals. The obtained impedimetric ammonium sensor shows a linear range of detection from 10(-4)M to 1M and a detection limit around 10(-6)M. © 2013.

  18. Crystallization of Chicken Egg White Lysozyme from Assorted Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Malone, Christine C.; Pusey, Marc L.


    Chicken egg white lysozyme has been found to crystallize from ammonium, sodium, potassium, rubidium, magnesium, and manganese sulfates at acidic and basic pH, with protein concentrations from 60 to 190 mg/ml. Crystals have also been grown at 4 C in the absence of any other added salts using isoionic lysozyme which was titrated to pH 4.6 with dilute sulfuric acid. Four different crystal forms have been obtained, depending upon the temperature, protein concentration, and precipitating salt employed. Crystals grown at 15 C were generally tetragonal, with space group P4(sub 3)2(sub 1)2. Crystallization at 20 C typically resulted in the formation of orthorhombic crystals, space group P2(sub 1)2(sub 1)2(sub 1). The tetragonal reversible reaction orthorhombic transition appeared to be a function of both the temperature and protein concentration, occurring between 15 and 20 C and between 100 and 125 mg/ml protein concentration. Crystallization from 1.2 M magnesium sulfate at pH 7.8 gave a trigonal crystal, space group P3(sub 1)2(sub 1), a = b = 87.4, c = 73.7, gamma = 120 deg, which diffracted to 2.8 A. Crystallization from ammonium sulfate at pH 4.6, generally at lower temperatures, was also found to result in a monoclinic form. space group C2, a = 65.6, b = 95.0, c = 41.2, beta = 119.2 deg. A crystal of approximately 0.2 x 0.2 x 0.5 mm grown from bulk solution diffracted to approximately 3.5 A.

  19. Crystallization of Chicken Egg White Lysozyme from Assorted Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Malone, Christine C.; Pusey, Marc L.


    Chicken egg white lysozyme has been found to crystallize from ammonium, sodium, potassium, rubidium, magnesium, and manganese sulfates at acidic and basic pH, with protein concentrations from 60 to 190 mg/ml. Crystals have also been grown at 4 C in the absence of any other added salts using isoionic lysozyme which was titrated to pH 4.6 with dilute sulfuric acid. Four different crystal forms have been obtained, depending upon the temperature, protein concentration, and precipitating salt employed. Crystals grown at 15 C were generally tetragonal, with space group P4(sub 3)2(sub 1)2. Crystallization at 20 C typically resulted in the formation of orthorhombic crystals, space group P2(sub 1)2(sub 1)2(sub 1). The tetragonal reversible reaction orthorhombic transition appeared to be a function of both the temperature and protein concentration, occurring between 15 and 20 C and between 100 and 125 mg/ml protein concentration. Crystallization from 1.2 M magnesium sulfate at pH 7.8 gave a trigonal crystal, space group P3(sub 1)2(sub 1), a = b = 87.4, c = 73.7, gamma = 120 deg, which diffracted to 2.8 A. Crystallization from ammonium sulfate at pH 4.6, generally at lower temperatures, was also found to result in a monoclinic form. space group C2, a = 65.6, b = 95.0, c = 41.2, beta = 119.2 deg. A crystal of approximately 0.2 x 0.2 x 0.5 mm grown from bulk solution diffracted to approximately 3.5 A.

  20. 21 CFR 573.170 - Ammonium formate.

    Code of Federal Regulations, 2014 CFR


    ..., FEEDS, AND RELATED PRODUCTS FOOD ADDITIVES PERMITTED IN FEED AND DRINKING WATER OF ANIMALS Food Additive... is manufactured by the reaction of 99.5 percent ammonia gas and 99 percent formic acid in a continuous loop reactor to produce a solution made up of 37 percent ammonium salt of formic acid and 62...

  1. 21 CFR 573.170 - Ammonium formate.

    Code of Federal Regulations, 2012 CFR


    ..., FEEDS, AND RELATED PRODUCTS FOOD ADDITIVES PERMITTED IN FEED AND DRINKING WATER OF ANIMALS Food Additive...) The additive is manufactured by the reaction of 99.5 percent ammonia gas and 99 percent formic acid in a continuous loop reactor to produce a solution made up of 37 percent ammonium salt of formic acid...

  2. 21 CFR 573.170 - Ammonium formate.

    Code of Federal Regulations, 2013 CFR


    ..., FEEDS, AND RELATED PRODUCTS FOOD ADDITIVES PERMITTED IN FEED AND DRINKING WATER OF ANIMALS Food Additive...) The additive is manufactured by the reaction of 99.5 percent ammonia gas and 99 percent formic acid in a continuous loop reactor to produce a solution made up of 37 percent ammonium salt of formic acid...

  3. 21 CFR 573.170 - Ammonium formate.

    Code of Federal Regulations, 2011 CFR


    ..., FEEDS, AND RELATED PRODUCTS FOOD ADDITIVES PERMITTED IN FEED AND DRINKING WATER OF ANIMALS Food Additive...) The additive is manufactured by the reaction of 99.5 percent ammonia gas and 99 percent formic acid in a continuous loop reactor to produce a solution made up of 37 percent ammonium salt of formic acid...

  4. 21 CFR 556.375 - Maduramicin ammonium.

    Code of Federal Regulations, 2012 CFR


    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.375 Maduramicin ammonium. A tolerance is established for...

  5. 21 CFR 556.375 - Maduramicin ammonium.

    Code of Federal Regulations, 2011 CFR


    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.375 Maduramicin ammonium. A tolerance is established for...

  6. Ambient Ammonium Contribution to total Nitrogen Deposition

    EPA Science Inventory

    There has been a wealth of evidence over the last decade illustrating the rising importance of reduced inorganic nitrogen (NHx = ammonia gas, NH3, plus particulate ammonium, p-NH4) in the overall atmospheric mass balance and deposition of nitrogen as emissions of oxidized nitrog...

  7. 21 CFR 184.1133 - Ammonium alginate.

    Code of Federal Regulations, 2013 CFR


    ...-34-9) is the ammonium salt of alginic acid, a natural polyuronide constituent of certain brown algae..., § 170.3(n)(9) of this chapter 0.4 Stabilizer, thickener, § 170.3(o)(28) of this chapter. Fats and...

  8. 21 CFR 184.1133 - Ammonium alginate.

    Code of Federal Regulations, 2012 CFR


    ...-34-9) is the ammonium salt of alginic acid, a natural polyuronide constituent of certain brown algae..., § 170.3(n)(9) of this chapter 0.4 Stabilizer, thickener, § 170.3(o)(28) of this chapter. Fats and...

  9. 21 CFR 184.1133 - Ammonium alginate.

    Code of Federal Regulations, 2010 CFR


    ...: Category of food Maximum level of use in food (as served) (percent) Functional use Confections, frostings... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium alginate. 184.1133 Section 184.1133 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...

  10. Diamond Head Revisited with Ammonium Dichromate.

    ERIC Educational Resources Information Center

    Arrigoni, Edward


    The classroom demonstration using ammonium dichromate to simulate a volcanic eruption can be modified into a more dramatic and accurate representation of the geologic processes involved in the formation of a volcanic crater. The materials, demonstration setup, safety procedures, and applications to instruction are presented. (Author/WB)

  11. Cyclo­hexyl­ammonium nitrate

    PubMed Central

    Bagabas, Abdulaziz A.; Aboud, Mohamed F. A.; Shemsi, Ahsan M.; Addurihem, Emad S.; Al-Othman, Zeid A.; Chidan Kumar, C. S.; Fun, Hoong-Kun


    In the title salt, C6H14N+·NO3 −, the cyclo­hexyl ring adopts a chair conformation. The ammonium group occupies an equatorial position and the crystal struture is stabilized by inter­molecular N—H⋯O hydrogen-bonding inter­actions, resulting in a three-dimensional network. PMID:24764971

  12. 21 CFR 184.1133 - Ammonium alginate.

    Code of Federal Regulations, 2011 CFR


    ...: Category of food Maximum level of use in food (as served) (percent) Functional use Confections, frostings... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium alginate. 184.1133 Section 184.1133 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...

  13. 21 CFR 184.1139 - Ammonium hydroxide.

    Code of Federal Regulations, 2010 CFR


    ... HUMAN CONSUMPTION (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of... ingredient as generally recognized as safe (GRAS) as a direct human food ingredient is based upon the... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium hydroxide. 184.1139 Section 184.1139...

  14. 21 CFR 184.1133 - Ammonium alginate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium alginate. 184.1133 Section 184.1133 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as...

  15. 21 CFR 184.1139 - Ammonium hydroxide.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium hydroxide. 184.1139 Section 184.1139 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as...

  16. 21 CFR 184.1135 - Ammonium bicarbonate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium bicarbonate. 184.1135 Section 184.1135 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as...

  17. 21 CFR 184.1137 - Ammonium carbonate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium carbonate. 184.1137 Section 184.1137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS SAFE Listing of Specific Substances Affirmed as...

  18. 21 CFR 184.1307 - Ferric sulfate.

    Code of Federal Regulations, 2010 CFR


    ... Substances Affirmed as GRAS § 184.1307 Ferric sulfate. (a) Ferric sulfate (iron (III) sulfate, Fe2(SO4)3 CAS... treating ferric oxide or ferric hydroxide with sulfuric acid. (b) The ingredient must be of a...

  19. 21 CFR 184.1307 - Ferric sulfate.

    Code of Federal Regulations, 2011 CFR


    ... Substances Affirmed as GRAS § 184.1307 Ferric sulfate. (a) Ferric sulfate (iron (III) sulfate, Fe2(SO4)3 CAS... treating ferric oxide or ferric hydroxide with sulfuric acid. (b) The ingredient must be of a...

  20. Sulfation of von Willebrand factor

    SciTech Connect

    Carew, J.A.; Browning, P.J.; Lynch, D.C. )


    von Willebrand factor (vWF) is a multimeric adhesive glycoprotein essential for normal hemostasis. We have discovered that cultured human umbilical vein endothelial cells incorporate inorganic sulfate into vWF. Following immunoisolation and analysis by polyacrylamide or agarose gel electrophoresis, metabolically labeled vWF was found to have incorporated (35S)-sulfate into all secreted multimer species. The time course of incorporation shows that sulfation occurs late in the biosynthesis of vWF, near the point at which multimerization occurs. Quantitative analysis suggests the presence, on average, of one molecule of sulfate per mature vWF subunit. Virtually all the detectable sulfate is released from the mature vWF subunit by treatment with endoglycosidases that remove asparagine-linked carbohydrates. Sulfated carbohydrate was localized first to the N-terminal half of the mature subunit (amino acids 1 through 1,365) by partial proteolytic digestion with protease V8; and subsequently to a smaller fragment within this region (amino acids 273 through 511) by sequential digestions with protease V8 and trypsin. Thus, the carbohydrate at asparagine 384 and/or 468 appears to be the site of sulfate modification. Sodium chlorate, an inhibitor of adenosine triphosphate-sulfurylase, blocks sulfation of vWF without affecting either the ability of vWF to assemble into high molecular weight multimers or the ability of vWF multimers to enter Weible-Palade bodies. The stability of vWF multimers in the presence of an endothelial cell monolayer also was unaffected by the sulfation state. Additionally, we have found that the cleaved propeptide of vWF is sulfated on asparagine-linked carbohydrate.

  1. The effect of ammonium ions on oxygen reduction and hydrogen peroxide formation on polycrystalline Pt electrodes

    NASA Astrophysics Data System (ADS)

    Halseid, Rune; Heinen, Martin; Jusys, Zenonas; Jürgen Behm, R.

    The influence of ammonium ions on the activity and selectivity of the electrocatalytic oxygen reduction reaction (ORR) on polycrystalline Pt was investigated in model studies under continuous mass transport, both in sulfuric and perchloric acid solutions. Ammonium was found to increase the yield of hydrogen peroxide, particularly in sulfuric acid, but also in perchloric acid solutions, and also at higher potentials (0.80-0.90 V RHE) typical for fuel cell cathode operation, which may severely impair the long-term stability of membranes and electrodes in fuel cells exposed to fuel gases and/or air containing ammonia. Adsorbed species, assigned to ammonia and nitric oxide, were identified on a Pt film electrode using in situ FTIR spectroscopy. Adsorbed nitric oxide could only be observed in perchloric acid solutions. The higher coverage of adsorbed ammonia in sulfuric acid solution is attributed to a stabilization by coadsorbed (bi-)sulfate species; the higher total coverage in this electrolyte can explain the larger effect of ammonium ions on the ORR activity and selectivity in sulfuric compared to perchloric acid solution.

  2. The role of the anion in the reaction of reducing sugars with ammonium salts.


    Agyei-Aye, Kwasi; Chian, May X; Lauterbach, John H; Moldoveanu, Serban C


    Reactions of reducing sugars with ammonia and its compounds are important commercially, particularly in the preparation of flavors and caramel colors. However, such reactions generally produce a complex series of products ranging from simple molecules to complex polymeric materials, particularly since commercial systems generally involve mixtures of sugars as opposed to single sugars. This complexity has made understanding the mechanisms of such reactions difficult. Therefore, investigatory work has generally been focused on model systems. Herein we report one such study with model systems: the effects of the nature of the anion of the reactions of reducing sugars with ammonium salts. D-Glucose was reacted in aqueous solution with each of the following ammonium salts: acetate, bicarbonate, carbonate, chloride, citrate, formate, monohydrogenphosphate (DAP), sulfate, and sulfite. These reactions were carried out in a Parr bomb at 93 degrees C for 2.5 h. The initial pH of the reaction mixtures was adjusted to pH 8.0 at 25 degrees C. The resulting mixtures were analyzed by LC-MS, and the results were analyzed by comparing the product yields and distributions with those obtained with DAP. The major reaction product of interest was 2,6-deoxyfructosazine, as it had been shown to be a marker for the polymeric material formed from such reactions. It was found that ammonium salts of weak acids were much more effective in effecting the desired reactions than were those of strong acids; however, none was as effective as DAP.

  3. PRN 88-2: Clustering of Quaternary Ammonium Compounds

    EPA Pesticide Factsheets

    This Notice announces that EPA has clustered the Quaternary Ammonium Compounds into four groups for the purpose of testing chemicals to build a database that will support continued registration of the entire family of quaternary ammonium compounds

  4. 21 CFR 184.1296 - Ferric ammonium citrate.

    Code of Federal Regulations, 2014 CFR


    ... granules or as a brownish-yellowish powder. (2) Ferric ammonium citrate (iron (III) ammonium citrate, CAS... granules, as a powder, or as transparent green crystals. (b) The ingredients meet the specifications of the...

  5. Pore mutations in ammonium transporter AMT1 with increased electrogenic ammonium transport activity.


    Loqué, Dominique; Mora, Silvia I; Andrade, Susana L A; Pantoja, Omar; Frommer, Wolf B


    AMT/Mep ammonium transporters mediate high affinity ammonium/ammonia uptake in bacteria, fungi, and plants. The Arabidopsis AMT1 proteins mediate uptake of the ionic form of ammonium. AMT transport activity is controlled allosterically via a highly conserved cytosolic C terminus that interacts with neighboring subunits in a trimer. The C terminus is thus capable of modulating the conductivity of the pore. To gain insight into the underlying mechanism, pore mutants suppressing the inhibitory effect of mutations in the C-terminal trans-activation domain were characterized. AMT1;1 carrying the mutation Q57H in transmembrane helix I (TMH I) showed increased ammonium uptake but reduced capacity to take up methylammonium. To explore whether the transport mechanism was altered, the AMT1;1-Q57H mutant was expressed in Xenopus oocytes and analyzed electrophysiologically. AMT1;1-Q57H was characterized by increased ammonium-induced and reduced methylammonium-induced currents. AMT1;1-Q57H possesses a 100x lower affinity for ammonium (K(m)) and a 10-fold higher V(max) as compared with the wild type form. To test whether the trans-regulatory mechanism is conserved in archaeal homologs, AfAmt-2 from Archaeoglobus fulgidus was expressed in yeast. The transport function of AfAmt-2 also depends on trans-activation by the C terminus, and mutations in pore-residues corresponding to Q57H of AMT1;1 suppress nonfunctional AfAmt-2 mutants lacking the activating C terminus. Altogether, our data suggest that bacterial and plant AMTs use a conserved allosteric mechanism to control ammonium flux, potentially using a gating mechanism that limits flux to protect against ammonium toxicity.

  6. Biogeography of sulfate-reducing prokaryotes in river floodplains.


    Miletto, Marzia; Loy, Alexander; Antheunisse, A Martijn; Loeb, Roos; Bodelier, Paul L E; Laanbroek, Hendrikus J


    In this study, a large-scale field survey was conducted to describe the biogeography of sulfate-reducing prokaryotes (SRPs) in river floodplains. Fingerprints obtained with three methods, i.e. 16S rRNA gene-based oligonucleotide microarray, dsrB-based denaturing gradient gel electrophoresis (DGGE) and polar lipid-derived fatty acid (PLFA) analyses, were used as a proxy to describe the SRPs community diversity. Each set of profiles was subjected to a combined multivariate/correlation analysis in order to compare SRP community profiles and to highlight the environmental variables influencing the SRPs distribution along environmental gradients. Floodplain soils harbored distinct SRP communities displaying biogeographic patterns. Nearly all profiles from the tidal sites consistently separated from the nontidal sites, independently from the screening method and the multivariate statistics used. The distribution of the microarray/DGGE/PLFA-based fingerprints in the principal component plots could be correlated to eight soil variables, i.e. soil organic matter, total nitrogen, total phosphorous and total potassium, and extractable ammonium, nitrate, phosphate and sulfate, as well as seven pore water variables, i.e. phosphate, sulfate, sulfide, chloride, sodium, potassium and magnesium ions. Indication of a salinity- and plant nutrient-dependent distribution of SRPs related to Desulfosarcina, Desulfomonile and Desulfobacter was suggested by microarray, DGGE and PLFA analyses.

  7. Contribution of ammonium ions to the lethality and antimetamorphic effects of ammonium perchlorate.


    Goleman, Wanda L; Carr, James A


    Ammonium perchlorate (AP) is a widespread military waste product in the United States and is a potent thyroid function disruptor in all vertebrates tested thus far. To determine the relative contribution of ammonium ions to the toxicity of AP, we exposed embryonic and larval Xenopus laevis to various concentrations of sodium perchlorate (SP) or ammonium chloride (AC). Ammonium perchlorate was significantly more lethal than SP; 5-d LC50s were 83 and 2,780 mg/L, respectively. To determine whether ammonium ions contribute to the antithyroid effects of AP, we exposed embryonic and larval X. laevis to two sublethal, environmentally relevant concentrations of AP or identical concentrations of AC or SP. At the smaller concentration, only AP delayed metamorphosis and reduced hindlimb growth. Sodium perchlorate and AP, but not AC, prevented metamorphosis and reduced hindlimb growth at the greater concentration. Although AP was slightly more effective in reducing outward manifestations of thyroid disruption, both perchlorate salts, unlike AC, caused profound histopathologic changes in the thyroid. Exposure to the higher concentration of either perchlorate salt produced a feminizing effect, resulting in a skewed sex ratio. We conclude that ammonium ions contribute significantly to the toxicity of AP but not to the direct antithyroid effects of perchlorate.

  8. Comparative irritant potency of inhaled sulfate aerosols: effects on bronchial mucociliary clearance. [Rabbits

    SciTech Connect

    Schlesinger, R.B.


    The effect of 1-hr oral inhalation exposures to submicrometer aerosols of ammonium bisulfate (NH/sub 4/HSO/sub 4/), ammonium sulfate ((NH/sub 4/)/sub 2/SO/sub 4/), and sodium sulfate (Na/sub 2/SO/sub 4/) upon mucociliary clearance from the bronchial tree of rabbits was examined. Exposures to NH/sub 4/HSO/sub 4/ at concentrations of approx. 600 to 1700 3/ produced a significant depression of clearance rate only at the highest exposure level. No significant effects were observed with the other sulfates at levels up to approx. 2000 3/. When results were compared to those from another study in this laboratory using sulfuric acid (H/sub 2/SO/sub 4/) aerosol, the ranking of irritant potency was H/sub 2/SO/sub 4/ > NH/sub 4/HSO/sub 4/ > (NH/sub 4/)/sub 2/SO/sub 4/, Na/sub 2/SO/sub 4/. Alteration in bronchial mucociliary clearance due to sulfate aerosols appears to be related to the deposition of (H/sup +/) on the mucus lining of conducting airways.

  9. Effective Henry's law partitioning and the salting constant of glyoxal in aerosols containing sulfate.


    Kampf, Christopher J; Waxman, Eleanor M; Slowik, Jay G; Dommen, Josef; Pfaffenberger, Lisa; Praplan, Arnaud P; Prévôt, André S H; Baltensperger, Urs; Hoffmann, Thorsten; Volkamer, Rainer


    The reversible partitioning of glyoxal was studied in simulation chamber experiments for the first time by time-resolved measurements of gas-phase and particle-phase concentrations in sulfate-containing aerosols. Two complementary methods for the measurement of glyoxal particle-phase concentrations are compared: (1) an offline method utilizing filter sampling of chamber aerosols followed by HPLC-MS/MS analysis and (2) positive matrix factorization (PMF) analysis of aerosol mass spectrometer (AMS) data. Ammonium sulfate (AS) and internally mixed ammonium sulfate/fulvic acid (AS/FA) seed aerosols both show an exponential increase of effective Henry's law coefficients (KH,eff) with AS concentration (cAS, in mol kg(-1) aerosol liquid water, m = molality) and sulfate ionic strength, I(SO4(2-)) (m). A modified Setschenow plot confirmed that "salting-in" of glyoxal is responsible for the increased partitioning. The salting constant for glyoxal in AS is K(S)CHOCHO = (-0.24 ± 0.02) m(-1), and found to be independent of the presence of FA. The reversible glyoxal uptake can be described by two distinct reservoirs for monomers and higher molecular weight species filling up at characteristic time constants. These time constants are τ1 ≈ 10(2) s and τ2 ≈ 10(4) s at cAS < 12 m, and about 1-2 orders of magnitude slower at higher cAS, suggesting that glyoxal uptake is kinetically limited at high salt concentrations.

  10. Ice Formation by Sulfate and Sulfuric Acid Aerosol Particles under Upper-Tropospheric Conditions.

    NASA Astrophysics Data System (ADS)

    Chen, Yalei; Demott, Paul J.; Kreidenweis, Sonia M.; Rogers, David C.; Eli Sherman, D.


    Ice formation in ammoniated sulfate and sulfuric acid aerosol particles under upper-tropospheric conditions was studied using a continuous flow thermal diffusion chamber. This technique allowed for particle exposure to controlled temperatures and relative humidities for known residence times. The phase states of (NH4)2SO4 and NH4HSO4 particles were found to have important impacts on their ice formation capabilities. Dry (NH4)2SO4 particles nucleated ice only at high relative humidity (RH 94%) with respect to water at temperatures between 40° and 60°C. This result suggested either an impedance or finite time dependence to deliquescence and subsequent homogeneous freezing nucleation. Ammonium sulfate particles that entered the diffusion chamber in a liquid state froze homogeneously at relative humidities that were 10% lower than where ice nucleated on initially dry particles. Likewise, crystalline or partially crystallized (as letovicite) NH4HSO4 particles required higher relative humidities for ice nucleation than did initially liquid bisulfate particles. Liquid particles of size 0.2 m composed of either ammonium sulfate or bisulfate froze at lower relative humidity at upper-tropospheric temperatures than did 0.05-m sulfuric acid aerosol particles. Comparison of calculated homogeneous freezing point depressions suggest that size effects on freezing may be more important than the degree of ammoniation of the sulfate compound.

  11. Identification and characterization of the sulfate precipitate in GI147211C IV formulation.


    Tong, W Q; Clark, J; Franklin, M L; Jozwiakowski, J P; Lemmo, J B; Sisco, J M; Whight, S R


    GI147211, a water soluble analog of camptothecin, is currently being investigated for the treatment of cancer as a topoisomerase I inhibitor. Precipitate was observed in some samples of a stability lot of the IV clinical formulation after being stored at 5 degrees C for one month. The precipitate was identified as the sulfate salt of GI147211 by various techniques including Environmental Scanning Electron Microscope/Energy Dispersive X-ray (ESEM/EDX) and Ion Chromatography (IC). The cause of the precipitation was proven to be from the presence of residual sulfate ions in ammonium sulfate treated glass vials that were suspected to be improperly washed. The solubility product (Ksp) of the sulfate salt was determined in 5% dextrose solution adjusted to pH 3.5 at 5 degrees C to mimic the clinical formulation and refrigerated storage conditions. The Ksp was also determined at 15 and 33 degrees C to determine the temperature effect on the constant. The stoichiometry of the sulfate salt was determined by solubility experiments using HPLC and IC to be 2:1 (base/salt). Based on the stoichiometry, the Ksp was calculated to be 3.04 x 10(-12), 9.27 x 10(-12) and 9.96 x 10(-11) M3 at 5 degrees C, 15 degrees C and 33 degrees C, respectively. Using the Ksp values, the sulfate threshold in GI147211 Injection when GI147211 sulfate precipitates was determined to be 1.3, 3.8 and 41 ppm at 5, 15 and 33 degrees C, respectively. Further experiments demonstrated that using the proper cleaning techniques the sulfate level in the treated vials was reduced to < 1.3 ppm. The washing cycles for the vials used for clinical supplies were thereafter modified so that the sulfate precipitate would no longer be an issue.

  12. 21 CFR 172.430 - Iron ammonium citrate.

    Code of Federal Regulations, 2014 CFR


    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Iron ammonium citrate. 172.430 Section 172.430... ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Anticaking Agents § 172.430 Iron ammonium citrate. Iron ammonium citrate may be safely used in food in accordance with the following...

  13. 40 CFR 721.10582 - Quaternary ammonium compound (generic).

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Quaternary ammonium compound (generic... Specific Chemical Substances § 721.10582 Quaternary ammonium compound (generic). (a) Chemical substance and... ammonium compound (PMN P-10-571) is subject to reporting under this section for the significant new...

  14. 40 CFR 721.10591 - Tertiary ammonium compound (generic).

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Tertiary ammonium compound (generic... Specific Chemical Substances § 721.10591 Tertiary ammonium compound (generic). (a) Chemical substance and... ammonium compound (PMN P-11-110) is subject to reporting under this section for the significant new...

  15. 40 CFR 721.10582 - Quaternary ammonium compound (generic).

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Quaternary ammonium compound (generic... Specific Chemical Substances § 721.10582 Quaternary ammonium compound (generic). (a) Chemical substance and... ammonium compound (PMN P-10-571) is subject to reporting under this section for the significant new...

  16. 40 CFR 721.10591 - Tertiary ammonium compound (generic).

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Tertiary ammonium compound (generic... Specific Chemical Substances § 721.10591 Tertiary ammonium compound (generic). (a) Chemical substance and... ammonium compound (PMN P-11-110) is subject to reporting under this section for the significant new...

  17. A new potentiometric ammonium electrode for biosensor construction.


    Karakuş, Emine; Pekyardimci, Sule; Kiliç, Esma


    New ammonium-selective membrane electrode based on poly(vinyl chloride) (PVC) membrane containing palmitic acid (a long-chain fatty acid) and nonactin as an ammonium ionophore for the determination of ammonium ions in the 10(-7) - 10(-1) mol/L concentration range was prepared and compared to those of the electrode prepared by using carboxylated PVC. Sebacate was used as a plasticiser for both of the ammonium sensor membranes. The analytical characteristics of the ammonium electrodes was investigated. The effect of pH, buffer concentration, temperature and stirring rate on the response to ammonium electrode was investigated. The linear working range and sensitivity of the electrodes were also determined. Ammonium electrodes give Nernstian response (52-58 mV/p[NH4+]) throughout the ammonium ion concentration range of 10(-1) to 10(-6)M with detection limits of 10(-6)M ammonium ions. The ammonium-selective electrodes prepared by using the PVC membranes containing palmitic acid showed more effective performance than those of the carboxylated PVC. The ammonium ion sensor has potential application in the analysis of ammonium ions for biosensor construction.

  18. 78 FR 32690 - Certain Ammonium Nitrate From Ukraine

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... COMMISSION Certain Ammonium Nitrate From Ukraine Determination On the basis of the record \\1\\ developed in... antidumping duty order on certain ammonium nitrate from Ukraine would be likely to lead to continuation or... Publication 4396 (May 2013), entitled Certain Ammonium Nitrate from Ukraine: Investigation No....

  19. 40 CFR 721.10511 - Quaternary ammonium salts (generic).

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Quaternary ammonium salts (generic... Specific Chemical Substances § 721.10511 Quaternary ammonium salts (generic). (a) Chemical substance and... ammonium salts (PMNs P-07-320, P-07-321, P-07-322, P-07-323, and P-07-324) are subject to reporting...

  20. 40 CFR 721.10430 - Tetra alkyl ammonium salt (generic).

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Tetra alkyl ammonium salt (generic... Specific Chemical Substances § 721.10430 Tetra alkyl ammonium salt (generic). (a) Chemical substance and... ammonium salt (PMN P-97-823) is subject to reporting under this section for the significant new...

  1. 40 CFR 721.10511 - Quaternary ammonium salts (generic).

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Quaternary ammonium salts (generic... Specific Chemical Substances § 721.10511 Quaternary ammonium salts (generic). (a) Chemical substance and... ammonium salts (PMNs P-07-320, P-07-321, P-07-322, P-07-323, and P-07-324) are subject to reporting...

  2. 40 CFR 721.10430 - Tetra alkyl ammonium salt (generic).

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Tetra alkyl ammonium salt (generic... Specific Chemical Substances § 721.10430 Tetra alkyl ammonium salt (generic). (a) Chemical substance and... ammonium salt (PMN P-97-823) is subject to reporting under this section for the significant new...

  3. 21 CFR 184.1141a - Ammonium phosphate, monobasic.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium phosphate, monobasic. 184.1141a Section... SAFE Listing of Specific Substances Affirmed as GRAS § 184.1141a Ammonium phosphate, monobasic. (a) Ammonium phosphate, monobasic (NH4H2PO4, CAS Reg. No. 7722-76-1) is manufactured by reacting ammonia with...

  4. 21 CFR 184.1141a - Ammonium phosphate, monobasic.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium phosphate, monobasic. 184.1141a Section... SAFE Listing of Specific Substances Affirmed as GRAS § 184.1141a Ammonium phosphate, monobasic. (a) Ammonium phosphate, monobasic (NH4H2PO4, CAS Reg. No. 7722-76-1) is manufactured by reacting ammonia with...

  5. 21 CFR 184.1141a - Ammonium phosphate, monobasic.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium phosphate, monobasic. 184.1141a Section... SAFE Listing of Specific Substances Affirmed as GRAS § 184.1141a Ammonium phosphate, monobasic. (a) Ammonium phosphate, monobasic (NH4H2PO4, CAS Reg. No. 7722-76-1) is manufactured by reacting ammonia with...

  6. 40 CFR 721.10302 - Zinc ammonium phosphate (generic).

    Code of Federal Regulations, 2012 CFR


    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Zinc ammonium phosphate (generic). 721... Substances § 721.10302 Zinc ammonium phosphate (generic). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as zinc ammonium phosphate (PMN P...

  7. 21 CFR 184.1141b - Ammonium phosphate, dibasic.

    Code of Federal Regulations, 2013 CFR


    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium phosphate, dibasic. 184.1141b Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1141b Ammonium phosphate, dibasic. (a) Ammonium phosphate, dibasic ((NH4)2HPO4, CAS Reg. No. 7783-28-0) is manufactured by reacting ammonia with phosphoric...

  8. 40 CFR 721.10302 - Zinc ammonium phosphate (generic).

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Zinc ammonium phosphate (generic). 721... Substances § 721.10302 Zinc ammonium phosphate (generic). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as zinc ammonium phosphate (PMN P...

  9. 21 CFR 184.1141b - Ammonium phosphate, dibasic.

    Code of Federal Regulations, 2010 CFR


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium phosphate, dibasic. 184.1141b Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1141b Ammonium phosphate, dibasic. (a) Ammonium phosphate, dibasic ((NH4)2HPO4, CAS Reg. No. 7783-28-0) is manufactured by reacting ammonia with phosphoric...

  10. 21 CFR 184.1141a - Ammonium phosphate, monobasic.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium phosphate, monobasic. 184.1141a Section... SAFE Listing of Specific Substances Affirmed as GRAS § 184.1141a Ammonium phosphate, monobasic. (a) Ammonium phosphate, monobasic (NH4H2PO4, CAS Reg. No. 7722-76-1) is manufactured by reacting ammonia with...

  11. 40 CFR 721.10302 - Zinc ammonium phosphate (generic).

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Zinc ammonium phosphate (generic). 721... Substances § 721.10302 Zinc ammonium phosphate (generic). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as zinc ammonium phosphate (PMN P...

  12. 21 CFR 184.1141b - Ammonium phosphate, dibasic.

    Code of Federal Regulations, 2012 CFR


    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium phosphate, dibasic. 184.1141b Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1141b Ammonium phosphate, dibasic. (a) Ammonium phosphate, dibasic ((NH4)2HPO4, CAS Reg. No. 7783-28-0) is manufactured by reacting ammonia with phosphoric...

  13. 21 CFR 184.1141b - Ammonium phosphate, dibasic.

    Code of Federal Regulations, 2011 CFR


    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium phosphate, dibasic. 184.1141b Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1141b Ammonium phosphate, dibasic. (a) Ammonium phosphate, dibasic ((NH4)2HPO4, CAS Reg. No. 7783-28-0) is manufactured by reacting ammonia with phosphoric...

  14. Analysis of an explosion accident of nitrogen trichloride in a waste liquid containing ammonium ion and platinum black.


    Okada, Ken; Akiyoshi, Miyako; Ishizaki, Keiko; Sato, Hiroyasu; Matsunaga, Takehiro


    Five liters of sodium hypochlorite aqueous solution (12 mass%) was poured into 300 L of liquid waste containing ammonium ion of about 1.8 mol/L in a 500 L tank in a plant area; then, two minutes later the solution exploded with a flash on March 30th, 2005. The tank cover, the fluorescent lamp and the air duct were broken by the blast wave. Thus, we have conducted 40 runs of laboratory-scale explosion tests under various conditions (solution concentrations of (NH4)2SO4 and NaClO, temperatures, Pt catalysts, pH, etc.) to investigate the causes for such an explosion. When solutions of ammonium sulfate and sodium hypochlorite are mixed in the presence of platinum black, explosions result. This is ascribable to the formation of explosive nitrogen trichloride (NCl3). In the case where it is necessary to mix these 2 solutions (ammonium sulfate and sodium hypochlorite) in the presence of platinum black, the following conditions would reduce a probability of explosion; the initial concentration of NH4(+) should be less than 3 mol/L and the pH should be higher than 6. The hypochlorite solution (in 1/10 in volume) to be added at room temperature is recommended to be less than 0.6 mol/L.

  15. Surface investigation and tribological mechanism of a sulfate-based lubricant deposited on zinc-coated steel sheets

    NASA Astrophysics Data System (ADS)

    Timma, Christian; Lostak, Thomas; Janssen, Stella; Flock, Jörg; Mayer, Christian


    Phosphatation is a well-known technique to improve friction and wear behaviour of zinc coated steel, but has a variety of economic and ecologic limitations. In this study an alternative coating based on ammonium sulfate ((NH4)2SO4) is applied on skin-passed hot-dip galvanized steel sheets in order to investigate its surface chemical and tribological behaviour in a Pin-on-Disk Tribometer. Raman- and X-ray photoelectron spectroscopic results revealed a formation of ammonium zinc sulfate ((NH4)2Zn(SO4)2 * xH2O) on the surface, which is primarily located in the skin-passed areas of the steel material. Sulfate coated samples exhibited a superior friction behaviour in Pin-on-Disk Tests using squalane as a model substance for oil-like lubricated conditions and a formation of a thin lubrication film is obtained in the wear track. Squalane acts as a carrier substance for ammonium zinc sulfate, leading to an effective lubrication film in the wear track.

  16. Structure of catabolite activator protein with cobalt(II) and sulfate

    SciTech Connect

    Rao, Ramya R.; Lawson, Catherine L.


    The crystal structure of E. coli catabolite activator protein with bound cobalt(II) and sulfate ions at 1.97 Å resolution is reported. The crystal structure of cyclic AMP–catabolite activator protein (CAP) from Escherichia coli containing cobalt(II) chloride and ammonium sulfate is reported at 1.97 Å resolution. Each of the two CAP subunits in the asymmetric unit binds one cobalt(II) ion, in each case coordinated by N-terminal domain residues His19, His21 and Glu96 plus an additional acidic residue contributed via a crystal contact. The three identified N-terminal domain cobalt-binding residues are part of a region of CAP that is important for transcription activation at class II CAP-dependent promoters. Sulfate anions mediate additional crystal lattice contacts and occupy sites corresponding to DNA backbone phosphate positions in CAP–DNA complex structures.

  17. Development and validation of stability-indicating HPLC method for determination of cefpirome sulfate.


    Zalewski, Przemysław; Skibiński, Robert; Cielecka-Piontek, Judyta; Bednarek-Rajewska, Katarzyna


    The stability-indicating LC assay method was developed and validated for quantitative determination of cefpirome sulfate (CPS) in the presence of degradation products formed during the forced degradation studies. An isocratic HPLC method was developed with Lichrospher RP-18 column, 5 μm particle size, 125 mm x 4 mm column and 12 mM ammonium acetate-acetonitrile (90 : 10 v/v) as a mobile phase. The flow rate of the mobile phase was 1.0 mL/min. Detection wavelength was 270 nm and temperature was 30 degrees C. Cefpirome sulfate as other cephalosporins was subjected to stress conditions of degradation in aqueous solutions including hydrolysis, oxidation, photolysis and thermal degradation. The developed method was validated with regard to linearity, accuracy, precision, selectivity and robustness. The method was applied successfully for identification and determination of cefpirome sulfate in pharmaceuticals and during kinetic studies.

  18. Impact of sulfation and desulfation on NOx reduction using Cu-chabazite SCR catalysts


    Brookshear, Daniel William; Nam, Jeong -Gil; Nguyen, Ke; ...


    This bench reactor study investigates the impact of gaseous sulfur on the NOx reduction activity of Cu-chabazite SCR (Cu-CHA) catalysts at SO2 concentrations representative of marine diesel engine exhaust. After two hours of 500 ppm SO2 exposure at 250 and 400 °C in the simulated diesel exhaust gases, the NOx reduction activity of the sulfated Cu-CHA SCR catalysts is severely degraded at evaluation temperatures below 250 °C; however, above 250 °C the impact of sulfur exposure is minimal. EPMA shows that sulfur is located throughout the washcoat and along the entire length of the sulfated samples. Interestingly, BET measurements revealmore » that the sulfated samples have a 20% decrease in surface area. Moreover, the sulfated samples show a decrease in NOx/nitrate absorption during NO exposure in a DRIFTS reactor which suggests that Cu sites in the catalyst are blocked by the presence of sulfur. SO2 exposure also results in an increase in NH3 storage capacity, possibly due to the formation of ammonium sulfate species in the sulfated samples. In all cases, lean thermal treatments as low as 500 °C reverse the effects of sulfur exposure and restore the NOx reduction activity of the Cu-CHA catalyst to that of the fresh condition.« less

  19. Integrated approach for investigating the durability of self-consolidating concrete to sulfate attack

    NASA Astrophysics Data System (ADS)

    Bassuoni, Mohamed Tamer F.

    The growing use of self-consolidating concrete (SCC) in various infrastructure applications exposed to sulfate-rich environments necessitates conducting comprehensive research to evaluate its durability to external sulfate attack. Since the reliability and adequacy of standard sulfate immersion tests have been questioned, the current thesis introduced an integrated testing approach for assessing the durability of a wide scope of SCC mixtures to external sulfate attack. This testing approach involved progressive levels of complexity from single to multiple damage processes. A new series of sulfate attack tests involving multiple field-like parameters and combined damage mechanisms (various cations, controlled pH, wetting-drying, partial immersion, freezing-thawing, and cyclic cold-hot conditions with or without sustained flexural loading) were designed to evaluate the performance (suitability) of the SCC mixtures under various sulfate attack exposure scenarios. The main mixture design variables of SCC included the type of binder (single, binary, ternary and quaternary), air-entrainment, sand-to-aggregate mass ratio and hybrid fibre reinforcement. The comprehensive database and knowledge obtained from this research were used to develop smart models (fuzzy and neuro-fuzzy inference systems) based on artificial-intelligence to evaluate and predict the performance of the SCC mixtures under various sulfate attack exposure regimes implemented in this study. In full immersion tests involving high concentration sodium and magnesium sulfate solutions with controlled pH, the low penetrability of SCC was responsible for the high durability of specimens. Ternary and quaternary cementitious systems with or without limestone materials provided a passivating layer, with or without acid neutralization capacity, which protected SCC from severe damage in the aggressive sulfuric acid and ammonium sulfate solutions. In contrast to conclusions drawn from the sodium sulfate immersion

  20. Residual keratan sulfate in chondroitin sulfate formulations for oral administration.


    Pomin, Vitor H; Piquet, Adriana A; Pereira, Mariana S; Mourão, Paulo A S


    Chondroitin sulfate is a biomedical glycosaminoglycan (GAG) mostly used as a dietary supplement. We undertook analysis on some formulations of chondroitin sulfates available for oral administration. The analysis was based on agarose-gel electrophoresis, strong anion-exchange chromatography, digestibility with specific GAG lyases, uronic acid content, NMR spectroscopy, and size-exclusion chromatography. Keratan sulfate was detected in batches from shark cartilage, averaging ∼16% of the total GAG. Keratan sulfate is an inert material, and hazardous effects due to its presence in these formulations are unlikely to occur. However, its unexpected high percentage compromises the desired amounts of the real ingredient specified on the label claims, and forewarns the pharmacopeias to update their monographs. The techniques they recommended, especially cellulose acetate electrophoresis, are inefficient in detecting keratan sulfate in chondroitin sulfate formulations. In addition, this finding also alerts the manufacturers for improved isolation procedures as well as the supervisory agencies for better audits. Analysis based on strong anion-exchange chromatography is shown to be more reliable than the methods presently suggested by standard pharmacopeias.

  1. 76 FR 23569 - Termination of the Suspension Agreement on Solid Fertilizer Grade Ammonium Nitrate From the...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... International Trade Administration Termination of the Suspension Agreement on Solid Fertilizer Grade Ammonium... (``AD'') Investigation on Solid Fertilizer Grade Ammonium Nitrate from the Russian Federation (``the... determine whether imports of solid fertilizer grade ammonium nitrate (``ammonium nitrate'') from Russia...

  2. 76 FR 49449 - Continuation of Antidumping Duty Order on Solid Fertilizer Grade Ammonium Nitrate From the...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... International Trade Administration Continuation of Antidumping Duty Order on Solid Fertilizer Grade Ammonium... duty investigation on solid fertilizer grade ammonium nitrate (``ammonium nitrate'') from the Russian... Solid Fertilizer Grade Ammonium Nitrate From the Russian Federation and Notice of Antidumping Duty...

  3. p-Cresyl Sulfate

    PubMed Central

    Gryp, Tessa; Vanholder, Raymond; Vaneechoutte, Mario; Glorieux, Griet


    If chronic kidney disease (CKD) is associated with an impairment of kidney function, several uremic solutes are retained. Some of these exert toxic effects, which are called uremic toxins. p-Cresyl sulfate (pCS) is a prototype protein-bound uremic toxin to which many biological and biochemical (toxic) effects have been attributed. In addition, increased levels of pCS have been associated with worsening outcomes in CKD patients. pCS finds its origin in the intestine where gut bacteria metabolize aromatic amino acids, such as tyrosine and phenylalanine, leading to phenolic end products, of which pCS is one of the components. In this review we summarize the biological effects of pCS and its metabolic origin in the intestine. It appears that, according to in vitro studies, the intestinal bacteria generating phenolic compounds mainly belong to the families Bacteroidaceae, Bifidobacteriaceae, Clostridiaceae, Enterobacteriaceae, Enterococcaceae, Eubacteriaceae, Fusobacteriaceae, Lachnospiraceae, Lactobacillaceae, Porphyromonadaceae, Staphylococcaceae, Ruminococcaceae, and Veillonellaceae. Since pCS remains difficult to remove by dialysis, the gut microbiota could be a future target to decrease pCS levels and its toxicity, even at earlier stages of CKD, aiming at slowing down the progression of the disease and decreasing the cardiovascular burden. PMID:28146081

  4. Simultaneous quantification of cholesterol sulfate, androgen sulfates, and progestagen sulfates in human serum by LC-MS/MS[S

    PubMed Central

    Sánchez-Guijo, Alberto; Oji, Vinzenz; Hartmann, Michaela F.; Traupe, Heiko; Wudy, Stefan A.


    Steroids are primarily present in human fluids in their sulfated forms. Profiling of these compounds is important from both diagnostic and physiological points of view. Here, we present a novel method for the quantification of 11 intact steroid sulfates in human serum by LC-MS/MS. The compounds analyzed in our method, some of which are quantified for the first time in blood, include cholesterol sulfate, pregnenolone sulfate, 17-hydroxy-pregnenolone sulfate, 16-α-hydroxy-dehydroepiandrosterone sulfate, dehydroepiandrosterone sulfate, androstenediol sulfate, androsterone sulfate, epiandrosterone sulfate, testosterone sulfate, epitestosterone sulfate, and dihydrotestosterone sulfate. The assay was conceived to quantify sulfated steroids in a broad range of concentrations, requiring only 300 μl of serum. The method has been validated and its performance was studied at three quality controls, selected for each compound according to its physiological concentration. The assay showed good linearity (R2 > 0.99) and recovery for all the compounds, with limits of quantification ranging between 1 and 80 ng/ml. Averaged intra-day and between-day precisions (coefficient of variation) and accuracies (relative errors) were below 10%. The method has been successfully applied to study the sulfated steroidome in diseases such as steroid sulfatase deficiency, proving its diagnostic value. This is, to our best knowledge, the most comprehensive method available for the quantification of sulfated steroids in human blood. PMID:26239050

  5. Simultaneous quantification of cholesterol sulfate, androgen sulfates, and progestagen sulfates in human serum by LC-MS/MS.


    Sánchez-Guijo, Alberto; Oji, Vinzenz; Hartmann, Michaela F; Traupe, Heiko; Wudy, Stefan A


    Steroids are primarily present in human fluids in their sulfated forms. Profiling of these compounds is important from both diagnostic and physiological points of view. Here, we present a novel method for the quantification of 11 intact steroid sulfates in human serum by LC-MS/MS. The compounds analyzed in our method, some of which are quantified for the first time in blood, include cholesterol sulfate, pregnenolone sulfate, 17-hydroxy-pregnenolone sulfate, 16-α-hydroxy-dehydroepiandrosterone sulfate, dehydroepiandrosterone sulfate, androstenediol sulfate, androsterone sulfate, epiandrosterone sulfate, testosterone sulfate, epitestosterone sulfate, and dihydrotestosterone sulfate. The assay was conceived to quantify sulfated steroids in a broad range of concentrations, requiring only 300 μl of serum. The method has been validated and its performance was studied at three quality controls, selected for each compound according to its physiological concentration. The assay showed good linearity (R(2) > 0.99) and recovery for all the compounds, with limits of quantification ranging between 1 and 80 ng/ml. Averaged intra-day and between-day precisions (coefficient of variation) and accuracies (relative errors) were below 10%. The method has been successfully applied to study the sulfated steroidome in diseases such as steroid sulfatase deficiency, proving its diagnostic value. This is, to our best knowledge, the most comprehensive method available for the quantification of sulfated steroids in human blood. Copyright © 2015 by the American Society for Biochemistry and Molecular Biology, Inc.

  6. Detonation Properties of Ammonium Dinitramide (ADN)

    NASA Astrophysics Data System (ADS)

    Wätterstam, A.; Östmark, H.; Helte, A.; Karlsson, S.


    Ammonium Dinitramide, ADN, has a potential as an oxidizer for underwater high explosives. Pure ADN has a large reaction-zone length and shows a strong non-ideal behaviour. The work presented here is an extension of previous work.(Sensitivity and Performance Characterization of Ammonium Dinitramide (ADN). Presented at 11th International Detonation Symposium, Snowmass, CO, 1998.) Experiments for determining the detonation velocity as a function of inverse charge radius and density, reaction-zone length and curvature, and the detonation pressure are presented. Measurements of pressure indicates that no, or weak von-Neumann spike exists, suggesting an immediate chemical decomposition. Experimental data are compared with predicted using thermochemical codes and ZND-theory.

  7. Decomposition of free chlorine with tertiary ammonium.


    Katano, Hajime; Uematsu, Kohei; Tatsumi, Hirosuke; Tsukatani, Toshihide


    The reaction of free chlorine with tertiary ammonium or amine compounds in aqueous solution was studied by the amperometry at a rotating Pt-disk electrode. The amperometric method can be applied to follow the concentration of free chlorine (c(Cl)) even in the presence of chloramine species. By addition of mono- and dibutylammonium to the solution containing free chlorine, the step-like decrease in c(Cl) was observed, indicating the rapid formation of the stable chloramine species. By addition of tributylammonium, the c(Cl) was decreased exponentially to nearly zero even if the free chlorine was present initially in excess. The c(Cl)-t curves can be explained by tributylammonium-species-catalyzed decomposition of free chlorine to chloride ion. The catalytic decomposition was observed also with the tertiary-ammonium-based anion-exchange resins. Furthermore, the anion-exchange resins exhibited the decomposition of not only free chlorine but also chloramines in water.

  8. Ammonium chloride poisoning in chronic renal disease

    PubMed Central

    Levene, Donald L.; Knight, Allan


    A 58-year-old woman with a long history of renal stone disease and urinary tract infection presented to the emergency room with exhaustion and air hunger. Laboratory data confirmed profound metabolic acidosis. Unduly large quantities of bicarbonate and potassium were required for correction of the deficits. She had been taking 6 g daily of ammonium chloride as a urine-acidifying agent for a period of six months in addition to agents directed against urinary tract infection. The combination of impaired renal function and effective hydrogen ion loading resulted in profound systemic acidosis. The metabolic derangements associated with the administration of ammonium chloride and its use as a therapeutic agent are discussed. PMID:4850503

  9. Corrosion and repairs of ammonium carbamate decomposers

    SciTech Connect

    De Romero, M.F.; Galban, J.P.


    Corrosion-erosion problems occurred in the carbon steel base metal of the ammonium carbamate decomposers in an urea extraction process lined with type 316L (UNS S31603) urea grade stainless steel. The cladding was replaced by weld overlay using a semiautomatic gas metal arc welding process. The first layer was alloy 25%Cr-15%Ni-2%Mo (UNS W30923); the second layer was alloy 25%Cr-22%Ni-2%Mo (UNS W31020).

  10. Nitrate, ammonium, and potassium sensing and signaling.


    Ho, Cheng-Hsun; Tsay, Yi-Fang


    Plants acquire numerous nutrients from the soil. In addition, nutrients elicit many physiological and morphological responses especially in roots. Recently, there has been significant progress in identifying the sensing and regulatory mechanisms of several essential nutrients. In this review, we describe the newly identified signaling components of nitrate, ammonium, and potassium, focusing specifically on the initial sensing steps. Copyright © 2010 Elsevier Ltd. All rights reserved.

  11. Anticaking and antidusting composition for ammonium nitrate

    SciTech Connect

    Newman, A.W.; Bishop, M.L.


    An aqueous liquid anticaking and antidusting composition is described comprising, from 20 to 30 parts of a sodium naphthalene sulfonate, from 17 to 28 parts of an ammonium naphthalene sulfonate, the naphthalene of the aforesaid sulfonates being selected from naphthalene and methyl-substituted derivatives thereof, and from 30 to 80 parts of water, the composition being neutralized with acid to a pH of from about 5 to about 7.

  12. Review of Ammonium Dinitramide Toxicity Studies

    DTIC Science & Technology


    Dean, K. W., Pace, D. M ., and Carmichael, A. J . Effects of ammonium dinitramide in human liver slices: An EPR/spin trapping study. Armstrong...Steel-Goodwin, L., Kuhlmann, K. J ., Miller, C., Pace, M . D., and Carmichael, A. J . Effects of reactive oxygen and nitrogen species induced by...Biotechnology Branch Teresa R. Sterner Henry M . Jackson Foundation for the Advancement of Military Medicine Wright-Patterson AFB, OH

  13. Oxidation of ammonium sulfite in aqueous solutions using ozone technology

    NASA Astrophysics Data System (ADS)

    Li, Yue; Shang, Kefeng; Lu, Na; Li, Jie; Wu, Yan


    How to deal with unstable ammonium sulfite, the byproduct of flue gas desulfuration by ammonia absorption methods, has been a difficult problem in recent years. Oxidation of ammonium sulfite in aqueous solutions using ozone produced by a surface discharge system was investigated in the paper. The oxidation efficiency of ammonium sulfite by ozone and traditional air aeration were compared, and the factors including ozone concentration, gas flow rate, initial concentration of ammonium sulfite solution and reaction temperature were discussed. The results show that the oxidation efficiency of ammonium sulfite by ozone technology reached nearly 100% under the optimum conditions, which had a significant increase compared with that by air aeration.



    Ellis, A.S.; Mooney, R.B.


    This patent relates to the preparation of ammonium uranium fluoride. The process comprises adding a water soluble fluoride to an aqueous solution of a uranous compound containing an ammonium salt, and isolating the resulting precipitate. This patent relates to the manufacture of uranium tetnafluoride from ammonium uranium fluoride, NH/sub 4/UF/sub 5/. Uranium tetrafluoride is prepared by heating the ammonium uranium fluoride to a temperature at which dissociation occurs with liberation of ammonium fluoride. Preferably the process is carried out under reduced pressure, or in a current of an inert gas.

  15. Cement composition and sulfate attack

    SciTech Connect

    Shanahan, Natalya; Zayed, Abla . E-mail:


    Four cements were used to address the effect of tricalcium silicate content of cement on external sulfate attack in sodium sulfate solution. The selected cements had similar fineness and Bogue-calculated tricalcium aluminate content but variable tricalcium silicates. Durability was assessed using linear expansion and compressive strength. Phases associated with deterioration were examined using scanning electron microscopy and X-ray diffraction. Mineralogical phase content of the as-received cements was studied by X-ray diffraction using two methods: internal standard and Rietveld analysis. The results indicate that phase content of cements determined by X-ray mineralogical analysis correlates better with the mortar performance in sulfate environment than Bogue content. Additionally, it was found that in cements containing triclacium aluminate only in the cubic form, the observed deterioration is affected by tricalcium silicate content. Morphological similarities between hydration products of high tricalcium aluminate and high tricalcium silicate cements exposed to sodium sulfate environment were also observed.

  16. Equation of State of Ammonium Nitrate

    NASA Astrophysics Data System (ADS)

    Robbins, David L.; Sheffield, Stephen A.; Dattelbaum, Dana M.; Velisavljevic, Nenad; Stahl, David B.


    Ammonium nitrate (AN) is a widely used fertilizer and mining explosive. AN is commonly used in ammonium nitrate-fuel oil (ANFO), which is a mixture of explosive-grade AN prills and fuel oil in a 94:6 ratio by weight. ANFO is a non-ideal explosive with measured detonation velocities around 4 km/s. The equation of state properties and known initiation behavior of neat AN are limited. We present the results of a series of gas gun-driven plate impact experiments on pressed neat ammonium nitrate at 1.72 g/cm3. No evidence of initiation was observed under shock loading to 22 GPa. High pressure x-ray diffraction experiments in diamond anvil cells provided insight into the high pressure phase behavior over the same pressure range (to 25 GPa), as well as a static isotherm at ambient temperature. From the isotherm and thermodynamic properties at ambient conditions, a preliminary unreacted equation of state (EOS) has been developed based on the Murnaghan isotherm and Helmholtz formalism [1], which compares favorably with the available experimental Hugoniot data on several densities of AN.

  17. Herbicide: fatal ammonium thiocyanate and aminotriazole poisoning.


    Legras, A; Skrobala, D; Furet, Y; Kintz, P; Forveille, E; Dequin, P F; Perrotin, D


    To describe fatal herbicide poisoning with Radoxone TL composed of aminotriazole and ammonium thiocyanate. A 54-year-old man was hospitalized because of unexplained coma with myoclonic jerks and vascular collapse. Despite symptomatic treatment with mechanical ventilation and vascular filling, life-threatening shock occurred with oliguria, profound metabolic acidosis and cardiac arrest. Hyperchloremia (141 mmol/L) with reversed anion gap (-19) suggested interference with chloride measurement caused by halogens (Br,F,I) or other anions such as thiocyanate. Eventually a weed killer, Radoxone TL containing ammonium thiocyanate, was found at the patient's house. Thiocyanate and aminotriazole blood levels were 750 mg/L and 138 mg/L respectively more than 12 hours after ingestion. After prolonged cardiopulmonary resuscitation, continuous venovenous hemodiafiltration was performed. Despite hemodynamic recovery the patient died 48 hours later of postanoxic coma. Aminotriazole, a systemic nonselective herbicide, is often associated with ammonium thiocyanate which enhances its activity. Experimental studies and previous fatal cases suggest a predominant toxicity of thiocyanate. Early diagnosis is important.

  18. Indoxyl sulfate induces nephrovascular senescence.


    Niwa, Toshimitsu; Shimizu, Hidehisa


    Indoxyl sulfate is markedly accumulated in the serum of chronic kidney disease (CKD) patients. The oral sorbent AST-120 reduces serum levels of indoxyl sulfate in CKD patients by adsorbing indole, a precursor of indoxyl sulfate, in the intestine. Indoxyl sulfate is taken up by proximal tubular cells through organic anion transporters (OAT1, OAT3), and it induces reactive oxygen species (ROS) with impairment of cellular antioxidative system. Indoxyl sulfate stimulates progression of CKD by increasing renal expression of profibrotic cytokines such as transforming growth factor beta 1. Further, it promotes the expression of p53 by ROS-induced activation of nuclear factor kappa B, thereby accelerating senescence of proximal tubular cells with progression of CKD. Administration of indoxyl sulfate to hypertensive rats reduces renal expression of Klotho and promotes cell senescence, with expression of senescence-associated beta-galactosidase, p53, p21, p16, and retinoblastoma protein, accompanied by kidney fibrosis. Indoxyl sulfate downregulates Klotho expression in the kidneys through production of ROS and activation of nuclear factor kappa B in proximal tubular cells. It promotes cell senescence, with expression of senescence-associated beta-galactosidase, p53, p21, p16, and retinoblastoma protein, in the aorta of hypertensive rats. It also promotes aortic calcification and aortic wall thickening in hypertensive rats with expression of osteoblast-specific proteins, induces ROS in vascular smooth muscle cells and vascular endothelial cells, stimulates proliferation and osteoblastic transdifferentiation of vascular smooth muscle cells, and inhibits viability and nitric oxide production of vascular endothelial cells. Thus, indoxyl sulfate accelerates the progression of not only CKD but also of cardiovascular disease by inducing nephrovascular cell senescence. Copyright © 2012 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  19. In defense of magnesium sulfate.


    Elliott, John P; Lewis, David F; Morrison, John C; Garite, Thomas J


    Magnesium sulfate has been used by obstetricians for more than 25 years to treat preterm labor. Magnesium sulfate is effective in delaying delivery for at least 48 hours in patients with preterm labor when used in higher dosages. There do not seem to be any harmful effects of the drug on the fetus, and indeed there is a neuroprotective effect in reducing the incidence of cerebral palsy in premature newborns weighing less than 1,500 g.

  20. Ammonium Ion Currents in the Squid Giant Axon

    PubMed Central

    Binstock, Leonard; Lecar, Harold


    Voltage-clamp studies on intact and internally perfused squid giant axons demonstrate that ammonium can substitute partially for either sodium or potassium. Ammonium carries the early transient current with 0.3 times the permeability of sodium and it carries the delayed current with 0.3 times the potassium permeability. The conductance changes observed in voltage clamp show approximately the same time course in ammonium solutions as in the normal physiological solutions. These ammonium ion permeabilities account for the known effects of ammonium on nerve excitability. Experiments with the drugs tetrodotoxin (TTX) and tetraethyl ammonium chloride (TEA) demonstrate that these molecules block the early and late components of the current selectively, even when both components are carried by the same ion, ammonium. PMID:5767336