Science.gov

Sample records for anton paier kerli

  1. Anton's Syndrome and Eugenics

    PubMed Central

    Frahm-Falkenberg, Siska

    2011-01-01

    Anton's syndrome is arguably the most striking form of anosognosia. Patients with this syndrome behave as if they can see despite their obvious blindness. Although best known for his description of asomatognosia and visual anosognosia, Gabriel Anton (1858-1933) made other significant contributions to the clinical neurosciences, including pioneering work in neurosurgery, neuropsychology, and child psychiatry. However, it has not been recognized in the English literature that Anton was also a dedicated advocate of eugenics and racial hygiene. This paper provides a case of Anton's syndrome and puts the works of Gabriel Anton into their historic context. PMID:21779298

  2. Anton Grdina Primary Achievement Program

    NASA Technical Reports Server (NTRS)

    1993-01-01

    The Anton project presents a partnership between NASA Lewis, CMHA, and the Cleveland Public Schools. The intent of this project is to empower parents to work with their children in science and math activities.

  3. Anton Chekhov: Yalta Years, 1899-1904.

    ERIC Educational Resources Information Center

    Brinkle, Lydle

    Anton Pavlovich Chekhov spent 6 of the last 7 years of his life at Yalta (located on the Crimean Peninsula) where he had a house constructed in order that he might live in a climate favorable to his failing health. During these years Chekhov married the actress Olga Knipper and met Leo Tolstoy, who was near the end of his life. Chekhov also…

  4. Anton Chekhov: Yalta Years, 1899-1904.

    ERIC Educational Resources Information Center

    Brinkle, Lydle

    Anton Pavlovich Chekhov spent 6 of the last 7 years of his life at Yalta (located on the Crimean Peninsula) where he had a house constructed in order that he might live in a climate favorable to his failing health. During these years Chekhov married the actress Olga Knipper and met Leo Tolstoy, who was near the end of his life. Chekhov also…

  5. Anton Makarenko: Contribution to Soviet Educational Theory.

    ERIC Educational Resources Information Center

    Zilberman, Victor

    1988-01-01

    Examines the relationship of Anton Makarenko's educational theories to Russian history, tradition, and culture. Analyzes the influence of Russian and foreign prerevolutionary thinking on Makarenko's major theories. Discusses his major educational concepts (i.e., discipline, education through work, collectives, and the teacher's role) and views of…

  6. [Anton Chekhov--a self-deceiver?].

    PubMed

    Lund, P J

    2000-04-10

    The Russian author and doctor Anton Chekhov (1860-1904) died from tuberculosis in 1904. He had his first haemoptysis in 1884. In spite of continuing symptoms he did not let himself be examined by colleagues until he had a severe haemorrhage in 1897. He was then hospitalized, and extensive bilateral pulmonary tuberculosis was diagnosed. Even after that, he did not take his disease seriously. His attitude has been taken as an example of a doctor's self-deception. Almost 4,500 of Chekhov's letters has been published. In this article, the letters and contemporary memorial literature are used to illustrate the development of his disease and his ambivalence towards it. His self-deception was not that massive; there is a strain of uneasiness in his reports of his symptoms.

  7. Introduction [to Special Section on Anton Hales Symposium

    NASA Astrophysics Data System (ADS)

    Ward, R. W.; Mitterer, R. M.

    1983-04-01

    This volume of the Journal of Geophysical Research is devoted to Anton L. Hales. It contains many of the papers presented at the Anton L. Hales Symposium on `Some Recent Advances in Geophysics' held at The University of Texas at Dallas (UTD) on October 5-6, 1981, to honor Professor Hales on his retirement from UTD at the age of 70. Many former students, colleagues, and friends attended the symposium to honor Anton and to share their experiences with a man who had touched their lives and left his mark on the field of geophysics. Professor Hales' career in geophysics spans 50 years beginning with his first course in geophysics in 1932 at Cambridge University.

  8. The Distribution of Accommodation Rates in St. Anton, Austria.

    ERIC Educational Resources Information Center

    Eysberg, Cees D.

    1984-01-01

    For use in college geography courses which teach spatial analysis, this case study investigated whether hotel rates in the ski resort of St. Anton, Austria, are affected by the hotel's proximity to ski lifts and apres ski establishments. Results showed that tourists are sensitive to distance; spatial behavior is predictable. (RM)

  9. The Distribution of Accommodation Rates in St. Anton, Austria.

    ERIC Educational Resources Information Center

    Eysberg, Cees D.

    1984-01-01

    For use in college geography courses which teach spatial analysis, this case study investigated whether hotel rates in the ski resort of St. Anton, Austria, are affected by the hotel's proximity to ski lifts and apres ski establishments. Results showed that tourists are sensitive to distance; spatial behavior is predictable. (RM)

  10. IN MEMORIAM: Hermann Anton Haus, 1925 2003

    NASA Astrophysics Data System (ADS)

    2004-08-01

    Photograph Hermann Anton Haus, an Institute Professor at the Massachusetts Institute of Technology (MIT), was to have been a Keynote Speaker at the Fluctuations and Noise in Photonics and Quantum Optics Conference, from which the papers in this special issue derive. Sadly, on May 21, 2003 - less than two weeks before the conference - Professor Haus succumbed to a heart attack after arriving home in Lexington, Massachusetts, from his regular, 15-mile commute by bicycle from MIT. He was 77. Throughout his lengthy and illustrious career, Professor Haus had repeatedly and very successfully addressed problems of fluctuations and noise, with special focus on the fundamental issues that arise in quantum optics. To honour Professor Haus' legacy to our technical community, this special issue of Journal of Optics B: Quantum and Semiclassical Optics is dedicated to his memory. Professor Haus was born in Ljubljana, Slovenia, in the former Yugoslavia, on 8 August 1925. After attending the Technische Hochschule, Graz, and the Technische Hochschule, Wien, in Austria, he received his Bachelor of Science degree from Union College in Schenectady, New York in 1949. In 1951, he graduated from Rensselaer Polytechnic Institute with a Master of Science in Electrical Engineering, and came to MIT, where he earned his Doctorate of Science and joined the faculty in 1954. He was promoted to Associate Professor in 1958, to Professor in 1962, and to Elihu Thomson Professor in 1973. In 1986, he was conferred the honour of Institute Professor. Professor Haus had a lifelong fascination with noise. While still an undergraduate at Union College, he became aware of Norbert Wiener's theories of statistical phenomena - the new mathematics needed to understand and quantify the random fluctuations we refer to as noise. So it was that noise theory formed the core of Professor Haus' research during the 1950s: noise in electron beams, noise in microwave amplifiers, and noise in amplifier cascades. Two of

  11. Anton Chekhov (1860-1904)--a 19th century physician.

    PubMed

    Cohen, Ben

    2007-08-01

    This account of Anton Chekhov's life as a doctor is distinct from the short story writer and playwright on which his fame rests. It describes his school days, the years as a medical student and the period in general practice. In later years he became active in social medicine on a voluntary basis and earned his living purely from his literary work. He died from pulmonary tuberculosis at the age of 44 years.

  12. [Anton Chekhov--physician and writer. Physicians in his novels].

    PubMed

    Lund, P J

    1997-12-10

    Anton Pavlovich Chekhov (1860-1904) was a doctor and a writer. He practised medicine in a rather sporadic manner throughout his life, and his main occupation was his authorship. His collected works comprise 581 items of a narrative type, 17 plays, a narrative and a treatise of his voyage to Sakhalin, a number of articles and about 4,000 letters. This paper describes the doctors who appear in 83 of his short stories and associated material, and shows how Chekhov's medical background influenced his writing.

  13. The pathogenic properties of a novel and conserved gene product, KerV, in proteobacteria.

    PubMed

    An, Dingding; Apidianakis, Yiorgos; Boechat, Ana Laura; Baldini, Regina L; Goumnerov, Boyan C; Rahme, Laurence G

    2009-09-25

    Identification of novel virulence factors is essential for understanding bacterial pathogenesis and designing antibacterial strategies. In this study, we uncover such a factor, termed KerV, in Proteobacteria. Experiments carried out in a variety of eukaryotic host infection models revealed that the virulence of a Pseudomonas aeruginosa kerV null mutant was compromised when it interacted with amoebae, plants, flies, and mice. Bioinformatics analyses indicated that KerV is a hypothetical methyltransferase and is well-conserved across numerous Proteobacteria, including both well-known and emerging pathogens (e.g., virulent Burkholderia, Escherichia, Shigella, Vibrio, Salmonella, Yersinia and Brucella species). Furthermore, among the 197 kerV orthologs analyzed in this study, about 89% reside in a defined genomic neighborhood, which also possesses essential DNA replication and repair genes and detoxification gene. Finally, infection of Drosophila melanogaster with null mutants demonstrated that KerV orthologs are also crucial in Vibrio cholerae and Yersinia pseudotuberculosis pathogenesis. Our findings suggested that KerV has a novel and broad significance as a virulence factor in pathogenic Proteobacteria and it might serve as a new target for antibiotic drug design.

  14. The Pathogenic Properties of a Novel and Conserved Gene Product, KerV, in Proteobacteria

    PubMed Central

    An, Dingding; Apidianakis, Yiorgos; Boechat, Ana Laura; Baldini, Regina L.; Goumnerov, Boyan C.; Rahme, Laurence G.

    2009-01-01

    Identification of novel virulence factors is essential for understanding bacterial pathogenesis and designing antibacterial strategies. In this study, we uncover such a factor, termed KerV, in Proteobacteria. Experiments carried out in a variety of eukaryotic host infection models revealed that the virulence of a Pseudomonas aeruginosa kerV null mutant was compromised when it interacted with amoebae, plants, flies, and mice. Bioinformatics analyses indicated that KerV is a hypothetical methyltransferase and is well-conserved across numerous Proteobacteria, including both well-known and emerging pathogens (e.g., virulent Burkholderia, Escherichia, Shigella, Vibrio, Salmonella, Yersinia and Brucella species). Furthermore, among the 197 kerV orthologs analyzed in this study, about 89% reside in a defined genomic neighborhood, which also possesses essential DNA replication and repair genes and detoxification gene. Finally, infection of Drosophila melanogaster with null mutants demonstrated that KerV orthologs are also crucial in Vibrio cholerae and Yersinia pseudotuberculosis pathogenesis. Our findings suggested that KerV has a novel and broad significance as a virulence factor in pathogenic Proteobacteria and it might serve as a new target for antibiotic drug design. PMID:19779606

  15. Molecular characterization, gene expression and dependence on thyroid hormones of two type I keratin genes (sseKer1 and sseKer2) in the flatfish Senegalese sole (Solea senegalensis Kaup)

    PubMed Central

    Infante, Carlos; Manchado, Manuel; Asensio, Esther; Cañavate, José Pedro

    2007-01-01

    Background Keratins make up the largest subgroup of intermediate filaments, and, in chordates, represent the most abundant proteins in epithelial cells. They have been associated with a wide range of functions in the cell, but little information is still available about their expression profile and regulation during flatfish metamorphosis. Senegalese sole (Solea senegalensis) is a commercially important flatfish in which no keratin gene has been described yet. Results The development of large-scale genomics of Senegalese sole has facilitated the identification of two different type I keratin genes referred to as sseKer1 and sseKer2. Main characteristics and sequence identities with other fish and mammal keratins are described. Phylogenetic analyses grouped sseKer1 and sseKer2 in a significant clade with other teleost epidermal type I keratins, and have allowed for the identification of sseKer2 as a novel keratin. The expression profile of both genes was studied during larval development and in tissues using a real-time approach. sseKer1 and sseKer2 mRNA levels were significantly higher in skin than in other tissues examined. During metamorphosis, sseKer1 transcripts increased significantly at first stages, and reduced thereafter. In contrast, sseKer2 mRNA levels did not change during early metamorphosis although a significant drop at metamorphosis climax and late metamorphosis was also detected. To study the possible regulation of sseKer gene expressions by thyroid hormones (THs), larvae were exposed to the goitrogen thiourea (TU). TU-treated larvae exhibited higher sseKer1 and sseKer2 mRNA levels than untreated control at both 11 and 15 days after treatment. Moreover, addition of exogenous T4 hormone to TU-treated larvae restored or even reduced the steady-state levels with respect to the untreated control, demonstrating that expression of both genes is negatively regulated by THs. Conclusion We have identified two keratin genes, referred to as sseKer1 and sseKer2

  16. Anton Makarenko: The "John Dewey of the U.S.S.R."

    ERIC Educational Resources Information Center

    Gehring, Thom; Bowers, Fredalene B.; Wright, Randall

    2005-01-01

    There are a few correctional educators whose work is historically so influential that it is difficult to summarize in an article. Anton Makarenko was among this very select group; this is merely an attempt to outline his work. One way to introduce Makarenko to correctional educators is to focus on some of the seemingly incongruous elements of his…

  17. An appreciation of Christiane Groehen: the correspondence between Charles Darwin and Anton Dohrn.

    PubMed

    Browne, Janet

    2015-01-01

    Anton Dohrn was introduced to Darwinism by Ernst Haeckel during his student years at Jena, and became an eager disciple of Charles Darwin's work. He founded the Stazione Zoologica in 1872. Darwin became a patron of Dohrn's Stazione, and the two naturalists corresponded regularly. This article discusses their relationship and the contributions of Christiane Groeben to its elucidation.

  18. Paint and Pedagogy: Anton Ehrenzweig and the Aesthetics of Art Education

    ERIC Educational Resources Information Center

    Williamson, Beth

    2009-01-01

    Anton Ehrenzweig's work training art teachers at Goldsmiths College in London was groundbreaking in its field. The work of the studio fed back into Ehrenzweig's writings through his reflections on teaching and the work produced in end of year shows. In "The Hidden Order of Art" (1967), he theorised the creative process in psychoanalytic…

  19. Anton Makarenko: The "John Dewey of the U.S.S.R."

    ERIC Educational Resources Information Center

    Gehring, Thom; Bowers, Fredalene B.; Wright, Randall

    2005-01-01

    There are a few correctional educators whose work is historically so influential that it is difficult to summarize in an article. Anton Makarenko was among this very select group; this is merely an attempt to outline his work. One way to introduce Makarenko to correctional educators is to focus on some of the seemingly incongruous elements of his…

  20. A literary approach to tuberculosis: lessons learned from Anton Chekhov, Franz Kafka, and Katherine Mansfield.

    PubMed

    Vilaplana, Cristina

    2017-03-01

    Letters by notable writers from the past century can provide valuable information on the times in which they lived. In this article, attention is drawn to the lessons learned from three famous writers who died of tuberculosis: Anton Chekhov, Franz Kafka, and Katherine Mansfield. The characteristics of the course of the disease in the pre-antibiotic era and the importance of addressing mental health in the management of tuberculosis are discussed. Copyright © 2016 The Author. Published by Elsevier Ltd.. All rights reserved.

  1. Seismology at the Australian National University; an interview with Anton L. Hales

    USGS Publications Warehouse

    Spall, H.

    1980-01-01

    Dr. Anton L. Hales is a leading seismologist who has just retired as Director of the Research School of Earth Sciences at the Australian National University (ANU), Canberra. Prior to that, he headed the Geosciences Division at the University of Texas at Dallas, and, before that, he was Director of the Bernard Price Institute of Geophysical Research at the University of the Witwatersrand Johannesburg, South Africa. he is about to step down as President of the International Geodynamics Commission. Dr. Hales' research has involved marine geophysics, the travel times of seismic waves, and the structure of the Earth's crust and upper mantle. 

  2. Anton P. Chekhov, MD (1860-1904): dual medical and literary careers.

    PubMed

    Carter, R

    1996-05-01

    This is a story of a physician who was one of the world's greatest short story writers. Anton Pavlovich Chekhov successfully performed dual careers of writing and practicing medicine during a short but productive life. Many biographers overlook Dr Chekhov's role, although his medical training and practice flowed over into his writing, influencing both his subject matter and his style. His stories and plays reveal the insights that Dr Chekhov discovered about the human psyche at work, thus delving into psychosomatic medicine nearly 50 years before its time. Despite orders to stop practicing medicine because of his own deteriorating health, Chekhov devoted himself further to the study of medicine, publishing a landmark study in social medicine that advocated reform of the Russian penal system. Meanwhile, his fictional works earned him the coveted Pushkin prize for the best literary work of the year in 1888. Shortly after celebrating his third wedding anniversary to actress Olga Knipper, Anton Chekhov died at age 44, victim of a nearly lifelong battle with tuberculosis.

  3. Thermal Properties of Capparis Decidua (ker) Fiber Reinforced Phenol Formaldehyde Composites

    SciTech Connect

    Singh, G. P.; Mangal, Ravindra; Bhojak, N.; Dixit, Manasvi; Saxena, N. S.

    2010-06-29

    Simultaneous measurement of effective thermal conductivity ({lambda}), effective thermal diffusivity ({kappa}) and specific heat of Ker fiber reinforced phenol formaldehyde composites have been studied by transient plane source (TPS) technique. The samples of different weight percentage typically (5, 10, 15, 20 and 25%) have been taken. It is found that values of effective thermal conductivity and effective thermal diffusivity of the composites decrease, as compared to pure phenol formaldehyde, as the fraction of fiber loading increases. Experimental data is fitted on Y. Agari model. Values of thermal conductivity of composites are calculated with two models (Rayleigh, Maxwell and Meredith-Tobias model). Good agreement between theoretical and experimental result has been found.

  4. Structure cristalline de la phase β-KEr 2F 7. Composés isotypes

    NASA Astrophysics Data System (ADS)

    Aleonard, S.; Le Fur, Y.; Gorius, M. F.; Roux, M. Th.

    1980-08-01

    Potassium erbium fluoride β-KEr 2F 7 crystallizes in the orthorhombic system, space group Pna2 1, with the unit-cell dimensions a = 11.820, b = 13.333, c = 7.816Å ( Z = 8). The crystal structure has been solved from single-crystal diffractometer measurements (Ag Kα) by Patterson and Fourier syntheses and refined by a least-squares method. The final R value is 0.042 for 2374 independent observed reflections ( RW = 0.051). The four species of erbium atoms are surrounded by eight fluorine atoms. These fluorine atoms form, respectively, three quadratic antiprisms and one dodecahedron, derived from a distorted cube. Two antiprisms and the dodecahedron share two of their faces to form (Er 3F 17) 8- groups. These groups are bidimensionally linked and the planes they form are joined together by the third antiprism. A three-dimensional network is then produced, in the tunnels of which potassium atoms are located. Lattice parameters of compounds which are isotypic to the new structure type of β-KEr 2F 7 are given.

  5. Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats.

    PubMed

    Tkachenko, A V; Buchman, V L; Bliskovsky, V V; Shvets YuP; Kisselev, L L

    1992-07-15

    A genomic fragment containing the K51 gene previously isolated from a rat genomic library by hybridization with the v-mos probe in nonstringent conditions [Chumakov et al., Dokl. Akad. Nauk SSSR 290 (1986) 1252-1254], resembles a human keratin type-I-encoding gene [Shvets et al., Mol. Biol. 24 (1990) 663-677]. This genomic clone, K51, has been used as a probe to search for related human genes. A recombinant clone, HK51, with a 1.5-kb insert, was isolated from a human embryonic skin cDNA library, and its nucleotide (nt) sequence was determined. Analysis has shown that the cloned cDNA encodes human keratin 10 (Ker10). All presently known nt sequences of the human Ker10-encoding gene (Ker10) are not identical. Differences are concentrated in the 5'-end of the first exon and in the middle of the seventh exon within repeats. In spite of structural rearrangements in two of eight exons, the reading frame and position of the stop codon are preserved. The genetic rearrangements cause changes in hydrophobicity profiles of the N and C termini of Ker10. It was also noticed that insertion of one nt leads to the formation of an unusual 3'-end of the transcript.

  6. Antone Tarazi: the first Palestinian neurosurgeon and the first neurosurgeon in Jordan: a neurosurgeon of two countries.

    PubMed

    Awad, Ahmed J; Jane, John A

    2014-12-01

    Antone (Tony) Tarazi (1927-1999) was the first Palestinian neurosurgeon and the first neurosurgeon in Jordan. In 1952, Tarazi received his medical degree from the American University of Beirut in Lebanon. After completing neurosurgery training at the Montreal Neurological Institute in 1960, he returned to Palestine to practice neurosurgery in both Palestine and Jordan. For almost 10 years, he alone carried the load of neurosurgery for a population of >3 million people. His skills and knowledge enabled him to achieve admirable results with limited available resources. Tarazi was the president of the Palestinian Neurosurgical Society, a member of Jordan medical societies, and a member of the American Association of Neurological Surgeons. His continuous efforts to improve medical services extended beyond neurosurgery to many other fields. This article recounts Antone Tarazi's achievements and contributions to neurosurgery in Palestine and Jordan.

  7. Soluble dietary fiber from Canna edulis Ker by-product and its physicochemical properties.

    PubMed

    Zhang, Juan; Wang, Zheng-Wu

    2013-01-30

    Using Canna edulis Ker by-product as raw materials, soluble dietary fiber (SDF) was prepared using six different methods, including chemical, physical-chemical, enzymatic, physical-enzymatic, chemical-enzymatic and physical-chemical-enzymatic methods. As main component in the C. edulis by-product composed of cellulose, glucose converts to other single sugars, which form a series of compounds in the SDF. The treated methods have impact effects on single sugar composition, metal ion content, molecular size distribution, chemical bonds and groups in the structure, thermal property and color of the final product. In view of security, high yield and homogeneity as well as good thermal stability of final product, physical-enzymatic method will be a best choice for the production of SDF from C. edulis by-product. The SDF obtained can be used as dietary supplement and additive in the food industry.

  8. Antiinflammatory flavonoids from Opuntia dillenii (Ker-Gawl) Haw. flowers growing in Egypt.

    PubMed

    Ahmed, M S; El Tanbouly, N D; Islam, W T; Sleem, A A; El Senousy, A S

    2005-09-01

    Opuntia dillenii (Ker-Gawl) Haw. (Family Cactaceae), is used in folk medicine as an antidiabetic and antiinflammatory. The antiinflammatory activity of the alcohol extracts of the flowers, fruits and stems was carried out using the carrageenan-induced rat paw oedema model. The analgesic effect of the same extracts was evaluated using electric current as a noxious stimulus. The alcohol extract of the flowers revealed the most potent antiinflammatory effect and a pronounced analgesic action at a dose of 200 mg/kg. Bioassay-guided fractionation of this extract using VLC followed by Sephadex and paper chromatography, afforded three flavonoid glycosides, namely, kaempferol 3-O-alpha-arabinoside, isorhamnetin-3-O-glucoside and isorhamnetin-3-O-rutinoside. Their identification was based on physical, chemical and spectroscopic data. Copyright 2005 John Wiley & Sons, Ltd.

  9. Opuntia dillenii (Ker-Gawl) Haw cladode mucilage: Physico-chemical, rheological and functional behavior.

    PubMed

    Kalegowda, Pavithra; Chauhan, Attar Singh; Nanjaraj Urs, Shashirekha Mysore

    2017-02-10

    The yield of mucilage extracted from cladodes of Opuntia dillenii (Ker-Gawl) Haw in aqueous medium was 6.2%. The neutral sugar comprised of arabinose (38.80%), galactose (33.00%), rhamnose (15.70%), xylose (5.10%), and glucose (5.10%). The mucilage showed pseudo plastic behavior with good swelling index (20%), water holding capacity (g water/g dry sample; 4±0.10) and micrometric properties. In addition, mucilage presented intrinsic viscosity of 3.7 dL/g with average molecular weight of 1.9×10(3)kDa. The FTIR and NMR spectra of extracted mucilage showed characteristic polysaccharide nature. Further, the mucilage exhibited anti-obesity property through lipase inhibition. These findings could highlight that isolated mucilage could be exploited as an additive in food and pharmaceutical sector.

  10. Estimating the recreational-use value for hiking in Bellenden Ker National Park, Australia.

    PubMed

    Nillesen, Eleonora; Wesseler, Justus; Cook, Averil

    2005-08-01

    The recreational-use value of hiking in the Bellenden Ker National Park, Australia has been estimated using a zonal travel cost model. Multiple destination visitors have been accounted for by converting visitors' own ordinal ranking of the various sites visited to numerical weights, using an expected-value approach. The value of hiking and camping in this national park was found to be dollar AUS 250,825 per year, or dollar AUS 144,45 per visitor per year, which is similar to findings from other studies valuing recreational benefits. The management of the park can use these estimates when considering the introduction of a system of user pays fees. In addition, they might be important when decisions need to be made about the allocation of resources for maintenance or upgrade of tracks and facilities.

  11. Anton Raederscheidt's distorted self-portraits and their significance for understanding balance in art.

    PubMed

    Butter, Charles M

    2004-03-01

    Following a right cerebral stroke, the German artist Anton Raederscheidt produced a remarkable series of self-portraits that depicted his severe visual neglect and gradual recovery. These distorted images, like those drawn by others with this disorder, inform us about lateral balance in art and why it is common in the art of cultures separated in time and space. After describing how artists in various cultures have employed lateral balance, I present Arnheim's view that this aspect of art is the result of visual forces generated by the brain. Following a brief history of visual neglect, I present evidence that this disorder provides us with clues to the origin of the visual forces responsible for lateral balance in art. The relevant brain mechanisms control exploration of visual space by integrating orienting movements with visual spatial information. The prevalence of lateral balance in art becomes understandable when we consider that these brain mechanisms evolved to promote survival in our vertebrate ancestors. I end with a speculative neurological account of the aesthetics of lateral balance--why it is pleasing and its absence is displeasing.

  12. Giant reversible rotating cryomagnetocaloric effect in KEr (MoO4)2 induced by a crystal-field anisotropy

    NASA Astrophysics Data System (ADS)

    Tkáč, V.; Orendáčová, A.; Čižmár, E.; Orendáč, M.; Feher, A.; Anders, A. G.

    2015-07-01

    Magnetocaloric properties of KEr(MoO4)2 single crystals were investigated using magnetization and specific heat measurements in the magnetic field applied along the easy and hard axis. Large conventional magnetocaloric effect was found around 10 K (-Δ Smax =14 J/kg K for 5 T) in the field applied along the easy axis. What is more, a huge magnetic anisotropy in the a b plane leads to a large anisotropy of magnetocaloric effect, -Δ SR ,max =10 and 13 J/kg K obtained by a simple rotating of the single crystal within the a b plane in the constant magnetic field 2 and 5 T, respectively. Large Δ SR values with no hysteresis losses and rather wide working temperature spans imply that KEr(MoO4)2 may serve as a promising candidate for the implementation of a compact rotary magnetic cryorefrigerator.

  13. Canna edulis Ker by-product: chemical composition and characteristics of the dietary fiber.

    PubMed

    Juan Zhang; Wang, Zheng-Wu; Shi, Xian-Ming

    2010-08-01

    Canna edulis Ker by-product was recycled and utilized after starch extraction. The chemical composition, physical properties and antioxidant activity of the by-product were investigated. The by-product was mainly composed of dietary fiber (54.84% measured by AOAC method), and the insoluble dietary fiber constituted the major fraction. Then, the chemical composition of dietary fiber was tested using modified AOAC and Englyst methods. The results showed that dietary fiber was comprised of cellulose, hemicelluloses (including xyloglucans, arabinoxylans and glucuronoxylans), pectin and lignin. Moreover, the by-product contained relatively high content of phenolic compounds and exhibited a moderate antioxidant activity. In addition, the by-product showed both high water-holding capacity (12.5 mL/g) and oil-holding capacity (14 mL/g), and its suspension exhibited controllable viscosity. Therefore, the by-product from C. edulis is not only a source of dietary fiber but also a functional ingredient for food industry.

  14. Fast TracKer: A fast hardware track trigger for the ATLAS detector

    NASA Astrophysics Data System (ADS)

    Pandini, Carlo; Atlas Collaboration

    2016-07-01

    The trigger system at the ATLAS experiment is designed to lower the event rate occurring from the nominal bunch crossing rate of 40 MHz to about 1 kHz for a LHC luminosity of the order of 1034cm-2s-1. To achieve high background rejection while maintaining good efficiency for interesting physics signals, sophisticated algorithms are needed which require an extensive use of tracking information. The Fast TracKer (FTK) trigger system, part of the ATLAS trigger upgrade program, is a highly parallel hardware device designed to perform track-finding at 100 kHz. Modern, powerful Field Programmable Gate Arrays (FPGAs) form an important part of the system architecture, and the combinatorial problem of pattern recognition is solved by 8000 standard-cell ASICs used to implement an Associative Memory architecture. The availability of the tracking and subsequent vertex information within a short latency ensures robust selections and allows improved trigger performance for the most difficult signatures, such as b-jets and τ leptons.

  15. FTK: The hardware Fast TracKer of the ATLAS experiment at CERN

    NASA Astrophysics Data System (ADS)

    Maznas, Ioannis

    2017-03-01

    In the ever increasing pile-up environment of the Large Hadron Collider, trigger systems of the experiments must use more sophisticated techniques in order to increase purity of signal physics processes with respect to background processes. The Fast TracKer (FTK) is a track finding system implemented in custom hardware that is designed to deliver full-scan tracks with pT above 1 GeV to the ATLAS trigger system for every Level-1 (L1) accept (at a maximum rate of 100 kHz). To accomplish this, FTK is a highly parallel system which is currently being installed in ATLAS. It will first provide the trigger system with tracks in the central region of the ATLAS detector, and next year it is expected that it will cover the whole detector. The system is based on pattern matching between hits coming from the silicon trackers of the ATLAS detector and one billion simulated patterns stored in specially designed ASIC Associative Memory chips. This document will provide an overview of the FTK system architecture, its design and information about its expected performance.

  16. Chemical constituents in n-butanol fractions of Castus afer ker Gawl leaf and stem

    PubMed Central

    Anyasor, Godswill Nduka; Funmilayo, Onajobi; Odutola, Osilesi; Olugbenga, Adebawo; Oboutor, Efere Martins

    2014-01-01

    Aim: This study was designed to investigate the bioactive compounds in Costus afer Ker Gawl, an indigenous African medicinal plant whose leaf and stem extracts are used in the treatment of chronic inflammatory diseases, especially rheumatism and arthritis. Materials and Methods: The bioactive compounds present in the n-butanol fractions of C. afer leaf and stem were identified using qualitative phytochemical evaluation and gas chromatography-mass spectrometry (GC/MS) analytical method, comparing the mass spectra of the identified compounds with those of the National Institute of Standards and Technology database library. Results: Qualitative analysis detected alkaloids, saponins, diterpenes, triterpenes, phytosterol, phlobatannins, and tannins in both n-butanol fractions of C. afer leaf and stem. Phenols were detected in leaves alone while flavonoids were present in stem alone. GC/MS data showed that the bioactive compounds in n-butanol fraction of C. afer leaf were indolizine, 2-methoxy-4 vinylphenol, phytol, hexadecanoic acid-methyl ester, n-hexadecanoic acid, 9,12-octadecanoic acid-methyl ester, eicosane, cis-vaccenic acid and oleic acid while n-butanol fraction of C. afer stem contain benzofuran,2,3-dihydro,2-methoxy-4 vinylphenol, 9-octadecenoic acid (Z)-2-hydroxy-1-(hydroxymethyl) ethyl ester, campesterol, stigmasterol, hexadecanoic acid-methyl ester, n-hexadecanoic acid, and cis-vaccenic acid. Conclusion: The bioactive compounds identified in the n-butanol fractions of C. afer leaves and stem may explain the folkloric use of C. afer plant in the treatment of chronic inflammatory and oxidative stress related diseases. PMID:26401352

  17. Known unknowns, Google Earth, plate tectonics and Mt Bellenden Ker: some thoughts on locality data.

    PubMed

    Mesibov, Robert

    2012-01-01

    Latitude/longitude data in locality records should be published with spatial uncertainties, datum(s) used and indications of how the data were obtained. Google Earth can be used to locate sampling sites, but the underlying georegistration of the satellite image should be checked. The little-known relabelling of a set of landmarks on Mt Bellenden Ker, a scientifically important collecting locality in tropical north Queensland, Australia, is documented as an example of the importance of checking records not accompanied by appropriately accurate latitude/longitude data.

  18. Known unknowns, Google Earth, plate tectonics and Mt Bellenden Ker: some thoughts on locality data

    PubMed Central

    Mesibov, Robert

    2012-01-01

    Abstract Latitude/longitude data in locality records should be published with spatial uncertainties, datum(s) used and indications of how the data were obtained. Google Earth can be used to locate sampling sites, but the underlying georegistration of the satellite image should be checked. The little-known relabelling of a set of landmarks on Mt Bellenden Ker, a scientifically important collecting locality in tropical north Queensland, Australia, is documented as an example of the importance of checking records not accompanied by appropriately accurate latitude/longitude data. PMID:23275756

  19. QCD propagators and vertices from lattice QCD (in memory of Michael Müller-Preußker)

    NASA Astrophysics Data System (ADS)

    Sternbeck, André

    2017-03-01

    We review lattice calculations of the elementary Greens functions of QCD with a special emphasis on the Landau gauge. These lattice results have been of interest to continuum approaches to QCD over the past 20 years. They are used as reference for Dyson-Schwinger- and functional renormalization group equation calculations as well as for hadronic bound state equations. The lattice provides low-energy data for propagators and three-point vertices in Landau gauge at zero and finite temperature even including dynamical fermions. We summarize Michael Müller-Preußker's important contributions to this field and put them into the perspective of his other research interests.

  20. Association football and the representation of homosexuality by the print media: a case study of Anton Hysén.

    PubMed

    Cleland, Jamie

    2014-01-01

    In March 2011, Anton Hysén (a semiprofessional footballer currently playing in the Swedish fourth division) became only the second association football (soccer) player of any professional disposition to publicly declare his homosexuality while still playing the game. This article provides a textual analysis of the print media's reaction to Hysén coming out and examines whether, in 2011, they portray more inclusive notions toward homosexuality than they did in 1990 when British footballer Justin Fashanu came out. The results advance inclusive masculinity theory as a number of print media sources (mostly British) interview Hysén in the weeks immediately after he came out and publish articles that challenge homophobia. Highlighting a change since 1990, a significant number of articles stress the need for the key stakeholders in football (players, fans, clubs, agents, the authorities, and the media) to accept gay players.

  1. Spontaneous generation and disease causation: Anton de Bary's experiments with Phytophthora infestans and late blight of potato.

    PubMed

    Matta, Christina

    2010-01-01

    Anton de Bary is best known for his elucidation of the life cycle of Phytopthora infestans, the causal organism of late blight of potato and the crop losses that caused famine in nineteenth-century Europe. But while practitioner histories often claim this accomplishment as a founding moment of modern plant pathology, closer examination of de Bary's experiments and his published work suggest that his primary motiviation for pursing this research was based in developmental biology, not agriculture. De Bary shied away from making any recommendations for agricultural practice, and instead focused nearly exclusively on spontaneous generation and fungal development - both concepts promoted through prize questions posted by the Académie des Sciences in the 1850s and 1860s. De Bary's submission to the Académie's 1859 Alhumbert prize question illustrates his own contributions to debates about spontaneous generation and demonstrates the practical applications of seemingly philosophical questions - such as the origin of life.

  2. Preliminary study of the antioxidant properties of flowers and roots of Pyrostegia venusta (Ker Gawl) Miers.

    PubMed

    Roy, Purabi; Amdekar, Sarika; Kumar, Avnish; Singh, Vinod

    2011-08-23

    Free radical stress leads to tissue injury and can eventually to arthritis, atherosclerosis, diabetes mellitus, neurodegenerative diseases and carcinogenesis. Several studies are ongoing worldwide to find natural antioxidants of plant origin. We assessed the in-vitro antioxidant activities and screened the phytochemical constituents of methanolic extracts of Pyrostegia venusta (Ker Gawl) Miers. We evaluated the antioxidant potential and phytochemical constituents of P. venusta using 1,1-Diphenyl-2-picrylhydrazyl (DPPH), 2, 2'-azinobis-3-ethylbenzothiazoline-6-sulfonic acid (ABTS) and ferric reducing antioxidant power (FRAP) assays. Gas chromatography-mass spectroscopy (GC-MS) studies were also undertaken to assess the phytochemical composition of the flower extracts. Phytochemical analyses revealed the presence of terpenoids, alkaloids, tannins, steroids, and saponins. The reducing ability of both extracts was in the range (in μm Fe(II)/g) of 112.49-3046.98 compared with butylated hydroxytoluene (BHT; 63.56 ± 2.62), catechin (972.02 ± 0.72 μm) and quercetin 3208.27 ± 31.29. A significant inhibitory effect of extracts of flowers (IC50 = 0.018 ± 0.69 mg/ml) and roots (IC50 = 0.026 ± 0.94 mg/ml) on ABTS free radicals was detected. The antioxidant activity of the extracts of flowers (95%) and roots (94%) on DPPH radicals was comparable with that of ascorbic acid (98.9%) and BHT (97.6%). GC-MS study revealed the presence of myoinositol, hexadecanoic acid, linoleic acid, palmitic acid and oleic acid in the flower extracts. These data suggest that P. venusta is a natural source of antioxidants. The extracts of flowers and roots of P. venusta contain significant amounts of phytochemicals with antioxidative properties and could serve as inhibitors or scavengers of free radicals. P. venusta could be exploited as a potential source for plant-based pharmaceutical products. These results could form a sound basis for further investigation in the potential discovery of new

  3. Preliminary study of the antioxidant properties of flowers and roots of Pyrostegia venusta (Ker Gawl) Miers

    PubMed Central

    2011-01-01

    Background Free radical stress leads to tissue injury and can eventually to arthritis, atherosclerosis, diabetes mellitus, neurodegenerative diseases and carcinogenesis. Several studies are ongoing worldwide to find natural antioxidants of plant origin. We assessed the in-vitro antioxidant activities and screened the phytochemical constituents of methanolic extracts of Pyrostegia venusta (Ker Gawl) Miers. Methods We evaluated the antioxidant potential and phytochemical constituents of P. venusta using 1,1-Diphenyl-2-picrylhydrazyl (DPPH), 2, 2'-azinobis-3-ethylbenzothiazoline-6-sulfonic acid (ABTS) and ferric reducing antioxidant power (FRAP) assays. Gas chromatography-mass spectroscopy (GC-MS) studies were also undertaken to assess the phytochemical composition of the flower extracts. Results Phytochemical analyses revealed the presence of terpenoids, alkaloids, tannins, steroids, and saponins. The reducing ability of both extracts was in the range (in μm Fe(II)/g) of 112.49-3046.98 compared with butylated hydroxytoluene (BHT; 63.56 ± 2.62), catechin (972.02 ± 0.72 μm) and quercetin 3208.27 ± 31.29. A significant inhibitory effect of extracts of flowers (IC50 = 0.018 ± 0.69 mg/ml) and roots (IC50 = 0.026 ± 0.94 mg/ml) on ABTS free radicals was detected. The antioxidant activity of the extracts of flowers (95%) and roots (94%) on DPPH radicals was comparable with that of ascorbic acid (98.9%) and BHT (97.6%). GC-MS study revealed the presence of myoinositol, hexadecanoic acid, linoleic acid, palmitic acid and oleic acid in the flower extracts. Conclusion These data suggest that P. venusta is a natural source of antioxidants. The extracts of flowers and roots of P. venusta contain significant amounts of phytochemicals with antioxidative properties and could serve as inhibitors or scavengers of free radicals. P. venusta could be exploited as a potential source for plant-based pharmaceutical products. These results could form a sound basis for further

  4. The fission yeast protein Ker1p is an ortholog of RNA polymerase I subunit A14 in Saccharomyces cerevisiae and is required for stable association of Rrn3p and RPA21 in RNA polymerase I.

    PubMed

    Imazawa, Yukiko; Hisatake, Koji; Mitsuzawa, Hiroshi; Matsumoto, Masahito; Tsukui, Tohru; Nakagawa, Kaori; Nakadai, Tomoyoshi; Shimada, Miho; Ishihama, Akira; Nogi, Yasuhisa

    2005-03-25

    A heterodimer formed by the A14 and A43 subunits of RNA polymerase (pol) I in Saccharomyces cerevisiae is proposed to correspond to the Rpb4/Rpb7 and C17/C25 heterodimers in pol II and pol III, respectively, and to play a role(s) in the recruitment of pol I to the promoter. However, the question of whether the A14/A43 heterodimer is conserved in eukaryotes other than S. cerevisiae remains unanswered, although both Rpb4/Rpb7 and C17/C25 are conserved from yeast to human. To address this question, we have isolated a Schizosaccharomyces pombe gene named ker1+ using a yeast two-hybrid system, including rpa21+, which encodes an ortholog of A43, as bait. Although no homolog of A14 has previously been found in the S. pombe genome, functional characterization of Ker1p and alignment of Ker1p and A14 showed that Ker1p is an ortholog of A14. Disruption of ker1+ resulted in temperature-sensitive growth, and the temperature-sensitive deficit of ker1delta was suppressed by overexpression of either rpa21+ or rrn3+, which encodes the rDNA transcription factor Rrn3p, suggesting that Ker1p is involved in stabilizing the association of RPA21 and Rrn3p in pol I. We also found that Ker1p dissociated from pol I in post-log-phase cells, suggesting that Ker1p is involved in growth-dependent regulation of rDNA transcription.

  5. Improved catalytic efficiency, thermophilicity, anti-salt and detergent tolerance of keratinase KerSMD by partially truncation of PPC domain

    PubMed Central

    Fang, Zhen; Zhang, Juan; Du, Guocheng; Chen, Jian

    2016-01-01

    The keratinase from Stenotrophomonas maltophilia (KerSMD) is known for its high activity and pH stability in keratin degradation. However, catalytic efficiency and detergent tolerability need to be improved in order to be used for industrial application. In this work, we obtained several keratinase variants with enhanced catalytic efficiency, thermophilicity, and anti-salt and detergent tolerability by partially truncating the PPC domain of KerSMD. The variants all showed improved catalytic efficiency to synthetic substrate AAPF, with the V355 variant having the highest kcat /Km value of 143.6 s−1 mM−1. The truncation of keratinase had little effect on alkaline stability but obviously decreased collagenase activity, developing its potential application in leather treatment. The variants V380, V370, and V355 were thermophilic, with a 1.7-fold enhancement of keratinlytic activity at 60 °C when compared to the wild type. The entire truncation of PPC domain obtained the variant V355 with improved tolerance to alkalinity, salt, chaotropic agents, and detergents. The V355 variant showed more than a 40% improvement in activity under 15% (w/v) NaCl or 4% (w/v) SDS solution, showing excellent stability under harsh washing and unhairing conditions. Our work investigated how protein engineering affects the function of PPC domain of KerSMD. PMID:27298079

  6. In the shadow of Darwin: Anton de Bary's origin of myxomycetology and a molecular phylogeny of the plasmodial slime molds.

    PubMed

    Hoppe, T; Kutschera, U

    2010-06-01

    In his Origin of Species (John Murray, London, 1859), Charles Darwin described the theory of descent with modification by means of natural selection and postulated that all life may have evolved from one or a few simple kinds of organisms. However, Darwin's concept of evolutionary change is entirely based on observations of populations of animals and plants. He briefly mentioned 'lower algae', but ignored amoebae, bacteria and other micro-organisms. In 1859, Anton de Bary, the founder of mycology and plant pathology, published a seminal paper on the biology and taxonomy of the plasmodial slime molds (myxomycetes). These heterotrophic protists are known primarily as a large composite mass, the plasmodium, in which single nuclei are suspended in a common 'naked' cytoplasm that is surrounded by a plasma membrane. Here we summarize the contents of de Bary's 1859 publication and highlight the significance of this scientific classic with respect to the establishment of the kingdom Protoctista (protists such as amoebae), the development of the protoplasmic theory of the cell, the introduction of the concept of symbiosis and the rejection of the dogma of spontaneous generation. We describe the life cycle of the myxomycetes, present new observations on the myxamoebae and propose a higher-order phylogeny based on elongation factor-1 alpha gene sequences. Our results document the congruence between the morphology-based taxonomy of the myxomycetes and molecular data. In addition, we show that free-living amoebae, common protists in the soil, are among the closest living relatives of the myxomycetes and conclude that de Bary's 'Amoeba-hypothesis' on the evolutionary origin of the plasmodial slime molds may have been correct.

  7. 4C-ker: A Method to Reproducibly Identify Genome-Wide Interactions Captured by 4C-Seq Experiments

    PubMed Central

    Raviram, Ramya; Rocha, Pedro P.; Müller, Christian L.; Miraldi, Emily R.; Badri, Sana; Fu, Yi; Swanzey, Emily; Proudhon, Charlotte; Snetkova, Valentina

    2016-01-01

    4C-Seq has proven to be a powerful technique to identify genome-wide interactions with a single locus of interest (or “bait”) that can be important for gene regulation. However, analysis of 4C-Seq data is complicated by the many biases inherent to the technique. An important consideration when dealing with 4C-Seq data is the differences in resolution of signal across the genome that result from differences in 3D distance separation from the bait. This leads to the highest signal in the region immediately surrounding the bait and increasingly lower signals in far-cis and trans. Another important aspect of 4C-Seq experiments is the resolution, which is greatly influenced by the choice of restriction enzyme and the frequency at which it can cut the genome. Thus, it is important that a 4C-Seq analysis method is flexible enough to analyze data generated using different enzymes and to identify interactions across the entire genome. Current methods for 4C-Seq analysis only identify interactions in regions near the bait or in regions located in far-cis and trans, but no method comprehensively analyzes 4C signals of different length scales. In addition, some methods also fail in experiments where chromatin fragments are generated using frequent cutter restriction enzymes. Here, we describe 4C-ker, a Hidden-Markov Model based pipeline that identifies regions throughout the genome that interact with the 4C bait locus. In addition, we incorporate methods for the identification of differential interactions in multiple 4C-seq datasets collected from different genotypes or experimental conditions. Adaptive window sizes are used to correct for differences in signal coverage in near-bait regions, far-cis and trans chromosomes. Using several datasets, we demonstrate that 4C-ker outperforms all existing 4C-Seq pipelines in its ability to reproducibly identify interaction domains at all genomic ranges with different resolution enzymes. PMID:26938081

  8. The combination of atomic force microscopy and sugar analysis to evaluate alkali-soluble Canna edulis Ker pectin.

    PubMed

    Zhang, Juan; Cui, Junhui; Xiao, Lin; Wang, Zhengwu

    2014-08-01

    Alkali-soluble pectin, which has been extracted from Canna edulis Ker, was characterized by single sugar determination and atomic force microscopy (AFM). The results indicated that the amounts of four predominant sugars including arabinose (Ara), glucose (Glc), galactose (Gal) and galacturonic acid (GalA) significantly decreased during the process of mild acid hydrolysis. The decreasing rates of these four sugars followed a sequential order of Ara>Gal>Glc>GalA. The homogalacturonan (HG) chain present in pectin, and the quantity of branched material is greater than the sample containing the main neutral sugars. The results indicated that the neutral sugar and HG side chains are attached to pectin as part of the rhamnogalacturonan I (RGI) complex. Moreover, hydrolysis leads to the reduction of mean lengths of backbone and branch, as well as the number/weight-average molecular weight. Meanwhile, the amount of short chain fractions increased during hydrolysis. Furthermore, the decrease of the polymerization degree of alkali-soluble C. edulis pectin as a function of the hydrolysis time could be described by a first-order exponential decay function.

  9. Anton permselective membrane

    NASA Technical Reports Server (NTRS)

    Alexander, S. S.; Hodgdon, R. B.; Waite, W. A.

    1979-01-01

    Experimental composite membranes were synthesized on a lab scale consisting of a thin layer of anion permselective resin supported by and bonded to a porous physically strong and conductive substrate film. These showed good selectivity and also substantially lower electrical resistivities than the homogenous candidate membranes optimized in the previous contract. A wide range of resin porosities were examined for three candidate membrane systems, CDIL, CP4L, and A3L to identify the formulation giving the best overall redox cell performance. Candidate anion membranes showed large increases in resistivity after a short time of immersion in concentrated FeCl/HCl solution. Largely on the basis of resistance stability the CDIL formulation was selected as prime candidate and about thirty-five membranes (one foot square) were produced for experimental static and dynamic evaluation.

  10. Benthic Assemblages of the Anton Dohrn Seamount (NE Atlantic): Defining Deep-Sea Biotopes to Support Habitat Mapping and Management Efforts with a Focus on Vulnerable Marine Ecosystems.

    PubMed

    Davies, Jaime S; Stewart, Heather A; Narayanaswamy, Bhavani E; Jacobs, Colin; Spicer, John; Golding, Neil; Howell, Kerry L

    2015-01-01

    In 2009 the NW and SE flanks of Anton Dohrn Seamount were surveyed using multibeam echosounder and video ground-truthing to characterise megabenthic biological assemblages (biotopes) and assess those which clearly adhere to the definition of Vulnerable Marine Ecosystems, for use in habitat mapping. A combination of multivariate analysis of still imagery and video ground-truthing defined 13 comprehensive descriptions of biotopes that function as mapping units in an applied context. The data reveals that the NW and SE sides of Anton Dohrn Seamount (ADS) are topographically complex and harbour diverse biological assemblages, some of which agree with current definitions of 'listed' habitats of conservation concern. Ten of these biotopes could easily be considered Vulnerable Marine Ecosystems; three coral gardens, four cold-water coral reefs, two xenophyophore communities and one sponge dominated community, with remaining biotopes requiring more detailed assessment. Coral gardens were only found on positive geomorphic features, namely parasitic cones and radial ridges, found both sides of the seamount over a depth of 1311-1740 m. Two cold-water coral reefs (equivalent to summit reef) were mapped on the NW side of the seamount; Lophelia pertusa reef associated with the cliff top mounds at a depth of 747-791 m and Solenosmilia variabilis reef on a radial ridge at a depth of 1318-1351 m. Xenophyophore communities were mapped from both sides of the seamount at a depth of 1099-1770 m and were either associated with geomorphic features or were in close proximity (< 100 m) to them. The sponge dominated community was found on the steep escarpment either side of the seamount over at a depth of 854-1345 m. Multivariate diversity revealed the xenophyophore biotopes to be the least diverse, and a hard substratum biotope characterised by serpulids and the sessile holothurian, Psolus squamatus, as the most diverse.

  11. Benthic Assemblages of the Anton Dohrn Seamount (NE Atlantic): Defining Deep-Sea Biotopes to Support Habitat Mapping and Management Efforts with a Focus on Vulnerable Marine Ecosystems

    PubMed Central

    Davies, Jaime S.; Stewart, Heather A.; Narayanaswamy, Bhavani E.; Jacobs, Colin; Spicer, John; Golding, Neil; Howell, Kerry L.

    2015-01-01

    In 2009 the NW and SE flanks of Anton Dohrn Seamount were surveyed using multibeam echosounder and video ground-truthing to characterise megabenthic biological assemblages (biotopes) and assess those which clearly adhere to the definition of Vulnerable Marine Ecosystems, for use in habitat mapping. A combination of multivariate analysis of still imagery and video ground-truthing defined 13 comprehensive descriptions of biotopes that function as mapping units in an applied context. The data reveals that the NW and SE sides of Anton Dohrn Seamount (ADS) are topographically complex and harbour diverse biological assemblages, some of which agree with current definitions of ‘listed’ habitats of conservation concern. Ten of these biotopes could easily be considered Vulnerable Marine Ecosystems; three coral gardens, four cold-water coral reefs, two xenophyophore communities and one sponge dominated community, with remaining biotopes requiring more detailed assessment. Coral gardens were only found on positive geomorphic features, namely parasitic cones and radial ridges, found both sides of the seamount over a depth of 1311–1740 m. Two cold-water coral reefs (equivalent to summit reef) were mapped on the NW side of the seamount; Lophelia pertusa reef associated with the cliff top mounds at a depth of 747–791 m and Solenosmilia variabilis reef on a radial ridge at a depth of 1318-1351 m. Xenophyophore communities were mapped from both sides of the seamount at a depth of 1099–1770 m and were either associated with geomorphic features or were in close proximity (< 100 m) to them. The sponge dominated community was found on the steep escarpment either side of the seamount over at a depth of 854-1345 m. Multivariate diversity revealed the xenophyophore biotopes to be the least diverse, and a hard substratum biotope characterised by serpulids and the sessile holothurian, Psolus squamatus, as the most diverse. PMID:25992572

  12. Simultaneous utilization of non-starch polysaccharides and starch and viscosity reduction for bioethanol fermentation from fresh Canna edulis Ker. tubers.

    PubMed

    Huang, Yuhong; Jin, Yanling; Fang, Yang; Li, Yuhao; Zhao, Hai

    2013-01-01

    Viscosity reduction and the effect of cell-wall degrading enzymes (CWDEs) were investigated using Canna edulis Ker. for bioethanol fermentation. The fermentation mash treated with CWDEs was much thinner (2.12 Pas) than the control mash (8.42 Pas), the fermentation efficiency was increased from 90.46% to 96.11%. HPLC analysis revealed that after treated with CWDEs, glucose and total sugar were increased by 28.07% and 7.60%, respectively. Changes in the starch granules were investigated by scanning electron microscopy (SEM), atomic force microscopy (AFM), and confocal laser scanning microscopy (CLSM). The results suggested that the reduction in viscosity was caused by changes in saccharide composition and physical changes of the starch granules. This present study is of significance that non-starch polysaccharides and starch can be simultaneously utilized for bioethanol production using roots and tubers as feedstock.

  13. [The Essen-based steel producer Alfred Krupp (1812-1887) as a reader of the flora and fauna of the Gulf of Naples. A look at the relationship of Anton Dohrn (1840-1909) to the house Krupp].

    PubMed

    Müller, Irmgard

    2015-01-01

    A unfavourable notice written by industrial magnate Alfred Krupp (1812-1887) has been discovered on the posterior cover sheet of the first volume of the monumental series Fauna und Flora des Golfes von Neapel, edited by the Zoological Station at Naples (1880) Krupp's handwritten statement affords the opportunity to discuss in more detail the intricate relationship between the founder of the first marine biology station, Anton Dohrn (1840-1909), and the owner of the greatest steel factory in Europe, the Krupp-family at Essen. Although Anton Dohrn did not know about Krupp's disapproving comment he had a fine unerring instinct for the mentality of his negotiating partner, whose way of thinking rather aimed at the practical success and completion of armament factory, preventing thus a the serious rapprochement between the two personalities. Even when the Krupp-heir, Friedrich Alfred Krupp, later devoted to questions about marine biology in his new built house at Capri, and was willing to support the Zoological Station with high sponsoring, Anton Dohrn maintained a reserved attitude towards the Krupp's offer to support the marine research financially. Likewise, he remained unimpressed, when the steel magnate was shook by the smear campaign in Capri that ultimately led to Krupp's death in November 1902.

  14. The influence of desiccation and predation on vertical size gradients in populations of the gastropod Oxystele variegata (Anton) on an exposed rocky shore.

    PubMed

    McQuaid, C D

    1982-04-01

    Oxystele variegata (Anton.) exhibits a vertical size gradient contrary to the model proposed by Vermeij (1972) for low/mid intertidal species, as shell size increases in an upshore direction. Settlement occurs in the lowest zones and juveniles are restricted to the lower shore by conditions of desiccation higher up the beach. Juveniles suffer rapid water loss due to a relatively large opercular surface area and circumference and have a much lower resistance to water loss than adults. This leads to high mortality under conditions of low humidities, and juveniles caged at the top of the balanoid zone, where adults normally occur, die within a few days. As animals increase in size their resistance to desiccation rises allowing them to migrate upshore. This is a response to high rates of predation by the whelk Burnupena delalandii in the lower balanoid zone. Predation is so intense as to override the advantages of higher food availability which lead to a greater body weight for adults protected by cages on the lower shore.

  15. Use of OSL dating to establish the stratigraphic framework of Quaternary eolian sediments, Anton scarp upper trench, Northeastern Colorado High Plains, USA

    USGS Publications Warehouse

    Mahan, S.A.; Noe, D.C.; McCalpin, J.P.

    2009-01-01

    This paper contains the results of the optically stimulated luminescence (OSL) dating used to establish stratigraphic ages and relationships of eolian sediments in a trench in northeastern Colorado, USA. This trench was located in the upper face of the Anton scarp, a major topographic lineament trending NW-SE for a distance of 135 km, in anticipation of intersecting near-surface faulting. The trench was 180 m long, 4.5-6.0 m deep, and exposed 22 m of stratigraphic section, most of which dipped gently west and was truncated by gulley channeling at the face of the scarp. No direct evidence of faulting was found in the upper trench. The stratigraphy from the trench was described, mapped and dated using OSL on quartz and potassium feldspar, and 14C obtained from woody material. OSL dating identified two upper loess units as Peoria Loess and Gilman Canyon Loess, deposited between 16 and 30 ka ago. The bottom layers of the trench were substantially older, giving OSL ages in excess of 100 ka. These older ages are interpreted as underestimates, owing to saturation of the fast component of OSL. Using OSL and 14C dating, we can constrain the erosion and down cutting of the scarp face as occurring between 16 and 5.7 ka. As the trenching investigation continues in other parts of the scarp face, the results of this preliminary study will be of importance in relating the ages of the strata that underlie different parts of the scarp, and in determining whether Quaternary faulting was a mechanism that contributed to the formation of this regional geomorphic feature.

  16. [Anton Nyström: the first practitioner in dermatology in Sweden and the controversy about his book on skin disorders].

    PubMed

    Thyresson, N

    1994-01-01

    Anton Nyström (1842-1931), practitioner and author, was at the end of the nineteenth and the beginning of the twentieth century a well-known but also controversial personage in Swedish cultural and intellectual life. The posterity remembers him mainly for having introduced the philosophical system of Auguste Comte and founded a Society for Positivism in Sweden as well as having founded an institution ("Arbetarinstitutet") in Stockholm with the purpose to give an all-round education to the working classes through lectures by leading personalities in the world of culture and science. In numerous publications he treated besides medical topics also religious, cultural, social, political and historical themes. Immediately after his medical graduation in May 1868, he went abroad to study dermatology and stayed for this purpose for nearly one and a half years in Vienna, Paris and London. Back in Sweden in the autumn of 1869, he began writing a book with the title "Theoretical and practical essays on skin disorders." This book is for us today interesting because it illustrates the different views of that time on skin diseases held by Hebra in Vienna, Bazin and Hardy in Paris and Wilson and Tilbury Fox in London. In Paris Nyström had been fascinated by Bazin's and Hardy's theories on constitutional diseases and diathetic states and had, as he says, "embraced the doctrines of Bazin". In Vienna, however, he had disapproved of Hebra's way to reject speculations on internal etiology for skin diseases and to look upon them as having mainly an external cause and of his method to treat skin diseases preferably with local remedies. In London he was on very friendly terms with Tilbury Fox, who to his satisfaction also sympathized with the opinions held by Bazin. ...

  17. [The tribute of the pioneer of hypnotherapy--Franz Anton Mesmer, MD, PhD in the history of psychotherapy and medicine].

    PubMed

    Radovancević, Ljubomir

    2009-01-01

    Modern hypnosis started with the Austrian physician Franz Anton Mesmer (1734-1815), who believed that the phenomenon known as mesmerism, or animal magnetism, or fluidum was related to an invisible substance--a fluid that runs within the subject or between the subject and the therapist, that is, the hypnotist, or the "magnetizer". The term hypnosis was introduced in the 1840s by a Scottish surgeon James Braid (1795-1860), who believed the subject to be in a particular state of sleep--a trance. In the late 19th century, a French neurologist Jean Martin Charcot (1825-1893) thought hypnotism to be a special physiological state, and his contemporary Hyppotite-Marie Bernheim (1840-1919) believed it to be a psychological state of heightened suggestibility. Sigmund Freud, who studied with Charcot, used hypnosis early in his career to help patients recover repressed memories. He noted that patients would relive traumatic events while under hypnosis, a process know as abreaction. Freud later replaced hypnosis with the technique of free associations. Today, hypnosis is used as a form of therapy (hypnotherapy), a method of investigation to recover lost memories, and research tool. According to Caplan & Sadock, F.A. Mesmer is generally thought of as the fons et origo of modern psychotherapy; and from the early techniques of mesmerism, it is said, have evolved the more elaborate and sophisticated therapeutic measures of the analyst and his colleagues. Although Mesmer was certainly dealing with individuals suffering from a variety of neurotic disorders, and though the clinical successes he achieved were the result of psychological processes that his procedures induced in his patients, Mesmer's theoretical formulations, his understanding of the nature of the treatment he developed, and his specific procedures were all totally different from those of the 20th century analyst. He was one of the corne stones in the development of psychoanalysis through hypnosis mainly of hysterical

  18. Potential of lignin from Canna edulis ker residue in the inhibition of α-d-glucosidase: Kinetics and interaction mechanism merging with docking simulation.

    PubMed

    Xie, Fan; Gong, Shengxiang; Zhang, Wei; Wu, Jinhong; Wang, Zhengwu

    2017-02-01

    In this study, we extracted lignin from Canna edulis ker residue. Its chemical structure, inhibitory activity on α-d-glucosidase, and kinetics as well as interaction mechanism were investigated by using spectrum analysis and docking simulation. The isolated lignin was composed by guaiacyl and syringal units, and exhibited stronger inhibition on α-d-glucosidase than acarbose with the half maximal inhibitory concentration at 5.3±0.3μM. It was a non-competitive inhibitior with Km and Ki values of 0.53±0.02mM and 0.92±0.12μM, respectively. It could quench the intrinsic fluorescence of α-d-glucosidase through a static quenching mode. The calculated values of enthalpy and entropy change were 20.8±2.5kJmol(-1) and 172.7±0.8Jmol(-1)K(-1), respectively. There was a single binding site on α-d-glucosidase for lignin, and the binding distance was 3.2nm. The molecular docking analysis exhibited that the hydrogen bonds, hydropholic interaction, and van der Waals forces were the main forces for lignin bind to α-d-glucosidase. This work provides a new insight into the interaction between the lignin and α-d-glucosidase, which might be beneficial to type 2 diabetes with the application of lignin in functional food and pharmacy fields.

  19. Comparative studies on the constituents of ophiopogonis tuber and its congeners. VIII. Studies on the glycosides of the subterranean part of Ophiopogon japonicus Ker-Gawler cv. Nanus.

    PubMed

    Asano, T; Murayama, T; Hirai, Y; Shoji, J

    1993-03-01

    Two monoterpene glycosides, tentatively named OJV-I (1) and OJV-II (2), and eight steroidal glycosides, tentatively named OJV-III (3), OJV-IV (4), OJV-V (5), OJV-VI (6), OJV-VII (7), OJV-VIII (8), OJV-IX (9) and OJV-X (10), were isolated from the butanol-soluble fraction of the fresh subterranean part of Ophiopogon japonicus KER-GAWLER cv. Nanus. Among these compounds, 1, 2, 3, 4, 5, 6 and 7 were identified as l-borneo1 O-beta-D-glucopyranoside, l-borneo1 O-beta-D-apiofuranosyl (1-->6)-beta-D-glucopyranoside, ophiopogonin B, glycoside C, ophiopogonin D, Ls-10, and ruscogenin 1-O-sulfate, respectively. The structures of compounds 8, 9, and 10 were established to be (23S,24S,25S)-23,24-dihydroxyruscogenin 1-O-[ alpha-L-rhamnopyranosyl(1-->2)] [beta-D-xylopyranosyl(1-->3)]-alpha-L-arabinopyranoside 24-O-beta-D-fucopyranoside, (23S,24S,25S)-23,24-dihydroxyruscogenin I-O-[alpha-L-2,3,4-tri-O-acetylrhamnopyranosyl(1-->2)][beta-D-xylo pyranosyl(1-->3)]-alpha-L-arabinopyranoside 24-O-beta-D-fucopyranoside, and (23S,24S,25S)-23,24-dihydroxyruscogenin 1-O-[alpha-L-2,3,4-tri-O-acetylrhamnopyranosyl(1-->2)] [beta-D-xylopyranosyl(1-->3)]=alpha-L-arabinopyranoside 24-O-beta-D-fucopyranoside, respectively.

  20. Effect of aqueous leaves extract of Costus afer Ker Gawl (Zingiberaceae) on the liver and kidney of male albino Wistar rat

    PubMed Central

    Ezejiofor, A. N.; Orish, C. N.; Orisakwe, Orish Ebere

    2013-01-01

    Background: The use of medicinal plants in Nigeria has significantly increased over recent years as it is easily accessible, cheap and the strong belief that herbal remedies are natural and therefore non toxic. Aims: This study aims to investigate the sub-chronic toxicity (28-day) of the aqueous extract of Costus afer Ker Gawl leaves on the liver and kidney of male albino Wistar rats. Materials and Methods: A total of 20 male albino Wistar rats (113-205 g) divided into four groups of five weight-matched animals each, were used for the study. Group 1 received standard feed and water ad libitium and served as the control. Group 2, 3 and 4 received 375, 750 and 1125 mg/kg of aqueous extract of C. afer leaves respectively. The animals were sacrificed under ether anesthesia and the organs were harvested, weighed and histopathological studies carried out. The effect of C. afer on the hepatic biomarkers aspartate aminotransferase (AST), alanine aminotransferase (ALT); alkaline phosphatase (ALP); triglyceride (TG); total bilirubin (TB); conjugated bilirubin (CB); albumin (ALB) and kidney biomarkers urea, creatinine, sodium, potassium and bicarbonate were investigated. Statistical Analysis: Data were evaluated using Mann Whitney. If P ≤ 0.05 groups were considered to be significantly different. Results: C. afer contained alkaloids, saponins, flavonoids, anthraquinones, cardiac glycosides, terpenoids, phenolic compounds and tannins. The average body, organ, relative weights, feed and fluid intake showed no significant changes (P > 0.05) when compared to the control. The liver function tests (ALT, ALP, AST, CB, TB and ALB) showed significant differences (P < 0.05) in the test groups when compared with the control while TG showed no statistical difference (P > 0.05). The kidney function tests (urea, creatinine, sodium, potassium and bicarbonate) showed no significant differences (P > 0.05) in the test groups when compared to the control. Conclusion: Costus afer may be

  1. Anton Chekhov (1860-1904). Writer, physician and tuberculosis patient.

    PubMed

    Dubovsky, H

    1979-04-21

    Chekhov chose writing as a career after a childhood of hardship and poverty. Tuberculosis manifested soon after medical graduation and caused his death at the age of 44. Essentially a short story writer, he used simplicity and impressionism to portray sympathetically the psychology of the common man. Similarly his plays, popular today, written in a light and ethereal style, while static, have an inner psychological evolution. The best example is The Cherry Orchard.

  2. A new oleanene triterpene from Gladiolus segetum Ker-Gawl.

    PubMed

    El-Shanawany, M A; Hassanean, H A; Mohamed, M H; Nafady, A M

    2009-01-01

    A new pentacyclic oleanene triterpene, 2beta, 3beta, 16alpha, 28-tetrahydroxy-olean-12-ene-23-oic acid (1), as well as the known pentacyclic triterpene medicagenic acid (2), have been isolated by different chromatographic techniques from the acid hydrolysate of the saponin fraction of Gladiolus segetum. The identification of these compounds was established by different methods of physical, chemical and spectral evidence.

  3. Nobel laureates at the Stazione Zoologica Anton Dohrn: phenomenology and paths to discovery in neuroscience.

    PubMed

    Groeben, Christiane; de Sio, Fabio

    2006-12-01

    The practice of science usually involves more than a solitary genius in a solitary room, coping with the problem of her/his life. From the second half of the 19th century onwards, scientific research, especially in the field of the Natural Sciences, has grown into a more and more complex practice, which often entangles very special needs, in terms of research objects, techniques, sources, and perspectives. A few special places, such as the Stazione Zoologica di Napoli, have represented in this period the focal points of an ever growing international scientific network, promoting independent research, exchange and diffusion of novel practices and techniques and unrestricted confrontation. The so-called "Naples experience" has been cited by a large number of renowned scientists of the last two centuries as a key moment in their scientific life. Here we have tried to test it against the experience of three great scientists par excellence, i.e. three Nobel laureates (T. H. Morgan, Otto Warburg, J. D. Watson). The different experiences they have had at Naples represent, in our view, three different moments of the professional life of almost every scientist. Therefore, we have chosen to present them as a phenomenology. The final section is dedicated to a survey of the Zoological Station's contribution to neurosciences, especially to the Naples experience of the Nobel Prize winner Sir Bernard Katz and his assistant Ricardo Miledi, between 1965 and 1970. Their work on the squid at Naples allowed probing and quantitative refinement of results already obtained on different animals and contributed to reinforce the long lasting neurophysiological tradition of the institute.

  4. Fantastic Antone Succeeds! Experiences in Educating Children with Fetal Alcohol Syndrome.

    ERIC Educational Resources Information Center

    Kleinfeld, Judith, Ed.; Wescott, Siobhan, Ed.

    Three themes run through the accounts of parents and teachers as they relate their experiences rearing and teaching children with fetal alcohol syndrome (FAS): (1) Children with FAS can achieve far more than current negative stereotypes suggest; (2) Early intervention and excellent family care make an enormous difference to the success and…

  5. Pioneering Studies on Cephalopod's Eye and Vision at the Stazione Zoologica Anton Dohrn (1883-1977)

    PubMed Central

    Dröscher, Ariane

    2016-01-01

    From the late nineteenth century onwards, the phenomena of vision and the anatomy and physiology of the eye of marine animals induced many zoologists, ethologists, physiologists, anatomists, biochemists, and ophthalmologists to travel to the Zoological Station in Naples. Initially, their preferred research objects were fish, but it soon became evident that cephalopods have features which make them particularly suited to research. After the first studies, which outlined the anatomical structure of cephalopods' eyes and optic nerves, the research rapidly shifted to the electrophysiology and biochemistry of vision. In the twentieth century these results were integrated with behavioral tests and training techniques. Between 1909 and 1913 also the well-known debate on color vision between ophthalmologist Carl von Hess and zoologist Karl von Frisch took place in Naples. Largely unknown is that the debate also concerned cephalopods. A comparative historical analysis of these studies shows how different experimental devices, theoretical frameworks, and personal factors gave rise to two diametrically opposing views. PMID:28066256

  6. Pioneering Studies on Cephalopod's Eye and Vision at the Stazione Zoologica Anton Dohrn (1883-1977).

    PubMed

    Dröscher, Ariane

    2016-01-01

    From the late nineteenth century onwards, the phenomena of vision and the anatomy and physiology of the eye of marine animals induced many zoologists, ethologists, physiologists, anatomists, biochemists, and ophthalmologists to travel to the Zoological Station in Naples. Initially, their preferred research objects were fish, but it soon became evident that cephalopods have features which make them particularly suited to research. After the first studies, which outlined the anatomical structure of cephalopods' eyes and optic nerves, the research rapidly shifted to the electrophysiology and biochemistry of vision. In the twentieth century these results were integrated with behavioral tests and training techniques. Between 1909 and 1913 also the well-known debate on color vision between ophthalmologist Carl von Hess and zoologist Karl von Frisch took place in Naples. Largely unknown is that the debate also concerned cephalopods. A comparative historical analysis of these studies shows how different experimental devices, theoretical frameworks, and personal factors gave rise to two diametrically opposing views.

  7. Materials Data on KEr(WO4)2 (SG:15) by Materials Project

    SciTech Connect

    Kristin Persson

    2014-07-09

    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see https://materialsproject.org/docs/calculations

  8. Software Reviews: "Pow! Zap! Ker-plunk! The Comic Book Maker" (Pelican Software).

    ERIC Educational Resources Information Center

    Porter, Bernajean

    1990-01-01

    Reviews the newest addition to Pelican's Creative Writing Series of instructional software, which uses the comic book format to provide a unique writing environment for satire, symbolism, sequencing, and combining text and graphics to communicate ideas. (SR)

  9. Optical Properties of Potassium Erbium Double Tungstate KEr(WO4)2

    DTIC Science & Technology

    2001-01-01

    possible application of rare earth double tungstates is using them as cooling agents in an adiabatic demagnetization method for obtaining very low...means of the Czochralski technique despite their congruent melting. To lower the temperature of crystallisation below the temperature of the phase...of flat surface. The orientation of plates was established by the X-ray diffraction method . Optical spectra were determined in two different cryogenic

  10. Materials Data on KErO2 (SG:166) by Materials Project

    SciTech Connect

    Kristin Persson

    2014-07-09

    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see https://materialsproject.org/docs/calculations

  11. Materials Data on KEr(PO3)4 (SG:4) by Materials Project

    SciTech Connect

    Kristin Persson

    2016-02-04

    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see https://materialsproject.org/docs/calculations

  12. An initial in-orbit performance study of Silicon Tungsten tracKer on DAMPE

    NASA Astrophysics Data System (ADS)

    Qiao, Rui

    2016-07-01

    The dark matter particle explorer (DAMPE) was launched in December 2015 and taking data since then. One of its major payloads, Silicon Tungsten tracker (STK) plays an important role in tracking and ion charge identification. From the study of first few months of data collection of STK, the noise behaviors, DAC/MIPs calibration and an initial charge detection result will be presented.

  13. Materials Data on KErP2S7 (SG:14) by Materials Project

    SciTech Connect

    Kristin Persson

    2016-02-04

    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see https://materialsproject.org/docs/calculations

  14. Comment on ``Accurate Hartree-Fock energy of extended systems using large Gaussian basis sets''

    NASA Astrophysics Data System (ADS)

    Civalleri, Bartolomeo; Orlando, Roberto; Zicovich-Wilson, Claudio M.; Roetti, Carla; Saunders, Victor R.; Pisani, Cesare; Dovesi, Roberto

    2010-03-01

    In a recent paper on Hartree-Fock (HF) calculations on solid LiH with large Gaussian-type basis sets, Paier [Phys. Rev. B 80, 174114 (2009)] report a comment that we dispute: that similar calculations appear unlikely to be feasible using the CRYSTAL code. Here we show that using a full HF approach within periodic boundary conditions as implemented in the CRYSTAL code the same total energy is obtained as from the schemes adopted by Paier

  15. [Did the patients with chronic obstructive pulmonary disease in Primary Care center Anton de Borja correctly utilize inhalers?].

    PubMed

    Represas-Carrera, Francisco Jesús

    2015-01-01

    To determine the percentage of patients with Pulmonary Obstructive Chronic Disease who doing of incorrect form the inhaler technique. Descriptive transversal study made in the Primary Care Center "Antón de Borja" of Rubi (in Barcelona) during the period between May and December 2013, where it was studied a representative sample of 200 patients. To assess the inhaler technique was performed a personal interview with the patient in which it was requested him to carry out a demonstration of how he was using his inhaler regularly evaluating his inhaler technique by means of the regulations established by Spanish Society of Pneumology and Thoracic Surgery. 43% of the patients carry out inhaler technique incorrectly. The percentage of inadequate use of inhalers of dry powder was 26%, of the pressurized cartridge 38% and the inhaler chamber 10%. 82% of patients ≥ 65 years who have prescribed a pressurized inhaler cartridge do not perform accompanied by an inhaler chamber. A high percentage of patients do not correctly carry out inhaler technique, pointing the rare use made of the inhaler chamber despite its proven efficacy and the high number of patients with pressurized inhaler cartridge. These results reflect the need for the implementation of an educational program in our Primary Care Center to teach patients to use inhaler devices. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  16. Science, evolution and natural selection: in praise of Darwin at the Stazione Zoologica Anton Dohrn of Naples.

    PubMed

    Ayala, Francisco J

    2015-01-01

    Copernicus, Galileo, Newton and other physical scientists ushered in a conception of the universe as matter in motion governed by natural laws. Their discoveries brought about a fundamental revolution, namely a commitment to the postulate that the universe obeys immanent laws that can account for natural phenomena. The workings of the universe were brought into the realm of science: explanation through natural laws. Darwin completed the Copernican revolution by extending it to the living world. Darwin demonstrated the evolution of organisms. More important yet is that he discovered natural selection, the process that explains the 'design' of organisms. The adaptations and diversity of organisms, the origin of novel and complex species, even the origin of mankind, could now be explained by an orderly process of change governed by natural laws. The origin of species and the exquisite features of organisms had previously been explained as special creations of an omniscient God. Darwin brought them into the domain of science.

  17. AM06: the Associative Memory chip for the Fast TracKer in the upgraded ATLAS detector

    NASA Astrophysics Data System (ADS)

    Annovi, A.; Beretta, M. M.; Calderini, G.; Crescioli, F.; Frontini, L.; Liberali, V.; Shojaii, S. R.; Stabile, A.

    2017-04-01

    This paper describes the AM06 chip, which is a highly parallel processor for pattern recognition in the ATLAS high energy physics experiment. The AM06 contains memory banks that store data organized in 18 bit words; a group of 8 words is called "pattern". Each AM06 chip can store up to 131 072 patterns. The AM06 is a large chip, designed in 65 nm CMOS, and it combines full-custom memory arrays, standard logic cells and serializer/deserializer IP blocks at 2 Gbit/s for input/output communication. The overall silicon area is 168 mm2 and the chip contains about 421 million transistors. The AM06 receives the detector data for each event accepted by Level-1 trigger, up to 100 kHz, and it performs a track reconstruction based on hit information from channels of the ATLAS silicon detectors. Thanks to the design of a new associative memory cell and to the layout optimization, the AM06 consumption is only about 1 fJ/bit per comparison. The AM06 has been fabricated and successfully tested with a dedicated test system.

  18. Anti-acetylcholinesterase and antioxidant activity of essential oils from Hedychium gardnerianum Sheppard ex Ker-Gawl.

    PubMed

    Arruda, Miguel; Viana, Hugo; Rainha, Nuno; Neng, Nuno R; Rosa, José Silvino; Nogueira, José M F; Barreto, Maria do Carmo

    2012-03-12

    Acetylcholinesterase inhibition, antioxidant and cytotoxic activities of Hedychium gardnerianum leaf essential oils from S. Miguel Island were determined. All the oils inhibited acetylcholinesterase, with IC(50) values of approximately 1 mg/mL, showing no statistical differences between collection sites. Three oils presented mixed inhibition, whilst one was almost truly competitive. This activity can be attributed to the presence of sesquiterpenes, which constituted more than 60% of the composition of the oils. Regarding the antioxidant activity as measured by the DPPH method, all the oils presented activities similar to reference compounds, although with statistical differences between collection sites. Cytotoxicity measured using Artemia salina classified these oils as moderately toxic, with LC(50) values ranging from 300 to 500 µg/mL. These results indicate a possible application of these oils in aromatherapy as coadjuvants in the treatment of cognitive diseases such as Alzheimer, since they may contribute to increase acetylcholine in cholinergic neurons and simultaneously fight deleterious oxidations responsible by neurological degeneration.

  19. Pyrostegia venusta (Ker Gawl.) Miers Crude Extract and Fractions: Prevention of Dental Biofilm Formation and Immunomodulatory Capacity

    PubMed Central

    de Sousa, Mayara Brito; Júnior, José Otávio Carrera Silva; Barbosa, Wagner Luiz Ramos; da Silva Valério, Erika; da Mata Lima, Andriele; de Araújo, Marlon Heggdorne; Muzitano, Michelle Frazão; Nakamura, Celso Vataru; de Mello, João Carlos Palazzo; Teixeira, Francisco Martins

    2016-01-01

    Background: Caries and periodontal diseases remain as important diseases in the Brazilian population. One important pathogen associated with this situation is Streptococcus mutans and other important factor is this pathogen's ability to adhere firmly to the tooth surface leading to dental biofilm formation and caries development. Objectives: Determine the antibacterial and other biological activities of P. venusta related to its potential to be used in the treatment of caries and periodontal disease. Methods: The growth inhibition by P. venusta of Streptococcus mutans, S. mitis, S. oralis and Candida albicans was determined using the broth microdilution method. In addition, the effect of the samples in adherence and reducing production of acids by S. mutans, and germ-tube formation of C. albicans was analysed. The Nitric Oxide (NO) production and cytotoxicity of P. venusta to peripheral blood mononuclear cells (PBMC) and RAW 264.7 Cell Line Murine Macrophage from Blood were assessed. Results: The crude extract (CE) and ethyl-acetate (AF) and n-butanol (BF) fractions showed antibacterial activity. The ethyl-acetate (AF) fraction showed the highest inhibition percentage against the adherence of S. mutans and C. albicans cells without budding, beyond NO production inhibition. There was not any cytotoxicity in the murine macrophages RAW 264.7 cells. Conclusion: Our results suggest that P. venusta presents potential to be used as a preliminary source of compounds that can provide helpful activity when used in prophylaxis or treatment of caries or periodontal disease. SUMMARY Biological activities of Pyrostegia venusta and its potential for use in formulations for the prevention of oral diseases. Abbreviations used: NO: Nitric oxide, PBMC: Peripheral blood mononuclear cells, CE: Crude extract, AF: Ethyl-acetate fraction, BF: n-butanol fraction, HF: Hexane fraction, WF: Water fraction, MIC: Minimum inhibitory concentration, MBC: Minimum bactericidal concentration, ATCC: American Type Culture Collection, CFU: Colony-forming units, BHI: Brain heart infusion, RPMI: Roswell Park Memorial Institute, MOPS: 3-(N-morpholino)propanesulfonic acid, DMEM: Dulbecco's modified Eagle's médium, LPS: Lipopolysacharide, MTT: 3-(4,5-Dimethylthiazol-2-yl)-2,5-Diphenyltetrazolium Bromide, OD: Optical density, AC: Acteoside, PMID:27279710

  20. Materials Data on KErP4(H2O9)2 (SG:15) by Materials Project

    SciTech Connect

    Kristin Persson

    2016-02-11

    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see https://materialsproject.org/docs/calculations

  1. [IPA secretary and patron--Freud's patient, financial administrator and friend. Anton von Freund's letters to Sigmund Freud (1916-1919)].

    PubMed

    Huppke, Andrea; Schröter, Michael

    2011-01-01

    Although the letters, of which numerous and lengthy excerpts are presented in this paper, have repeatedly been used by scholars, they have so far remained unpublished. There are 45 items, written between 4. 1. 1916 and 13. 7. 1919. They indicate a passionate transference to Freud, unfolding against the background of two Hungarian revolutions. After suffering a relapse of his cancer, v. Freund had several stretches of analysis with Freud. While he was better, he established two major funds: one of them allowing the foundation of the psychoanalytic publishing house, the other destined to sponsor a psychoanalytic clinic in Budapest. V. Freund helped organize the Budapest IPA congress, became a member of the "secret committee" and started to actively conduct analyses. Freud was very attached to him and felt deeply shaken by the inexorable progression of v. Freund's disease and then death in January 1920.

  2. The Hybrid Expert in the "Bergstaat": Anton Von Ruprecht as a Professor of Chemistry and Mining and as a Mining Official, 1779-1814

    ERIC Educational Resources Information Center

    Konecny, Peter

    2012-01-01

    In the course of the 18th century a new type of scientifically educated functional elites developed, who were trained to administer mines. The educational project that led to the formation of a corps of mining engineers was part of a programme of administrative and economic reforms that led to a new configuration of bonds between state, economy…

  3. The Hybrid Expert in the "Bergstaat": Anton Von Ruprecht as a Professor of Chemistry and Mining and as a Mining Official, 1779-1814

    ERIC Educational Resources Information Center

    Konecny, Peter

    2012-01-01

    In the course of the 18th century a new type of scientifically educated functional elites developed, who were trained to administer mines. The educational project that led to the formation of a corps of mining engineers was part of a programme of administrative and economic reforms that led to a new configuration of bonds between state, economy…

  4. Swapping of pro-sequences between keratinases of Bacillus licheniformis and Bacillus pumilus: altered substrate specificity and thermostability.

    PubMed

    Rajput, Rinky; Tiwary, Ekta; Sharma, Richa; Gupta, Rani

    2012-08-10

    Pro-sequences were swapped in cis between keratinases from Bacillus licheniformis (Ker BL) and Bacillus pumilus (Ker BP) to construct Ker ProBP-BL and Ker ProBL-BP, respectively. Expression of these keratinases was carried out constitutively by E. coli HB101-pEZZ18 system. They were characterized with respect to their parent enzymes, Ker BL and Ker BP, respectively. Ker ProBP-BL became more thermostable with a t(1/2) of 45 min at 80°C contrary to Ker BL which was not stable beyond 60°C. Similarly, the activity of Ker ProBP-BL on keratin and casein substrate, i.e. K:C ratio increased to 1.2 in comparison to 0.1 for Ker BL. Hydrolysis of insulin B-chain revealed that the cleavage sites increased to six from four in case of Ker ProBP-BL in comparison to Ker BL. However, cleavage sites decreased from seven to four in case of Ker ProBL-BP in comparison to the parent keratinase, Ker BP. Likewise, Ker ProBL-BP revealed altered pH and temperature kinetics with optima at pH 10 and 60°C in comparison to Ker BP which had optima at pH 9 and 70°C. It also cleaved soluble substrates with better efficiency in comparison to Ker BP with K:C ratio of 1.6. Pro-sequence mediated conformational changes were also observed in trans and were almost similar to the features acquired by the chimeras constructed in cis by swapping the pro-sequence region.

  5. Cellulose, chitosan, and keratin composite materials. Controlled drug release.

    PubMed

    Tran, Chieu D; Mututuvari, Tamutsiwa M

    2015-02-03

    A method was developed in which cellulose (CEL) and/or chitosan (CS) were added to keratin (KER) to enable [CEL/CS+KER] composites to have better mechanical strength and wider utilization. Butylmethylimmidazolium chloride ([BMIm(+)Cl(-)]), an ionic liquid, was used as the sole solvent, and because the [BMIm(+)Cl(-)] used was recovered, the method is green and recyclable. Fourier transform infrared spectroscopy results confirm that KER, CS, and CEL remain chemically intact in the composites. Tensile strength results expectedly show that adding CEL or CS into KER substantially increases the mechanical strength of the composites. We found that CEL, CS, and KER can encapsulate drugs such as ciprofloxacin (CPX) and then release the drug either as a single or as two- or three-component composites. Interestingly, release rates of CPX by CEL and CS either as a single or as [CEL+CS] composite are faster and independent of concentration of CS and CEL. Conversely, the release rate by KER is much slower, and when incorporated into CEL, CS, or CEL+CS, it substantially slows the rate as well. Furthermore, the reducing rate was found to correlate with the concentration of KER in the composites. KER, a protein, is known to have secondary structure, whereas CEL and CS exist only in random form. This makes KER structurally denser than CEL and CS; hence, KER releases the drug slower than CEL and CS. The results clearly indicate that drug release can be controlled and adjusted at any rate by judiciously selecting the concentration of KER in the composites. Furthermore, the fact that the [CEL+CS+KER] composite has combined properties of its components, namely, superior mechanical strength (CEL), hemostasis and bactericide (CS), and controlled drug release (KER), indicates that this novel composite can be used in ways which hitherto were not possible, e.g., as a high-performance bandage to treat chronic and ulcerous wounds.

  6. Cellulose, Chitosan, and Keratin Composite Materials. Controlled Drug Release

    PubMed Central

    2015-01-01

    A method was developed in which cellulose (CEL) and/or chitosan (CS) were added to keratin (KER) to enable [CEL/CS+KER] composites to have better mechanical strength and wider utilization. Butylmethylimmidazolium chloride ([BMIm+Cl–]), an ionic liquid, was used as the sole solvent, and because the [BMIm+Cl–] used was recovered, the method is green and recyclable. Fourier transform infrared spectroscopy results confirm that KER, CS, and CEL remain chemically intact in the composites. Tensile strength results expectedly show that adding CEL or CS into KER substantially increases the mechanical strength of the composites. We found that CEL, CS, and KER can encapsulate drugs such as ciprofloxacin (CPX) and then release the drug either as a single or as two- or three-component composites. Interestingly, release rates of CPX by CEL and CS either as a single or as [CEL+CS] composite are faster and independent of concentration of CS and CEL. Conversely, the release rate by KER is much slower, and when incorporated into CEL, CS, or CEL+CS, it substantially slows the rate as well. Furthermore, the reducing rate was found to correlate with the concentration of KER in the composites. KER, a protein, is known to have secondary structure, whereas CEL and CS exist only in random form. This makes KER structurally denser than CEL and CS; hence, KER releases the drug slower than CEL and CS. The results clearly indicate that drug release can be controlled and adjusted at any rate by judiciously selecting the concentration of KER in the composites. Furthermore, the fact that the [CEL+CS+KER] composite has combined properties of its components, namely, superior mechanical strength (CEL), hemostasis and bactericide (CS), and controlled drug release (KER), indicates that this novel composite can be used in ways which hitherto were not possible, e.g., as a high-performance bandage to treat chronic and ulcerous wounds. PMID:25548871

  7. Development and Validation of Kindergarten Environment Rating Scale

    ERIC Educational Resources Information Center

    Liu-Yan; Pan-Yuejuan

    2008-01-01

    The authors present the development and the validation of the four-dimensional, twenty-five-item, five-point Kindergarten Environment Rating Scale (KERS). The Cohen's Kappa of the items indicates acceptable reliability for the instrument. The content validity and confirmatory factor analysis indicates that the data obtained using the KERS could…

  8. Fractals and Chaos

    DTIC Science & Technology

    1991-06-01

    Mathematical Society, 1989. Anton , Howard , and Chris Rorres, Elementary Linear Algebra with Applications, John Wiley & Sons, 1987. Arnold, V. L...Additionally, the references used for general information throughout the thesis are Ross (1980) for advanced calculus, Anton (1987) for linear algebra ...our understanding of the physical world. The mathematics required to understand this thesis includes basic courses in calculus and linear algebra

  9. The Military Inventory Routing Problem with Direct Delivery

    DTIC Science & Technology

    2014-03-27

    Unmanned Aircraft Systems (UAS). General Dynamics Information Technology. [13] Kleywegt, Anton J, Nori , Vijay S, & Savelsbergh, Martin WP. 2002. The...stochas- tic inventory routing problem with direct deliveries. Transportation Science, 36(1), 94–118. 55 [14] Kleywegt, Anton J, Nori , Vijay S

  10. Applicability of rapid and on-site measured enzyme activity for surface water quality monitoring in an agricultural catchment

    NASA Astrophysics Data System (ADS)

    Stadler, Philipp; Farnleitner, Andreas H.; Sommer, Regina; Kumpan, Monika; Zessner, Matthias

    2014-05-01

    For the near real time and on-site detection of microbiological fecal pollution of water, the measurement of beta-D- Glucuronidase (GLUC) enzymatic activity has been suggested as a surrogate parameter and has been already successfully operated for water quality monitoring of ground water resources (Ryzinska-Paier et al. 2014). Due to possible short measure intervals of three hours, this method has high potential as a water quality monitoring tool. While cultivation based standard determination takes more than one working day (Cabral 2010) the potential advantage of detecting the GLUC activity is the high temporal measuring resolution. Yet, there is still a big gap of knowledge on the fecal indication capacity of GLUC (specificity, sensitivity, persistence, etc.) in relation to potential pollution sources and catchment conditions (Cabral 2010, Ryzinska-Paier et al. 2014). Furthermore surface waters are a big challenge for automated detection devices in a technical point of view due to the high sediment load during event conditions. This presentation shows results gained form two years of monitoring in an experimental catchment (HOAL) dominated by agricultural land use. Two enzymatic measurement devices are operated parallel at the catchment outlet to test the reproducibility and precision of the method. Data from continuous GLUC monitoring under both base flow and event conditions is compared with reference samples analyzed by standardized laboratory methods for fecal pollution detection (e.g. ISO 16649-1, Colilert18). It is shown that rapid enzymatic on-site GLUC determination can successfully be operated from a technical point of view for surface water quality monitoring under the observed catchment conditions. The comparison of enzyme activity with microbiological standard analytics reveals distinct differences in the dynamic of the signals during event conditions. Cabral J. P. S. (2010) "Water Microbiology. Bacterial Pathogens and Water" International Journal of

  11. Tracing direct and sequential two-photon double ionization of D{sub 2} in femtosecond extreme-ultraviolet laser pulses

    SciTech Connect

    Jiang, Y. H.; Kurka, M.; Kuehnel, K. U.; Ergler, Th.; Schroeter, C. D.; Moshammer, R.; Rudenko, A.; Foucar, L.; Plesiat, E.; Perez-Torres, J. F.; Martin, F.; Herrwerth, O.; Lezius, M.; Kling, M. F.; Titze, J.; Jahnke, T.; Doerner, R.; Sanz-Vicario, J. L.; Schoeffler, M.; Tilborg, J. van

    2010-02-15

    Two-photon double ionization (TPDI) of D{sub 2} is studied for 38-eV photons at the Free Electron Laser in Hamburg (FLASH). Based on model calculations, instantaneous and sequential absorption pathways are identified as separated peaks in the measured D{sup +}+D{sup +} fragment kinetic energy release (KER) spectra. The instantaneous process appears at high KER, corresponding to ionization at the molecule's equilibrium distance, in contrast to sequential ionization mainly leading to low-KER contributions. Measured fragment angular distributions are in good agreement with theory.

  12. Electronic structure of cation-codoped TiO2 for visible-light photocatalyst applications from hybrid density functional theory calculations

    NASA Astrophysics Data System (ADS)

    Long, Run; English, Niall J.

    2011-04-01

    The electronic structures of Mg/Ca- and/or Mo/W- (mono- and co-) doped anatase TiO2 have been investigated via generalized Kohn-Sham theory with the Heyd-Scuseria-Ernzerhof hybrid functional for exchange-correlation {J. Heyd et al., [J. Chem. Phys. 118, 8207 (2003)], J. Heyd et al., [J. Chem. Phys. 124, 219906 (2006)], and J. Paier et al., [J. Chem. Phys. 125, 249901 (2006)]}, in the context of density functional theory. Gap narrowing is small for monodoping, which also creates impuritiy bands in the "forbidden gap," either as acceptor or donor states, limiting possible utility as visible-light photocatalysts. However, codoping of Mg/Ca and Mo/W not only induces appreciable gap narrowing, but also serves to passivate the impurity bands, which can harvest visible-light to a greater extent. Considering ionic radii, Mg and Mo should constitute the best cation-pair.

  13. The AM05 density functional applied to solids.

    PubMed

    Mattsson, Ann E; Armiento, Rickard; Paier, Joachim; Kresse, Georg; Wills, John M; Mattsson, Thomas R

    2008-02-28

    We show that the AM05 functional [Armiento and Mattsson, Phys. Rev. B 72, 085108 (2005)] has the same excellent performance for solids as the hybrid density functionals tested in Paier et al. [J. Chem. Phys. 124, 154709 (2006); 125, 249901 (2006)]. This confirms the original finding that AM05 performs exceptionally well for solids and surfaces. Hartree-Fock hybrid calculations are typically an order of magnitude slower than local or semilocal density functionals such as AM05, which is of a regular semilocal generalized gradient approximation form. The performance of AM05 is on average found to be superior to selecting the best of local density approximation and PBE for each solid. By comparing data from several different electronic-structure codes, we have determined that the numerical errors in this study are equal to or smaller than the corresponding experimental uncertainties.

  14. North Korea and Iran’s Nuclear Programs as Instability Factors in the New System of International Relations

    DTIC Science & Technology

    2007-11-01

    Aleksandr. “V mire letiat ‘iadernye utki’.” (Nuclear Hoax in the World.) Izvestiia, October 19, 2004. 113 Andreenko, Anton. “Iran i uran .” (Iran and...149 Andreenko, Anton. “Iran i uran .” (Iran and Uranium). 7 dnei. August 26, 2004. 150 Shumilin, Aleksandr. “V mire letiat ‘iadernye utki...152 IAEA materials. http://www.iaea.org. 153 Andreenko, Anton. “Iran i uran .” (Iran and Uranium). 7 dnei. August 26, 2004. - 38 - of its missile

  15. What Causes Aplastic Anemia?

    MedlinePlus

    ... to aplastic anemia. Examples include Fanconi anemia , Shwachman-Diamond syndrome, dyskeratosis (DIS-ker-ah-TO-sis) congenita, and Diamond-Blackfan anemia. Rate This Content: NEXT >> Featured Video ...

  16. 77 FR 35291 - Killed, Nonviable Streptomyces acidiscabies Strain RL-110T

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-06-13

    ... pesticide active ingredient consists of killed, nonviable Streptomyces acidiscabies strain RL-110\\T\\ cells.... Loria R, Kers J, Joshi M. 2006. Evolution of plant pathology in Streptomyces. Annual Review of...

  17. Correlation functions of higher-dimensional automatic sequences

    NASA Astrophysics Data System (ADS)

    Barbé, A.; von Haeseler, F.

    2004-11-01

    A procedure for calculating the (auto)correlation function \\gamma_f(k), k\\in {\\bb Z}^m , of an m-dimensional complex-valued automatic sequence f:{\\bb Z}^m\\rightarrow {\\bb C} , is presented. This is done by deriving a recursion for the vector correlation function Γker(f)(k) whose components are the (cross)correlation functions between all sequences in the finite set ker(f), the so-called kernel of f which contains all properly defined decimations of f. The existence of Γker(f)(k), which is defined as a limit, for all k\\in {\\bb Z}^m , is shown to depend only on the existence of Γker(f)(0). This is illustrated for the higher-dimensional Thue-Morse, paper folding and Rudin-Shapiro sequences.

  18. Temperature and heat capacity of atomic clusters as estimated in terms of kinetic-energy release of atomic evaporation

    NASA Astrophysics Data System (ADS)

    Fujii, Mikiya; Takatsuka, Kazuo

    2007-11-01

    The temperature and heat capacity of isolated atomic clusters are studied in terms of an ab initio statistical theory of kinetic energy distribution by atomic evaporation. Two definitions of canonical temperature are examined and numerically compared: One is based on the most probable kinetic energy release (KER), whereas the other is determined with use of the entire distribution of the KER. The mutual relationship and their advantages are discussed.

  19. Codon Optimization Significantly Improves the Expression Level of a Keratinase Gene in Pichia pastoris

    PubMed Central

    Hu, Hong; Gao, Jie; He, Jun; Yu, Bing; Zheng, Ping; Huang, Zhiqing; Mao, Xiangbing; Yu, Jie; Han, Guoquan; Chen, Daiwen

    2013-01-01

    The main keratinase (kerA) gene from the Bacillus licheniformis S90 was optimized by two codon optimization strategies and expressed in Pichia pastoris in order to improve the enzyme production compared to the preparations with the native kerA gene. The results showed that the corresponding mutations (synonymous codons) according to the codon bias in Pichia pastoris were successfully introduced into keratinase gene. The highest keratinase activity produced by P. pastoris pPICZαA-kerAwt, pPICZαA-kerAopti1 and pPICZαA-kerAopti2 was 195 U/ml, 324 U/ml and 293 U/ml respectively. In addition, there was no significant difference in biomass concentration, target gene copy numbers and relative mRNA expression levels of every positive strain. The molecular weight of keratinase secreted by recombinant P. pastori was approx. 39 kDa. It was optimally active at pH 7.5 and 50°C. The recombinant keratinase could efficiently degrade both α-keratin (keratin azure) and β-keratin (chicken feather meal). These properties make the P. pastoris pPICZαA-kerAopti1 a suitable candidate for industrial production of keratinases. PMID:23472192

  20. Subtilisin-γ-glutamyl transpeptidase: a novel combination as ungual enhancer for prospective topical application.

    PubMed

    Tiwary, Ekta; Gupta, Rani

    2010-12-01

    A feather degrading strain of Bacillus licheniformis ER-15 was isolated which also degraded α-keratin of hooves. A detailed analysis revealed that a novel monomeric γ-glutamyl transpeptidase (GGT(30)), a proteolytic product of heterodimeric 67 kDa γ-glutamyl transpeptidase (GGT(67)), assists subtilisin during its action on α keratin. An equimolar combination of subtilisin and GGT(30) was designated as KerN and was used as ungual enhancer for topical application. KerN was effective in releasing proteins from nail plate surface and 300 µg of enzyme could release 41 µg protein/mg of nail after 24 h treatment. Scanning electron micrograph (SEM) revealed loosening of nail matrix confirming the action of KerN on nail keratin. Drug permeation studies revealed permeation of clotrimazole through both enzymatically pretreated nail plates and also through nail plates in presence of KerN. Nearly 58% drug could be retained by nail plates after 24 h of 300 µg/mL KerN which further enhanced up to 97% by prolonging the enzyme application. The enzyme was found to be stable in presence of drug even after 72 h. Thus, KerN can be used as an additive in formulation of topical drug for onchomycosis. © 2010 Wiley-Liss, Inc. and the American Pharmacists Association

  1. 78 FR 1210 - Notice of Membership of Performance Review Board for Senior Executives (PRB)

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-01-08

    ... will remove the following member: Charles H. Schneider The Commission's PRB will add the following member: Anton C. Porter, PRB Chairman Dated: January 2, 2013. Kimberly D. Bose, Secretary. BILLING CODE...

  2. Black Scholars in Europe during the Renaissance and the Enlightenment.

    ERIC Educational Resources Information Center

    Fikes, Robert, Jr.

    1980-01-01

    Describes the accomplishments of Juan Latino (1516-1599), Jacobus Eliza Johannes Capitein (1717-1747), and Anton Wilhelm Amo (1703-1753), Blacks who were educated in Europe and became important intellectual and literary figures. (GC)

  3. Too Little too Soon: The Literature of Deaf Education in 17th-Century Britain (Part II).

    ERIC Educational Resources Information Center

    Hoolihan, Christopher

    1985-01-01

    The article describes the growth in literature on deaf education in 17th century Britain. Noted is the work of John Wallis, William Holder, George Dalgarno, Anton Deusing, and Johann Conrad Amman. (CL)

  4. Shkaplerov uses a Video Display Unit in the SM

    NASA Image and Video Library

    2012-01-05

    ISS030-E-021039 (5 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, wears a communication system headset while working with a video display unit in the Zvezda Service Module of the International Space Station.

  5. Shkaplerov uses a Video Display Unit in the SM

    NASA Image and Video Library

    2012-01-05

    ISS030-E-021042 (5 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, wears a communication system headset while working with a video display unit in the Zvezda Service Module of the International Space Station.

  6. Shkaplerov uses a Video Display Unit in the SM

    NASA Image and Video Library

    2012-01-05

    ISS030-E-021041 (5 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, wears a communication system headset while working with a video display unit in the Zvezda Service Module of the International Space Station.

  7. Expedition 29 Crew Profile

    NASA Image and Video Library

    The six members of Expedition 29 are profiled and interviewed. NASA astronauts Mike Fossum and Dan Burbank; JAXA astronaut Satoshi Furukawa; and cosmonauts Anton Shkaplerov and Anatoly Ivanishin di...

  8. Hypothyroidism

    MedlinePlus

    ... Anton B, Ladenson PW. Prevalence and incidence of endocrine and metabolic disorders in the United States: a comprehensive review. Journal ... thyroid gland. Hashimoto’s disease is also an ... and Metabolic Diseases Information Service (NEMDIS) fact sheet ...

  9. ISS Expedition 42 Crew Profiles - Version 01

    NASA Image and Video Library

    2014-11-14

    Narrated program with biographical information about ISS Expedition 42 crewmembers Terry Virts, Samantha Cristoforetti and Anton Shjaplerov. The program covers the crewmember's career including childhood photographs; footage from previous missions; and interview sound bites.

  10. Shkaplerov makes a selection from food container

    NASA Image and Video Library

    2012-02-03

    ISS030-E-117514 (3 Feb. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, makes a selection from a food storage container in the Zvezda Service Module of the International Space Station.

  11. Shkaplerov exercises on the aRED

    NASA Image and Video Library

    2012-01-05

    ISS030-E-235507 (5 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, exercises using the advanced Resistive Exercise Device (aRED) in the Tranquility node of the International Space Station.

  12. Forced Labor and ’Foreign Workers’ in the Third Reich

    DTIC Science & Technology

    2009-03-18

    Wanderarbeiter, Gastarbeiter, ed. Klaus J. Bade (Ostfildern: Scripta Mercaturae Verlag, 1984), 581-583. 6 Anton Grossmann, “ Polen und Sowjetrussen...Herbert, “Fremdarbeiter,” 285-288. 23 Grossmann, “ Polen und Sowjetrussen,” 395. 24 Anton Grossmann, Fremd und Zwangsarbeiter: Providing several examples...Grossmann, “ Polen und Sowjetrussen,” 391 40 Grossmann, “ Polen und Sowjetrussen,” 390. 41 Herbert, “Fremdarbeiter,” 231. 42 Grossmann, “ Polen und

  13. Synthesis, structure and antimicrobial property of green composites from cellulose, wool, hair and chicken feather.

    PubMed

    Tran, Chieu D; Prosencyes, Franja; Franko, Mladen; Benzi, Gerald

    2016-10-20

    Novel composites between cellulose (CEL) and keratin (KER) from three different sources (wool, hair and chicken feather) were successfully synthesized in a simple one-step process in which butylmethylimidazolium chloride (BMIm(+)Cl(-)), an ionic liquid, was used as the sole solvent. The method is green and recyclable because [BMIm(+)Cl(-)] used was recovered for reuse. Spectroscopy (FTIR, XRD) and imaging (SEM) results confirm that CEL and KER remain chemically intact and homogeneously distributed in the composites. KER retains some of its secondary structure in the composites. Interestingly, the minor differences in the structure of KER in wool, hair and feather produced pronounced differences in the conformation of their corresponding composites with wool has the highest α-helix content and feather has the lowest content. These results correlate well with mechanical and antimicrobial properties of the composites. Specifically, adding CEL into KER substantially improves mechanical strength of [CEL+KER] composites made from all three different sources, wool, hair and chicken feathers i.e., [CEL+wool], [CEL+hair] and [CEL+feather]. Since mechanical strength is due to CEL, and CEL has only random structure, [CEL+feather] has, expectedly, the strongest mechanical property because feather has the lowest content of α-helix. Conversely, [CEL+wool] composite has the weakest mechanical strength because wool has the highest α-helix content. All three composites exhibit antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA). The antibacterial property is due not to CEL but to the protein and strongly depends on the type of the keratin, namely, the bactericidal effect is strongest for feather and weakest for wool. These results together with our previous finding that [CEL+KER] composites can control release of drug such as ciprofloxacin clearly indicate that these composites can potentially be used as wound dressing. Copyright © 2016 Elsevier

  14. One-Pot Synthesis of Biocompatible Silver Nanoparticle Composites from Cellulose and Keratin: Characterization and Antimicrobial Activity.

    PubMed

    Tran, Chieu D; Prosenc, Franja; Franko, Mladen; Benzi, Gerald

    2016-12-21

    A novel, simple method was developed to synthesize biocompatible composites containing 50% cellulose (CEL) and 50% keratin (KER) and silver in the form of either ionic (Ag(+)) or Ag(0) nanoparticles (Ag(+)NPs or Ag(0)NPs). In this method, butylmethylimmidazolium chloride ([BMIm(+)Cl(-)]), a simple ionic liquid, was used as the sole solvent and silver chloride was added to the [BMIm(+)Cl(-)] solution of [CEL+KER] during the dissolution process. The silver in the composites can be maintained as ionic silver (Ag(+)) or completely converted to metallic silver (Ag(0)) by reducing it with NaBH4. The results of spectroscopy [Fourier transform infrared and X-ray diffraction (XRD)] and imaging [scanning electron microscopy (SEM)] measurements confirm that CEL and KER remain chemically intact and homogeneously distributed in the composites. Powder XRD and SEM results show that the silver in the [CEL+KER+Ag(+)] and [CEL+KER+Ag(0)] composites is homogeneously distributed throughout the composites in either Ag(+) (in the form of AgClNPs) or Ag(0)NPs form with sizes of 27 ± 2 or 9 ± 1 nm, respectively. Both composites were found to exhibit excellent antibacterial activity against many bacteria including Escherichia coli, Staphylococcus aureus, Pseudomonas aeruginosa, methicillin-resistant S. aureus (MRSA), and vancomycin-resistant Enterococus faecalis (VRE). The antibacterial activity of both composites increases with the Ag(+) or Ag(0) content in the composites. More importantly, for the same bacteria and the same silver content, the [CEL+KER+AgClNPs] composite is relatively more toxic than [CEL+KER+Ag(0)NPs] composite. Experimental results confirm that there was hardly any Ag(0)NPs release from the [CEL+KER+Ag(0)NPs] composite, and hence its antimicrobial activity and biocompatibility is due not to any released Ag(0)NPs but rather entirely to the Ag(0)NPs embedded in the composite. Both AgClNPs and Ag(0)NPs were found to be toxic to human fibroblasts at higher concentration

  15. Compatibility study of alginate/keratin blend for biopolymer development.

    PubMed

    Gupta, Pratima; Nayak, Kush Kumar

    2015-12-18

    The ultimate characteristics of blend film depend on the properties of its polymeric components, composition, and on the compatibility of the polymers. Binary polymer blend films of alginate (ALG) and keratin (KER) fibers (obtained from chicken feathers) were prepared by simple solution casting techniques and their compatibility properties were studied by X-ray diffraction and scanning electron microscopy. The tensile strength and percent of elongation were measured by a tensile strength tester. The results of the present studies elucidate that ALG and KER are compatible and suitable for the development of a blend film. It was found that the ALG/KER blend ratios of 90:10 and 80:20 possess characteristics to make a blend film with a high tensile strength value. The blend with composition 90:10 of ALG/KER is the one of the strongest candidates in the preparation of blending films, because it has the highest tensile strength (0.38 MPa) and percentage of elongation (59.5%) among all tested blend compositions. The blend ratio of 80:20 of ALG/KER achieves maximum compatibility, since its intensity pattern changes drastically as recorded in an X-ray diffraction study. The fabricated blend film can be a suitable candidate for a range of biomaterials such as for a drug delivery vesicle, hydrogel, and scaffolding, etc.

  16. Cysteic Acid in Dietary Keratin is Metabolized to Glutathione and Liver Taurine in a Rat Model of Human Digestion

    PubMed Central

    Wolber, Frances M.; McGrath, Michelle; Jackson, Felicity; Wylie, Kim; Broomfield, Anne

    2016-01-01

    Poultry feathers, consisting largely of keratin, are a low-value product of the poultry industry. The safety and digestibility of a dietary protein produced from keratin (KER) was compared to a cysteine-supplemented casein-based diet in a growing rat model for four weeks. KER proved to be an effective substitute for casein at 50% of the total dietary protein, with no changes in the rats’ food intake, weight gain, organ weight, bone mineral density, white blood cell counts, liver glutathione, or blood glutathione. Inclusion of KER in the diet reduced total protein digestibility from 94% to 86% but significantly increased total dietary cysteine uptake and subsequent liver taurine levels. The KER diet also significantly increased caecum weight and significantly decreased fat digestibility, resulting in a lower proportion of body fat, and induced a significant increase in blood haemoglobin. KER is therefore a safe and suitable protein substitute for casein, and the cysteic acid in keratin is metabolised to maintain normal liver and blood glutathione levels. PMID:26907334

  17. Cysteic Acid in Dietary Keratin is Metabolized to Glutathione and Liver Taurine in a Rat Model of Human Digestion.

    PubMed

    Wolber, Frances M; McGrath, Michelle; Jackson, Felicity; Wylie, Kim; Broomfield, Anne

    2016-02-19

    Poultry feathers, consisting largely of keratin, are a low-value product of the poultry industry. The safety and digestibility of a dietary protein produced from keratin (KER) was compared to a cysteine-supplemented casein-based diet in a growing rat model for four weeks. KER proved to be an effective substitute for casein at 50% of the total dietary protein, with no changes in the rats' food intake, weight gain, organ weight, bone mineral density, white blood cell counts, liver glutathione, or blood glutathione. Inclusion of KER in the diet reduced total protein digestibility from 94% to 86% but significantly increased total dietary cysteine uptake and subsequent liver taurine levels. The KER diet also significantly increased caecum weight and significantly decreased fat digestibility, resulting in a lower proportion of body fat, and induced a significant increase in blood haemoglobin. KER is therefore a safe and suitable protein substitute for casein, and the cysteic acid in keratin is metabolised to maintain normal liver and blood glutathione levels.

  18. O2^+ dissociation caused by an ultrashort intense laser pulse

    NASA Astrophysics Data System (ADS)

    Sayler, A. M.

    2005-05-01

    Laser-induced dissociation of O2^+ has been experimentally studied with ultrashort (˜50 fs) intense (10^14 to 10^15 W/cm^2) laser pulses at 790 nm using kinematically complete coincidence 3D momentum imaging. The resulting kinetic energy release (KER) distribution has several distinct peaks, each of which has a unique angular distribution. The lower KER features are peaked around the laser polarization, while at higher KER, dissociation perpendicular to the laser polarization is significant. For comparison, a theoretical study of O2^+ dissociation using the Electron-Nuclear Dynamics (END) approach with a laser pulse included in the time-dependent dynamics is underway. Preliminary results also indicate that ionization, which occurs predominantly at the high end of the intensity range, is strongly peaked along the laser polarization.

  19. Electron Localization in Molecular Fragmentation of H{sub 2} by Carrier-Envelope Phase Stabilized Laser Pulses

    SciTech Connect

    Kremer, Manuel; Fischer, Bettina; Feuerstein, Bernold; Sharma, Vandana; Hofrichter, Christian; Schroeter, Claus Dieter; Moshammer, Robert; Ullrich, Joachim; Jesus, Vitor L. B. de; Rudenko, Artem; Thumm, Uwe

    2009-11-20

    Fully differential data for H{sub 2} dissociation in ultrashort (6 fs, 760 nm), linearly polarized, intense (0.44 PW/cm{sup 2}) laser pulses with a stabilized carrier-envelope phase (CEP) were recorded with a reaction microscope. Depending on the CEP, the molecular orientation, and the kinetic energy release (KER), we find asymmetric proton emission at low KERs (0-3 eV), basically predicted by Roudnev and Esry, and much stronger than reported by Kling et al. Wave packet propagation calculations reproduce the salient features and discard, together with the observed KER-independent electron asymmetry, the first ionization step to be the reason for the asymmetric proton emission.

  20. Improving the Performance of a Millimeter-Wave Scalar Network Analyzer.

    DTIC Science & Technology

    1986-09-01

    Naval Postgraduate School. This thesis is dedicated to my mother and father. 11 I. INTRODUCTION A. BACKGROUND In the past few years the populariLy of...SETTING (dB) a. 65 GHz. > 19999 - E Li 10 B I- -J 0 1 9 F- -C scH TTKYDRRRER DODE T 1 -- -ODE I’- - NH! KER lODE 2= .1 - - - - - - - - - 0 -45 -49 -35...30 -25 -29 -15 -19 -5 9 5 RTTENURTOR SETTING (dB) b. 75 GHz. > 10999- E ! LiJ I- a 10 -CH(TTKY BARR ER ) ODE --. NH! KER lODE 2 0 -45 -49 -35 -39 -25

  1. Stability, Stochastic Stationarity and Generalized Lyapunov Equations for Two-Point Boundary-Value Descriptor Systems,

    DTIC Science & Technology

    1988-03-03

    M where M is a nilpotent matrix and J is invertible, and V [ 0 VU,l 0t VMf]V, = vj 0 , 1 = vil Then, the extendibility condition Ker(A ) C Ker(V 1...subsystem 1 by El -1 , and the resulting system will be causal and such that the dynamics matrix ElNA is nilpotent . A similar transformation can be...time-invariant, but not extendible, TPBVDS can be obtained by replacing Vi and V1 by V,’ and VI, such that (i) V ’ is the lowest rank matrix

  2. Development and Testing of Living Skin Equivalent.

    DTIC Science & Technology

    1988-05-01

    Model a) The use of Isografts in an inbred strain of rats. In a preliminary series of experiments the potential use of Fischer strain rats has been...tested by preparing a series of isografts made by grafting skin equivalents with cells from female donors to male hosts. On the average, wound...Autograft--rat 4 1 4 3 5 17 Autograft--rabbit 6 3 1 1 11 Isograft --rat 37 13 13 1 64 Allo fib., iso ker--rat 15 12 3 30 Allo fib, iso ker--rab 8 6 14 Iso

  3. Resolving Phase Ambiguities in the Calibration of Redundant Interferometric Arrays: Implications for Array Design (Preprint)

    DTIC Science & Technology

    2016-02-29

    solution ep. The complete set of solutions is then given by: ê = ep + eh (9) where eh is any integer vector in the kernel of P̃. Suppose we choose one such...vector eh and correct our phase measure- ment vector accordingly. The corrected phase measurement vector can be written as: β̂∗ = β + 2π(ep + eh ) (10...Lemma 2.1: eh ∈ K + L,∀ eh Proof: The fact that eh ∈ ker (PWW 1 2 ) implies that W 1 2 eh ∈ ker (PW). This in turn implies that W 1 2 eh ∈ im(W 1 2 M

  4. Resolving Phase Ambiguities in the Calibration of Redundant Interferometric Arrays: Implications for Array Design

    DTIC Science & Technology

    2016-03-04

    ep. The complete set of solutions is then given by: ê = ep + eh (9) where eh is any integer vector in the kernel of P̃. Suppose we choose one such...vector eh and correct our phase measure- ment vector accordingly. The corrected phase measurement vector can be written as: β̂∗ = β + 2π(ep + eh ) (10...Lemma 2.1: eh ∈ K + L,∀ eh Proof: The fact that eh ∈ ker (PWW 1 2 ) implies that W 1 2 eh ∈ ker (PW). This in turn implies that W 1 2 eh ∈ im(W 1 2 M

  5. Computing Reaction Pathways of Rare Biomolecular Transitions using Atomistic Force-Fields.

    PubMed

    Faccioli, P; a Beccara, S

    2016-01-01

    The Dominant Reaction Pathway (DRP) method is an approximate variational scheme which can be used to compute reaction pathways in conformational transitions undergone by large biomolecules (up to ~10(3) amino-acids) using realistic all-atom force fields. We first review the status of development of this method. Next, we discuss its validation against the results of plain MD protein folding simulations performed by the DE-Shaw group using the Anton supercomputer. Finally, we review a few representative applications of the DRP approach to study reactions which are far too complex and rare to be investigated by plain MD, even on the Anton machine.

  6. Premalignant Genetic and Epigenetic Alterations in Tubal Epithelium from Women with BRCA1 Mutations

    DTIC Science & Technology

    2010-10-14

    Premalignant Genetic and Epigenetic Alterations in Tubal Epithelium from Women with BRCA1 Mutations PRINCIPAL INVESTIGATOR: Anton Krumm, Ph.D...REPORT TYPE 3. DATES COVERED (From - To) 15 Sept 2009 – 14 Sept 2010 4. TITLE AND SUBTITLE Premalignant Genetic and Epigenetic Alterations in Tubal 5a...Appendices…………………………………………………………………………… 8-33 10/14/2010 Anton Krumm 1 Premalignant Genetic and Epigenetic Alterations in Tubal Epithelium from Women

  7. Workshop on the Mechanics of Ice and Its Applications

    DTIC Science & Technology

    1993-10-01

    41st Street 206/363-3394 P.O. Box 3383 206/363-3394 (FAX) Tulsa, OK 74102 918/660-3339 Anton Prodanovic 918/660-3274 (FAX) Mobil Research & Development...5846 4502 East 41st Street 206/363-3394 P.O. Box 3383 206/363-3394 (FAX) Tulsa, OK 74102 918/660-3339 Anton Prodanovic 918/660-3274 (FAX) Mobil Research...um Aademy of Scimmoes, Moscow.. US= P. Varstas Helsinki University of Technlogy # Be’sInki, Finland A IN AN ICE (OVM UNDE RO~RSIQI Results and

  8. Renormalized second-oder perturbation theory for the electron correlation energy: concepts and benchmarks

    NASA Astrophysics Data System (ADS)

    Rinke, Patrick; Ren, Xinguo; Scheffler, Matthias; Scuseria, Gustavo

    2012-02-01

    We present a renormalized second-oder perturbation theory (R2PT) for the electron correlation energy that combines the random-phase approximation (RPA), second-order screened exchange (SOSEX) [1], and renormalized single excitations (rSE) [2]. These three terms all involve a summation of certain types of diagrams to infinite order, and can be viewed as a ``renormalization" of the direct, the exchange and the single excitation (SE) term of 2nd-order Rayleigh-Schr"ordinger perturbation theory based on an (approximate) Kohn-Sham reference state. A preliminary version of R2PT has been benchmarked for covalently-bonded molecular systems and chemical reaction barrier heights [3] and shows an overall well balanced performance. We have extended this, by including ``off-diagonal'' diagrams into the rSE term and expect this refined version of R2PT to be more generally applicable to electronic systems of different bonding characteristics. Extended benchmarks of van-der-Waals-bonded molecules and crystalline solids will be presented. [1] A. Gr"uneis et al., J. Chem. Phys. 131, 154115 (2009). [2] X. Ren et al., Phys. Rev. Lett. 106, 153003 (2011). [3] J. Paier et al., arXiv:cond-mat/1111.0173.

  9. Adverse Outcome Pathway (AOP) for a Mutagenic Mode of Action for Cancer: AFB1 and Hepatocellular Carcinoma (HCC)

    EPA Science Inventory

    AOPs provide a framework to describe a sequence of measureable key events (KEs), beginning with a molecular initiating event (MIE), followed by a series of identified KEs linked to one another by KE Relationships (KERs), all anchored by a specific adverse outcome (AO). Each KE/KE...

  10. Design and Implementation of a Relational Database Management System for the AFIT Thesis Process.

    DTIC Science & Technology

    1985-09-01

    AIRLIFT Gourdin 4. APPLIED MATHEMATICS Daneman Lee Na rga rsen ker 5. ARTIFICIAL INTELLEGENCE Gen et 6. CAPARILITY ASSESSMENT S Budde Talbott 31...05 ARTIFICIAL INTELLIGENCE 06 CAPABILITY ASSESSMENT 07 COMMUNIICATIONS 08 COMPUTER AIDED DESIGN 09 COMPUTER BASED TRAINING 10 COMPUTER SOFTWARE 11

  11. Heat and Mass Transfer Modeling of Rough Rice Under Convective and Infrared Drying

    USDA-ARS?s Scientific Manuscript database

    Infrared drying of rice can reduce drying time, perform disinfestations and reduce rice fissuring compared to traditional hot air drying method. Fissures in the rice kernels are caused by high moisture content gradients within the kernels. To understand the moisture distributions within a rice ker...

  12. The Road from Coorain.

    ERIC Educational Resources Information Center

    Conway, Jill Ker

    This autobiography is concerned with the early years and young womanhood of Jill Ker Conway, the first female president of Smith College and a noted historian specializing in the experience of women in America. The book tells the story of Conway's journey from a girlhood on an isolated sheep farm in the Australian grasslands where she studied by…

  13. Removal of Radioactive Aerosols and Gases from Exhaust Air

    DTIC Science & Technology

    1975-08-07

    relatively small Yinvestment and operating costs. A disadvantage is the danger of explosion as the consequence of ozone formation. The processes of...Bakterien und Viron) aus Luft und ardereu Gasen Staub U (1963) 21 5] HASENCLEVER, D. Filter sur Luft- und Gasroinigung in ker-teohnisohen Anlagen Staub

  14. The kernel of Laplace-Beltrami operators with zero-radius potential or on decorated graphs

    NASA Astrophysics Data System (ADS)

    Tolchennikov, A. A.

    2008-08-01

    An isomorphism is described for the kernel of the Laplace operator \\Delta^{\\!\\Lambda} (determined by a Lagrangian plane \\Lambda\\subset\\mathbb C^k\\oplus\\mathbb C^k) with potential \\sum_{j=1}^kc_j\\delta_{q_j}(x) on a manifold. The isomorphism is given by \\Gamma\\colon\\ker\\Delta^{\\!\\Lambda}\\to\\Lambda\\cap\

  15. Catholic Women's Colleges in America.

    ERIC Educational Resources Information Center

    Schier, Tracy, Ed.; Russett, Cynthia, Ed.

    The chapters in this collection provide a comprehensive history of Catholic women's colleges in the United States and how they have met the challenges of broader educational change. The chapters are: (1) "Faith, Knowledge, and Gender" (Jill Ker Conway); (2) "Colleges of Religious Women's Congregations: The Spiritual Heritage" (Monika K. Hellwig);…

  16. The Road from Coorain.

    ERIC Educational Resources Information Center

    Conway, Jill Ker

    This autobiography is concerned with the early years and young womanhood of Jill Ker Conway, the first female president of Smith College and a noted historian specializing in the experience of women in America. The book tells the story of Conway's journey from a girlhood on an isolated sheep farm in the Australian grasslands where she studied by…

  17. Discriminating Nonpareil marketing group almond cultivars through multivariate analyses

    USDA-ARS?s Scientific Manuscript database

    The California almond industry produces over 80% of the world’s almonds with nearly 2 billion pounds harvested in 2011. Several dozen cultivars are grown, but the Nonpareil cultivar is dominant in both acreage and tonnage. Almond cultivars are categorized into defined marketing groups based on ker...

  18. A New Species of Hymenocallis (Amaryllidaceae) in the Florida Panhandle

    USGS Publications Warehouse

    Smith, Gerald L.; Darst, Melanie R.

    1994-01-01

    A new species of spider-lily, Hymenocallis godfreyi, is described and illustrated. It is a rare endemic that occurs in the St. Marks and Wakulla Rivers, Florida. Its striking features are contrasted to an allied species Hymenocallis rotata (Ker-Gawler) Herbert.

  19. Adverse Outcome Pathway (AOP) for a Mutagenic Mode of Action for Cancer: AFB1 and Hepatocellular Carcinoma (HCC)

    EPA Science Inventory

    AOPs provide a framework to describe a sequence of measureable key events (KEs), beginning with a molecular initiating event (MIE), followed by a series of identified KEs linked to one another by KE Relationships (KERs), all anchored by a specific adverse outcome (AO). Each KE/KE...

  20. Submillisecond Optical Knife-Edge Testing

    NASA Technical Reports Server (NTRS)

    Thurlow, P.

    1983-01-01

    Fast computer-controlled sampling of optical knife-edge response (KER) signal increases accuracy of optical system aberration measurement. Submicrosecond-response detectors in optical focal plane convert optical signals to electrical signals converted to digital data, sampled and feed into computer for storage and subsequent analysis. Optical data are virtually free of effects of index-of-refraction gradients.

  1. Detection of fungal damaged popcorn using image property covariance features

    USDA-ARS?s Scientific Manuscript database

    Covariance-matrix-based features were applied to the detection of popcorn infected by a fungus that cause a symptom called “blue-eye.” This infection of popcorn kernels causes economic losses because of their poor appearance and the frequently disagreeable flavor of the popped kernels. Images of ker...

  2. Catholic Women's Colleges in America.

    ERIC Educational Resources Information Center

    Schier, Tracy, Ed.; Russett, Cynthia, Ed.

    The chapters in this collection provide a comprehensive history of Catholic women's colleges in the United States and how they have met the challenges of broader educational change. The chapters are: (1) "Faith, Knowledge, and Gender" (Jill Ker Conway); (2) "Colleges of Religious Women's Congregations: The Spiritual Heritage" (Monika K. Hellwig);…

  3. Secure Design Patterns

    DTIC Science & Technology

    2009-10-01

    www.devshed.com/c/a/PHP/Validating-User-Input-with-the-Strategy-Pattern/ [ Kernighan 1999] Kernighan , Brian W. & Pike, Rob. The Practice of...Postfix mail system designs • relevant recommendations from Kernighan and Pike’s The Practice of Programming [Ker- nighan 1999] • well-known basic design

  4. EASY-SIM: A Visual Simulation System Software Architecture with an ADA 9X Application Framework

    DTIC Science & Technology

    1994-12-01

    Association for Computing Machinery, Inc., November 1994. [Ker78] Brian W. Kernighan and Dennis M. Ritchie, The C Programming Language, Englewood Cliffs...Ph1.,-.ps Laboratory, Fall 1994. (Sol93] Brian B. Soltz, Graphical Tools for Situational Awareness Assistance for Large Synthetic Battle Fields, MS

  5. PSynUTC - Evaluation of a High-Precision Time Synchronization Prototype System for Ethernet LANs

    DTIC Science & Technology

    2002-12-01

    now been taken over by our spin-off company Oregano Systems (http://www.oregano.at). Roland Höller, Nikolaus Kerö Department of Computer Technology... Oregano Systems, will demonstrate the feasibility of GPS time distribution and time synchronization in Ethernet- based LANs with a worst-case

  6. Observation of fast and slow interatomic Coulombic decay in argon dimers induced by electron-impact ionization

    NASA Astrophysics Data System (ADS)

    Ren, Xueguang; Miteva, Tsveta; Kolorenč, Přemysl; Gokhberg, Kirill; Kuleff, Alexander I.; Cederbaum, Lorenz S.; Dorn, Alexander

    2017-09-01

    We investigate the interatomic Coulombic decay (ICD) in argon dimers induced by electron-impact ionization (E0=90 eV ) using a multiparticle coincidence experiment in which the momentum vectors and, consequently, the kinetic energies for electrons and fragment ions are determined. The signature of the ICD process is obtained from a correlation map between ejected electron energy and kinetic energy release (KER) for Ar++Ar+ fragment ions where low-energy ICD electrons can be identified. Furthermore, two types of ICD processes, termed fast and slow interatomic decay, are separated by the ICD initial-state energies and projectile energy losses. The dependence of the energies of emitted low-energy ICD electrons on the initial-state energy is studied. ICD electron energy spectra and KER spectra are obtained separately for fast and slow decay processes where the KER spectra for the slow decay channel are strongly influenced by nuclear motion. The KER and ICD electron energy spectra are well reproduced by ab initio calculations.

  7. "The Road from Coorain": A Journey of Power.

    ERIC Educational Resources Information Center

    Madsen, Sandra

    "The Road from Coorain" is the autobiographical story of Jill Ker Conway, the first woman president of Smith College. The story traces Conway's journey from powerlessness to power. Born in the outback of Australia, where all people were powerless in the face of the vacillations of nature, forced off the land into a city life to which she…

  8. Erbium: YAG Laser Incision of Urethral Strictures for Treatment of Urinary Incontinence After Prostate Cancer Surgery

    DTIC Science & Technology

    2005-02-01

    laser trephination 22. Nubling RK, Harrington JA (1998). Single-crystal laser-heated with convergent and divergent cut angles for penetrating ker...laser YAG laser trephination for penetrating keratoplasty. Arch beam propagation. Opt Commun 220:151-160 Ophthalmol 121:1415-1422 24. Papagiakoumou El

  9. Ionization and dissociation of CH3I in intense laser field

    NASA Astrophysics Data System (ADS)

    Liu, Hongtao; Yang, Zheng; Gao, Zhen; Tang, Zichao

    2007-01-01

    The ionization-dissociation of methyl iodide in intense laser field has been studied using a reflection time-of-flight mass spectrometry (RTOF-MS), at a laser intensity of ⩽6.6×1014W/cm2, λ =798nm, and a pulse width of 180fs. With the high resolution of RTOF-MS, the fragment ions with the same M /z but from different dissociation channels are resolved in the mass spectra, and the kinetic energy releases (KERs) of the fragment ions such as Iq + (q=1-6), CHm+ (m =0-3), C2+, and C3+ are measured. It is found that the KERs of the fragment ions are independent of the laser intensity. The fragments CH3+ and I + with very low KERs (<1eV for CH3+ and <0.07eV for I +) are assigned to be produced by the multiphoton dissociation of CH3I +. For the fragments CH3+ and I + from CH3I2+, they are produced by the Coulomb explosion of CH3I2+ with the interaction from the covalent force of the remaining valence electrons. The split of the KER of the fragments produced from CH3I2+ dissociation is observed experimentally and explained with the energy split of I +(P23) and I+(P0,13). The dissociation CH3I3+→CH3++I2+ is caused by Coulomb explosion. The valid charge distance Rc between I2+ and CH3+, at which enhanced ionization of methyl iodide occurs, is obtained to be 3.7Å by the measurements of the KERs of the fragments CH3+ and I2+. For the CH3In + (n⩾3), the KERs of the fragment ions CH3p + and Iq + are attributed to the Coulomb repulsion between CH3p + and Iq + from Rc≈3.7Å. The dissociation of the fragment CH3+ is also discussed. By the enhanced ionization mechanism and using the measured KER of Iq +, all the possible Coulomb explosion channels are identified. By comparing the abundance of fragment ions in mass spectrum, it is found that the asymmetric dissociation channels with more charges on iodine, q >p, are the dominant channels.

  10. Sphingomonas frigidaeris sp. nov., isolated from an air conditioning system.

    PubMed

    Lee, Yunho; Jeon, Che Ok

    2017-09-08

    A strictly aerobic Gram-stain-negative bacterium, designated strain KER25-10T, was isolated from a laboratory air conditioning system in South Korea. Cells were yellow-pigmented, non-motile rods showing catalase- and oxidase-positive reactions. The strain grew at pH 4.0-9.0 (optimum, pH 6.0-7.0) and 10-40 °C (optimum, 30 °C) and in the presence of 0-3 % (w/v) NaCl (optimum, 0 %). The G+C content of the genomic DNA was 65.1 mol%. Strain KER25-10T contained ubiquinone-10 (Q-10) as the predominant isoprenoid quinone and C16 : 0, C17 : 1ω6c, summed feature 3 (comprising C16 : 1ω7c and/or C16 : 1ω6c) and summed feature 8 (comprising C18 : 1ω7c and/or C18 : 1ω6c) as the major fatty acids. The major polar lipids were sphingoglycolipid, diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine and phosphatidylcholine. Only spermidine was detected as the polyamine. Phylogenetic analysis based on 16S rRNA sequences indicated that strain KER25-10T formed a distinct phylogenetic lineage within the genus Sphingomonas of the family Sphingomonadaceae and the strain was most closely related to Sphingomonas kyeonggiense THG-DT81T with a 96.8 % 16S rRNA gene sequence similarity. On the basis of phenotypic, chemotaxonomic and molecular features, strain KER25-10T clearly represents a novel species of the genus Sphingomonas, for which the name Sphingomonas frigidaeris sp. nov. is proposed. The type strain is KER25-10T (=KACC 19285T=JCM 32053T).

  11. Birthday party

    NASA Image and Video Library

    2015-04-26

    ISS043E142528 (04/26/2015) ---From the International Space Station NASA astronaut Terry Virts (right) tweeted this image of he and his crewmate Russian cosmonaut Anton Shkaplerov celebrating the birthday of ESA (European Space Agency) astronaut Samantha Cristoforetti (middle). His tweet commented: "Happy Birthday @AstroSamantha! We had a great time celebrating as a crew."

  12. Adaptive Identification by Systolic Arrays.

    DTIC Science & Technology

    1987-12-01

    BIBLIOGRIAPHY Anton , Howard , Elementary Linear Algebra , John Wiley & Sons, 19S4. Cristi, Roberto, A Parallel Structure Jor Adaptive Pole Placement...10 11. SYSTEM IDENTIFICATION M*YETHODS ....................... 12 A. LINEAR SYSTEM MODELING ......................... 12 B. SOLUTION OF SYSTEMS OF... LINEAR EQUATIONS ......... 13 C. QR DECOMPOSITION ................................ 14 D. RECURSIVE LEAST SQUARES ......................... 16 E. BLOCK

  13. ISS Expedition 42 Crew Profile, Version 2

    NASA Image and Video Library

    2014-11-26

    Narrated production with biographical information about ISS Expedition 42 crewmembers Barry "Butch" Wilmore, Alexander Samokutyaev, Elena Serova, Terry Virts, Anton Shkaplerov and Samantha Cristoforetti. The program covers the crewmember's career including childhood photographs, previous space missions and interview sound bites with the crewmembers.

  14. Ice cream

    NASA Image and Video Library

    2015-04-20

    ISS043E125774 (04/20/2015) --- NASA astronaut Scott Kelly gives the "high sign" on the quality of his snack while taking a break from his work schedule aboard the International Space Station on Apr. 20, 2015. Russian cosmonaut Anton Shkaplerov (ROSCOSMOS) seems to agree on the tasty factor of the specially prepared space food.

  15. State of the Modern Information Professional, 1992-1993. An International View of the State of the Information Professional and the Information Profession in 1992-1993. FID Occasional Paper 4.

    ERIC Educational Resources Information Center

    International Federation for Information and Documentation, The Hague (Netherlands).

    The following 14 papers are provided: (1) "Perfil del profesional de la informacion en Venezuela" with a synopsis in English: "Profile of the Information Professional in Venezuela" (A. D. Anton and M. S. de Arenas); (2) "The Modern Information Professional in the Caribbean Setting" (D. Douglas); (3) "Development…

  16. Robotics Competitions and Science Classrooms

    ERIC Educational Resources Information Center

    Benke, Gertraud

    2012-01-01

    This paper looks at the distinctions between science classrooms and the robotics competition described in the article "Examining the mediation of power in a collaborative community: engaging in informal science as authentic practice" written by Anton Puvirajah, Geeta Verma and Horace Webb. Using the framework of "productive disciplinary…

  17. Movements and Spatial Use of Satellite-Tagged Odontocetes in the Western Main Hawaiian Islands: Results of Field Work Undertaken off O’ahu in October 2010 and Kaua’i in February 2011

    DTIC Science & Technology

    2011-09-01

    Off O‘ahu we thank Bud Antonelis, Brenda Asuncion, Chuck Babbitt, Chris Boggs, Colleen Bryan, Vicki Davis, Pete Donaldson, Melissa Evans, Scott...Postgraduate School Monterey, CA Chris Miller Naval Postgraduate School Monterey, CA John Joseph Naval Postgraduate School Monterey, CA... Eckman Office of Naval Research Arlington, VA Ari Friedlaender Duke University Beaufort, NC CAPT Robin Brake U.S. Navy Washington

  18. The Quality of Gymnasium Education in the Banal Croatia in the Era of Neoabsolutism (1854-1860)

    ERIC Educational Resources Information Center

    Bošnjak, Arijana Kolak

    2015-01-01

    The goal of this paper is to present an attempt to increase the quality of education in the Banal Croatia by analysing the reports sent to the Ministry of Religion and Education in Vienna by secondary school supervisor for the Banal Croatia Anton Jarc as well as the existing scholarly literature. The mentioned attempt was based on a reform of the…

  19. Shkaplerov trims Burbank's hair in the Node 3

    NASA Image and Video Library

    2011-12-18

    ISS030-E-012655 (18 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, trims the hair of NASA astronaut Dan Burbank, commander, in the Tranquility node of the International Space Station. Shkaplerov used hair clippers fashioned with a vacuum device to garner freshly cut hair.

  20. Burbank trims Shkaplero's hair in the Node 3

    NASA Image and Video Library

    2011-12-18

    ISS030-E-012660 (18 Dec. 2011) --- NASA astronaut Dan Burbank, Expedition 30 commander, trims the hair of Russian cosmonaut Anton Shkaplerov, flight engineer, in the Tranquility node of the International Space Station. Burbank used hair clippers fashioned with a vacuum device to garner freshly cut hair.

  1. Burbank trims Shkaplerov's hair in the Node 3

    NASA Image and Video Library

    2012-03-18

    ISS030-E-161707 (18 March 2012) --- NASA astronaut Dan Burbank, Expedition 30 commander, trims the hair of Russian cosmonaut Anton Shkaplerov, flight engineer, in the Tranquility node of the International Space Station. Burbank used hair clippers fashioned with a vacuum device to garner freshly cut hair.

  2. Shkaplerov conducts an active session for the Russian Experiment KPT-10 Kulonvkiy Kristill

    NASA Image and Video Library

    2011-12-14

    ISS030-E-010546 (14 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, conducts an active session for the Russian experiment KPT-10 ?Kulonovskiy Kristall? (Coulomb Crystal) in the Poisk Mini-Research Module 2 (MRM2) of the International Space Station.

  3. Shkaplerov conducts an active session for the Russian Experiment KPT-10 Kulonvkiy Kristill

    NASA Image and Video Library

    2011-12-14

    ISS030-E-010540 (14 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, conducts an active session for the Russian experiment KPT-10 ?Kulonovskiy Kristall? (Coulomb Crystal) in the Poisk Mini-Research Module 2 (MRM2) of the International Space Station.

  4. Shkaplerov conducts an active session for the Russian Experiment KPT-10 Kulonvkiy Kristill

    NASA Image and Video Library

    2011-12-14

    ISS030-E-010539 (14 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, conducts an active session for the Russian experiment KPT-10 “Kulonovskiy Kristall” (Coulomb Crystal) in the Poisk Mini-Research Module 2 (MRM2) of the International Space Station.

  5. Shkaplerov conducts an active session for the Russian Experiment KPT-10 Kulonvkiy Kristill

    NASA Image and Video Library

    2011-12-14

    ISS030-E-010536 (14 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, conducts an active session for the Russian experiment KPT-10 “Kulonovskiy Kristall” (Coulomb Crystal) in the Poisk Mini-Research Module 2 (MRM2) of the International Space Station.

  6. Shkaplerov conducts an active session for the Russian Experiment KPT-10 Kulonvkiy Kristill

    NASA Image and Video Library

    2011-12-14

    ISS030-E-010538 (14 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, conducts an active session for the Russian experiment KPT-10 ?Kulonovskiy Kristall? (Coulomb Crystal) in the Poisk Mini-Research Module 2 (MRM2) of the International Space Station.

  7. Remembering Johann Gregor Mendel: a human, a Catholic priest, an Augustinian monk, and abbot.

    PubMed

    Richter, Father Clemens

    2015-11-01

    Johann Mendel (Gregor was the name given to him only later by his Augustinian order, Fig. 1) was born on July 20, 1822 to an ethnic German family, Anton and Rosina Mendel (Fig. 2), in Heinzendorf in the Austrian Empire at the Moravian-Silesian border (now Hynčice, Czech Republic).

  8. Integrative Education: Teaching Psychology with the Use of Literature and Informational Technology

    ERIC Educational Resources Information Center

    Toom, Anna

    2013-01-01

    In this work, a new method of teaching psychology based on the union of scientific, artistic, and information-technological knowledge is presented. The author teaches Cognitive Development in Early Childhood analyzing Anton Chekhov's short story "Grisha" and uses both traditional and computerized instructional methodology. In the authors' two…

  9. JPRS Report, Soviet Union, Kommunist.

    DTIC Science & Technology

    2007-11-02

    cides in quantities and varieties which would fully satisfy population demand. The decree suggests to the councils of ministers of autonomous...excerpt from the memoirs of one of Anton Semenovich’s students: "We were required to display impeccable cour- tesy in addressing one another

  10. A Request for the Conference and Symposia Grant from COMP Division of American Chemical Society

    DTIC Science & Technology

    2015-03-02

    Elucidating electrode and solid electrolyte kinetics from first principles Anton Van der Ven 11:05 am 169 Quantum chemistry of lithium-ion battery cathodes Bo...CA Abstracts2View™: http://abstracts.acs.org/chem/248nm/program/divisionindex.php?act=pre... 3 of 5 8/26/2014 8:19 PM 11:10 am 420 DME decomposition

  11. York Papers in Linguistics 14.

    ERIC Educational Resources Information Center

    Harlow, S. J., Ed.; Warner, A. R., Ed.

    Papers on a variety of linguistic topics include six papers from a Festschrift and nine others, as follows: "Attitudes Towards English as a Possible Lingua Franca in Switzerland" (Urs Durmuller); "Functional Stability and Structural Levelling of Dialects: The Case of Maastricht" (Anton M. Hagen, Henk Munstermann); "On the…

  12. Effectiveness of Graduate Training in School Psychology: Perspectives of Graduate Practitioners

    ERIC Educational Resources Information Center

    Satchwell, Mary Susan

    2013-01-01

    While trends in graduate training in school psychology indicate a movement towards an increasing emphasis on consultation and decreasing emphasis on assessment (Anton-LaHart & Rosenfield, 2004), there remains a gap between training and practice for professional school psychologists (Harrison, et al., 2004). The present study provided an…

  13. jsc2011e203732

    NASA Image and Video Library

    2011-10-24

    At the Gagarin Cosmonaut Training Center in Star City, Russia, outside Moscow, Expedition 30 Commander Dan Burbank of NASA (left), Soyuz Commander Anton Shkaplerov (center), and Flight Engineer Anatoly Ivanishin listen to questions from reporters during their news conference October 24, 2011 as they prepare for their launch November 14 on the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Credit: NASA

  14. 17. 'BIRDSEYEVIEW, PRESIDIO OF MONTEREY, CAL., JAN. 1938.' No signature, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    17. 'BIRDSEYEVIEW, PRESIDIO OF MONTEREY, CAL., JAN. 1938.' No signature, photographer probably Anton C. Heidrick. This panoramic view looks west over Soldier Field from the upper floor or roof of the gymnasium. Original cool toned silver gelatin print measures 85.1 cm by 22.4 cm, flush mounted on mat board. - Presidio of Monterey, Soldier Field, Monterey, Monterey County, CA

  15. Teaching Translation and Interpreting in Slovakia: Is There Anything Other than Levý and Popovic?

    ERIC Educational Resources Information Center

    Biloveský, Vladimír; Djovcoš, Martin

    2016-01-01

    Institutional translation and interpreting training has a long lasting tradition in Slovakia mainly thanks to such significant translation scholars as Anton Popovic, František Miko, Ján Vilikovský and many others. However the situation has changed after the Velvet Revolution in 1989 and the education needed to start adapting to the new market…

  16. Classification of a second group of ordinary chondrites from Texas

    NASA Astrophysics Data System (ADS)

    Ehlmann, A. J.; Keil, K.

    1987-03-01

    Based on optical microscopy and electron microprobe analyses of mafic minerals, six previously undescribed or poorly known ordinary chondrites from Texas were classified into compositional groups, petrologic types, and shock facies. These meteorites are Junction, L5d; Anton, H5b; Venus, H4d; Dalhart, H5a; Rosebud, H5c; and Cranfills Gap, H6c.

  17. Classification of a second group of ordinary chondrites from Texas

    NASA Technical Reports Server (NTRS)

    Ehlmann, Arthur J.; Keil, Klaus

    1987-01-01

    Based on optical microscopy and electron microprobe analyses of mafic minerals, six previously undescribed or poorly known ordinary chondrites from Texas were classified into compositional groups, petrologic types, and shock facies. These meteorites are Junction, L5d; Anton, H5b; Venus, H4d; Dalhart, H5a; Rosebud, H5c; and Cranfills Gap, H6c.

  18. Expedition 29 Press Conference

    NASA Image and Video Library

    2011-11-12

    Expedition 29 Soyuz Commander Anton Shkaplerov answers a reporter’s question during a press conference held at the Cosmonaut Hotel in Baikonur, Kazakhstan on Saturday, Nov. 12, 2011. The mission is set to launch November 14 from the Baikonur Cosmodrome. Photo Credit: (NASA/Carla Cioffi)

  19. Expedition 29 State Commission

    NASA Image and Video Library

    2011-11-12

    Expedition 29 Soyuz Commander Anton Shkaplerov speaks during the State Commission meeting to approve the Soyuz launch of Expedition 29 to the International Space Station, Saturday, Nov. 12, 2011 at the Cosmonaut Hotel in Baikonur, Kazakhstan. The mission is set to launch November 14 from the Baikonur Cosmodrome. Photo Credit: (NASA/Carla Cioffi)

  20. Expedition 29 Press Conference

    NASA Image and Video Library

    2011-11-12

    Expedition 29 NASA Flight Engineer Dan Burbank answers a reporter’s question during a press conference held at the Cosmonaut Hotel in Baikonur, Kazakhstan on Saturday, Nov. 12, 2011. The launch of the Soyuz spacecraft with Expedition 29 NASA Flight Engineer Dan Burbank, Soyuz Commander Anton Shkaplerov and Flight Engineer Anatoly Ivanishin is scheduled for November 14. Photo Credit: (NASA/Carla Cioffi)

  1. Expedition 29 Press Conference

    NASA Image and Video Library

    2011-11-12

    Expedition 29 Russian Flight Engineer Anatoly Ivanishin answers a reporter’s question during a press conference held at the Cosmonaut Hotel in Baikonur, Kazakhstan on Saturday, Nov. 12, 2011. The launch of the Soyuz spacecraft with Ivanishin, Soyuz Commander Anton Shkaplerov and NASA Flight Engineer Dan Burbank is scheduled for November 14. Photo Credit: (NASA/Carla Cioffi)

  2. BTKh-35 MEMBRANA experiment

    NASA Image and Video Library

    2011-11-17

    ISS029-E-042539 (17 Nov. 2011) --- Russian cosmonaut Anton Shkaplerov is pictured onboard the International Space Station working with the biological BTKh-35 MEMBRANE experiment. Shkaplerov is one of three Expedition 29 crew members who recently joined three original Expedition 29 crew members aboard the orbiting complex. In a few days he will become a flight engineer on the Expedition 30 crew.

  3. Ivanishin participates in a CHeCS Medical Contingency Drill in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-16

    ISS030-E-012604 (16 Dec. 2011) --- Russian cosmonauts Anatoly Ivanishin (foreground) and Anton Shkaplerov, both Expedition 30 flight engineers, participate in a Crew Health Care System (CHeCS) medical contingency drill in the Destiny laboratory of the International Space Station. This drill gives crew members the opportunity to work as a team in resolving a simulated medical emergency onboard the space station.

  4. Shkaplerov participates in a CHeCS Medical Contingency Drill in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-16

    ISS030-E-012600 (16 Dec. 2011) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, participates in a Crew Health Care System (CHeCS) medical contingency drill in the Destiny laboratory of the International Space Station. This drill gives crew members the opportunity to work as a team in resolving a simulated medical emergency onboard the space station.

  5. A Teaching Tool for Linear Programming

    DTIC Science & Technology

    1993-07-01

    U I Bibliography U Anton, Howard. Elementary Linear Algebra . 5th ed. New York: John Wiley & Sons, 1973.I...Richard 0. Jr. Elementary Linear Algebra with Applications. 2nd ed. San Diego: Harcourt Brace Jovanovich, 1991.I I Hillier, Frederick S. Pnd Gerald

  6. Requirements for IV&V of NATO (North Atlantic Treaty Organization) Common Ada Programming Support Environment (APSE) Interface Set (CAIS) implementation

    DTIC Science & Technology

    1988-10-01

    kernel calls ( Pesch et al. 1985), In the original specification of the kernel calls, the syntax of each system function was formally defined. However, the...26-27 August 1985. Pesch . Ilerbvi-t. Schnupp, Perter, Schaller, Hans, and Spirk, Anton Paul, "Test Case Generation U.ing Prolog." in Proceedings of the

  7. Franklin, Lavoisier, and Mesmer: origin of the controlled clinical trial.

    PubMed

    Herr, Harry W

    2005-01-01

    In 1784, a Royal Commission headed by Benjamin Franklin and Antoine Lavoisier designed a series of ingenious experiments to debunk France's greatest medical rogue, Anton Mesmer, and his bizarre healing of illnesses based on his bogus theory of animal magnetism. Using intentional subject ignorance and sham interventions to investigate mesmerism, Franklin's commission provided a model for the controlled clinical trial.

  8. ISS Expedition 42 / 43 Soyuz Spacecraft and Crew Preparations for Launch

    NASA Image and Video Library

    2014-11-26

    NASA TV (NTV) video file of crewmembers Terry Virts, Anton Shkaplerov (Roskosmos) and Samantha Cristoforetti (ESA) during final fit check of the Soyuz TMA 15M spacedraft at the Integration Facility, Baikonurk, Kazakhstan. Includes footage of the crew climbing into the Soyuz spacecraft, interviews, visit to museum where the crew sign posters and a flag; flag raising ceremony; and visit to mating facility.

  9. The Democratic School and the Pedagogy of Janusz Korczak: A Model of Early Twentieth Century Reform in Modern Israel

    ERIC Educational Resources Information Center

    Engel, Liba H.

    2013-01-01

    This article explores the history and pedagogy of Janusz Korczak within the context of his contemporary early Twentieth-Century European Innovative Educators which include Maria Montessori, Homer Lane, A.S. Neill, and Anton Semyonovitch Makarenko. The pedagogies of the aforementioned are compared and contrasted within the literature.

  10. The Way of the Drum: When Earth Becomes Heart.

    ERIC Educational Resources Information Center

    Antone, Grafton; Turchetti, Lois Provost

    Two Native people describe their respective journeys to healing, journeys that involved the rediscovery of language and culture. In Part I, "Healing the Tears of Yesterday by the Drum Today: The Oneida Language Is a Healing Medicine" (Grafton Antone), the first narrator taught the Oneida language to adult students at a community center.…

  11. Effectiveness of Graduate Training in School Psychology: Perspectives of Graduate Practitioners

    ERIC Educational Resources Information Center

    Satchwell, Mary Susan

    2013-01-01

    While trends in graduate training in school psychology indicate a movement towards an increasing emphasis on consultation and decreasing emphasis on assessment (Anton-LaHart & Rosenfield, 2004), there remains a gap between training and practice for professional school psychologists (Harrison, et al., 2004). The present study provided an…

  12. The Democratic School and the Pedagogy of Janusz Korczak: A Model of Early Twentieth Century Reform in Modern Israel

    ERIC Educational Resources Information Center

    Engel, Liba H.

    2013-01-01

    This article explores the history and pedagogy of Janusz Korczak within the context of his contemporary early Twentieth-Century European Innovative Educators which include Maria Montessori, Homer Lane, A.S. Neill, and Anton Semyonovitch Makarenko. The pedagogies of the aforementioned are compared and contrasted within the literature.

  13. Burbank and Shkaplerov playing musical instruments

    NASA Image and Video Library

    2012-04-21

    ISS030-E-267651 (21 April 2012) --- NASA astronaut Dan Burbank, Expedition 30 commander, plays a guitar, while Russian cosmonaut Anton Shkaplerov, flight engineer, plays a musical keyboard during off-time in the Unity node of the International Space Station.

  14. Burbank and Shkaplerov with musical instruments

    NASA Image and Video Library

    2012-04-21

    ISS030-E-267652 (21 April 2012) --- NASA astronaut Dan Burbank (with guitar), Expedition 30 commander, and Russian cosmonaut Anton Shkaplerov, flight engineer, are pictured at a musical keyboard during off-time in the Unity node of the International Space Station.

  15. Burbank and Shkaplerov playing musical instruments

    NASA Image and Video Library

    2012-04-21

    ISS030-E-267658 (21 April 2012) --- NASA astronaut Dan Burbank, Expedition 30 commander, plays a guitar, while Russian cosmonaut Anton Shkaplerov, flight engineer, plays a musical keyboard during off-time in the Unity node of the International Space Station.

  16. A Communicative Analysis of Chekhovian Drama as Portrayed in "The Sea Gull."

    ERIC Educational Resources Information Center

    Hellweg, John D.; Hellweg, Susan A.

    The precision and poetic logic of the language used by Anton Chekhov in his plays, particularly "The Sea Gull," can be explored through an analysis of his use of dialogue, characterization, and imagery. Measuring the nature of a relationship, rather than providing a direct literal interchange, the dialogue is both social, when individual…

  17. Shkaplerov makes a selection from food container

    NASA Image and Video Library

    2012-02-03

    ISS030-E-117515 (3 Feb. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, makes a selection from a food storage container in the Zvezda Service Module of the International Space Station. NASA astronaut Dan Burbank, commander, is visible in the background.

  18. The Miami Linguistic Reading Program, 1965-1968. Report.

    ERIC Educational Resources Information Center

    Digneo, Ellen Hartnett, Ed.; Shaya, Tila, Ed.

    Information related to the implementation of the Miami Linguistic Reading Program for Spanish-speaking and American Indian children in 6 New Mexico school systems is presented. School systems utilizing and reporting on the program are: (1) the West Las Vegas School System; (2) Anton Chico Elementary School in Santa Rosa; (3) Pojoaque Valley…

  19. Shkaplerov works with EVA Hardware in the SM

    NASA Image and Video Library

    2012-02-03

    ISS030-E-061157 (3 Feb. 2012) --- Russian cosmonaut Anton Shkaplerov, Expedition 30 flight engineer, works with extravehicular activity (EVA) hardware in the Zvezda Service Module of the International Space Station in preparation for an EVA scheduled for Feb. 16, 2012.

  20. Renormalized second-order perturbation theory for the electron correlation energy: Concept, implementation, and benchmarks

    NASA Astrophysics Data System (ADS)

    Ren, Xinguo; Rinke, Patrick; Scuseria, Gustavo E.; Scheffler, Matthias

    2013-07-01

    We present a renormalized second-order perturbation theory (rPT2), based on a Kohn-Sham (KS) reference state, for the electron correlation energy that includes the random-phase approximation (RPA), second-order screened exchange (SOSEX), and renormalized single excitations (rSE). These three terms all involve a summation of certain types of diagrams to infinite order, and can be viewed as ``renormalization'' of the second-order direct, exchange, and single-excitation (SE) terms of Rayleigh-Schrödinger perturbation theory based on a KS reference. In this work, we establish the concept of rPT2 and present the numerical details of our SOSEX and rSE implementations. A preliminary version of rPT2, in which the renormalized SE (rSE) contribution was treated approximately, has already been benchmarked for molecular atomization energies and chemical reaction barrier heights and shows a well-balanced performance [J. Paier , New J. Phys.1367-263010.1088/1367-2630/14/4/043002 14, 043002 (2012)]. In this work, we present a refined version of rPT2, in which we evaluate the rSE series of diagrams rigorously. We then extend the benchmark studies to noncovalent interactions, including the rare-gas dimers, and the S22 and S66 test sets, as well as the cohesive energy of small copper clusters, and the equilibrium geometry of 10 diatomic molecules. Despite some remaining shortcomings, we conclude that rPT2 gives an overall satisfactory performance across different electronic situations, and is a promising step towards a generally applicable electronic-structure approach.

  1. Ultrafast Extreme Ultraviolet Induced Isomerization of Acetylene Cations

    SciTech Connect

    Jiang, Y.; Rudenko, Artem; Herrwerth, O.; Foucar, L.; Kurka, M.; Kuhnel, K.; Lezius, M.; Kling, Matthias; van Tilborg, Jeroen; Belkacem, Ali; Ueda, K.; Dusterer, S.; Treusch, R.; Schroter, Claus-Dieter; Moshammer, Robbert; Ullrich, Joachim

    2011-06-17

    Ultrafast isomerization of acetylene cations ([HC = CH]{sup +}) in the low-lying excited A{sup 2}{Sigma}{sub g}{sup +} state, populated by the absorption of extreme ultraviolet (XUV) photons (38 eV), has been observed at the Free Electron Laser in Hamburg, (FLASH). Recording coincident fragments C{sup +} + CH{sub 2}{sup +} as a function of time between XUV-pump and -probe pulses, generated by a split-mirror device, we find an isomerization time of 52 {+-} 15 fs in a kinetic energy release (KER) window of 5.8 < KER < 8 eV, providing clear evidence for the existence of a fast, nonradiative decay channel.

  2. Frequency-resolved optical gating technique for retrieving the amplitude of a vibrational wavepacket

    NASA Astrophysics Data System (ADS)

    Nabekawa, Yasuo; Furukawa, Yusuke; Okino, Tomoya; Amani Eilanlou, A.; Takahashi, Eiji J.; Yamanouchi, Kaoru; Midorikawa, Katsumi

    2015-06-01

    We propose a novel method to determine the complex amplitude of each eigenfunction composing a vibrational wavepacket of / molecular ions evolving with a ~10 fs time scale. We find that the two-dimensional spectrogram of the kinetic energy release (KER) of H+/D+ fragments plotted against the time delay of the probe pulse is equivalent to the spectrogram used in the frequency-resolved optical gating (FROG) technique to retrieve the complex amplitude of an ultrashort optical pulse. By adapting the FROG algorithm to the delay-KER spectrogram of the vibrational wavepacket, we have successfully reconstructed the complex amplitude. The deterioration in retrieval accuracy caused by the bandpass filter required to process actual experimental data is also discussed.

  3. Time-resolved x-ray spectroscopy for x-ray-induced phenomena

    NASA Astrophysics Data System (ADS)

    Picón, Antonio

    2017-05-01

    X-ray-pump/x-ray-probe spectroscopy allows investigation of ultrafast x-ray induced molecular dynamics. X-ray absorption and Auger decay leave molecules in manifolds of transient intermediate states in the femtosecond time scale. By using an x-ray probe pulse, we can image nuclear wavepackets as a function of time using ion-ion coincidence spectroscopy to record ion momentum distributions and kinetic energy releases (KERs). Numerical simulations, a timedependent approach that includes both K-shell photoionization and Auger decay, show how the transient intermediate states are projected onto the KERs. At short time delays, the measurements are sensitive to interatomic interactions, whereas at longer delays the contribution from separated ions due to dissociative intermediate states becomes observable. We present simulations for the nitrogen molecule. These simulations have the potential to be extended to more complex molecules.

  4. The ATLAS Fast Tracker and Tracking at the High-Luminosity LHC

    NASA Astrophysics Data System (ADS)

    Ilic, N.

    2017-02-01

    The increase in centre-of-mass energy and luminosity of the Large Hadron Collider makes controlling trigger rates with high efficiency challenging. The ATLAS Fast TracKer is a hardware processor built to reconstruct tracks at a rate of up to 100 kHz and provide them to the high level trigger. The tracker reconstructs tracks by matching incoming detector hits with pre-defined track patterns stored in associative memory on custom ASICs. Inner detector hits are fitted to these track patterns using modern FPGAs. This proceeding describe the electronics system used for the massive parallelization performed by the Fast TracKer. An overview of the installation, commissioning and running of the system is given. The ATLAS upgrades planned to enable tracking at the High-Luminosity Large Hadron Collider are also discussed.

  5. Ultrafast Extreme Ultraviolet Induced Isomerization of Acetylene Cations

    SciTech Connect

    Jiang, Y. H.; Kurka, M.; Kuehnel, K. U.; Schroeter, C. D.; Moshammer, R.; Rudenko, A.; Foucar, L.; Herrwerth, O.; Lezius, M.; Kling, M. F.; Tilborg, J. van; Belkacem, A.; Ueda, K.; Duesterer, S.; Treusch, R.; Ullrich, J.

    2010-12-31

    Ultrafast isomerization of acetylene cations ([HC=CH]{sup +}) in the low-lying excited A{sup 2}{Sigma}{sub g}{sup +} state, populated by the absorption of extreme ultraviolet (XUV) photons (38 eV), has been observed at the Free Electron Laser in Hamburg, (FLASH). Recording coincident fragments C{sup +}+CH{sub 2}{sup +} as a function of time between XUV-pump and -probe pulses, generated by a split-mirror device, we find an isomerization time of 52{+-}15 fs in a kinetic energy release (KER) window of 5.8<KER<8 eV, providing clear evidence for the existence of a fast, nonradiative decay channel.

  6. Dynamic modification of the fragmentation of CO{sup q+} excited states generated with high-order harmonics

    SciTech Connect

    Cao, W.; De, S.; Singh, K. P.; Chen, S.; Laurent, G.; Ray, D.; Ben-Itzhak, I.; Cocke, C. L.; Schoeffler, M. S.; Belkacem, A.; Osipov, T.; Rescigno, T.; Alnaser, A. S.; Bocharova, I. A.; Zherebtsov, S.; Kling, M. F.; Litvinyuk, I. V.

    2010-10-15

    The dynamic process of fragmentation of CO{sup q+} excited states is investigated using a pump-probe approach. EUV radiation (32-48 eV) generated by high-order harmonics was used to ionize and excite CO molecules and a time-delayed infrared (IR) pulse (800 nm) was used to influence the evolution of the dissociating multichannel wave packet. Two groups of states, separable experimentally by their kinetic-energy release (KER), are populated by the EUV and lead to C{sup +}-O{sup +} fragmentation: direct double ionization of the neutral molecule and fragmentation of the cation leading to C{sup +}-O*, followed by autoionization of O*. The IR pulse was found to modify the KER of the latter group in a delay-dependent way which is explained with a model calculation.

  7. Measurement of kinetic energy release in CO fragmentation by charge-changing collisions of fast heavy ions

    SciTech Connect

    Mizuno, T.; Yamada, T.; Tsuchida, H.; Itoh, A.; Nakai, Y.

    2010-01-15

    We study ionization and fragmentation of CO in electron loss and capture collisions of B{sup 2+}, O{sup 2+}, and Si{sup 2+} ions at an energy of 71.4 keV/u (v=1.69 a.u.). Coincidence measurements of fragment ions from CO and charge-selected ions were performed by means of a momentum three-dimensional imaging technique. Production cross sections of CO{sup r+} and branching ratios into various fragmentation channels were obtained for r=1-4. We also measured kinetic energy release (KER) in individual fragmentation channels. The KER spectra for r<=2 are found to be different for electron loss and capture collisions, while the difference becomes small for r>=3. As a measure of the degree of molecular fragmentation, the magnitude of the binding energy of the relevant electronic states seems the important parameter both in loss and capture collisions.

  8. Ship-borne measurements of microbial enzymatic activity: A rapid biochemical indicator for microbial water quality monitoring

    NASA Astrophysics Data System (ADS)

    Stadler, Philipp; Loken, Luke; Crawford, John; Schramm, Paul; Sorsa, Kirsti; Kuhn, Catherine; Savio, Domenico; Striegl, Rob; Butman, David; Stanley, Emily; Farnleitner, Andreas H.; Zessner, Matthias

    2017-04-01

    Contamination of aquatic ecosystems by human and animal wastes is a global concern for water quality. Disclosing fate and transport processes of fecal indicator organism (FIO) in large water bodies is a big challenge due to material intensive and time consuming methods used in microbiological water quality monitoring. In respect of utilization of large surface water resources there is a dearth of rapid microbiological methods that allow a near-real time health related water quality monitoring to be implemented into early warning systems. The detection of enzymatic activities has been proposed as a rapid surrogate for microbiological pollution monitoring of water and water resources (Cabral, 2010; Farnleitner et al., 2001, 2002). Methods such as the beta-D-Glucuronidase assay (GLUC), targeting FIO such as E. coli, were established. New automated enzymatic assays have been implemented during the last years into on-site monitoring stations, ranging from ground- to surface waters (Ryzinska-Paier et al., 2014; Stadler et al., 2017, 2016). While these automated enzymatic methods cannot completely replace assays for culture-based FIO enumeration, they yielded significant information on pollution events and temporal dynamics on a catchment specific basis, but were restricted to stationary measurements. For the first time we conducted ship-borne and automated measurements of enzymatic GLUC activity on large fresh water bodies, including the Columbia River, the Mississippi River and Lake Mendota. Not only are automated enzymatic assays technically feasible from a mobile vessel, but also can be used to localize point sources of potential microbial fecal contamination, such as tributaries or storm drainages. Spatial and temporal patterns of enzymatic activity were disclosed and the habitat specific correlation with microbiological standard assays for FIO determined due to reference samples. The integration of rapid and automated enzymatic assays into well-established systems

  9. Southeast Asia Report.

    DTIC Science & Technology

    2007-11-02

    furniture valued at US$1 billion to the US market annually. It has achieved this at the expense of timber producers like Malaysia . One way could be the...City Artisan Experts 38 Briefs Vientiane District Tax Collection ^ MALAYSIA Forestry Sector Posts Earnings of $4.2 Billion (Hardev Kaur; BUSINESS...such as palm oil and coconut oil. In 1985, for example, Malaysia alone exported 470,887 tonnes of palm oil and palm ker- nel oil to the EEC valued

  10. Identification of Strain-Softening Properties and Computational Predictions of Localized Fracture.

    DTIC Science & Technology

    1984-03-01

    OFFICE SYMBOL I de .4 a Code) LAWRENCE D. HOKANSON, Lt. Col. USAF (202) 767-4935 AFOSR/NA DO FORM 1473, 83 APR EDITION OF I JAN 73 IS OBSOLETE...crack band approach of Bazant and co-wor- kers [9] who interpreted the fictitious crack model of Hillerborg et al [10] within a crack band of finite...shear bands within linear bifurcation studies [13], [14]. In fact, Bazant offered some elementary strain-softening interpretation of concrete in

  11. ABCs of Operational Resilience

    DTIC Science & Technology

    2014-01-23

    Services Tactical InfoSec Services “Provides, operates, and assures command and control, information sharing capabilities, and a globally accessible...factories he highlighting the fragility and resilience of the aerospace giant’s global su it works to sharply increase production . The star slate...kers bakes The explosion at a German chemicals plant two weeks ago which kille By JEFF BE nd JA HROt1 KO two workers, has thrown the global car

  12. Laminin α5 in the keratinocyte basement membrane is required for epidermal-dermal intercommunication.

    PubMed

    Wegner, Jeannine; Loser, Karin; Apsite, Gunita; Nischt, Roswitha; Eckes, Beate; Krieg, Thomas; Werner, Sabine; Sorokin, Lydia

    2016-12-01

    Laminin α5 is broadly expressed in the epidermal basement membrane (BM) of mature mice and its elimination at this site (Lama5(Ker5) mouse) results in hyperproliferation of basal keratinocytes and a delay in hair follicle development, which correlated with upregulation of the dermally-derived laminin α2 and laminin α4 chains in the epidermal BM and of tenascin-C subjacent to the BM. In vitro studies revealed laminin 511 to be strongly adhesive for primary keratinocytes and that loss of laminin α5 does not result in cell autonomous defects in proliferation. Flow cytometry reveals that the loss of laminin α5 resulted in increased numbers of CD45(+), CD4(+) and CD11b(+) immune cells in the skin, which temporo-spatial analyses revealed were detectable only subsequent to the loss of laminin α5 and the appearance of the hyperproliferative keratinocyte phenotype. These findings indicate that immune cell changes are the consequence and not the cause of keratinocyte hyperproliferation. Loss of laminin α5 in the epidermal BM was also associated with changes in the expression of several dermally-derived growth factors involved in keratinocyte proliferation and hair follicle development in adult but not new born Lama5(Ker5) skin, including KGF, EGF and KGF-2. In situ binding of FGF-receptor-2α (IIIb)-Fc chimera (FGFR2IIIb) to mouse skin sections revealed decoration of several BMs, including the epidermal BM, which was absent in Lama5(Ker5) skin. This indicates reduced levels of FGFR2IIIb ligands, which include KGF and KGF-2, in the epidermal BM of adult Lama5(Ker5) skin. Our data suggest an initial inhibitory effect of laminin α5 on basal keratinocyte proliferation and migration, which is exacerbated by subsequent changes in growth factor expression by epidermal and dermal cells, implicating laminin α5 in epidermal-dermal intercommunication.

  13. Diagnostic utility of snail in metaplastic breast carcinoma

    PubMed Central

    2010-01-01

    Metaplastic breast carcinoma (MBC) is a rare subtype of breast cancer characterized by coexistence of carcinomatous and sarcomatous components. Snail is a nuclear transcription factor incriminated in the transition of epithelial to mesenchymal differentiation of breast cancer. Aberrant Snail expression results in lost expression of the cell adhesion molecule E-cadherin, an event associated with changes in epithelial architecture and invasive growth. We aimed to identify the utility of Snail, and of traditional immunohistochemical markers, in accurate MBC classification and to evaluate clinicopathologic characteristics and outcome. We retrospectively reviewed 34 MBC cases from January 1997 to September 2007. The control group contained 26 spindle cell lesions. Immunohistochemistry used Snail, p63, epidermal growth factor receptor (EGFR), OSCAR, and wide spectrum cytokeratin (WS-KER). Negative was a score less than 1%. We found that Snail and EGFR are sensitive (100%) markers with low specificity (3.8% and 19.2%) for detecting MBC. p63 and WS-KER are specific (100%), with moderate sensitivity (67.6% and 76.5%); OSCAR is sensitive (85.3%) and specific (92.3%). A combination of any 2 of the p63, OSCAR, and WS-KER markers increased sensitivity and specificity. MBCs tended to be high-grade (77%), triple negative (negative for estrogen receptor, progesterone receptor, and HER2) [27/33; 81.8%], and carcinomas with low incidence of axillary lymph node involvement (15%), and decreased disease-free [71% (95%CI: 54%, 94%) at 3 yrs.) and overall survival. A combination of p63, OSCAR and WS-KER are useful in its work-up. On the other hand, Snail is neither a diagnostic nor a prognostic marker for MBC. PMID:21110878

  14. Diagnostic utility of snail in metaplastic breast carcinoma.

    PubMed

    Nassar, Aziza; Sookhan, Nicole; Santisteban, Marta; Bryant, Sandra C; Boughey, Judy C; Giorgadze, Tamar; Degnim, Amy

    2010-11-26

    Metaplastic breast carcinoma (MBC) is a rare subtype of breast cancer characterized by coexistence of carcinomatous and sarcomatous components. Snail is a nuclear transcription factor incriminated in the transition of epithelial to mesenchymal differentiation of breast cancer. Aberrant Snail expression results in lost expression of the cell adhesion molecule E-cadherin, an event associated with changes in epithelial architecture and invasive growth. We aimed to identify the utility of Snail, and of traditional immunohistochemical markers, in accurate MBC classification and to evaluate clinicopathologic characteristics and outcome.We retrospectively reviewed 34 MBC cases from January 1997 to September 2007. The control group contained 26 spindle cell lesions. Immunohistochemistry used Snail, p63, epidermal growth factor receptor (EGFR), OSCAR, and wide spectrum cytokeratin (WS-KER). Negative was a score less than 1%. We found that Snail and EGFR are sensitive (100%) markers with low specificity (3.8% and 19.2%) for detecting MBC. p63 and WS-KER are specific (100%), with moderate sensitivity (67.6% and 76.5%); OSCAR is sensitive (85.3%) and specific (92.3%). A combination of any 2 of the p63, OSCAR, and WS-KER markers increased sensitivity and specificity. MBCs tended to be high-grade (77%), triple negative (negative for estrogen receptor, progesterone receptor, and HER2) [27/33; 81.8%], and carcinomas with low incidence of axillary lymph node involvement (15%), and decreased disease-free [71% (95%CI: 54%, 94%) at 3 yrs.) and overall survival. A combination of p63, OSCAR and WS-KER are useful in its work-up. On the other hand, Snail is neither a diagnostic nor a prognostic marker for MBC.

  15. Research in Computer Simulation of Integrated Circuits.

    DTIC Science & Technology

    1983-07-31

    bwadeid a -’. ate dew’.d or "mom 1640e 4 4 4 4.5 he ham ala ker 27601 519 6145 2549 "and 3.2 1.5 2.2 34 4230 TAME 4 A,4er Stsmao m CLAS From the show...from SPICEV it is expected that the speedup is Larger for t.(As) 4 4 4 4 6 the adder circuits compared to the filters. A first observe- iter 352 27601

  16. Laser-induced dissociative ionization of H2 from the near-infrared to the mid-infrared regime

    NASA Astrophysics Data System (ADS)

    Jing, Qingli; Madsen, Lars Bojer

    2016-12-01

    We apply the Monte Carlo wave packet (MCWP) approach to investigate the kinetic energy release (KER) spectra of the protons following double ionization in H2 when interacting with laser pulses with central wavelengths ranging from the near-infrared (IR) (800 nm) to the mid-IR (6400 nm) regions and with durations of 3-21 laser cycles. We uncover the physical origins of the peaks in the nuclear KER spectra and ascribe them to mechanisms such as ionization following a resonant dipole transition, charge-resonance-enhanced ionization, and ionization in the dissociative limit of large internuclear distances. For relatively large pulse durations, i.e., for 15 or more laser cycles at 3200 nm and 10 or more at 6400 nm, it is possible for the nuclear wave packet in H2+ to reach very large separations. Ionization of this part of the wave packet results in peaks in the KER spectra with very low energies. These peaks give direct information about the dissociative energy in the 2 p σu potential energy curve of H2+ at the one- and three-photon resonances between the 2 p σu and 1 s σg curves in H2+ . With the MCWP approach, we perform a trajectory analysis of the contributions to the KER peaks and identify the dominant ionization pathways. Finally, we consider a pump-probe scheme by applying two delayed pulses to track the nuclear dynamics in a time-resolved setting. Low-energy peaks appear for large delays and these are used to obtain the 2 p σu dissociative energy values at the one-photon resonance between the 2 p σu and 1 s σg curves in H2+ for different wavelengths.

  17. UNIVERS Product. Phase 1.

    DTIC Science & Technology

    1987-04-27

    g omier cd Time Figure 5-3. One Language Using the new constructs, the Ada users may declare...34.. • -. . -,.,’ -’ "’, " ’..........................................-, ..........-.." ".."...............,;.-’,.*. ,’J,,,.,. g ,.. ’ 4r a kx; , , ,, - 4 . . - . - - -. ,.. ’ " - -i- .a...1975. Ker78 Kernighan, Brian W. and Ritchie, Dennis M., The C Programming Language, Prentice-Hall, Englewood Cliffs, NJ, 1978. Les75 Lesk, M. E.,

  18. Phenylpropanoid derivatives from edible canna, Canna edulis.

    PubMed

    Yun, Young Sook; Satake, Motoyoshi; Katsuki, Shigeki; Kunugi, Akira

    2004-07-01

    Two phenylpropanoid sucrose esters were isolated from dry rhizomes of Canna edulis Ker Gawl., along with a known phenylpropanoid sucrose ester and four known phenylpropanoids. On the basis of analysis of spectroscopic data and chemical evidence, these two phenylpropanoid sucrose esters were shown to be 3-O-p-coumaroyl-6-O-feruloyl-beta-D-fructofuranosyl 6-O-acetyl-alpha-D-glucopyranoside and 3,6-di-O-p-coumaroyl-beta-D-fructofuranosyl 6-O-acetyl-alpha-D-glucopyranoside.

  19. Differential Expression of Inward and Outward Potassium Currents in the Macrophage-like Cell Line J774.1

    DTIC Science & Technology

    1985-04-02

    pantophobic mutants. These sub-lines are deficient in specific + K conductances and show exaggerated responses to stimulation (Saimi, Hinrichsen, Forte...Activator Lysosyme Adenosine Oeaminase 8-Glucuronidase CSF (Interleukin 2) Aryl sulfatase Chemotaxis C5a Respiratory Burst H202 Superoxide...after mutagenesis are deficient in a calmodulin binding protein present in TFP-sensitive J774 cells (Spea ker, Orlow, Sturgill & Rosen, 1983

  20. Adverse Outcome Pathway (AOP) for a Mutagenic Mode of ...

    EPA Pesticide Factsheets

    AOPs provide a framework to describe a sequence of measureable key events (KEs), beginning with a molecular initiating event (MIE), followed by a series of identified KEs linked to one another by KE Relationships (KERs), all anchored by a specific adverse outcome (AO). Each KE/KER is supported by data and evaluated against criteria to assess biological plausibility, weight/strength of evidence, specificity, and confidence. AOPs offer an approach to using toxicological data and predictive modeling to actualize use of mode-of-action (MOA) for such purposes as read-across, integrated approaches to testing & assessment, and risk assessment. Different applications will depend partly on the scientific confidence underpinning each KE/KER and the overall AOP. An OECD program encourages development of AOPs, with a wiki that allows for public review & comment to foster collaborations and broaden understanding & application of AOPs. Developing an AOP for a mutagenic MOA for cancer as a case study in the OECD program lays a path towards determination of such an MOA and its use in chemical assessment programs. Aflatoxin B1 (AFB1), with ubiquitous exposure and a rich database, was selected for this case study. AFB1 has been determined to induce HCC via a DNA-reactive MOA in many species, including humans. The sequential KEs identified for AFB1 are as follows: pre-MIE: Hepatic metabolic activation; MIE: Formation of a pro-mutagenic DNA adduct (N7-AFB1-guanine or AFB1-FAPy); KE

  1. Imaging the radical channel in acetaldehyde photodissociation: Competing mechanisms at energies close to the triplet exit barrier

    SciTech Connect

    Amaral, G. A.; Arregui, A.; Rodriguez, J. D.; Banares, L.; Rubio-Lago, L.

    2010-08-14

    The photodissociation of acetaldehyde in the radical channel has been studied at wavelengths between 315 and 325 nm using the velocity-map imaging technique. Upon one-photon absorption at 315 nm, the molecule is excited to the first singlet excited state S{sub 1}, which, in turn, undergoes intersystem crossing to the first excited triplet state T{sub 1}. On the triplet surface, the molecule dissociates into CH{sub 3} and HCO radicals with large kinetic energy release (KER), in accordance with the well characterized exit barrier on T{sub 1}. However, at longer wavelengths (>320 nm), which correspond to excitation energies just below the triplet barrier, a sudden change in KER is observed. At these photolysis wavelengths, there is not enough energy to surpass the exit barrier on the triplet state, which leaves the possibility of unimolecular dissociation on S{sub 0} after internal conversion from S{sub 1}. We have characterized the fragments' KER at these wavelengths, as well as determined the energy partitioning for the radical fragments. A new accurate estimate of the barrier height on T{sub 1} is presented.

  2. Double-ionization mechanisms of the argon dimer in intense laser fields

    SciTech Connect

    Ulrich, B.; Vredenborg, A.; Malakzadeh, A.; Meckel, M.; Cole, K.; Jahnke, T.; Doerner, R.; Smolarski, M.; Chang, Z.

    2010-07-15

    We have measured the two-site double ionization of argon dimers by ultrashort laser pulses leading to fragmentation into two singly charged argon ions. Contrary to the expectations from a pure Coulomb explosion following rapid removal of one electron from each of the atoms, we find three distinct peaks in the kinetic energy release (KER) distribution. By measuring the angular distribution of the fragment ions and the vector momentum of one of the emitted electrons for circular and linear laser polarization, we are able to unravel the ionization mechanisms leading to the three features in the KER. The most abundant one results from tunnel ionization at one site followed by charge-enhanced tunnel ionization of the second atom. The second mechanism, which leads to a higher KER we identify as sequential tunnel ionization of both atoms accompanied by excitation. The third mechanism is present with linearly polarized light only. It is most likely a frustrated triple ionization, where the third electron does not escape but is trapped in a Rydberg state.

  3. Construction of a Rapid Feather-Degrading Bacterium by Overexpression of a Highly Efficient Alkaline Keratinase in Its Parent Strain Bacillus amyloliquefaciens K11.

    PubMed

    Yang, Lian; Wang, Hui; Lv, Yi; Bai, Yingguo; Luo, Huiying; Shi, Pengjun; Huang, Huoqing; Yao, Bin

    2016-01-13

    Keratinase is essential to degrade the main feather component, keratin, and is of importance for wide industrial applications. In this study, Bacillus amyloliquefaciens strain K11 was found to have significant feather-degrading capacity (completely degraded whole feathers within 24 h). The keratinase encoding gene, kerK, was expressed in Bacillus subtilis SCK6. The purified recombinant KerK showed optimal activity at 50 °C and pH 11.0 and degraded whole feathers within 0.5 h in the presence of DTT. The recombinant plasmids harboring kerK were extracted from B. subtilis SCK6 and transformed into B. amyloliquefaciens K11. As a result, the recombinant B. amyloliquefaciens K11 exhibited enhanced feather-degrading capacity with shortened reaction time within 12 h and increased keratinolytic activity (1500 U/mL) by 6-fold. This efficient and rapid feather-degrading character makes the recombinant strain of B. amyloliquefaciens K11 have potential for applications in feather meal preparation and waste feather disposal.

  4. Role of a Neighbor Ion in the Fragmentation Dynamics of Covalent Molecules

    NASA Astrophysics Data System (ADS)

    Méry, A.; Agnihotri, A. N.; Douady, J.; Fléchard, X.; Gervais, B.; Guillous, S.; Iskandar, W.; Jacquet, E.; Matsumoto, J.; Rangama, J.; Ropars, F.; Safvan, C. P.; Shiromaru, H.; Zanuttini, D.; Cassimi, A.

    2017-06-01

    Fragmentation of molecular nitrogen dimers (N2)2 induced by collision with low energy 90 keV Ar9 + ions is studied to evidence the influence of a molecular environment on the fragmentation dynamics of N2 cations. Following the capture of three or four electrons from the dimer, the three-body N2++Nm ++Nn + [with (m ,n )=(1 ,1 ) or (1, 2)] fragmentation channels provide clean experimental cases where molecular fragmentation may occur in the presence of a neighbor molecular cation. The effect of the environment on the fragmentation dynamics within the dimer is investigated through the comparison of the kinetic energy release (KER) spectra for these three-body channels and for isolated N2(m +n )+ monomer cations. The corresponding KER spectra exhibit energy shifts of the order of 10 eV, attributed to the deformation of the Nm ++Nn + potential energy curves in the presence of the neighboring N2+ cation. The KER structures remain unchanged, indicating that the primary collision process is not significantly affected by the presence of a neighbor molecule.

  5. Biodegradation of feather wastes and the purification and characterization of a concomitant keratinase from Paecilomyces lilacinus.

    PubMed

    Wang, Q Y; Liao, M D

    2014-01-01

    Paecilomyces lilacinus strain PL-HN-16 was found to have the ability to degrade feathers. During the degradation process, the broth initially turned as sticky as gelatin and then turned into fluid that means the feathers can be hydrolyzed completely. Keratinolytic protein (Ker) of aforementioned strain was purified using ammonium sulphate precipitation, HiTrap Butyl FF chromatography and Sephacryl S-200 gel filtration. The Ker of P. lilacinus PL-HN-16 had molecular mass of 33 kDa, the optimum pH 8.0 and temperature optimum at 40 degrees C. It used the soluble keratin as substrate. The enzyme showed high activity and stability over a wide range of pH (6.0 to 10.0) and temperature (300C to 600C) values but was completely inhibited by PMSF. Ker of P. lilacinus PL-HN-16 exhibited stability toward SDS. These promising properties make the enzyme a potential candidate for future applications in biotechnological processes as keratin hydrolysis and dehairing during leather processing.

  6. Angular and energy distribution of fragment ions in dissociative double photoionization of acetylene molecules at 39 eV

    SciTech Connect

    Alagia, M.; Callegari, C.; Richter, R.; Candori, P.; Falcinelli, S.; Vecchiocattivi, F.; Pirani, F.; Stranges, S.

    2012-05-28

    The two-body dissociation reactions of the dication, C{sub 2}H{sub 2}{sup 2+}, produced by 39.0 eV double photoionization of acetylene molecules, have been studied by coupling photoelectron-photoion-photoion coincidence and ion imaging techniques. The results provide the kinetic energy and angular distributions of product ions. The analysis of the results indicates that the dissociation leading to C{sub 2}H{sup +}+H{sup +} products occurs through a metastable dication with a lifetime of 108 {+-} 22 ns, and a kinetic energy release (KER) distribution exhibiting a maximum at {approx}4.3 eV with a full width at half maximum (FWHM) of about 60%. The reaction leading to CH{sub 2}{sup +}+C{sup +} occurs in a time shorter than the typical rotational period of the acetylene molecules (of the order of 10{sup -12} s). The KER distribution of product ions for this reaction, exhibits a maximum at {approx}4.5 eV with a FWHM of about 28%. The symmetric dissociation, leading to CH{sup +} + CH{sup +}, exhibits a KER distribution with a maximum at {approx}5.2 eV with a FWHM of 44%. For the first two reactions the angular distributions of ion products also indicate that the double photoionization of acetylene occurs when the neutral molecule is mainly oriented perpendicularly to the light polarization vector.

  7. [Screening of collagenase and keratinase producers].

    PubMed

    Ivanko, O V; Varbanets', L D; Valahurova, O V; Nahorna, S S; Redchyts', T I; Zhdanova, N M

    2002-01-01

    The study of the capacity of 310 strains of microorganisms from different taxonomic groups (40 bacilli, 43 yeast, 105 streptomycetes, 12 micromycetes) to hydrolyze collagen and keratin allowed to establish that the highest level of collagenase (KA) and keratinase (KerA) activity is inherent in representatives of streptomycetes. Two strains of Streptomyces sp.--1349 and 1382 with the highest KA and KerA indices--1.9 and 1.85 un./mg of protein, respectively, have been chosen. It has been established that collagenase activity in the medium without adding the inducers decreases 4.76 times, while that of keratinase--5.71 times, i.e. the above enzymes are inducible. The investigation of the spectrum of activities has demonstrated that the both strains possess low level of the general proteolytic and elastase activities and high level of collagenase and keratinase activities. Partial purification of the enzyme complex of Streptomyces sp. 1349 by the successive precipitation by ammonium sulphate with 30, 60 and 80% saturation and a single precipitation by ammonium sulphate with 80% saturation helped to increase the level of KA 5.6-5.9 times, and that of KerA--4.2-4.5 times.

  8. 2015 Annual Report of the American Psychological Association.

    PubMed

    2016-01-01

    Presents the 2015 Annual Report of the American Psychological Association. In his introduction, President Barry Anton describes how 2015 was among APA's most challenging. Although 2015 ushered in an era of greater transparency within the association and enhanced communications to members and the public, it also required painful self-reflection stemming from the revelations of an independent review by an outside law firm. The review examined the question of whether APA played any role related to the Bush administration's use of abusive interrogation techniques during the war on terror. Anton's introduction also discusses (1) the APA convention, (2) representing APA at a White House meeting with health care providers and insurance companies, (3) APA's effort to increase the number of APA-accredited internships, (4) international activities, and (5) the global summit on psychology and integrated care. (PsycINFO Database Record

  9. A Model for and Method of Predicting High Quality Army Enlistment Contracts.

    DTIC Science & Technology

    1986-09-01

    Practice of Econometrics, John Wiley and Sons, 1982. 11. Anton , Howard , Elementary Linear Algebra , John Wiley & Sons, 1984. 12. Barr, Donald R. and...the decision maker. " 4 The thesis develops the framework for a parsimonious linear statistical model of quality enlistment contracts for the U.S. Army...develops the framework for a parsimonious linear statistical model of quality enlistment contracts for the U.S. Army. There is a need for such a model that

  10. An Automated Immittance Measuring System for Electroacoustic Transducers

    DTIC Science & Technology

    1984-09-01

    Howard Anton , Elementary Linear Algebra , (John Wiley & Sons, Inc., New York, 1973) pp. 80-82. 3. "IEEE Standand on Piezoelectricity," IEEE Std. 176...immittance. Figure 1 compares an immittance circle defined by a linear sequence of frequencies with one in which the frequencies are generated from the...circular approximation method. There are two hundred points in the linear frequency sweep of Pig. la and only fifty points in Pig. lb. This

  11. Matrix Algebra.

    DTIC Science & Technology

    1998-06-01

    on courses being taught at NPS. LIST OF REFERENCES [1] Anton , Howard , Elementary Linear Algebra , John Wiley and Sons, New York, New York, 1994...and computational techniques for solving systems of linear equations. The goal is to enhance current matrix algebra textbooks and help the beginning... algebra is the study of algebraic operations on matrices and of their applications, primarily for solving systems of linear equations. Systems of

  12. Analysis and Evaluation of Project EVERGREEN Data

    DTIC Science & Technology

    1991-09-01

    Anton , Howard and Rorres, Chris, Elementary Linear Algebra with AyDlications, John Wiley and Sons, New York, 1987. 2. Binnall, Eugene P., EVERGREEN...2. Transmitter used was a Febetron. 3. Elevation angle ( Source ) = 45 degrees. 4. Polarization transmitted - Linear "Horizontal". 5. Polarization...2. Transmitter used was a Febetron. 3. Elevation angle ( Source ) = 45 degrees. 4. Polarization transmitted - Linear "Horizontal". 5. Polarization

  13. An Extended Microcomputer-Based Network Optimization Package.

    DTIC Science & Technology

    1982-10-01

    Analysis, Laxenberq, Austria, 1981, pp. 781-808. 9. Anton , H., Elementary Linear Algebra , John Wiley & Sons, New York, 1977. 10. Koopmans, T. C...fCaRUlue do leVee. aide It 001100"M OW eedea9f’ OF Nooke~e Network, generalized network, microcomputer, optimization, network with gains, linear ...Oboe &111111041 network problem, in turn, can be viewed as a specialization of a linear programuing problem having at most two non-zero entries in each

  14. Human Factors Aspects of Aircraft Accidents

    DTIC Science & Technology

    1982-10-01

    AIRCRAFT ACCIDENTS/’ --.. by S.A.Anderson _ --’ ^LIFE SUPPORT, RESTRAINT AND EJECTION SYSTEMS INVESTIGATION by D.J. Anton C^> AIRCRAFT ACCIDENT...and includes lectures on engineering, life support systems / restraint/ejection^ and the flight surgeon’s investigation. The flight surgeon’s lecture...will include the on-scene investigation and documentation, the removal of the aircraft and follow-on analyses, the selection of systems and subsystems

  15. E-Pals: Examining a Cross-Cultural Writing/Literature Project.

    ERIC Educational Resources Information Center

    McClanahan, Lauren G.

    This paper reports on a case study of a U.S. high school literature class during an e-mail exchange with a high school literature class in Moscow (Russia). During this project, the students in both classrooms read short stories by Anton Chekhov and O'Henry. By using the stories as a catalyst, the students' goal was to help their distant partner to…

  16. jsc2011e203164

    NASA Image and Video Library

    2011-10-23

    At the Kremlin Wall in Moscow, Expedition 30 Commander Dan Burbank of NASA laid flowers October 24, 2011 in a traditional ceremony during the tour of Red Square he and his crewmates conducted prior to their launch to the International Space Station November 14 on the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Burbank, Soyuz Commander Anton Shkaplerov and Anatoly Ivanishin will arrive in Baikonur October 31 for final pre-launch preparations. Credit: NASA

  17. jsc2011e203165

    NASA Image and Video Library

    2011-10-23

    At the Kremlin Wall in Moscow, Expedition 30 Flight Engineer Anatoly Ivanishin laid flowers October 24, 2011 in a traditional ceremony during the tour of Red Square he and his crewmates conducted prior to their launch to the International Space Station November 14 on the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Ivanishin, Expedition Commander Dan Burbank of NASA and Soyuz Commander Anton Shkaplerov will arrive in Baikonur October 31 for final pre-launch preparations. Credit: NASA

  18. jsc2011e203163

    NASA Image and Video Library

    2011-10-23

    At the Kremlin Wall in Moscow, Expedition 30 Soyuz Commander Anton Shkaplerov laid flowers October 24, 2011 in a traditional ceremony during the tour of Red Square he and his crewmates conducted prior to their launch to the International Space Station November 14 on the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Shkaplerov, Expedition Commander Dan Burbank of NASA and Anatoly Ivanishin will arrive in Baikonur October 31 for final pre-launch preparations. Credit: NASA

  19. Next Generation Proton Beam Writing: A Platform Technology for Nanowire Integration

    DTIC Science & Technology

    2010-06-01

    silsesquioxane (HSQ) nanostructures for Nickel electroplating, S. Gorelick, F. Zhang, P.G. Shao, J.A. van Kan, Harry J . Whitlow, F. Watt, Nuclear...Yaping Ren, Jeroen Anton van Kan, Sher-Yi Chiam, Linke Jian, Herbert O. Moser, Thomas Osipowicz, Frank Watt, Nuclear Instruments & Methods in Physics...Research Section B Volume 267 (2009) 2376-2380 2 Proton beam writing: a platform technology for nanowire production, J . A. van Kan F. Zhang S. Y

  20. The Next Generation Focusing Lenses for Proton Beam Writing

    DTIC Science & Technology

    2009-07-28

    nanostructures for Nickel electroplating, S. Gorelick, F. Zhang, P.G. Shao, J.A. van Kan, Harry J . Whitlow, F. Watt, Nuclear Instruments & Methods in Physics...Anton van Kan, Sher-Yi Chiam, Linke Jian, Herbert O. Moser, Thomas Osipowicz, Frank Watt, Nuclear Instruments & Methods in Physics Research Section B...Volume 267 (2009) 2376-2380 2 Proton beam writing: a platform technology for nanowire production, J . A. van Kan F. Zhang S. Y. Chiam T. Osipowicz A

  1. JPRS Report, East Europe

    DTIC Science & Technology

    1989-11-21

    asked for their collabora- tion (Ion Mihalache , Gr. Iunian, N. Titulescu, T. Teodorescu-Braniste, Mihai Ralea, Petre Pandrea, Con- stants Visoianu...came out of hospital, Gr. Iunian (who had spoken about the incident in the Assembly of Deputies) advised me to appeal to Ion Mihalache , who at the...shrugged his shoul- ders helplessly and quoted a saying from Anton Pann: "If you can’t do anything, why seek trouble." Ion Mihalache knew only too

  2. Cooperation and Integration: Keeping Austria’s Forces Relevant for 21st Century

    DTIC Science & Technology

    2013-03-01

    December, 12, 2012). 59 Johann Frank Johann Pucher, “Strategie Und Sicherheit 2012” (Anton Pelinka: Die Oesterreichische Aussen- und...Sicherheitspolitik), Boehlau Verlag, 2012, 637. 60 Johann Frank Johann Pucher, “Strategie Und Sicherheit 2012” (Thomas Mayer, Sicherheitspolitik nach dem Psst...Proposal, Friedrich Ebert Stiftung, Berlinn 2010, http://library.fes.de/pdf-files/id/ipa/07075.pdf, (accessed September 20, 2012), 55. 65 European

  3. Varied Human Tolerance to the Combined Conditions of Low Contrast and Diminished Luminance: A Quasi-Meta Analysis

    DTIC Science & Technology

    2017-08-30

    no scotopic CA data available for larger population comparisons until February 2016 (Bartholomew, Lad, Cao, Bach , & Cirulli, 2016) in which data...Böhringer, Bach , Reinhard, and Birnbaum (2014). A prospective data analysis followed ten patients who received bifocal intraocular lenses, and ten...Progress in Retinal and Eye Research, 19(6), 711–777. Anton, A., Böhringer, D., Bach , M., Reinhard, T., & Birnbaum, F. (2014). Contrast sensitivity

  4. 16. 'EXCELLENT NEW PARADE GROUND BEST SINCE POST ESTABLISHED. STARTED ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    16. 'EXCELLENT NEW PARADE GROUND BEST SINCE POST ESTABLISHED. STARTED BY COL. RALPH PARKER, FINISHED BY COL. TROUPE MILLER, PRESIDIO OF MONTEREY CALIFORNIA.' No date, probably ca. 1936. No signature, photographer probably Anton C. Heidrick. This panoramic view looks east over Soldier Field to the Bay, from the cannons at the west end. Original hand tinted silver gelatin print measures 90.4 cm by 20.2 cm, flush mounted on mat board. - Presidio of Monterey, Soldier Field, Monterey, Monterey County, CA

  5. 14. 'TROOP A, OREGON CAVALRY IN CAMP AT PRESIDIO OF ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    14. 'TROOP A, OREGON CAVALRY IN CAMP AT PRESIDIO OF MONTEREY, CALIFORNIA, 1915.' Anton C. Heidrick, photographer. This panoramic view looks west from the lower end of Soldier Field, before construction of walls and roads. Original warm toned silver gelatin print measures 94.9 cm by 19.7 cm, flush mounted on mat board. - Presidio of Monterey, Soldier Field, Monterey, Monterey County, CA

  6. Burbank participates in a CHeCS Medical Contingency Drill in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-16

    ISS030-E-012609 (16 Dec. 2011) --- NASA astronaut Dan Burbank (foreground), Expedition 30 commander, and Russian cosmonaut Anton Shkaplerov, flight engineer, participate in a Crew Health Care System (CHeCS) medical contingency drill in the Destiny laboratory of the International Space Station. This drill gives crew members the opportunity to work as a team in resolving a simulated medical emergency onboard the space station.

  7. Burbank participates in a CHeCS Medical Contingency Drill in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-16

    ISS030-E-012613 (16 Dec. 2011) --- NASA astronaut Dan Burbank (foreground), Expedition 30 commander, and Russian cosmonaut Anton Shkaplerov, flight engineer, participate in a Crew Health Care System (CHeCS) medical contingency drill in the Destiny laboratory of the International Space Station. This drill gives crew members the opportunity to work as a team in resolving a simulated medical emergency onboard the space station.

  8. The Economy of Romania: How it Compares to Other Centrally-Planned Economies in Eastern Europe.

    DTIC Science & Technology

    1984-06-01

    United Nations Relief and Rehabilitation Adminis- tration) assistance was all but terminated. The 6 8 Anton Logoreci, "Albania’s Future," New York Times... motor buses and trucks, high capacity tractors, farming machinery, Diesel and electric locomotives, aircraft and helicopters as well as installations...34 Yoga by Commissars." Economist. Volume 283, Number 7238, May 22, 1982, p. 80. "Yugoslav/Romanian Aircraft." Aviation Week and Space Tech- nology

  9. Russian Political Warfare: Origin, Evolution, and Application

    DTIC Science & Technology

    2015-06-01

    WARFARE: ORIGIN , EVOLUTION, AND APPLICATION by Jeffrey V. Dickey Thomas B. Everett Zane M. Galvach Matthew J. Mesko Anton V. Soltis June...blank) 2. REPORT DATE June 2015 3. REPORT TYPE AND DATES COVERED Master’s Thesis 4. TITLE AND SUBTITLE RUSSIAN POLITICAL WARFARE: ORIGIN ...political warfare (PW) campaign. Analysis of the origin , history, and evolution of Soviet/Russian PW from 1917 through today reveals that Russia is

  10. Introduction to Real Orthogonal Polynomials

    DTIC Science & Technology

    1992-06-01

    7 A. ELEMENTARY LINEAR ALGEBRA ....................... 7 1. Vector Spaces ............. ......... .... .... ...... 7 2. Inner...fundamental ideas in the next chapter. IH. BACKGROUND A. ELEMENTARY LINEAR ALGEBRA 1. Vector Spaces Let R" denote the collection of all vectors (n-tuples), u...Handbook of Mathematical Sciences, 6th ed., CRC Press, Inc., 1987. 2. Anton, H., and Rorres, C., Elementary Linear Algebra with Applications, John Wiley

  11. jsc2011e204589

    NASA Image and Video Library

    2011-10-30

    At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 29/30 Flight Engineer Anatoly Ivanishin (foreground, left), NASA’s Dan Burbank (center) and Russian Soyuz Commander Anton Shkaplerov (right) lead a delegation as they walk to their bus October 31, 2011, preparing to depart for their launch site in Baikonur, Kazakhstan. The trio will launch November 14 from Baikonur on their Soyuz TMA-22 spacecraft for the International Space Station. Credit: NASA

  12. Analysis of the Causes of Military Coups d’Etat in Sub-Saharan Africa, 1960-1982.

    DTIC Science & Technology

    1983-04-01

    of Defense S TMAR 2 6 1985• . A collaborative research project by The Orkand Corporation and Arizona State University. The views and conclusions...issues proved invaluable. Dr. Donald S . Orkand, President of The Orkand Corporation, and Dr. Anton S . Morton, Director of its National Security...Appendix D should be processed as one document per Dr. Slater, Defense Intelligence College 1 j . S EXECUTIVE SUMMARY INTRODUCTION The Washington Post

  13. Nocturnal Oxygen Variability in Home Dwelling Heart Failure Patients

    DTIC Science & Technology

    2017-06-16

    MEMORANDUM FOR ST DEPARTMENT OF THE AIR FORCE 59TH MEDICAL WING (AETC) JOINT BASE SAN ANTON IO - LACKLAND TEXAS ATTN: MAJ CUBBY L. GARDNER FROM...forward your request fo r funds lo the designated wing POC. 4. Congratulations, and thank you for your efforts and time. Your contributions arc vital to...RESEARCH AND DEVELOPMENT AGREEMENT (CRADA), MATERIAL TRANSFER AGREEMENT (MTA), INTELLECTUAL PROPERTY RIGHTS AGREEMENT ETC.? O YES 1:8:] NO NOTE: If the

  14. Expedition 30 Landing

    NASA Image and Video Library

    2012-04-28

    Expedition 30 Flight Engineer Anatoly Ivanishin is welcomed home by colleagues and family in Star City, Russia on Saturday, April 28, 2012. Russian Cosmonaut Ivanishin, Expedition 30 Commander Daniel Burbank, and Russian Cosmonaut Anton Shkaplerov landed outside of Arkalyk, Kazakhstan earlier in the day from over five months onboard the International Space Station where they served as members of the Expedtion 29 and 30 crews. Photo Credit: (NASA/Carla Cioffi)

  15. Expedition 30 Landing

    NASA Image and Video Library

    2012-04-28

    Expedition 30 Flight Engineers Anatoly Ivanishin, far left, and Anton Shkaplerov are welcomed home by colleagues and family in Star City, Russia on Saturday, April 28, 2012. Russian Cosmonauts Ivanishin, Shkaplerov and Expedition 30 Commander Daniel Burbank landed outside of Arkalyk, Kazakhstan earlier in the day from over five months onboard the International Space Station where they served as members of the Expedtion 29 and 30 crews. Photo Credit: (NASA/Carla Cioffi)

  16. [Michel de Montaigne (1533-1592): report of a case of not perceiving own blindness].

    PubMed

    Bernoulli, R

    1990-01-01

    In the second book of the Essais towards the end of the twelfth chapter Montaigne mentions a nobleman who does not take note of his blindness. This case of not noticing his own blindness is presumably the first ever described. It belongs to the complex of anosognosia symptoms among which must be emphasized the Anton syndrome. The invalidity described by Montaigne means for him a crucial point of his critique of senses and thus of his doctrine of natural cognition.

  17. ISS Expedition 42 / 43 Departs for Kazakhstan Launch Site

    NASA Image and Video Library

    2014-11-26

    NASA TV (NTV) video file of ISS Expedition 42 / 43 crewmembers Anton Shkaplerov (Roskosmos), Terry Virts and Samantha Cristoforetti (ESA) during traditional ceremonies at the Gagarin Cosmonaut Training Center (GCTC) in Star City, Russia.. Includes footage of crew and backup crew speaking with friends, family and officials outside of GCTC; crew and backup crew walking to Gararian monument where they pose for pictures; media interviews; and crew driving away in a bus.

  18. ISS Expedition 42 Crew Final Training Outside Moscow

    NASA Image and Video Library

    2014-11-26

    NASA TV (NTV) video file on ISS Expedition 42 / 43 final qualification training at the Gagarin Cosmonaut Training Center (GCTC), Star City, Russia. Includes footage of ISS Expedition 42 / 43 crewmembers Anton Shkaplerov (Roscosmos), Terry Virts, Samantha Cristoforetti (ESA) during signing in for Soyuz inspection; interviews; Soyuz inspection; interview with Astronaut Dan Burbank, Director of Russian Operations, NASA; crew signing in for final examinations and interviews.

  19. ISS Expedition 42 / 43 Crew Training Resource Reel (JSC-2641)

    NASA Image and Video Library

    2014-11-14

    Media resource reel of ISS Expedition 42 / 43 Crew training activities. Includes footage of crew photo shots with Samantha Cristoforetti, Anton Shkaplerov and Terry Virts; Routine shots with Virts, ISS Expedition 43 crewmember Scott Kelly, Cristoforetti, ISS Expedition 41 / 42 crewmember Barry Wilmore; and Shklaplerov; T-38 Operations with Virts; Routine operations with Cristoforetti, Shkaplerov and Virts; Neutral Buoyancy Lab (NBL) with Cristoforetti and Kelly; and Emergency Scenatios with Virts, Cristoforetti and Shkaplerov.

  20. Expedition 30 crewmembers use TORU Docking System Controls

    NASA Image and Video Library

    2012-04-22

    ISS030-E-241414 (22 April 2012) --- Russian cosmonauts Anton Shkaplerov (right) and Oleg Kononenko, both Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  1. Progress Resupply Vehicle approach

    NASA Image and Video Library

    2012-01-28

    ISS030-E-050932 (27 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov (left), Expedition 30 flight engineer, monitors data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012. NASA astronaut Dan Burbank, commander, looks on.

  2. Expedition 30 Crewmembers Monitor Data in the SM during Approach

    NASA Image and Video Library

    2013-04-22

    ISS030-E-267689 (22 April 2012) --- Russian cosmonauts Anton Shkaplerov (left), Oleg Kononenko (right) and Anatoly Ivanishin, all Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  3. Shkaplerov and Kononenko monitor data at the manual TORU Docking System Controls

    NASA Image and Video Library

    2012-01-27

    ISS030-E-156562 (27 Jan. 2012) --- Russian cosmonauts Anton Shkaplerov (left) and Oleg Kononenko, both Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012.

  4. Expedition 30 crewmembers use TORU Docking System Controls

    NASA Image and Video Library

    2012-04-22

    ISS030-E-241387 (22 April 2012) --- Russian cosmonauts Anton Shkaplerov (left), Oleg Kononenko (right) and Anatoly Ivanishin, all Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  5. Expedition 42 Press Conference

    NASA Image and Video Library

    2014-11-22

    Expedition 42 Flight Engineer Terry Virts of NASA (left), Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) (center), and Flight Engineer Samantha Cristoforetti of the European Space Agency (right), pose for a photo at the conclusion of the press conference, Saturday, Nov. 22, 2014, at the Cosmonaut Hotel in Baikonur, Kazakhstan. The mission to the International Space Station is set to launch Nov. 24 from the Baikonur Cosmodrome. Photo Credit: (NASA/Aubrey Gemignani)

  6. Decay, Transfer, and the Reacquisition of a Complex Skill: An Investigation of Practice Schedules, Observational Rehearsal, and Individual Differences

    DTIC Science & Technology

    2007-12-01

    separate matter to consider. Issues pertaining to motivation are salient, and applying reinforcement (Skinner, 1969) and value- expectancy ( Vroom , 1964...6. AUTHOR( S ) Winfred Arthur, Eric Anthony Day, Anton J. V lado, Paul R. Boatman, Vanessa Kowollik, Winston Bennett, Jr., Alok Bhupatkar ROJECT...NUMBER il 5d. P 1400 5e. TASK NUMBER AS 5f. WORK UNIT NUMBER 01 7. PERFORMING ORGANIZATION NAME( S ) AND ADDR . PERFORMING ORGANIZATION

  7. Expedition 42 Crew Wave

    NASA Image and Video Library

    2014-11-24

    Expedition 42 Flight Engineer Samantha Cristoforetti, of the European Space Agency (ESA), top, Flight Engineer Terry Virts of NASA, center, and Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos), bottom, wave farewell prior to boarding the Soyuz TMA-15M spacecraft for launch, Monday, Nov. 24, 2014 at the Baikonur Cosmodrome in Kazakhstan. Cristoforetti, Virts, and Shkaplerov will spend the next five and a half months aboard the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  8. jsc2011e205781

    NASA Image and Video Library

    2011-11-08

    In Baikonur, Kazakhstan, Expedition 30 Commander Dan Burbank of NASA (left), Soyuz Commander Anton Shkaplerov (center) and Flight Engineer Anatoly Ivanishin review docking procedures on a laptop computer during training at their Cosmonaut Hotel crew quarters November 8, 2011. The trio will launch in the Soyuz TMA-22 spacecraft from Baikonur on November 14 bound for the International Space Station. Credit: NASA/Victor Zelentsov

  9. Transient cortical blindness after intradiscal oxygen–ozone therapy

    PubMed Central

    Vaiano, Agostino Salvatore; Valente, Cristiana; De Benedetti, Giacomo; Caramello, Guido

    2016-01-01

    A 54-year-old caucasian male developed bilateral blindness during an oxygen–ozone injection for disc herniation. The visual loss (VL) was immediately followed by severe frontal headache, vomiting, and nausea. The patient underestimated the VL showing Anton's syndrome, with a complete visual recovery after 2-month follow-up. Magnetic resonance data were consistent with recent ischemic lesions in bilateral vascular territories of posterior cerebral arteries. PMID:28112142

  10. Expedition 30 Landing

    NASA Image and Video Library

    2012-04-27

    Expedition 30 Commander Dan Burbank is seen as he is extracted from the Soyuz TMA-22 spacecraft shortly after the capsule landed with Russian flight engineers Anton Shkaplerov and Anatoly Ivanishin in a remote area outside of the town of Arkalyk, Kazakhstan on Friday, April 27, 2012. Burbank, Ivanishin, and Shkaplerov are returning from more than five months onboard the International Space Station where they served as members of the Expedition 29 and 30 crews. Photo Credit: (NASA/Carla Cioffi)

  11. Effects of High Altitude on Neurological and Pulmonary Function: The Effect of High Altitude on Visual Evoked Potentials in Humans on Mt. Everest.

    DTIC Science & Technology

    1985-07-25

    on Mount 1. Larson EB, Roach RC, Schoene RB, et al: Acetazolamide and Rainier , which may allow more meaningful comparisons, acute mountain sickness...CDM Fort Sam Houston, TX 78234-6100 1.9 -J., 19 ’ % Phenytoin and Acute Mountain Sickness on Mount Everest RICHARD N. W. WOHNS, M.D. Twenty-one...M.S. clinical trial of phenytoin prophylaxis for acute mountain sickness ANTON KARUZA, D.P.M. during the approach to the northeast ridge of Mount

  12. Falkland’s War: Strategic, Intelligence and Diplomatic Failures

    DTIC Science & Technology

    1985-05-01

    Spain, bearing L the name San Anton Islands and dated 1526. Sixty-five years later, the British navigator John Davis sighted the islands, and eight...34..........-.-...........° perspective and to underestimate the importance of South America and the determination of its people. 2 At least one British official, Sir James...senior ministers most closely involved, Mr. Humphry Athus and Mr. Richard Luce. Mrs. Thatcher tried to persuade Lord Carrington not to resign, but he felt

  13. A Decentralized Variable Ordering Method for Distributed Constraint Optimization

    DTIC Science & Technology

    2005-05-01

    Either aproach can be used depending on how densely the nodes are connected inside blocks. If inside-block connec- tivity is sparse, the latter method ...A Decentralized Variable Ordering Method for Distributed Constraint Optimization Anton Chechetka Katia Sycara CMU-RI-TR-05-18 May 2005 Robotics...00-00-2005 4. TITLE AND SUBTITLE A Decentralized Variable Ordering Method for Distributed Constraint Optimization 5a. CONTRACT NUMBER 5b. GRANT

  14. 3-D Soviet Style: A Presentation on Lessons Learned from the Soviet Experience in Afghanistan

    DTIC Science & Technology

    2007-10-01

    veut une analyse des efforts soviétiques en matière de défense, de développement et de diplomatie au cours du conflit russo-afghan (1979 à 1989). Les...publiée en russe et en anglais . Les données statistiques sur le conflit ont également été prises en compte. Les auteurs, MM. Anton Minkov et

  15. JPRS Report East Europe.

    DTIC Science & Technology

    1990-06-01

    34 37 There ought to be a even arrested in the GDR (Max Fechner , Max Fank, special research program for this chapter as well as for Willy Jesse, Paul...Anton Ackermann, Franz SED Central Committee or of the Central Party Control Dahlem, Max Fechner , Erich Gniffke, August Karsten, Commission (ZPKK...organized in the fall of 1948, Paul Merker, and Elli Schmidt-of them Fechner and respectively. The Central Committee passed another Merker were arrested and

  16. Equality judgments cannot distinguish between attention effects on appearance and criterion: a reply to Schneider (2011).

    PubMed

    Anton-Erxleben, Katharina; Abrams, Jared; Carrasco, Marisa

    2011-01-01

    Whether attention modulates the appearance of stimulus features is debated. Whereas many previous studies using a comparative judgment have found evidence for such an effect, two recent studies using an equality judgment have not. Critically, these studies have relied on the assumption that the equality paradigm yields bias-free PSE estimates and is as sensitive as the comparative judgment, without testing these assumptions. Anton-Erxleben, Abrams, and Carrasco (2010) compared comparative judgments and equality judgments with and without the manipulation of attention. They demonstrated that the equality paradigm is less sensitive than the comparative judgment and also bias-prone. Furthermore, they reported an effect of attention on the PSE using both paradigms. Schneider (2011) questions the validity of the latter finding, stating that the data in the equality experiment are corrupted because of skew in the response distributions. Notably, this argument supports the original conclusion by Anton-Erxleben et al.: that the equality paradigm is bias-prone. Additionally, the necessary analyses to show that the attention effect observed in Anton-Erxleben et al. was due to skew in the data were not conducted. Here, we provide these analyses and show that although the equality judgment is bias-prone, the effects we observe are consistent with an increase of apparent contrast by attention.

  17. Alcohol consumption and the risk of renal cancers in the European Prospective Investigation into Cancer and Nutrition (EPIC). Wozniak MB, Brennan P, Brenner DR, Overvad K, Olsen A, Tjønneland A, Boutron-Ruault MC, Clavel-Chapelon F, Fagherazzi G, Katzke V, Kühn T, Boeing H, Bergmann MM, Steffen A, Naska A, Trichopoulou A, Trichopoulos D, Saieva C, Grioni S, Panico S, Tumino R, Vineis P, Bueno-de-Mesquita HB, Peeters PH, Hjartåker A, Weiderpass E, Arriola L, Molina-Montes E, Duell EJ, Santiuste C, Alonso de la Torre R, Barricarte Gurrea A, Stocks T, Johansson M, Ljungberg B, Wareham N, Khaw KT, Travis RC, Cross AJ, Murphy N, Riboli E, Scelo G.Int J Cancer. 2015 Oct 15;137(8):1953-66. [Epub 2015 Apr 28]. doi: 10.1002/ijc.29559.

    PubMed

    Jay, Raman; Brennan, P; Brenner; Overvad, K; Olsen, A; Tjønneland, A; Boutron-Ruault, M C; Clavel-Chapelon, F; Fagherazzi; Katzke, V; Kühn, T; Boeing, H; Bergmann, M M; Steffen, A; Naska, A; Trichopoulou, A; Trichopoulos, D; Saieva, C; Grioni, S; Panico, S; Tumino, R; Vineis, P; Bueno-de-Mesquita, H B; Peeters, P H; Hjartåker, A; Weiderpass, E; Arriola, L; Molina-Montes, E; Duell, E J; Santiuste, C; Alonso de la Torre, R; Barricarte Gurrea, A; Stocks, T; Johansson, M; Ljungberg, B; Wareham, N; Khaw, K T; Travis, R C; Cross, A J; Murphy, N; Riboli, E; Scelo, G

    2017-03-01

    Epidemiologic studies have reported that moderate alcohol consumption is inversely associated with the risk of renal cancer. However, there is no information available on the associations in renal cancer subsites. From 1992 to 2010, 477,325 men and women in the European Prospective Investigation into Cancer and Nutrition cohort were followed for incident renal cancers (n = 931). Baseline and lifetime alcohol consumption was assessed by country-specific, validated dietary questionnaires. Information on past alcohol consumption was collected by lifestyle questionnaires. Hazard ratios (HRs) and 95% confidence intervals (CIs) were estimated from Cox proportional hazard models. In multivariate analysis, total alcohol consumption at baseline was inversely associated with renal cancer; the HR and 95% CI for the increasing categories of total alcohol consumption at recruitment vs. the light drinkers category were 0.78 (0.62-0.99), 0.82 (0.64-1.04), 0.70 (0.55-0.90), and 0.91 (0.63-1.30), respectively, (ptrend = 0.001). A similar relationship was observed for average lifetime alcohol consumption and for all renal cancer subsites combined or for renal parenchyma subsite. The trend was not observed in hypertensive individuals and not significant in smokers. In conclusion, moderate alcohol consumption was associated with a decreased risk of renal cancer. Copyright © 2017. Published by Elsevier Inc.

  18. Adverse Outcome Pathway (AOP) Development I: Strategies and Principles

    PubMed Central

    Villeneuve, Daniel L.; Crump, Doug; Garcia-Reyero, Natàlia; Hecker, Markus; Hutchinson, Thomas H.; LaLone, Carlie A.; Landesmann, Brigitte; Lettieri, Teresa; Munn, Sharon; Nepelska, Malgorzata; Ottinger, Mary Ann; Vergauwen, Lucia; Whelan, Maurice

    2014-01-01

    An adverse outcome pathway (AOP) is a conceptual framework that organizes existing knowledge concerning biologically plausible, and empirically supported, links between molecular-level perturbation of a biological system and an adverse outcome at a level of biological organization of regulatory relevance. Systematic organization of information into AOP frameworks has potential to improve regulatory decision-making through greater integration and more meaningful use of mechanistic data. However, for the scientific community to collectively develop a useful AOP knowledgebase that encompasses toxicological contexts of concern to human health and ecological risk assessment, it is critical that AOPs be developed in accordance with a consistent set of core principles. Based on the experiences and scientific discourse among a group of AOP practitioners, we propose a set of five fundamental principles that guide AOP development: (1) AOPs are not chemical specific; (2) AOPs are modular and composed of reusable components—notably key events (KEs) and key event relationships (KERs); (3) an individual AOP, composed of a single sequence of KEs and KERs, is a pragmatic unit of AOP development and evaluation; (4) networks composed of multiple AOPs that share common KEs and KERs are likely to be the functional unit of prediction for most real-world scenarios; and (5) AOPs are living documents that will evolve over time as new knowledge is generated. The goal of the present article was to introduce some strategies for AOP development and detail the rationale behind these 5 key principles. Consideration of these principles addresses many of the current uncertainties regarding the AOP framework and its application and is intended to foster greater consistency in AOP development. PMID:25466378

  19. Fragmentation of multiply charged hydrocarbon molecules C{sub n}H{sup q+} (n{<=} 4, q{<=} 9) produced in high-velocity collisions: Branching ratios and kinetic energy release of the H{sup +} fragment

    SciTech Connect

    Beroff, K.; Pino, T.; Carpentier, Y.; Van-Oanh, N. T.; Chabot, M.; Tuna, T.; Martinet, G.; Le Padellec, A.; Lavergne, L.

    2011-09-15

    Fragmentation branching ratios for channels involving H{sup +} emission and associated kinetic energy release of the H{sup +} fragment [KER(H{sup +})] have been measured for multicharged C{sub n}H{sup q+} molecules produced in high velocity (3.6 a.u.) collisions between C{sub n}H{sup +} projectiles and helium atoms. For CH{sup q+} (q{<=} 4) molecules, measured KER(H{sup +}) were found well below predictions of the simple point charge Coulomb model (PCCM) for all q values. Multireference configuration interaction (MRCI) calculations for ground as well as electronic excited states were performed which allowed a perfect interpretation of the CH{sup q+} experimental results for low charges (q = 2-3) as well as for the highest charge (q = 4). In this last case we could show, on the basis of ionization cross sections calculations and experimental measurements performed on the same systems at slightly higher velocity (4.5 a.u.), the prominent role played by inner-shell ionization followed by Auger relaxation and could extract the lifetime of this Auger relaxation giving rise to the best agreement between the experiment and the calculations. For dissociation of C{sub 2}H{sup q+} and C{sub 3}H{sup q+} with the highest charges (q{>=} 5), inner-shell ionization contributed in a prominent way to the ion production. In these two cases it was shown that measured KER(H{sup +}) were in good agreement with PCCM predictions when those were corrected for Auger relaxation with the same Auger lifetime value as in CH{sup 3+}.

  20. Adverse outcome pathway (AOP) development I: strategies and principles.

    PubMed

    Villeneuve, Daniel L; Crump, Doug; Garcia-Reyero, Natàlia; Hecker, Markus; Hutchinson, Thomas H; LaLone, Carlie A; Landesmann, Brigitte; Lettieri, Teresa; Munn, Sharon; Nepelska, Malgorzata; Ottinger, Mary Ann; Vergauwen, Lucia; Whelan, Maurice

    2014-12-01

    An adverse outcome pathway (AOP) is a conceptual framework that organizes existing knowledge concerning biologically plausible, and empirically supported, links between molecular-level perturbation of a biological system and an adverse outcome at a level of biological organization of regulatory relevance. Systematic organization of information into AOP frameworks has potential to improve regulatory decision-making through greater integration and more meaningful use of mechanistic data. However, for the scientific community to collectively develop a useful AOP knowledgebase that encompasses toxicological contexts of concern to human health and ecological risk assessment, it is critical that AOPs be developed in accordance with a consistent set of core principles. Based on the experiences and scientific discourse among a group of AOP practitioners, we propose a set of five fundamental principles that guide AOP development: (1) AOPs are not chemical specific; (2) AOPs are modular and composed of reusable components-notably key events (KEs) and key event relationships (KERs); (3) an individual AOP, composed of a single sequence of KEs and KERs, is a pragmatic unit of AOP development and evaluation; (4) networks composed of multiple AOPs that share common KEs and KERs are likely to be the functional unit of prediction for most real-world scenarios; and (5) AOPs are living documents that will evolve over time as new knowledge is generated. The goal of the present article was to introduce some strategies for AOP development and detail the rationale behind these 5 key principles. Consideration of these principles addresses many of the current uncertainties regarding the AOP framework and its application and is intended to foster greater consistency in AOP development.

  1. Distribution of Barley yellow dwarf virus-PAV in the Sub-Antarctic Kerguelen Islands and Characterization of Two New Luteovirus Species

    PubMed Central

    Svanella-Dumas, Laurence; Candresse, Thierry; Hullé, Maurice; Marais, Armelle

    2013-01-01

    A systematic search for viral infection was performed in the isolated Kerguelen Islands, using a range of polyvalent genus-specific PCR assays. Barley yellow dwarf virus (BYDV) was detected in both introduced and native grasses such as Poa cookii. The geographical distribution of BYDV and its prevalence in P. cookii were analyzed using samples collected from various sites of the archipelago. We estimate the average prevalence of BYDV to be 24.9% in P. cookii, with significant variability between sites. BYDV genetic diversity was assessed using sequence information from two genomic regions: the P3 open reading frame (ORF) (encoding the coat protein) and the hypervariable P6 ORF region. The phylogenetic analysis in the P3 region showed that BYDV sequences segregate into three major lineages, the most frequent of which (Ker-I cluster) showed close homology with BYDV-PAV-I isolates and had very low intra-lineage diversity (0.6%). A similarly low diversity was also recorded in the hypervariable P6 region, suggesting that Ker-I isolates derive from the recent introduction of BYDV-PAV-I. Divergence time estimation suggests that BYDV-PAV-I was likely introduced in the Kerguelen environment at the same time frame as its aphid vector, Rhopalosiphum padi, whose distribution shows good overlap with that of BYDV-Ker-I. The two other lineages show more than 22% amino acid divergence in the P3 region with other known species in the BYDV species complex, indicating that they represent distinct BYDV species. Using species-specific amplification primers, the distribution of these novel species was analyzed. The high prevalence of BYDV on native Poaceae and the presence of the vector R. padi, raises the question of its impact on the vulnerable plant communities of this remote ecosystem. PMID:23825645

  2. Restrictions of the sale of pharmaceuticals and medical devices such as contact lenses over the internet and the free movement of goods.

    PubMed

    de Sadeleer, Nicolas

    2012-03-01

    In the light of new case law development, this article examines whether national restrictions on the online sale of pharmaceuticals and medical devices such as contact lenses are consistent either with EU secondary law, either with Article 34 TFEU that prohibits measures having equivalent effect to quantitative restrictions on imports. In particular, this article focuses on an analysis of two judgments on this important issue delivered by the Court of Justice of the European Union in 2003 and 2010, namely the Deutscher Apothekerverband decision and the Ker-Optika decision.

  3. Temperature dependence of the photodissociation of CO2 from high vibrational levels: 205-230 nm imaging studies of CO(X1Σ+) and O(3P, 1D) products

    NASA Astrophysics Data System (ADS)

    Sutradhar, S.; Samanta, B. R.; Samanta, A. K.; Reisler, H.

    2017-07-01

    The 205-230 nm photodissociation of vibrationally excited CO2 at temperatures up to 1800 K was studied using Resonance Enhanced Multiphoton Ionization (REMPI) and time-sliced Velocity Map Imaging (VMI). CO2 molecules seeded in He were heated in an SiC tube attached to a pulsed valve and supersonically expanded to create a molecular beam of rotationally cooled but vibrationally hot CO2. Photodissociation was observed from vibrationally excited CO2 with internal energies up to about 20 000 cm-1, and CO(X1Σ+), O(3P), and O(1D) products were detected by REMPI. The large enhancement in the absorption cross section with increasing CO2 vibrational excitation made this investigation feasible. The internal energies of heated CO2 molecules that absorbed 230 nm radiation were estimated from the kinetic energy release (KER) distributions of CO(X1Σ+) products in v″ = 0. At 230 nm, CO2 needs to have at least 4000 cm-1 of rovibrational energy to absorb the UV radiation and produce CO(X1Σ+) + O(3P). CO2 internal energies in excess of 16 000 cm-1 were confirmed by observing O(1D) products. It is likely that initial absorption from levels with high bending excitation accesses both the A1B2 and B1A2 states, explaining the nearly isotropic angular distributions of the products. CO(X1Σ+) product internal energies were estimated from REMPI spectroscopy, and the KER distributions of the CO(X1Σ+), O(3P), and O(1D) products were obtained by VMI. The CO product internal energy distributions change with increasing CO2 temperature, suggesting that more than one dynamical pathway is involved when the internal energy of CO2 (and the corresponding available energy) increases. The KER distributions of O(1D) and O(3P) show broad internal energy distributions in the CO(X1Σ+) cofragment, extending up to the maximum allowed by energy but peaking at low KER values. Although not all the observations can be explained at this time, with the aid of available theoretical studies of CO2 VUV

  4. The Effect of Surface Conditions on the Mach Reflection Phenomenon.

    DTIC Science & Technology

    1985-09-01

    parts: 1) the reflection of a planar shock wave over rough surfaces, and 2) the ref lection of a planar shock wave over a liquid surface. ker, j~~5 In...rough surfaces, and 2) the reflection of a planar shock wave over a liquid surface. In accordance with these two parts, the following final report is...only. In the first model (the pressure loss mrxe1, the transition from PR to MR is assuTce] to be relate:, to t!he pressure loss due to the increaed5

  5. Stochastic Dynamics and Bifurcation Behavior of Nonlinear Nonconservative Systems in the Presence of Noise

    DTIC Science & Technology

    1990-08-31

    diagonalizable matrix A satisfy 5 Xi i k for j = 1,2,...,n, Ik ki = >k 2 (2) 1 where k is an integer vector k = (k1 , ,..., kn) with k1 > 0. Furthermore...stochastic systems and secondly, to demonstrate the relationship between stochastic averaging and normal form theory for non- nilpotent systems. To this...for large k. Furthermore, since the matrix A is diagonal, the image of LA, Im(LA), and its null space, ker (LA), span the whole space. Consequently, in

  6. Temperature dependence of the photodissociation of CO2 from high vibrational levels: 205-230 nm imaging studies of CO(X(1)Σ(+)) and O((3)P, (1)D) products.

    PubMed

    Sutradhar, S; Samanta, B R; Samanta, A K; Reisler, H

    2017-07-07

    The 205-230 nm photodissociation of vibrationally excited CO2 at temperatures up to 1800 K was studied using Resonance Enhanced Multiphoton Ionization (REMPI) and time-sliced Velocity Map Imaging (VMI). CO2 molecules seeded in He were heated in an SiC tube attached to a pulsed valve and supersonically expanded to create a molecular beam of rotationally cooled but vibrationally hot CO2. Photodissociation was observed from vibrationally excited CO2 with internal energies up to about 20 000 cm(-1), and CO(X(1)Σ(+)), O((3)P), and O((1)D) products were detected by REMPI. The large enhancement in the absorption cross section with increasing CO2 vibrational excitation made this investigation feasible. The internal energies of heated CO2 molecules that absorbed 230 nm radiation were estimated from the kinetic energy release (KER) distributions of CO(X(1)Σ(+)) products in v″ = 0. At 230 nm, CO2 needs to have at least 4000 cm(-1) of rovibrational energy to absorb the UV radiation and produce CO(X(1)Σ(+)) + O((3)P). CO2 internal energies in excess of 16 000 cm(-1) were confirmed by observing O((1)D) products. It is likely that initial absorption from levels with high bending excitation accesses both the A(1)B2 and B(1)A2 states, explaining the nearly isotropic angular distributions of the products. CO(X(1)Σ(+)) product internal energies were estimated from REMPI spectroscopy, and the KER distributions of the CO(X(1)Σ(+)), O((3)P), and O((1)D) products were obtained by VMI. The CO product internal energy distributions change with increasing CO2 temperature, suggesting that more than one dynamical pathway is involved when the internal energy of CO2 (and the corresponding available energy) increases. The KER distributions of O((1)D) and O((3)P) show broad internal energy distributions in the CO(X(1)Σ(+)) cofragment, extending up to the maximum allowed by energy but peaking at low KER values. Although not all the observations can be explained at this time, with the aid of

  7. Formation of inner-shell autoionizing CO+ states below the CO++ threshold

    SciTech Connect

    Osipov, Timur; Weber, Thorsten; Rescigno, Thomas N; Lee, Sun; Orel, Ann; Schoffler, Markus; Sturm, Felix; Schossler, S.; Lenz, U.; Havermeier, T.; Kuhnel, M.; Jahnke, Till; Williams, J. B.; Ray, D.; Landers, Alan; Dorner, Reinhard; Belkacem, Ali

    2009-12-27

    We report a kinematically complete experiment on the production of CO{sup +} autoionizing states following photoionization of carbon monoxide below its vertical double ionization threshold. Momentum imaging spectroscopy is used to measure the energies and body-frame angular distributions of both photo- and autoionization electrons, as well as the kinetic energy release (KER) of the atomic ions. This data, in combination with ab initio theoretical calculations, provides insight into the nature of the cation states produced and their subsequent dissociation into autoionizing atomic (O*) fragments.

  8. Dissociation dynamics of diatomic molecules in intense fields

    NASA Astrophysics Data System (ADS)

    Magrakvelidze, Maia

    We study the dynamics of diatomic molecules (dimers) in intense IR and XUV laser fields theoretically and compare the results with measured data in collaboration with different experimental groups worldwide. The first three chapters of the thesis cover the introduction and the background on solving time-independent and time-dependent Schrodinger equation. The numerical results in this thesis are presented in four chapters, three of which are focused on diatomic molecules in IR fields. The last one concentrates on diatomic molecules in XUV pulses. The study of nuclear dynamics of H2 or D2 molecules in IR pulses is given in Chapter 4. First, we investigate the optimal laser parameters for observing field-induced bond softening and bond hardening in D2+. Next, the nuclear dynamics of H2 + molecular ions in intense laser fields are investigated by analyzing their fragment kinetic-energy release (KER) spectra as a function of the pump-probe delay τ Lastly, the electron localization is studied for long circularly polarized laser pulses. Chapter 5 covers the dissociation dynamics of O2+ in an IR laser field. The fragment KER spectra are analyzed as a function of the pump-probe delay τ Within the Born-Oppenheimer approximation, we calculate ab-initio adiabatic potential-energy curves and their electric dipole couplings, using the quantum chemistry code GAMESS. In Chapter 6, the dissociation dynamics of the noble gas dimer ions He 2+, Ne2+, Ar2 +, Kr2+, and Xe2 + is investigated in ultrashort pump and probe laser pulses of different wavelengths. We observe a striking "delay gap" in the pump-probe-delay-dependent KER spectrum only if the probe-pulse wavelength exceeds the pump-pulse wavelength. Comparing pump-probe-pulse-delay dependent KER spectra for different noble gas dimer cations, we quantitatively discuss quantum-mechanical versus classical aspects of the nuclear vibrational motion as a function of the nuclear mass. Chapter 7 focuses on diatomic molecules in XUV

  9. An Evaluation of a Computerized C3 Decision Aid.

    DTIC Science & Technology

    1980-03-01

    Iotitv~ un--ii- 1 ’e- oshv tyoically served the rIeCliiOn M’aKer well, an-i np/s5-A can reflect on some oersonal history -)f nr .- uctive rel iance .. n...8217 "’ "’P, 1 A B7 i : I IF;:; /’:7i’: .L-: 4i, L ,ljii D10 NOT W 80 6 3 057 DISCLAIMER NOTICE THIS DOCUMENT IS BEST QUALITY PRACTICABLE. THE COPY FURNISHED...Cailfornia 93940 I I CONTROLLING OPPICCENAME AND ADDRESS 2a"I-DT Naval Postgraduate School ____________________ Monterey, California 93940 1 .MONITORING

  10. Preliminary studies of analgesic and anti-inflammatory properties of Opuntia dillenii aqueous extract.

    PubMed

    Loro, J F; del Rio, I; Pérez-Santana, L

    1999-11-01

    Opuntia dillenii (Ker-Gawl) Haw is a cactus that belongs to the family Opuntiae. Lyophilized aqueous extract of the fruits of the plant, used in Canarian traditional medicine for gastrointestinal and bronchial troubles, was evaluated for analgesic and anti-inflammatory properties in rats and mice. The Opuntia dillenii extract (100-400 mg/kg, i.p.) inhibited, in a dose-related manner, carrageenan-induced paw edema in rats. A dose-dependent action was obtained against chemical (writhing test) and thermic (hot plate test) stimuli, respectively, with doses of 50 and 100 mg/kg.

  11. An interdecadal change in the relationship between the western North Pacific Ocean and the East Asian summer monsoon

    NASA Astrophysics Data System (ADS)

    Yu, Peilong; Zhang, Lifeng; Zhong, Quanjia

    2017-08-01

    This study reveals that the relationship between the western North Pacific Ocean (WNPO; 0-55°N, 100-165°E) and the East Asian summer monsoon (EASM) experiences a well-defined interdecadal change in the late 1980s and early 1990s. The EASM-related WNPO sea surface temperature anomaly (SSTA) pattern changes from the dipole pattern [WNPO dipole (WNPOD)] that develops over the period between 1968 and 1987 (P1) to a tripole pattern [WNPO tripole (WNPOT)] between 1991 and 2010 (P2). The positive (negative) phase of the WNPOD is characterized by warm (cold) SSTAs in the Japan Sea and Kuroshio-Oyashio Extension region, and cold (warm) SSTAs in the subtropical WNPO, whereas the positive (negative) phase of the WNPOT shows warming (cooling) in the Kuroshio Extension region (KER), and cooling (warming) in the south of Kamchatka Peninsula (SKP) and Philippine Sea (PS). During P1 (P2), the WNPOD (WNPOT) can be regarded as the first (second) leading mode of summer WNPO SST variability, and its positive phase is associated with a weakened WNPO subtropical high and thereby the deficient summer rainfall in the Yangtze River valley, together with a strong EASM, and vice versa. The change in the WNPO-EASM relationship may be caused by interdecadal changes in the relationship of the equatorial central Pacific (ECP) with the WNPO and EASM, and an increase in summer KER SST variability. During P2, because the ECP warming-induced cyclonic anomalies move northwestwards and intensify, summertime ECP warming is able to generate a strong EASM and significant cooling over the two poles of the WNPOT (SKP and PS). These strengthened impacts of the ECP on the WNPOT and EASM contribute to the strengthened WNPOT-EASM relationship during P2. In addition, summer KER SST variability increases between 1991 and 2010, and this may have enhanced the impact of the KER on the EASM during P2. These two factors probably cause the EASM-related WNPO SSTA pattern to change from the WNPOD in P1 to the WNPOT in

  12. Markovian Shock Models, Deterioration Processes, Stratified Markov Processes and Replacement Policies.

    DTIC Science & Technology

    1986-05-05

    1 ):: ). "-e i,<ti a_) ’’-s ro 0 so it{ rv s,’, ve ’ i;, . ’. n,’] T of" :’ ’y’ i 𔃼 1 ’. ,,th , w th K nic ker bor rk,. r , . Fluid .’rch. , 15 1 1...1984) In this Letter we show that the fixed points of the Ikeda map are more unstable to perturbations with a short- scale transverse structure than to...solutions of the plane-wave map (1) are type. This instability changes the whole character of more unstable to perturbations with a short- scale the

  13. The Associative Memory System for the Ftk Processor at Atlas

    NASA Astrophysics Data System (ADS)

    Magalotti, D.; Citraro, S.; Donati, S.; Luciano, P.; Piendibene, M.; Giannetti, P.; Lanza, A.; Verzellesi, G.; Andreas, Sakellariou; Billereau, W.; Combe, J. M.

    2014-06-01

    In high energy physics experiments, the most interesting processes are very rare and hidden in an extremely large level of background. As the experiment complexity, accelerator backgrounds, and instantaneous luminosity increase, more effective and accurate data selection techniques are needed. The Fast TracKer processor (FTK) is a real time tracking processor designed for the ATLAS trigger upgrade. The FTK core is the Associative Memory system. It provides massive computing power to minimize the processing time of complex tracking algorithms executed online. This paper reports on the results and performance of a new prototype of Associative Memory system.

  14. An interdecadal change in the relationship between the western North Pacific Ocean and the East Asian summer monsoon

    NASA Astrophysics Data System (ADS)

    Yu, Peilong; Zhang, Lifeng; Zhong, Quanjia

    2016-09-01

    This study reveals that the relationship between the western North Pacific Ocean (WNPO; 0-55°N, 100-165°E) and the East Asian summer monsoon (EASM) experiences a well-defined interdecadal change in the late 1980s and early 1990s. The EASM-related WNPO sea surface temperature anomaly (SSTA) pattern changes from the dipole pattern [WNPO dipole (WNPOD)] that develops over the period between 1968 and 1987 (P1) to a tripole pattern [WNPO tripole (WNPOT)] between 1991 and 2010 (P2). The positive (negative) phase of the WNPOD is characterized by warm (cold) SSTAs in the Japan Sea and Kuroshio-Oyashio Extension region, and cold (warm) SSTAs in the subtropical WNPO, whereas the positive (negative) phase of the WNPOT shows warming (cooling) in the Kuroshio Extension region (KER), and cooling (warming) in the south of Kamchatka Peninsula (SKP) and Philippine Sea (PS). During P1 (P2), the WNPOD (WNPOT) can be regarded as the first (second) leading mode of summer WNPO SST variability, and its positive phase is associated with a weakened WNPO subtropical high and thereby the deficient summer rainfall in the Yangtze River valley, together with a strong EASM, and vice versa. The change in the WNPO-EASM relationship may be caused by interdecadal changes in the relationship of the equatorial central Pacific (ECP) with the WNPO and EASM, and an increase in summer KER SST variability. During P2, because the ECP warming-induced cyclonic anomalies move northwestwards and intensify, summertime ECP warming is able to generate a strong EASM and significant cooling over the two poles of the WNPOT (SKP and PS). These strengthened impacts of the ECP on the WNPOT and EASM contribute to the strengthened WNPOT-EASM relationship during P2. In addition, summer KER SST variability increases between 1991 and 2010, and this may have enhanced the impact of the KER on the EASM during P2. These two factors probably cause the EASM-related WNPO SSTA pattern to change from the WNPOD in P1 to the WNPOT in

  15. Secure Design Patterns

    DTIC Science & Technology

    2009-03-01

    Kernighan , Brian W. & Pike, Rob. The Practice of Programming. Addison-Wesley, 1999 (ISBN 020161586X). [Massa 2008] Massa, Jacques. “Migrate an...from Kernighan and Pike’s The Practice of Programming [Ker- nighan 1999] • well-known basic design patterns from [Gamma 1995] 1.2.3 Intended Audience...Developer Shed, March 6, 2007. http://www.devshed.com/c/a/PHP/Validating-User-Input-with-the-Strategy-Pattern/ 61 | CMU/SEI-2009-TR-010 [ Kernighan 1999

  16. Cultural Resources Literature Search and Records Review of the Upper Minnesota River Subbasin, Southwestern Minnesota and Northeastern South Dakota. Volume 1.

    DTIC Science & Technology

    1980-05-01

    River. Murdock Caneron died there in 1811. Thomas G. Anderson traded there from 1808 to 1810. Other tra- ders included James H. Lockwood from 1816 to 1818...Sioux Agency State Park; follow this border to the bor- der of section 28 & 29, T 115 N., R 38 W ; thence south on this line to the bank of the Yellow...constructed by Schr -ker in 1885 at a location adjoining the brewery (now removed). The bar and dance hall establishment served as an outlet for the

  17. Convergence and reproducibility in molecular dynamics simulations of the DNA duplex d(GCACGAACGAACGAACGC).

    PubMed

    Galindo-Murillo, Rodrigo; Roe, Daniel R; Cheatham, Thomas E

    2015-05-01

    The structure and dynamics of DNA are critically related to its function. Molecular dynamics simulations augment experiment by providing detailed information about the atomic motions. However, to date the simulations have not been long enough for convergence of the dynamics and structural properties of DNA. Molecular dynamics simulations performed with AMBER using the ff99SB force field with the parmbsc0 modifications, including ensembles of independent simulations, were compared to long timescale molecular dynamics performed with the specialized Anton MD engine on the B-DNA structure d(GCACGAACGAACGAACGC). To assess convergence, the decay of the average RMSD values over longer and longer time intervals was evaluated in addition to assessing convergence of the dynamics via the Kullback-Leibler divergence of principal component projection histograms. These molecular dynamics simulations-including one of the longest simulations of DNA published to date at ~44μs-surprisingly suggest that the structure and dynamics of the DNA helix, neglecting the terminal base pairs, are essentially fully converged on the ~1-5μs timescale. We can now reproducibly converge the structure and dynamics of B-DNA helices, omitting the terminal base pairs, on the μs time scale with both the AMBER and CHARMM C36 nucleic acid force fields. Results from independent ensembles of simulations starting from different initial conditions, when aggregated, match the results from long timescale simulations on the specialized Anton MD engine. With access to large-scale GPU resources or the specialized MD engine "Anton" it is possible for a variety of molecular systems to reproducibly and reliably converge the conformational ensemble of sampled structures. This article is part of a Special Issue entitled: Recent developments of molecular dynamics. Copyright © 2014. Published by Elsevier B.V.

  18. The 11th INTEGRAL Conference: Gamma-Ray Astrophysics in Multi-Wavelength Perspective

    NASA Astrophysics Data System (ADS)

    SRON Netherlands Institute for Space Research and the Anton Pannekoek Institute for Astronomy of the University of Amsterdam have organised the 11th INTEGRAL Conference. The meeting focused on the astrophysics of highly energetic phenomena that are observed with INTEGRAL, taking into account advanced modelling and observational constraints from all wavelengths (and other cosmic messengers). The programme provided a broad perspective of the findings of INTEGRAL in synergy with other space observatories (XMM-Newton, Chandra, NuStar, Swift, ASTROSAT, Hitomi, Fermi, etc.) and ground-based facilities (LOFAR, H.E.S.S., Veritas, MAGIC, etc.). It addressed key open questions in the field and novel ideas to resolve them.

  19. Nonlinear Optimization Involving Polynomial Matrices and Their Generalized Inverses

    DTIC Science & Technology

    1988-12-01

    Since k is an arbitrary number of equations, this holds true for all k. This completes the proof. 103 B bi i oar aDhv 1. Anton . Howard . Elementary Linear ...interface it has with the Fundamental Theorem of Linear Algebra previously 47 A [A I]Initial A( Canonical I For mn Elementary Transformations 0 0 A1.22...as well as the strong interface between the ST method and the Fundamental Theorem of Linear Algebra . Finally selected application problems are solved

  20. Apathy, empathy, physicians, and Chekhov.

    PubMed

    Gianakos, D

    1997-01-01

    Healing depends on a caring, involved physician. In his story "Ward Number Six," Anton Chekhov illustrated how patients suffer when physicians become apathetic. Reading this story may inspire physicians to resist apathy and assume greater responsibility for the social conditions that impact on their patients' well-being. It may also stimulate physicians' imagination in such a way as to improve their ability to empathize with their patients. Finally, the act of reading itself--particularly reading great literature such as "Ward Number Six," can help rejuvenate those physicians who struggle with their own apathy.

  1. Creativity and mood disorders: The enigmatic case of Isaak Il'ich Levitan (1860-1900).

    PubMed

    Lerner, Vladimir; Margolin, Jacob; Witztum, Eliezer

    2015-08-25

    Isaak Levitan (1860-1900) was one of Russia's most influential landscape artists. He lived a very short life, only 40 years, but left more than 1000 paintings. He suffered from mood fluctuations, and died as a result of serious heart disease. After an introduction related to the issue of creativity and mental disorders, a short biography of Levitan's life is outlined, followed by some examples of his mood and behavior. A section on the mood's reflection in Levitan's professional work is followed by a description of his romantic loves and disappointments and his relationship with his contemporary Russian, the writer Anton Chekhov.

  2. Pigment characterization of important golden age panel paintings of the 17th century

    NASA Astrophysics Data System (ADS)

    Pięta, Ewa; Proniewicz, Edyta; Szmelter-Fausek, Bożena; Olszewska-Świetlik, Justyna; Proniewicz, Leonard M.

    2015-02-01

    Samples were obtained from two world-famous 17th century panel paintings of the Gdańsk school of panting: 'Seven Acts of Charity' (1607, in St. Mary's Church in Gdańsk, Poland) by Anton Möller and 'Angelic Concert' (1611, in Diocesan Museum in Pelplin, Poland) by Hermann Han. Micro-Raman spectroscopy (MRS), optical microscopy (OM), and X-ray fluorescence (XRF) spectroscopy studies of the samples were performed to characterize the pigments present in the individual painting layers (a rich palette of white, black, blue, red, and yellow pigments) and the pictorial techniques used by the artists.

  3. jsc2017e114488

    NASA Image and Video Library

    2017-09-01

    jsc2017e114488 (Sept. 1, 2017) --- Expedition 53-54 prime crewmember Alexander Misurkin of Roscosmos (foreground) and his backup and fellow cosmonaut Anton Shkaplerov lay flowers at the Kremlin Wall in Red Square in Moscow Sept. 1 as part of traditional pre-launch ceremonies. Misurkin and Joe Acaba and Mark Vande Hei of NASA will launch Sept. 13 from the Baikonur Cosmodrome in Kazakhstan Sept. 13 on the Soyuz MS-06 spacecraft for a five and a half month mission on the International Space Station. Credit: NASA/Elizabeth Weissinger

  4. jsc2014e092329

    NASA Image and Video Library

    2014-11-06

    4108: At the Kremlin Wall in Red Square in Moscow, Expedition 42/43 crewmember Samantha Cristoforetti of the European Space Agency lays flowers Nov. 6 at the site where Russian space icons are interred. Cristoforetti, Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) and Terry Virts of NASA will launch Nov. 24, Kazakh time from the Baikonur Cosmodrome in Kazakhstan on their Soyuz TMA-15M spacecraft for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  5. Earth observation taken by the Expedition 43 crew

    NASA Image and Video Library

    2015-04-01

    ISS043E080914 (04/01/2015) --- This Earth view from the International Space Station Apr. 1, 2015 (bottom left corner) is Soyuz TMA-15M which carried NASA astronaut Terry Virts, ESA (European Space Agency) astronaut Samantha Cristoforetti and Russian cosmonaut Anton Shkaplerov to the ISS back in No. 2014 and will remain until May 2015. The further one (top left corner) is Progress 57 a Russian supply spaceship which launched and docked in October last year and will undock at the end of April to return to Earth.

  6. Expedition 30 Crew Members celebrate Christmas in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-25

    ISS030-E-015666 (25 Dec. 2011) --- The six Expedition 30 crew members assemble in the U.S. Lab (Destiny) aboard the International Space Station for a brief celebration of the Christmas holiday on Dec. 25. In front are Expedition 30 Commander Dan Burbank (right) and Flight Engineer Oleg Kononenko. On the back row, left to right, are Flight Engineers Don Pettit, Anatoly Ivanishin, Andre Kuipers and Anton Shkaplerov (suspended with his feet anchored above the group). Burbank and Pettit are NASA astronauts; Kononenko, Shkaplerov and Ivanishin are Russian cosmonauts; and Kuipers represents the European Space Agency.

  7. Expedition 30 Crew Members celebrate Christmas in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-25

    ISS030-E-015660 (25 Dec. 2011) --- The six Expedition 30 crew members assemble in the U.S. Lab (Destiny) aboard the International Space Station for a brief celebration of the Christmas holiday on Dec. 25. In front are Expedition 30 Commander Dan Burbank (right) and Flight Engineer Oleg Kononenko. On the back row, left to right, are Flight Engineers Don Pettit, Anatoly Ivanishin, Andre Kuipers and Anton Shkaplerov (suspended with his feet anchored above the group). Burbank and Pettit are NASA astronauts; Kononenko, Shkaplerov and Ivanishin are Russian cosmonauts; and Kuipers represents the European Space Agency.

  8. Expedition 30 Crew Members celebrate Christmas in the U.S. Laboratory

    NASA Image and Video Library

    2011-12-25

    ISS030-E-015674 (25 Dec. 2011 --- The six Expedition 30 crew members assemble in the U.S. Lab (Destiny)aboard the International Space Station for a brief celebration of the Christmas holiday on Dec. 25. In front are Expedition 30 Commander Dan Burbank (right) and Flight Engineer Oleg Kononenko. On the back row, left to right, are Flight Engineers Don Pettit, Anatoly Ivanishin, Andre Kuipers and Anton Shkaplerov (suspended with his feet anchored above the group). Burbank and Pettit are NASA astronauts; Kononenko, Shkaplerov and Ivanishin are Russian cosmonauts; and Kuipers represents the European Space Agency.

  9. Very Large Scale Integration of Nano-Patterned YBa2Cu3O7-delta Josephson Junctions in a Two-Dimensional Array

    DTIC Science & Technology

    2010-03-26

    Array Shane A. Cybart,∗,†,‡ Steven M. Anton,†,‡ Stephen M. Wu,†,‡ John Clarke,†,‡ and Robert C. Dynes†,‡ Department of Physics, University of California...bias currents in the opposite direction, the asymmetry had the opposite sign, consistent with our interpretation. We analyzed our data using the Bardeen ...B 2000, 63, 024511. (42) Bardeen , J.; Stephen, M. J. Phys. Rev 1965, 140, A1197. (43) Welty, R. P.; Martinis, J. M. IEEE Trans. Magn. 1991, 27, 2924

  10. Expedition 42 Door Signing

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) performs the traditional door signing at the Cosmonaut Hotel prior to departing the hotel for launch in a Soyuz rocket with fellow crewmates, Flight Engineers Samantha Cristoforetti of the European Space Agency (ESA) and Terry Virts of NASA, Sunday, Nov. 23, 2014 in Baikonur, Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 Kazakhstan time and will carry Shkaplerov, Cristoforetti, and Virts into orbit to begin their five and a half month mission on the International Space Station. Photo Credit (NASA/Aubrey Gemignani)

  11. Expedition 42 Door Signing

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Flight Engineer Terry Virts of NASA performs the traditional door signing at the Cosmonaut Hotel prior to departing the hotel for launch in a Soyuz rocket with fellow crewmates, Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) and Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA), Sunday, Nov. 23, 2014 in Baikonur, Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 Kazakhstan time and will carry Virts, Shkaplerov, and Cristoforetti into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  12. Expedition 42 Door Signing

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA), performs the traditional door signing at the Cosmonaut Hotel prior to departing the hotel for launch in a Soyuz rocket with fellow crewmates, Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) and Flight Engineer Terry Virts of NASA, Sunday, Nov. 23, 2014 in Baikonur, Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 Kazakhstan time and will carry Cristoforetti, Virts, and Shkaplerov into orbit to begin their five and a half month mission on the International Space Station. Photo Credit (NASA/Aubrey Gemignani)

  13. Music and biology at the Naples Zoological Station.

    PubMed

    Fantini, Bernardino

    2015-01-01

    Anton Dohrn projected the Stazione Zoologica as composed of two complementary halves: nature and culture. This attitude was not only expression of the general cultural background of the nineteenth century cultural elite, for Dohrn both formed a coherent and organized whole. In my essay I will analyse the different levels of the relationship between music and biology. In particular, I will demonstrate that both share similar "styles of thought". In the last part I will show that Dohrn's most important scientific contribution, the concept or "principle" of Functionswechsel, provides evidence for the link he had established between music and biology.

  14. Soyuz TMA-22/28S departs the ISS

    NASA Image and Video Library

    2012-04-27

    ISS031-E-005056 (27 April 2012) --- The Soyuz TMA-22 spacecraft departs from the International Space Station and heads toward a landing on April 27, 2012. Inside the Soyuz, NASA astronaut Dan Burbank, Expedition 30 commander; along with Russian cosmonauts Anton Shkaplerov, Soyuz commander, and Anatoly Ivanishin, flight engineer, were looking forward to putting their feet on terra firma for the first time in more than five months onboard the station, where they served as members of the Expedition 29 and 30 crews. At the time of this photo the two spacecraft were over the northwestern Pacific Ocean. With the aid of sun glint, ice floes can be seen clearly.

  15. Expedition 42 Pressure Check

    NASA Image and Video Library

    2014-11-23

    Expedition 42 crew members, Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos), left, Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA), center, and Flight Engineer Terry Virts of NASA, right, prepare for pressure checks of their Sokol suits in Building 254 following their suit up for launch, Sunday, Nov. 23, 2014, at the Baikonur Cosmodrome in Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 and will carry Virts, Shkaplerov, and Cristoforetti into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  16. Expedition 42 Pressure Check

    NASA Image and Video Library

    2014-11-23

    Expedition 42 crew members, Flight Engineer Terry Virts of NASA, left, Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos), center, and Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA), right, prepare for pressure checks of their Sokol suits in Building 254 following their suit up for launch, Sunday, Nov. 23, 2014, at the Baikonur Cosmodrome in Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 and will carry Virts, Shkaplerov, and Cristoforetti into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  17. Expedition 42 Pressure Check

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA) waits for a pressure check of her Sokol suit in Building 254 following her suit up for launch, Sunday, Nov. 23, 2014, at the Baikonur Cosmodrome in Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 and will carry Cristoforetti and fellow crewmates, Flight Engineer Terry Virts of NASA and Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  18. Expedition 42 Pressure Check

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Flight Engineer Terry Virts of NASA waits for a pressure check of his Sokol suit in Building 254 following his suit up for launch, Sunday, Nov. 23, 2014, at the Baikonur Cosmodrome in Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 and will carry Virts and fellow crewmates, Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA) and Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  19. Expedition 42 Pressure Check

    NASA Image and Video Library

    2014-11-23

    Expedition 42 Flight Engineer Terry Virts of NASA gives a thumbs up while waiting for a pressure check of his Sokol suit in Building 254 following his suit up for launch, Sunday, Nov. 23, 2014, at the Baikonur Cosmodrome in Kazakhstan. Launch of the Soyuz rocket is scheduled for the early hours of Nov. 24 and will carry Virts and fellow crewmates, Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA) and Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  20. A case of vertebrobasilar stroke during oxygen-ozone therapy.

    PubMed

    Corea, Francesco; Amici, Serena; Murgia, Nicola; Tambasco, Nicola

    2004-01-01

    Despite only sporadic observations, the use of medical oxygen-ozone therapy is a largely diffused treatment for lumbar disk herniation that has failed to respond to conservative management. Combined intradiscal and periganglionic injection of medical ozone and periganglionic injection of steroids are presumed to have a cumulative effect enhancing the overall outcome of treatment for pain caused by disk herniation. To our knowledge, this is the first reported case of stroke during such medical application. The patient had Anton's syndrome as a result of top of the basilar hypoperfusion.

  1. Strategic and Operational Relevance of Heavy Lift in the United States Marine Corps: CH-53E Program

    DTIC Science & Technology

    2002-07-01

    capabilities of the CH-53E: - Operation EASTERN EXIT - The recovery of Basher 52 (Captain Scott O’Grady Rescue) - Operation ENDURING FREEDOM (covered in the...significant payload. Recovery of Basher 52 Captain Scott O’Grady’s F-16 was shot down while flying over Bosnia on the 2nd of June 1995. The 24th MEU(SOC...Eric Damm USMC, Dr Tom Bowditch , Mr. Anton Jareb, Mr. Robert Bendow Marine Aviation Requirements Study: Summary Report, August 2001(Center for Naval

  2. Pure Dephasing in Flux Qubits due to Flux Noise with Spectral Density Scaling as 1/f(alpha)

    DTIC Science & Technology

    2012-06-05

    Anton, C. Müller, J. Birenbaum, S. O’Kelley, A. Fefferman, D. Golubev, G. Hilton , H.-M. Cho, K. Irwin, F. Wellstood, Gerd Schön, A. Shnirman, John...1 C. Müller,2,3 J. S. Birenbaum,1 S. R. O’Kelley,1 A. D. Fefferman,1,* D. S. Golubev,4 G. C. Hilton ,5 H.-M. Cho,5 K. D. Irwin,5 F. C. Wellstood,6...de Physique Statistique de l’Ecole Normale Supérieure, associé au CNRS et aux Universités Denis Diderot et P.M. Curie, 24 rue Lhomond 75231 Paris

  3. jsc2011e027535

    NASA Image and Video Library

    2011-03-21

    At the Baikonur Cosmodrome in Kazakhstan, Expedition 27 Flight Engineer Ron Garan of NASA (left), Soyuz Commander Alexander Samokutyaev (center) and Flight Engineer Andrey Borisenko (right) are greeted upon their arrival March 21, 2011 by RSC-Energia Vice-President Nikolai Zelenchikov after their flight to the launch site from Star City, Russia. The trio, and their backups, Anatoly Ivanishin, Anton Shkaplerov and Dan Burbank are in the final weeks of training for their launch April 5 (April 4, U.S. time) on the Soyuz TMA-21 spacecraft to the International Space Station. Credit: NASA/Victor Zelentsov

  4. jsc2011e204586

    NASA Image and Video Library

    2011-10-30

    At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 29/30 Soyuz Commander Anton Shkaplerov (left) shares a moment with legendary Russian cosmonaut Alexei Leonov (right), the first human to walk in space, during the departure ceremony October 31, 2011 for Shkaplerov, NASA’s Dan Burbank and Russian Flight Engineer Anatoly Ivanishin as they left for their launch site in Baikonur, Kazakhstan. The trio will launch November 14 from Baikonur on their Soyuz TMA-22 spacecraft for the International Space Station. Credit: NASA

  5. Expedition 30 Landing

    NASA Image and Video Library

    2012-04-27

    NASA and GCTC (Gagarin Cosmonaut Training Center) crew support personnel enter the inflatable medical tent in which Expedition 30 Commander Dan Burbank, and flight engineers Anton Shkaplerov and Anatoly Ivanishin are being checked out shortly after their Soyuz TMA-22 capsule landed out side the town of Arkalyk, Kazakhstan, Friday, April 27, 2012. Burbank, and Russian Cosmonauts Shkaplerov and Ivanishin are returning from more than five months onboard the International Space Station where they served as members of the Expedition 29 and 30 crews. Photo Credit: (NASA/Carla Cioffi)

  6. Expedition 22 Suitup

    NASA Image and Video Library

    2009-12-21

    Expedition 22 crew members, seated from left, NASA Flight Engineer Timothy J. Creamer of the U.S., Soyuz Commander Oleg Kotov of Russia, and Flight Engineer Soichi Noguchi of Japan and their backup crew members, standing from left, NASA’s Doug Wheelock, Russian Anton Shkaplerov and Japan’s Satoshi Furakawa, pose for a group photo shortly after donning their flight suits a few hours before the scheduled launch of the Soyuz TMA-17 spacecraft from the Baikonur Cosmodrome in Kazakhstan, Sunday Dec. 20, 2009. Photo Credit: (NASA/Bill Ingalls)

  7. Expedition 22 Prelaunch Press Conference

    NASA Image and Video Library

    2009-12-19

    Expedition 22 backup crew members, from left, NASA’s Doug Wheelock, Russian Anton Shkaplerov and Japan’s Satoshi Furakawa are seen during during a press conference held at the Cosmonaut Hotel in Baikonur, Kazakhstan, Saturday, Dec., 19, 2009. The launch of the Soyuz spacecraft with Expedition 22 NASA Flight Engineer Timothy J. Creamer of the U.S., Soyuz Commander Oleg Kotov of Russia and Flight Engineer Soichi Noguchi of Japan, is scheduled for Monday, Dec., 21, 2009 at 3:52a.m. Kazakhstan time. Photo Credit (NASA/Bill Ingalls)

  8. The Perseids Aug 11-12, 1996 in Bulgaria

    NASA Astrophysics Data System (ADS)

    Bojurova, E.; Trukchev, I.

    As every year Astroclub "Canopus" organized an extended Perseid observing campaign. Members of the club took part in expedition to Avren village near Varna, at the National Astronomical Observatory (Rojen) and at the National Yought Astronomical Camp in Belite Brezi (South Bulgaria). Here we present some results derived on the basis of data obtained by Biliana Ognianova, Diana Tisheva, Diliana Antonova, Eva Bojurova, Elena Surbinska, Irena Stavreva, Katia Koleva, Lilia Porojanova, Anton Antonov, Denis Mechmedov, Doichin Docinski, Galin Genchev, Ivan Trukhchev, Valentin Velkov. More than 2000 Perseids were recorded. Some other showers were also observed.

  9. Evolution of the gamma/gamma’ Interface Width in a Commercial Nickel Base Superalloy Studied by 3D Atom Probe (Preprint)

    DTIC Science & Technology

    2009-03-01

    6 Reference 1. D . D . Krueger, R. D . Kissinger, R. D . Menzies, and, C. S. Wukusick, U. S. Patent 4,957,567. 2. S. T. Wlodek, M. Kelly, and, D . A...Alden, Superalloys 1996, Ed. R. D . Kissinger, D . J. Deye, D . L. Anton, A. D . Cetel, M. V. Nathal, T. M. Pollock, and, D . A. Woodford, TMS, Warrendale...H.L. Fraser, submitted to Phys. Rev. Lett. 2008. 6. D . Blavette, E. Cadel, and, B. Deconihout, Mater. Char. 2000, vol. 44, pp.133-57. 7. P. M

  10. New crew launches to ISS on This Week @NASA - November 28, 2014

    NASA Image and Video Library

    2014-11-28

    NASA’s Terry Virts and Expedition 42/43 crewmates, Anton Shkaplerov of the Russian Federal Space Agency and the European Space Agency’s Samantha Cristoforetti, launched Nov. 23 at 4:01 p.m. Eastern Standard Time, from Baikonur, Kazakhstan. Almost six hours later, their Soyuz spacecraft docked to the International Space Station – where they joined Expedition 42 Commander Barry Wilmore of NASA, and Flight Engineers Alexander Samokutyaev and Elena Serova of Roscosmos – returning the station crew to its full complement of six people. Also, First 3-D printed object in space, Orion flight test update, New airborne Earth Science missions and Happy Thanksgiving from space!

  11. Excess volumes of binary mixtures of 1,3-dichloropropane with isomeric butanols at 298. 15 and 313. 15 K

    SciTech Connect

    Lafuente, C.; Pardo, J.; Rodriguez, V.; Royo, F.M.; Urieta, J.S. . Dept. de Quimica Organica-Quimica Fisica)

    1993-10-01

    Excess molar volumes, V[sub m][sup E], for binary mixtures of 1,3-dichloropropane with 1-butanol, 2-butanol, 2-methyl-1-propanol, and 2-methyl-2-propanol have been determined from density measurements at 298.15 and 313.15 K by means of an Anton Paar DMA-58 vibrating tube densimeter. V[sub m][sup E] is positive over the whole composition range except for mixtures containing 1-butanol and 2-methyl-1-propanol at 298.15 K in which V[sub m][sup E] shows negative values at low mole fractions of dichloroalkane.

  12. Progress Resupply Vehicle approach

    NASA Image and Video Library

    2012-01-27

    ISS030-E-050883 (27 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov (bottom), Expedition 30 flight engineer, monitors data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012. NASA astronaut Dan Burbank, commander, looks on. Russian cosmonaut Anatoly Ivanishin (bottom background), flight engineer, photographs the approach of the Progress from a Zvezda window.

  13. Progress Resupply Vehicle approach

    NASA Image and Video Library

    2012-01-27

    ISS030-E-050885 (27 Jan. 2012) --- Russian cosmonauts Anton Shkaplerov (bottom) and Oleg Kononenko (center), both Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012. NASA astronaut Dan Burbank, commander, looks on. Russian cosmonaut Anatoly Ivanishin (bottom background), flight engineer, photographs the approach of the Progress from a Zvezda window.

  14. Progress Resupply Vehicle approach

    NASA Image and Video Library

    2012-01-28

    ISS030-E-050933 (27 Jan. 2012) --- Russian cosmonauts Anton Shkaplerov (left) and Oleg Kononenko (partially obscured), both Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012. NASA astronaut Dan Burbank (partially out of frame at right), commander, looks on.

  15. Expedition 30 Crewmembers use manual TORU docking system

    NASA Image and Video Library

    2012-04-22

    ISS030-E-241403 (22 April 2012) --- Russian cosmonauts Anton Shkaplerov (center) and Oleg Kononenko (left foreground); along with NASA astronaut Don Pettit, all Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  16. After Progress Resupply Vehicle Docking

    NASA Image and Video Library

    2012-01-28

    ISS030-E-050949 (27 Jan. 2012) --- NASA astronaut Dan Burbank (right), Expedition 30 commander; Russian cosmonauts Anton Shkaplerov (bottom), Oleg Kononenko (center) and Anatoly Ivanishin (left background); and European Space Agency astronaut Andre Kuipers, all flight engineers, take a moment for a photo in the Zvezda Service Module of the International Space Station following the successful docking of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012.

  17. AFT view of the Transfer Compartment

    NASA Image and Video Library

    2012-04-22

    ISS030-E-241385 (22 April 2012) --- Photographed from the transfer compartment between the Zarya Functional Cargo Block (FGB) and the Zvezda Service Module of the International Space Station, Russian cosmonauts Anton Shkaplerov (left), Oleg Kononenko (right) and Anatoly Ivanishin, all Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in Zvezda during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  18. After Progress Resupply Vehicle Docking

    NASA Image and Video Library

    2012-01-28

    ISS030-E-050946 (27 Jan. 2012) --- NASA astronaut Dan Burbank (right), Expedition 30 commander; Russian cosmonauts Anton Shkaplerov (bottom), Oleg Kononenko (center) and Anatoly Ivanishin (left background); and European Space Agency astronaut Andre Kuipers, all flight engineers, take a moment for a photo in the Zvezda Service Module of the International Space Station following the successful docking of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012.

  19. AFT view of the Transfer Compartment

    NASA Image and Video Library

    2012-04-22

    ISS030-E-241386 (22 April 2012) --- Photographed from the transfer compartment between the Zarya Functional Cargo Block (FGB) and the Zvezda Service Module of the International Space Station, Russian cosmonauts Anton Shkaplerov (left), Oleg Kononenko (right) and Anatoly Ivanishin, all Expedition 30 flight engineers, monitor data at the manual TORU docking system controls in Zvezda during approach and docking operations of the unpiloted ISS Progress 47 resupply vehicle. Progress 47 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 10:39 a.m. (EDT) on April 22, 2012.

  20. Progress Resupply Vehicle approach

    NASA Image and Video Library

    2012-01-27

    ISS030-E-050884 (27 Jan. 2012) --- Russian cosmonaut Anton Shkaplerov (bottom), Expedition 30 flight engineer, monitors data at the manual TORU docking system controls in the Zvezda Service Module of the International Space Station during approach and docking operations of the unpiloted ISS Progress 46 resupply vehicle. Progress 46 docked automatically to the Pirs Docking Compartment via the Kurs automated rendezvous system at 7:00 p.m. (EST) on Jan. 27, 2012. NASA astronaut Dan Burbank, commander, looks on. Russian cosmonaut Anatoly Ivanishin (bottom background), flight engineer, photographs the approach of the Progress from a Zvezda window.

  1. Expedition 40 Press Conference

    NASA Image and Video Library

    2014-05-27

    Expedition 40 prime crew members Flight Engineer Alexander Gerst of the European Space Agency, ESA, far left, Soyuz Commander Maxim Suraev of the Russian Federal Space Agency, Roscosmos, second left, and Flight Engineer Reid Wiseman of NASA, center, pose for a picture with Expedition 40 backup crew members Flight Engineer Terry Virts of NASA, third right, Soyuz Commander Anton Shkaplerov of Roscosmos, and Flight Engineer Samantha Cristoforetti of ESA at the conclusion a press conference, Tuesday, May 27, 2014, at the Cosmonaut Hotel in Baikonur, Kazakhstan. The mission to the International Space Station is set to launch May 29 from the Baikonur Cosmodrome. Photo Credit: (NASA/Joel Kowsky)

  2. Expedition 42 Press Conference

    NASA Image and Video Library

    2014-11-22

    Family visits with Expedition 42 Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) through glass at the conclusion of the press conference, Saturday, Nov. 22, 2014, at the Cosmonaut Hotel in Baikonur, Kazakhstan. Launch of the Soyuz rocket is scheduled for Nov. 24 and will carry Shkaplerov, Flight Engineer Terry Virts of NASA , and Flight Engineer Samantha Cristoforetti of the European Space Agency into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  3. Expedition 42 Press Conference

    NASA Image and Video Library

    2014-11-22

    Flight Engineer Samantha Cristoforetti of the European Space Agency (ESA) speaks with friends and family through glass at the conclusion of the press conference, Saturday, Nov. 22, 2014, at the Cosmonaut Hotel in Baikonur, Kazakhstan. Launch of the Soyuz rocket is scheduled for Nov. 24 and will carry Cristoforetti, Flight Engineer Terry Virts of NASA , and Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) into orbit to begin their five and a half month mission on the International Space Station. Photo Credit: (NASA/Aubrey Gemignani)

  4. jsc2011e203161

    NASA Image and Video Library

    2011-10-23

    With famed St. Basil’s Cathedral in the background, the prime crew for the upcoming Expedition 30 launch to the International Space Station toured Red Square in Moscow October 24, 2011 as part of their ceremonial pre-launch activities. From left to right are Expedition 30 Commander Dan Burbank of NASA, Soyuz Commander Anton Shkaplerov and Anatoly Ivanishin. Burbank, Shkaplerov and Ivanishin will launch on November 14 to the International Space Station in the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Credit: NASA

  5. Expedition 30 Landing

    NASA Image and Video Library

    2012-04-27

    Expedition 30 flight engineer and Russian cosmonaut Anatoly Ivanishin is seen as he is extracted from the Soyuz TMA-22 spacecraft shortly after the capsule landed with Expedition 30 Commander Dan Burbank and flight engineer Anton Shkaplerov in a remote area outside of the town of Arkalyk, Kazakhstan on Friday, April 27, 2012. Ivanishin, Burbank and Shkaplerov are returning from more than five months onboard the International Space Station where they served as members of the Expedition 29 and 30 crews. Photo Credit: (NASA/Carla Cioffi)

  6. Abrasion-Erosion Evaluation of Concrete Mixtures for Stilling Basin Repairs, Kinzua Dam, Pennsylvania.

    DTIC Science & Technology

    1986-09-01

    Federal Building Pittsburgh, PA 15222 Attention: Mr. Anton Krysa Re: Mix Compositions of Microsilica Concrete for the Neville Island Test Dear Mr. Krysa...and look forward to further r associations. Please do not hesitate to contact us regarding further information on the microsilica concrete as needed...wt. 159.2 156.7 156.6 (Ibs/cu. fz-.) Air content. , 1.2 2.5 2.6 S) ump. i n. 10 __;____________ I The surrv contains 50, solid microsilica by we irht

  7. Darwin: German mystic or French rationalist?

    PubMed

    Ghiselin, Michael T

    2015-01-01

    The notion that Charles Darwin embraced the German Romantic tradition seems plausible, given the early influence of Alexander von Humboldt. But this view fails to do justice to other scientific traditions. Darwin was a protégé of the Englishman John Stevens Henslow and was a follower of the Scott Charles Lyell. He had important debts to French scientists, notably Henri Milne-Edwards, Etienne and Isidore Geoffroy Saint-Hilaire, and Alphonse de Candolle. Many Germans were quite supportive of Darwin, but not all of these were encumbered by idealistic metaphysical baggage. Both Darwin and Anton Dohrn treated science as very much a cosmopolitan enterprise.

  8. jsc2014e092317

    NASA Image and Video Library

    2014-11-06

    3851: At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 42/43 crewmember Samantha Cristoforetti of the European Space Agency (right) signs a ceremonial book Nov. 6 as her crewmates, Terry Virts of NASA (left) and Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos, center) look on. Virts, Cristoforetti and Shkaplerov will launch Nov. 24, Kazakh time from the Baikonur Cosmodrome in Kazakhstan on their Soyuz TMA-15M spacecraft for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  9. Optimizing Assignment of Tomahawk Cruise Missile Missions to Firing Units

    DTIC Science & Technology

    2009-01-01

    Brown,2* Wilson Price,2 Anton Rowe,2 Charles F. Fennemore,3 Robert L. Taft3 1 Division of Economics and Business , Colorado School of Mines, Golden...simultaneously optimizes each zk (x), then the multiobjective problem would be clear and simple, but such an ideal solution cannot be guaranteed, and is rare in...objective problems (Hk), for k = 1, . . . , |K|: (Hk) : z ∗ k = min zk (x) s.t. x ∈ θ zk ′(x) = z∗k′ , ∀k′ < k One weakness of this hierarchical

  10. The FUor Candidate V582 Aurigae: First Photometric and Spectroscopic Observations

    NASA Astrophysics Data System (ADS)

    Semkov, Evgeni H.; Peneva, Stoyanka P.; Dennefeld, Michel

    One of the most attractive events in the pre-main sequence evolution is the FU Orionis (FUor) outburst. Because only a small number of FUor stars have been detected to date, photometric and spectral studies of every new object are of great interest. Recently, a new FUor candidate was discovered by Anton Khruslov - V582 Aur. To confirm the FUors nature of this object we started regular photometric observations with the telescopes of the National Astronomical Observatory Rozhen (Bulgaria). A high-resolution spectrum of V582 Aur was obtained with the 1.93 m telescope in Haute-Provence Observatory (France).

  11. Identification of two new keratinolytic proteases from a Bacillus pumilus strain using protein analysis and gene sequencing.

    PubMed

    Fellahi, Soltana; Chibani, Abdelwaheb; Feuk-Lagerstedt, Elisabeth; Taherzadeh, Mohammad J

    2016-12-01

    The Bacillus strain (CCUG 66887) has a high capacity to excrete keratinase with the ability to degrade both alpha- and beta keratin. In this study we aimed to show the characteristics of the keratinolytic protease and to identify its gene by using liquid chromatography-electrospray ionization tandem mass spectrometry methods (nanoHPLC-ESI-MS/MS) followed by Mascot data base search. The results showed that the enzyme in fact consists of two different keratinases, both with a molecular mass of 38 kDa. Further, DNA sequencing generated the open reading frame (ORF) of one of the genes (Ker1), and de novo genome sequencing identified the ORF of the second gene (Ker2). The two keratinase genes contain 1153 base pairs each and have a gene similarity of 67 %. In addition, the Bacillus strain was classified as Bacillus pumilus and its genes were annotated in the GeneBank at NCBI (accession: CP011109.1). Amino acid sequences alignment with known B. pumilus proteases indicated that the two keratinases of B. pumilus strain C4 are subtilisin-like serine proteases belonging to the Protease S8 family. Taken together, these result suggest the two keratinases as promising candidates for enzymatic processing of keratinous wastes in waste refinery.

  12. High resolution Coulomb explosion spectra and angular distributions of fragment ions of N 2 in a femtosecond laser field

    NASA Astrophysics Data System (ADS)

    Shi, Mingyuan; Huang, Shaochuan; Xi, Wei; Liu, Zuoye; Du, Hongchuan; Ding, Baowei; Hu, Bitao

    2017-03-01

    Femtosecond laser field-induced ionization and Coulomb explosion are systematically investigated using high-resolution time-of-flight mass spectroscopy. Meanwhile a good alignment of the N2 is achieved geometrically. Based on the energy and momentum conservation laws, the events from different Coulomb explosion channels are identified accurately and further used to obtain the Kinetic Energy Release (KER) by the created molecular ion pairs and the angular distributions of the fragment ions. The KERs measured at laser intensities varying from 4 × 10^{14} W/cm2 to 2 × 10^{15} W/cm2 are found to stay constant. The angular distributions are measured at laser intensity of 9 × 10^{14} W/cm2. The atomic ions N+, N^{2+} and N^{3+} exhibit highly anisotropic distributions and for higher charge state, the angular distributions become narrower. With good exclusion of channel N(1,0), the non-zeroes normal to the laser polarization vector in channel N(1,1) still exist, which indicates the presence of geometric alignments (GA). The elusive shrink structure at θ=0° for channels N(1,1), N(1,2) and N(2,3) is observed, which implies that the non-sequential process exists, and the electron rescattering plays role in the ionization process.

  13. Observation of two sequential pathways of (CO2 ) 3 + dissociation by heavy-ion impact

    NASA Astrophysics Data System (ADS)

    Yan, S.; Zhu, X. L.; Zhang, P.; Ma, X.; Feng, W. T.; Gao, Y.; Xu, S.; Zhao, Q. S.; Zhang, S. F.; Guo, D. L.; Zhao, D. M.; Zhang, R. T.; Huang, Z. K.; Wang, H. B.; Zhang, X. J.

    2016-09-01

    An experimental investigation of the breakup of (CO2 ) 3 + induced by N e4 + ion impact at incident energies of 1.12 MeV was performed. By analyzing the momentum distributions and the kinetic energies of the three fragment ions, the nonsequential and sequential dissociation mechanisms are verified. In contrast to highly charged ion impact, two different sequential decay pathways were observed in the present experiment. One pathway originates from the primary cation (CO2 ) 3 + populated into +4Σ states by collision charge exchange and its daughter cation (CO) 2 + populated into the two excited states (3Π and X 1Π ) by the first fragmentation step, resulting in a lower KER peak. The other pathway originates from the primary cation (CO2 ) 3 + locating at 6Π state, and its daughter cation (CO) 2 + populated into the metastable excited states 3Π , X 1Π , and +3Σ, leading to the higher KER peak. Our work is a breakup experiment of (CO2 ) 3 + presenting the initial states of the parent cation (CO2 ) 3 + and the metastable states of C O2 + ion simultaneously.

  14. HTLV-I Tax and Cytokeratin: Tax-Expressing Cells Show Morphological Changes in Keratin-Containing Cytoskeletal Networks.

    PubMed

    Trihn, D.; Jeang, K.-T.; Semmes, O.J.

    1997-01-01

    Human T cell leukemia virus type I (HTLV-I) has been linked to the development of an aggressive lymphoproliferative disorder (adult T cell leukemia), a chronic neurodegenerative presentation (HTLV-I-associated myelopathy/tropical spastic paraparesis) and numerous less well-defined inflammatory conditions. The viral regulatory protein Tax has been implicated in cellular transformation events leading to the onset of adult T cell leukemia. Details on the stepwise processes through which Tax induces morphological changes in cells are poorly understood. We show here that Tax can bind to a class of intermediate filaments, the cytokeratins (Ker). Tax interacts with the 1B helical coil of keratin 8, a domain critical for higher-order intermediate filament matrix formation. Expression of Tax in epithelial cells visibly altered the structural pattern of the Ker network. In a T lymphocyte cell line, induction of Tax expression resulted in increased cellular adherence/invasion of Matrigel filters. We propose that one aspect of Tax function is the induction of morphological changes in cellular cytoskeletal structures. This finding for Tax-expressing cells might be one factor contributing directly to the pathogenesis of HTLV-I disease(s). Copyright 1997 S. Karger AG, Basel

  15. Epidermal-specific deletion of CD44 reveals a function in keratinocytes in response to mechanical stress

    PubMed Central

    Shatirishvili, M; Burk, A S; Franz, C M; Pace, G; Kastilan, T; Breuhahn, K; Hinterseer, E; Dierich, A; Bakiri, L; Wagner, E F; Ponta, H; Hartmann, T N; Tanaka, M; Orian-Rousseau, V

    2016-01-01

    CD44, a large family of transmembrane glycoproteins, plays decisive roles in physiological and pathological conditions. CD44 isoforms are involved in several signaling pathways essential for life such as growth factor-induced signaling by EGF, HGF or VEGF. CD44 is also the main hyaluronan (HA) receptor and as such is involved in HA-dependent processes. To allow a genetic dissection of CD44 functions in homeostasis and disease, we generated a Cd44 floxed allele allowing tissue- and time-specific inactivation of all CD44 isoforms in vivo. As a proof of principle, we inactivated Cd44 in the skin epidermis using the K14Cre allele. Although the skin of such Cd44Δker mutants appeared morphologically normal, epidermal stiffness was reduced, wound healing delayed and TPA induced epidermal thickening decreased. These phenotypes might be caused by cell autonomous defects in differentiation and HA production as well as impaired adhesion and migration on HA by Cd44Δker keratinocytes. These findings support the usefulness of the conditional Cd44 allele in unraveling essential physiological and pathological functions of CD44 isoforms. PMID:27831556

  16. Molecular dissociation of D2+ scattered from a polycrystalline nickel surface

    NASA Astrophysics Data System (ADS)

    Hamhami, M.; Djouhri, N.; Chami, A. C.; Richard-Viard, M.; Boudjema, M.

    2008-08-01

    We compare time of flight spectra of atomic D + and molecular D2+ ions specularly scattered from a polycrystalline nickel surface at 4° of incidence and with a velocity corresponding to 1 keV/u. Molecular dissociation is assumed to occur mostly upon resonant neutralisation into the antibonding triplet state of D 2. The kinetic energy released in the dissociation (KER) is distributed over both atomic fragments. We consider the D2+ spectrum as the result of atomic projectiles hitting the surface at different energies and different incidence or azimuthal angles given by the cinematic of the fragmentation. The electronic density of states of Ni, the vibrational levels of D2+ and the image potential shift are taken into consideration to calculate the KER distribution. The resulting broadening function is then applied to the experimental D + spectrum, which is finally compared to the spectrum of D2+. The good agreement found without any adjustable parameter is consistent with the assumption of a complete dissociation by resonant neutralisation on the incoming path.

  17. Sustained expression of keratinase gene under PxylA and PamyL promoters in the recombinant Bacillus megaterium MS941.

    PubMed

    Radha, S; Gunasekaran, P

    2008-09-01

    The ker gene encoding pre-pro keratinase of Bacillus licheniformis MKU3 was cloned with xylose inducible promoter (PxylA) or alpha-amylase promoter (PamyL) or both in Escherichia coli-Bacillus shuttle vector, pWH1520 generating recombinant plasmids pWHK3, pWAK3 and pWXAK3 respectively. Compared with Bacillius megaterium MS941 (pWXAK3) expressing ker gene with PxylA-PamyL promoters, B. megaterium MS941 (pWAK3) with PamyL displayed higher keratinase yield (168.6 U/ml) and specific activity (14.59 U/mg) after 36 h of growth in LB medium, however the keratinase yield decreased in the culture grown in LB medium supplemented with starch or xylose or both. A maximum yield of 186.3 U/ml with specific activity of 17.25 U/mg was obtained from xylose induced keratinase expression in B. megaterium MS941 (pWHK3) grown for 24h. The recombinant plasmids were stably maintained with sustained expression of keratinase for about 60 generations in B. megaterium MS941 rather than in B. megaterium 1,4945.

  18. Adverse Outcome Pathway Development II: Best Practices

    PubMed Central

    Villeneuve, Daniel L.; Crump, Doug; Garcia-Reyero, Natàlia; Hecker, Markus; Hutchinson, Thomas H.; LaLone, Carlie A.; Landesmann, Brigitte; Lettieri, Teresa; Munn, Sharon; Nepelska, Malgorzata; Ottinger, Mary Ann; Vergauwen, Lucia; Whelan, Maurice

    2014-01-01

    Organization of existing and emerging toxicological knowledge into adverse outcome pathway (AOP) descriptions can facilitate greater application of mechanistic data, including those derived through high-throughput in vitro, high content omics and imaging, and biomarker approaches, in risk-based decision making. The previously ad hoc process of AOP development is being formalized through development of internationally harmonized guidance and principles. The goal of this article was to outline the information content desired for formal AOP description and some rules of thumb and best practices intended to facilitate reuse and connectivity of elements of an AOP description in a knowledgebase and network context. For example, key events (KEs) are measurements of change in biological state that are indicative of progression of a perturbation toward a specified adverse outcome. Best practices for KE description suggest that each KE should be defined as an independent measurement made at a particular level of biological organization. The concept of “functional equivalence” can help guide both decisions about how many KEs to include in an AOP and the specificity with which they are defined. Likewise, in describing both KEs and evidence that supports a causal linkage or statistical association between them (ie, a key event relationship; KER), best practice is to build from and contribute to existing KE or KER descriptions in the AOP knowledgebase rather than creating redundant descriptions. The best practices proposed address many of the challenges and uncertainties related to AOP development and help promote a consistent and reliable, yet flexible approach. PMID:25466379

  19. Adverse outcome pathway development II: best practices.

    PubMed

    Villeneuve, Daniel L; Crump, Doug; Garcia-Reyero, Natàlia; Hecker, Markus; Hutchinson, Thomas H; LaLone, Carlie A; Landesmann, Brigitte; Lettieri, Teresa; Munn, Sharon; Nepelska, Malgorzata; Ottinger, Mary Ann; Vergauwen, Lucia; Whelan, Maurice

    2014-12-01

    Organization of existing and emerging toxicological knowledge into adverse outcome pathway (AOP) descriptions can facilitate greater application of mechanistic data, including those derived through high-throughput in vitro, high content omics and imaging, and biomarker approaches, in risk-based decision making. The previously ad hoc process of AOP development is being formalized through development of internationally harmonized guidance and principles. The goal of this article was to outline the information content desired for formal AOP description and some rules of thumb and best practices intended to facilitate reuse and connectivity of elements of an AOP description in a knowledgebase and network context. For example, key events (KEs) are measurements of change in biological state that are indicative of progression of a perturbation toward a specified adverse outcome. Best practices for KE description suggest that each KE should be defined as an independent measurement made at a particular level of biological organization. The concept of "functional equivalence" can help guide both decisions about how many KEs to include in an AOP and the specificity with which they are defined. Likewise, in describing both KEs and evidence that supports a causal linkage or statistical association between them (ie, a key event relationship; KER), best practice is to build from and contribute to existing KE or KER descriptions in the AOP knowledgebase rather than creating redundant descriptions. The best practices proposed address many of the challenges and uncertainties related to AOP development and help promote a consistent and reliable, yet flexible approach.

  20. Rydberg and valence state excitation dynamics: a velocity map imaging study involving the E-V state interaction in HBr.

    PubMed

    Zaouris, Dimitris; Kartakoullis, Andreas; Glodic, Pavle; Samartzis, Peter C; Rafn Hróðmarsson, Helgi; Kvaran, Ágúst

    2015-04-28

    Photoexcitation dynamics of the E((1)Σ(+)) (v' = 0) Rydberg state and the V((1)Σ(+)) (v') ion-pair vibrational states of HBr are investigated by velocity map imaging (VMI). H(+) photoions, produced through a number of vibrational and rotational levels of the two states were imaged and kinetic energy release (KER) and angular distributions were extracted from the data. In agreement with previous work, we found the photodissociation channels forming H*(n = 2) + Br((2)P3/2)/Br*((2)P1/2) to be dominant. Autoionization pathways leading to H(+) + Br((2)P3/2)/Br*((2)P1/2) via either HBr(+)((2)Π3/2) or HBr(+)*((2)Π1/2) formation were also present. The analysis of KER and angular distributions and comparison with rotationally and mass resolved resonance enhanced multiphoton ionization (REMPI) spectra revealed the excitation transition mechanisms and characteristics of states involved as well as the involvement of the E-V state interactions and their v' and J' dependence.

  1. Time-resolved Coulomb-explosion imaging of nuclear wave-packet dynamics induced in diatomic molecules by intense few-cycle laser pulses

    SciTech Connect

    Bocharova, I. A.; Thumm, U.; Ray, D.; Cocke, C. L.; Alnaser, A. S.; Niederhausen, T.; Litvinyuk, I. V.

    2011-01-15

    We studied the nuclear dynamics in diatomic molecules (N{sub 2}, O{sub 2}, and CO) following their interaction with intense near-IR few-cycle laser pulses. Using Coulomb-explosion imaging in combination with the pump-probe approach, we mapped dissociation pathways of those molecules and their molecular ions. We identified all symmetric and asymmetric breakup channels for molecular ions up to N{sub 2}{sup 5+}, O{sub 2}{sup 4+}, and CO{sup 4+}. For each of those channels we measured the kinetic energy release (KER) spectra as a function of delay between the pump and probe pulses. For both N{sub 2} and O{sub 2} the asymmetric (3,1) channel is only observed for short (<20 fs) delays and completely disappears after that. We interpret this observation as a signature of electron localization taking place in dissociating molecular tri-cations when their internuclear separation reaches about 2.5 times the equilibrium bond length. This is a direct confirmation that electron localization plays an essential role in the universal mechanism of enhanced ionization in homonuclear diatomic molecules. Using classical and quantum mechanical simulations of the time-dependent KER spectra, we identify the pathways and intermediate states involved in the laser-induced dissociation of those molecules.

  2. Fragmentation dynamics of Ar2^+ dimers in intense laser fields

    NASA Astrophysics Data System (ADS)

    Magrakvelidze, M.; Wu, J.; Dörner, R.; Thumm, U.

    2012-06-01

    We studied the fragmentation dynamics of the Ar2 dimers in 790 nm pump and 1400 nm probe pulses with intensities of 10^14 W/cm^2 by analyzing kinetic energy release (KER) spectra as a function of the pump probe delay. The KER spectra are measured by detecting Ar-ion fragments in a COLTRIMS [1] setup and are compared with model calculations based on the numerical propagations of the time-dependent Schr"odinger equation [2]. The measured spectra are best reproduced by two-state calculations that include the adiabatic electronic states I(1/2)u and II(1/2)g of Ar2^+, dipole coupled in the pump- and probe-laser electric fields. [4pt] [1] J. Wu, A. Vredenborg, B. Ulrich, L. Ph. H. Schmidt, M. Meckel, S. Voss, H. Sann, H. Kim, T. Jahnke, and R. D"orner, PRA 83, 061403(R) (2011) [0pt] [2] M. Magrakvelidze, F. He, Th. Niederhausen, I. V. Litvinyuk, and U. Thumm, PRA 79, 033410 (2009).

  3. Revisiting molecular ionization: Does a molecule like to share?

    NASA Astrophysics Data System (ADS)

    Madsen, C. B.; Esry, B. D.

    2012-06-01

    The ever-increasing detail obtained in strong-field experiments calls for a deeper understanding of the laser-molecule interaction. For instance, recent measurements reported in PRL 107, 143004 (2011) reveal a limitation in understanding strong-field ionization dynamics in terms of the strong-field approximation. We have addressed the question of how the electron and the nuclei share the energy when H2^+ breaks up in the presence of an intense IR field via the process: H2^++nφ->p+p+e^-. Solving the time-dependent Schr"odinger equation and calculating the ionization probability resolved as a function of the asymptotic electron energy and the nuclear kinetic energy release (KER) allow us to give an answer. The energy sharing is non-trivial and plays an important role in the prediction of, for instance, the KER. We also address the limitations of current understanding of molecular ionization by comparing to models like the strong-field approximation and the Floquet picture. Such benchmarking may be facilitated by XUV+IR pump-probe schemes and carrier-envelope-phase control that allow for time-resolved and spatial probing of the dynamics.

  4. High-throughput microarray mapping of cell wall polymers in roots and tubers during the viscosity-reducing process.

    PubMed

    Huang, Yuhong; Willats, William G; Lange, Lene; Jin, Yanling; Fang, Yang; Salmeán, Armando A; Pedersen, Henriette L; Busk, Peter Kamp; Zhao, Hai

    2016-01-01

    Viscosity reduction has a great impact on the efficiency of ethanol production when using roots and tubers as feedstock. Plant cell wall-degrading enzymes have been successfully applied to overcome the challenges posed by high viscosity. However, the changes in cell wall polymers during the viscosity-reducing process are poorly characterized. Comprehensive microarray polymer profiling, which is a high-throughput microarray, was used for the first time to map changes in the cell wall polymers of sweet potato (Ipomoea batatas), cassava (Manihot esculenta), and Canna edulis Ker. over the entire viscosity-reducing process. The results indicated that the composition of cell wall polymers among these three roots and tubers was markedly different. The gel-like matrix and glycoprotein network in the C. edulis Ker. cell wall caused difficulty in viscosity reduction. The obvious viscosity reduction of the sweet potato and the cassava was attributed to the degradation of homogalacturonan and the released 1,4-β-d-galactan and 1,5-α-l-arabinan.

  5. THE ADVERSE OUTCOME PATHWAY (AOP) FRAMEWORK ...

    EPA Pesticide Factsheets

    An Adverse Outcome Pathway (AOP) represents the organization of current and newly acquired knowledge of biological pathways. These pathways contain a series of nodes (Key Events, KEs) that when sufficiently altered influence the next node on the pathway, beginning from an Molecular Initiating Event (MIE), through intermediate KEs, ending in an Adverse Outcome (AO) which may be used as a basis for decision making. A KE is a measurable biological change, and is linked with other KEs via Key Event Relationships (KERs). A given KE may be involved in several AOPs, leading to a plausible network of biological changes that are involved in an organism’s response to an external stressor. When describing an AOP, five guiding principles have been proposed [1]: 1) an AOP is not specific to a single external stressor, 2) AOPs are modular, with KEs and KERs that can be used in several AOPs, 3) a single AOP is the unit of development, 4) most biological responses will be the result of networks of AOPs, and 5) AOPs will be modified as more biological knowledge becomes available. The collaborative development of AOPs is recommended to be performed using the AOP-Wiki (https://aopwiki.org), which is an effort between the European Commission – DG Joint Research Centre (JRC) and U.S. Environmental Protection Agency (EPA). The Wiki is one part of a larger OECD-sponsored AOP Knowledgebase effort, which is a repository for all AOPs developed as part of the Organization for Economic

  6. Early modern experimentation on live animals.

    PubMed

    Bertoloni Meli, Domenico

    2013-01-01

    Starting from the works by Aselli (De lactibus sive lacteis venis, 1627) on the milky veins and Harvey (1628, translated in 1993) on the motion of the heart and the circulation of the blood, the practice of vivisection witnessed a resurgence in the early modern period. I discuss some of the most notable cases in the century spanning from Aselli's work to the investigations of fluid pressure in plants and animals by Stephen Hales (Vegetable Staticks, 1727). Key figures in my study include Johannes Walaeus, Jean Pecquet, Marcello Malpighi, Reinier de Graaf, Richard Lower, Anton Nuck, and Anton de Heide. Although vivisection dates from antiquity, early modern experimenters expanded the range of practices and epistemic motivations associated with it, displaying considerable technical skills and methodological awareness about the problems associated with the animals being alive and the issue of generalizing results to humans. Many practitioners expressed great discomfort at the suffering of the animals; however, many remained convinced that their investigations were not only indispensable from an epistemic standpoint but also had potential medical applications. Early modern vivisection experiments were both extensive and sophisticated and cannot be ignored in the literature of early modern experimentation or of experimentation on living organisms across time.

  7. Absorbed dose determination in kilovoltage X-ray synchrotron radiation using alanine dosimeters.

    PubMed

    Butler, D J; Lye, J E; Wright, T E; Crossley, D; Sharpe, P H G; Stevenson, A W; Livingstone, J; Crosbie, J C

    2016-12-01

    Alanine dosimeters from the National Physical Laboratory (NPL) in the UK were irradiated using kilovoltage synchrotron radiation at the imaging and medical beam line (IMBL) at the Australian Synchrotron. A 20 × 20 mm(2) area was irradiated by scanning the phantom containing the alanine through the 1 mm × 20 mm beam at a constant velocity. The polychromatic beam had an average energy of 95 keV and nominal absorbed dose to water rate of 250 Gy/s. The absorbed dose to water in the solid water phantom was first determined using a PTW Model 31014 PinPoint ionization chamber traceable to a graphite calorimeter. The alanine was read out at NPL using correction factors determined for (60)Co, traceable to NPL standards, and a published energy correction was applied to correct for the effect of the synchrotron beam quality. The ratio of the doses determined by alanine at NPL and those determined at the synchrotron was 0.975 (standard uncertainty 0.042) when alanine energy correction factors published by Waldeland et al. (Waldeland E, Hole E O, Sagstuen E and Malinen E, Med. Phys. 2010, 37, 3569) were used, and 0.996 (standard uncertainty 0.031) when factors by Anton et al. (Anton M, Büermann L., Phys Med Biol. 2015 60 6113-29) were used. The results provide additional verification of the IMBL dosimetry.

  8. Hydrographic conditions in the Veracruz Reef System (Western Gulf of Mexico)

    NASA Astrophysics Data System (ADS)

    Salas Perez, J. D.; Arenas Fuentes, V.

    2007-05-01

    The hydrographic conditions over the Veracruz reef system (Western continental shelf of the Gulf of Mexico) are investigated by means of CTD profiles. These were measured during two periods: The first one was doing, between 28-30 January of 2005 in the Arrecifal system of Anton Lizardo, just before a Norte event occurs, and the second one was doing between 6-8 of February of 2005, in front of the Jamapa River region and the Arrecifal system of Veracruz, just after a moderate Norte event take place. The most remarkable result was the notable difference of temperature and salinity values of ~ 2ºC and ~ 2 psu between the southern region (Arrecifal system of Anton Lizardo) and the middle (Jamapa River region) and northern (Arrecifal system of Veracruz) regions, induced by convective mixing after a moderate Norte event pass. Moreover, the temperature values during this period were 3ºC under the optimal range of temperature (25ºC-29ºC) to allow healthy coral reef growth.

  9. Embryos in evolution: evo-devo at the Naples Zoological Station in 1874.

    PubMed

    Hall, Brian K

    2009-03-01

    Eighteen seventy-four was a high point in evolutionary embryology. Thanks to Charles Darwin, the theory of evolution by natural selection provided a revolutionary new way of viewing the relationships and origins of organisms on Earth. Thanks to Ernst Haeckel, embryos were the way to study evolution (Haeckel in Generelle morphologie der organismen, vols 1, 2. Verlag Georg Reimer, Berlin, 1866)-it really was embryos in evolution-and recapitulation was in the air. Thanks to Anton Dohrn, a new research facility was on the ground, designed, located and structured to facilitate the study of embryos in evolution. Anton Dohrn devised, designed, financed, supervised the construction and then administered the Naples Zoological Station specifically so that researchers from all nations would have a facility where Darwin's theory of evolution by natural selection could be tested. The zoologists who took advantage of the brand new facility within weeks of its opening late in 1873 established lines of research into evolutionary embryology, the field we now know as evolutionary developmental biology (evo-devo), the study of embryos in evolution. I examine the approach taken by Ambrosius Hubrecht, the first Dutch embryologist to undertake research at the station, and then evaluate the research of three British zoologists-E. Ray Lankester, Albert Dew-Smith, and Francis Maitland (Frank) Balfour. All four sought insights into origins, especially vertebrate origins that rested on comparative embryology, homology, germ layers, and a Darwinian approach to origins.

  10. Volumetric Properties, Viscosities, and Refractive Indices of the Binary Systems 1-Butanol + PEG 200, + PEG 400, and + TEGDME

    NASA Astrophysics Data System (ADS)

    Živković, N.; Šerbanović, S.; Kijevčanin, M.; Živković, E.

    2013-06-01

    Densities, viscosities, and refractive indices of three binary systems consisting of 1-butanol with polyethylene glycols of different molecular weights (PEG 200 and PEG 400) or tetraethylene glycol dimethyl ether (TEGDME) were measured at ten temperatures (288.15, 293.15, 298.15, 303.15, 308.15, 313.15, 318.15, 323.15, 328.15, and 333.15) K and atmospheric pressure. Densities of the selected binary mixtures were measured with an Anton Paar DMA 5000 digital vibrating U-tube densimeter, refractive indices were measured with an automatic Anton Paar RXA-156 refractometer, while for viscosity measurements, a digital Stabinger SVM 3000/G2 viscometer was used. From these data, excess molar volumes were calculated and fitted to the Redlich-Kister equation. The obtained results have been analyzed in terms of specific molecular interactions and mixing behavior between mixture components, as well as the influence of temperature on them. Viscosity data were also correlated by Grunberg-Nissan, Eyring-UNIQUAC, three-body McAlister, and Eyring-NRTL models.

  11. Heredity, evolution and development in their (epistemic) environment at the turn of the nineteenth century.

    PubMed

    Colonna, Federica Turriziani

    2016-03-01

    During the early 1870s a young zoologist who worked as a Privatdozent delivering lectures at different Prussian universities invested much of his family wealth and solicited his fellows' contributions to establish a research facility by the sea. The young zoologist happened to be called Anton Dohrn. From the time it opened its doors, the Anton Dohrn Zoological Station - or Naples Zoological Station, as it was originally called - played a crucial role in shaping life sciences as it facilitated research aimed at explaining the mechanics of inheritance. During the last quarter of the nineteenth century and the first decades of the twentieth, zoologists attempted to explain how evolutionary changes occur within a population and become stabilized. In so doing, they looked at developmental processes as well as environmental pressure, coming up with different hypotheses to explain inheritance. In some cases, their research was highly speculative, whereas in other cases they conducted cytological observations to identify the material basis of heredity. Research on evolution and development has been carried out in different places, and zoological stations like the one in Naples have played a major role in this story. However, numerous biological institutions active at the turn of the twentieth century have not received much attention from historians.

  12. Estimation of Rainfall Kinetic Energy by Rain Intensity and/or Radar Reflectivity Factor

    NASA Astrophysics Data System (ADS)

    Yu, N.; Delrieu, G.; Boudevillain, B.; Hazenberg, P.; Uijlenhoet, R.

    2011-12-01

    This study presents an approach to estimate the rainfall kinetic energy (KE) by rain intensity (R) and radar reflectivity factor (Z) separately, or jointly, on the basis of a one- or two-moment scaled formulation. This formulation considers the raindrop size distribution (DSD) as a combination of bulk rainfall variable(s) (R or/and Z) and an intrinsic distribution g(x), which is in function of the scaled raindrop diameter x. Results from previous studies showed that g(x) remains more or less constant, hence the variability of DSD is mainly explained by the bulk rainfall variable(s). In this study, the Gamma probability density function (pdf) with two parameters is used to model the g(x). Considered the self-consistent relationships between parameters, a robust method is proposed to estimate three climatological g(x), in R-, Z- and RZ-scaled formulation respectively, with a 28-month DSD dataset collected in the Cevennes-Vivarais region, France. Three relationships (KE-R, KE-Z and KE-(R,Z)), which link the observations (R and/or Z) to rainfall kinetic energy (KE), are established based on three climatological g(x). As expected, the combination of R and Z yields a significant improvement of the estimation of KE compared to the single-moment formulations. And Z yields a better performance in KE estimating compared to the KE-R relationship. In terms of the application of these relationships based on real radar reflectivity factors and/or rain gauge measurements, the combination of R and Z yields also the best performance in estimation of KE among the three relationships. Different from the application of the disdrometer data, the performance of the real KE-Z relationship degrades compared to the real KE-R relationship, which is probably due to the sampling error of radar. However, KE estimated by radar possess the advantages in spatialization of kinetic energy over that based on rain gauge stations. This study was supported financially by the HYDRATE project of the

  13. Observations of toroidicity-induced Alfvén eigenmodes in a reversed field pinch plasma

    NASA Astrophysics Data System (ADS)

    Regnoli, G.; Bergsâker, H.; Tennfors, E.; Zonca, F.; Martines, E.; Serianni, G.; Spolaore, M.; Vianello, N.; Cecconello, M.; Antoni, V.; Cavazzana, R.; Malmberg, J.-A.

    2005-04-01

    High frequency peaks in the spectra of magnetic field signals have been detected at the edge of Extrap-T2R [P. R. Brunsell, H. Bergsåker, M. Cecconello, J. R. Drake, R. M. Gravestijn, A. Hedqvist, and J.-A. Malmberg, Plasma Phys. Controlled Fusion, 43, 1457 (2001)]. The measured fluctuation is found to be mainly polarized along the toroidal direction, with high toroidal periodicity n and Alfvénic scaling (f∝B/√mini ). Calculations for a reversed field pinch plasma predict the existence of an edge resonant, high frequency, high-n number toroidicity-induced Alfvén eigenmode with the observed frequency scaling. In addition, gas puffing experiments show that edge density fluctuations are responsible for the rapid changes of mode frequency. Finally a coupling with the electron drift turbulence is proposed as drive mechanism for the eigenmode.

  14. Terahertz lattice dynamics of the potassium rare-earth binary molybdates.

    PubMed

    Poperezhai, S; Gogoi, P; Zubenko, N; Kutko, K; Kutko, V I; Kovalev, A S; Kamenskyi, D

    2017-03-08

    We report a systematic study of low-energy lattice vibrations in the layered systems KY(MoO4)2, KDy(MoO4)2, KEr(MoO4)2, and KTm(MoO4)2. A layered crystal structure and low symmetry of the local environment of the rare-earth ion cause the appearance of vibrational and electronic excitations in Terahertz frequencies. The interaction between these excitations leads to sophisticated dynamical properties, including non-linear effects in paramagnetic resonance spectra. The THz study in magnetic field allows for the clear distinction between lattice vibrations and electronic excitations. We measured the THz transmission spectra and show that the low energy lattice vibrations in binary molybdates can be well described within the quasi-one-dimensional model. The developed model describes the measured far-infrared spectra, and results of our calculations agree with previous Raman and ultrasound studies.

  15. Two new hydronaphthoquinones from Sinningia aggregata (Gesneriaceae) and cytotoxic activity of aggregatin D.

    PubMed

    Verdan, Maria Helena; Mera de Souza, Lauro; Ernesto de Carvalho, João; Vendramini Costa, Débora B; Salvador, Marcos José; Barison, Andersson; Alves Stefanello, Maria Élida

    2015-01-01

    Two new hydronaphthoquinones, aggregatins E and F (1 and 2, resp.) were isolated from the tubers of Sinningia aggregata (Ker-Gawl.) Wiehler (Gesneriaceae), along with twelve known compounds aggregatin D (3), tectoquinone (4), 1-hydroxy-2-methylanthraquinone (5), icosyl ferulate (6), pustuline (7), 1,6-dihydroxy-2-methylanthranquinone (8), 6-hydroxy-2-methylanthraquinone (9), 7-hydroxy-2-methylanthraquinone (10), tyrosol (11), halleridone (12), calceolarioside B (13), and cornoside (14). All compounds were identified by analysis of spectroscopic and spectrometric data. Compounds 3, 4, and 10 had already been reported in this species. Compounds 2 and 3 were evaluated against several tumor cell lines, but only 3 exhibited activities against UACC-62, 786-0 and OVCAR-3 cell lines, with IC50 values of 12.3, 12.8 and 0.3 μg/ml, respectively, without toxic effects on non-cancer cell line HaCat (human keratinocyte).

  16. Design of a hardware track finder (Fast Tracker) for the ATLAS trigger

    NASA Astrophysics Data System (ADS)

    Cavaliere, V.; Adelman, J.; Albicocco, P.; Alison, J.; Ancu, L. S.; Anderson, J.; Andari, N.; Andreani, A.; Andreazza, A.; Annovi, A.; Antonelli, M.; Asbah, N.; Atkinson, M.; Baines, J.; Barberio, E.; Beccherle, R.; Beretta, M.; Bertolucci, F.; Biesuz, N. V.; Blair, R.; Bogdan, M.; Boveia, A.; Britzger, D.; Bryant, P.; Burghgrave, B.; Calderini, G.; Camplani, A.; Cavasinni, V.; Chakraborty, D.; Chang, P.; Cheng, Y.; Citraro, S.; Citterio, M.; Crescioli, F.; Dawe, N.; Dell'Orso, M.; Donati, S.; Dondero, P.; Drake, G.; Gadomski, S.; Gatta, M.; Gentsos, C.; Giannetti, P.; Gkaitatzis, S.; Gramling, J.; Howarth, J. W.; Iizawa, T.; Ilic, N.; Jiang, Z.; Kaji, T.; Kasten, M.; Kawaguchi, Y.; Kim, Y. K.; Kimura, N.; Klimkovich, T.; Kolb, M.; Kordas, K.; Krizka, K.; Kubota, T.; Lanza, A.; Li, H. L.; Liberali, V.; Lisovyi, M.; Liu, L.; Love, J.; Luciano, P.; Luongo, C.; Magalotti, D.; Maznas, I.; Meroni, C.; Mitani, T.; Nasimi, H.; Negri, A.; Neroutsos, P.; Neubauer, M.; Nikolaidis, S.; Okumura, Y.; Pandini, C.; Petridou, C.; Piendibene, M.; Proudfoot, J.; Rados, P.; Roda, C.; Rossi, E.; Sakurai, Y.; Sampsonidis, D.; Saxon, J.; Schmitt, S.; Schoening, A.; Shochet, M.; Shojaii, S.; Soltveit, H.; Sotiropoulou, C. L.; Stabile, A.; Swiatlowski, M.; Tang, F.; Taylor, P. T.; Testa, M.; Tompkins, L.; Vercesi, V.; Volpi, G.; Wang, R.; Watari, R.; Webster, J.; Wu, X.; Yorita, K.; Yurkewicz, A.; Zeng, J. C.; Zhang, J.; Zou, R.

    2016-02-01

    The use of tracking information at the trigger level in the LHC Run II period is crucial for the trigger and data acquisition system and will be even more so as contemporary collisions that occur at every bunch crossing will increase in Run III. The Fast TracKer is part of the ATLAS trigger upgrade project; it is a hardware processor that will provide every Level-1 accepted event (100 kHz) and within 100μs, full tracking information for tracks with momentum as low as 1 GeV . Providing fast, extensive access to tracking information, with resolution comparable to the offline reconstruction, FTK will help in precise detection of the primary and secondary vertices to ensure robust selections and improve the trigger performance.

  17. Acetylene/Vinylidene Isomerization after Carbon K-shell Photo-Ionization

    NASA Astrophysics Data System (ADS)

    Osipov, Timut; Weber, T.; Jahnke, T.; Alnaser, A.; Landers, A.; Hertlein, M.; Jagutzki, O.; Schmidt, L.; Schöffler, M.; Prior, M.; Feinberg, B.; Cocke, C. L.; Dörner, R.; Belkacem, A.

    2006-05-01

    Comprehensive study of the acetylene/vinylidene isomerization dynamics after the carbon k-shell photoionization followed by the Auger decay was performed by means of the COLTRIMS (COLd Target Recoil Ion Momentum Spectroscopy) technique. The Auger electrons, produced in this reaction, were detected in coincidence with the products of the Coulomb explosion of the dication C2H2^2+. Measurement of the 3d vector momenta for all detected particles inferred the Auger electron energies and directions in the body fixed molecular frame along with the KER (Kinetic Energy Release) for different break up channels. This highly differential reaction cross-section study provided very unique information about the fragmentation pathways of the doubly charged acetylene molecule.

  18. Statistical evaporation of rotating clusters. I. Kinetic energy released

    NASA Astrophysics Data System (ADS)

    Calvo, F.; Parneix, P.

    2003-07-01

    Unimolecular evaporation in rotating atomic clusters is investigated using phase space theory (PST) and molecular dynamics simulations. The rotational densities of states are calculated in the sphere+atom approximation, and analytical expressions are given for a radial interaction potential with the form -C/rp. The vibrational densities of states are calculated using Monte Carlo simulations, and the average radial potential at finite temperature is obtained using a recent extension of the multiple range random-walk algorithm. These ideas are tested on simple argon clusters modeled with the Lennard-Jones interaction potential, at several excitation energies and angular momenta of the parent cluster. Our results show that PST successfully reproduces the simulation data, not only the average KER but its probability distribution, for dissociations from LJ14, for which the product cluster can effectively be considered as spherical. Even for dissociations from the nonspherical LJ8, simulation results remain very close to the predictions of the statistical theory.

  19. Experimentelles FMCW-Radar zur hochfrequenten Charakterisierung von Windenergieanlagen

    NASA Astrophysics Data System (ADS)

    Schubert, Karsten; Werner, Jens; Schwartau, Fabian

    2017-09-01

    During the increasing dissemination of renewable energy sources the potential and actual interference effects of wind turbine plants became obvious. Turbines reflect the signals of weather radar and other radar systems. In addition to the static radar echoes, in particular the Doppler echoes are to be mentioned as an undesirable impairment Keränen (2014). As a result, building permit is refused for numerous new wind turbines, as the potential interference can not be reliably predicted. As a contribution to the improvement of this predictability, measurements are planned which aim at the high-frequency characterisation of wind energy installations. In this paper, a cost-effective FMCW radar is presented, which is operated in the same frequency band (C-band) as the weather radars of the German weather service. Here, the focus is on the description of the hardware design including the considerations used for its dimensioning.

  20. Characterization of starch from two ecotypes of andean achira roots (Canna edulis).

    PubMed

    Cisneros, Fausto H; Zevillanos, Roberto; Cisneros-Zevallos, Luis

    2009-08-26

    Starches from two ecotypes of achira roots (Canna edulis Ker-Gawler) were characterized and compared to commercial potato and corn starches. This included scanning electron microscopy (SEM) of starch granules and amylose content determination of starch. Starch solutions or gels were tested by rotational viscometry, Rapid Visco Analyzer (RVA), and texture analysis. Some starch samples were subjected to various treatments: pH reduction, autoclaving at high temperature, and high shear before testing by rotational viscometry. Achira starch showed some unusual properties, such as very large oblong granules (approximately 45-52 microm major axis and approximately 33-34 microm minor axis) and relatively high amylose content (approximately 33-39%). The San Gaban achira ecotype formed high-consistency gels upon cooling, both in RVA study (5% starch) and in texture analysis (8% starch), compared to other starch gels and also exhibited higher thermal resistance to viscosity breakdown.

  1. Agreeableness accounts for the factor structure of the youth psychopathic traits inventory.

    PubMed

    Sherman, Emily D; Lynam, Donald R; Heyde, Brianne

    2014-04-01

    The present study investigated the relationship between the Five-Factor Model (FFM) and the Youth Psychopathic Traits Inventory (YPI; Andershed, Ker, Stattin, & Levander, 2002) in an undergraduate sample. It was hypothesized that Agreeableness would saturate the lower- and higher-order scales of the YPI, and that taking Agreeableness into account would reduce the intercorrelations among the three factors of the YPI. These hypotheses were explored in a sample of 466 undergraduates who completed the YPI and the Revised NEO Personality Inventory (NEO-PI-R; Costa & McCrae, 1992). Results demonstrated that Agreeableness was the strongest, most consistent correlate of the lower-order scales and three higher-order factors of the YPI. Additionally, analyses showed that Agreeableness accounted for large portions of the three YPI factors, as well as the overlap among factors, helping explain their intercorrelations. Current results underscore the centrality of Agreeableness to the assessment and understanding of psychopathy, particularly as measured by the YPI.

  2. Discrete element simulation of powder compaction in cold uniaxial pressing with low pressure

    NASA Astrophysics Data System (ADS)

    Rojek, Jerzy; Nosewicz, Szymon; Jurczak, Kamila; Chmielewski, Marcin; Bochenek, Kamil; Pietrzak, Katarzyna

    2016-11-01

    This paper presents numerical studies of powder compaction in cold uniaxial pressing. The powder compaction in this work is considered as an initial stage of a hot pressing process so it is realized with relatively low pressure (up to 50 MPa). Hence the attention has been focused on the densification mechanisms at this range of pressure and models suitable for these conditions. The discrete element method employing spherical particles has been used in the numerical studies. Numerical simulations have been performed for two different contact models—the elastic Hertz-Mindlin-Deresiewicz model and the plastic Storåkers model. Numerical results have been compared with the results of laboratory tests of the die compaction of the NiAl powder. Comparisons have shown that the discrete element method is capable to represent properly the densification mechanisms by the particle rearrangement and particle deformation.

  3. Terahertz lattice dynamics of the potassium rare-earth binary molybdates

    NASA Astrophysics Data System (ADS)

    Poperezhai, S.; Gogoi, P.; Zubenko, N.; Kutko, K.; Kutko, V. I.; Kovalev, A. S.; Kamenskyi, D.

    2017-03-01

    We report a systematic study of low-energy lattice vibrations in the layered systems KY(MoO4)2, KDy(MoO4)2, KEr(MoO4)2, and KTm(MoO4)2. A layered crystal structure and low symmetry of the local environment of the rare-earth ion cause the appearance of vibrational and electronic excitations in Terahertz frequencies. The interaction between these excitations leads to sophisticated dynamical properties, including non-linear effects in paramagnetic resonance spectra. The THz study in magnetic field allows for the clear distinction between lattice vibrations and electronic excitations. We measured the THz transmission spectra and show that the low energy lattice vibrations in binary molybdates can be well described within the quasi-one-dimensional model. The developed model describes the measured far-infrared spectra, and results of our calculations agree with previous Raman and ultrasound studies.

  4. Neurofilament-tubulin binding site peptide NFL-TBS.40-63 increases the differentiation of oligodendrocytes in vitro and partially prevents them from lysophosphatidyl choline toxiciy.

    PubMed

    Fressinaud, Catherine; Eyer, Joël

    2014-02-01

    During multiple sclerosis (MS), the main axon cystoskeleton proteins, neurofilaments (NF), are altered, and their release into the cerebrospinal fluid correlates with disease severity. The role of NF in the extraaxonal location is unknown. Therefore, we tested whether synthetic peptides corresponding to the tubulin-binding site (TBS) sequence identified on light NF chain (NFL-TBS.40-63) and keratin (KER-TBS.1-24), which could be released during MS, modulate remyelination in vitro. Biotinylated NFL-TBS.40-63, NFL-Scramble2, and KER-TBS.1-54 (1-100 μM, 24 hr) were added to rat oligodendrocyte (OL) and astrocyte (AS) cultures, grown in chemically defined medium. Proliferation and differentiation were characterized by using specific antibodies (A2B5, CNP, MBP, GFAP) and compared with untreated cultures. Lysophosphatidyl choline (LPC; 2 × 10(-5) M) was used to induce OL death and to test the effects of TBS peptides under these conditions. NFL-TBS.40-63 significantly increased OL differentiation and maturation, with more CNP(+) and MBP(+) cells characterized by numerous ramified processes, along with myelin balls. When OL were challenged with LPC, concomitant treatment with NFL-TBS.40-63 rescued more than 50% of OL compared with cultures treated with LPC only. Proliferation of OL progenitors was not affected, nor were AS proliferation and differentiation. NFL-TBS.40-63 peptide induces specific effects in vitro, increasing OL differentiation and maturation without altering AS fate. In addition, it partially protects OL from demyelinating injury. Thus release of NFL-TBS.40-63 caused by axonal damage in vivo could improve repair through increased OL differentiation, which is a prerequisite for remyelination. Copyright © 2013 Wiley Periodicals, Inc.

  5. Probing calculated O2+ potential-energy curves with an XUV-IR pump-probe experiment

    NASA Astrophysics Data System (ADS)

    Cörlin, Philipp; Fischer, Andreas; Schönwald, Michael; Sperl, Alexander; Mizuno, Tomoya; Thumm, Uwe; Pfeifer, Thomas; Moshammer, Robert

    2015-04-01

    We study dissociative photoionization of molecular oxygen in a kinematically complete XUV-IR pump-probe experiment. Detecting charged fragments and photoelectrons in coincidence using a reaction microscope, we observe a pump-probe delay-dependent yield of very low energetic O+ ions which oscillates with a period of 40 fs . This feature is caused by a time-dependent vibrational wave packet in the potential of the binding O2+(a Π4u) state, which is probed by resonant absorption of a single infrared photon to the weakly repulsive O2+(f Π4g) state. By quantitative comparison of the experimental kinetic-energy-release (KER) and quantum-beat (QB) spectra with the results of a coupled-channel simulation, we are able to discriminate between the calculated adiabatic O2+ potential-energy curves (PECs) of Marian et al. [Marian, Marian, Peyerimhoff, Hess, Buenker, and Seger, Mol. Phys. 46, 779 (1982), 10.1080/00268978200101591] and Magrakvelidze et al. [Magrakvelidze, Aikens, and Thumm, Phys. Rev. A 86, 023402 (2012), 10.1103/PhysRevA.86.023402]. In general, we find a good agreement between experimental and simulated KER and QB spectra. However, we could not reproduce all features of the experimental data with these PECs. In contrast, adjusting a Morse potential to the experimental data, most features of the experimental spectra are well reproduced by our simulation. By comparing this Morse potential to theoretically predicted PECs, we demonstrate the sensitivity of our experimental method to small changes in the shape of the binding potential.

  6. Investigation of electronically excited indole relaxation dynamics via photoionization and fragmentation pump-probe spectroscopy

    SciTech Connect

    Godfrey, T. J.; Yu, Hui; Ullrich, Susanne

    2014-07-28

    The studies herein investigate the involvement of the low-lying {sup 1}L{sub a} and {sup 1}L{sub b} states with {sup 1}ππ{sup *} character and the {sup 1}πσ{sup *} state in the deactivation process of indole following photoexcitation at 201 nm. Three gas-phase, pump-probe spectroscopic techniques are employed: (1) Time-resolved photoelectron spectroscopy (TR-PES), (2) hydrogen atom (H-atom) time-resolved kinetic energy release (TR-KER), and (3) time-resolved ion yield (TR-IY). Each technique provides complementary information specific to the photophysical processes in the indole molecule. In conjunction, a thorough examination of the electronically excited states in the relaxation process, with particular focus on the involvement of the {sup 1}πσ{sup *} state, is afforded. Through an extensive analysis of the TR-PES data presented here, it is deduced that the initial excitation of the {sup 1}B{sub b} state decays to the {sup 1}L{sub a} state on a timescale beyond the resolution of the current experimental setup. Relaxation proceeds on the {sup 1}L{sub a} state with an ultrafast decay constant (<100 femtoseconds (fs)) to the lower-lying {sup 1}L{sub b} state, which is found to possess a relatively long lifetime of 23 ± 5 picoseconds (ps) before regressing to the ground state. These studies also manifest an additional component with a relaxation time of 405 ± 76 fs, which is correlated with activity along the {sup 1}πσ{sup *} state. TR-KER and TR-IY experiments, both specifically probing {sup 1}πσ{sup *} dynamics, exhibit similar decay constants, further validating these observations.

  7. Pathways for nonsequential and sequential fragmentation of CO2 3 + investigated by electron collision

    NASA Astrophysics Data System (ADS)

    Wang, Enliang; Shan, Xu; Shen, Zhenjie; Gong, Maomao; Tang, Yaguo; Pan, Yi; Lau, Kai-Chung; Chen, Xiangjun

    2015-05-01

    We report nonsequential and sequential fragmentation dynamics of CO2 3 + investigated by electron collision at an impact energy of 500 eV. The dissociation mechanisms are clearly distinguished by combined use of the Dalitz plot together with momentum correlation spectra. The angular distributions and kinetic-energy releases (KERs) of different fragmentation processes are obtained. The dissociation channels of higher excited states of the CO2 3 + molecular ion are opened, which are quite different from the previous studies of heavy-ion collision [N. Neumann, D. Hant, L. Ph. H. Schmidt, J. Titze, T. Jahnke, A. Czasch, M. S. Schöffler, K. Kreidi, O. Jagutzki, H. Schmidt-Böcking, and R. Dörner, Phys. Rev. Lett. 104, 103201 (2010), 10.1103/PhysRevLett.104.103201] and intense laser field [C. Wu, C. Wu, D. Song, H. Su, Y. Yang, Z. Wu, X. Liu, H. Liu, M. Li, Y. Deng, Y. Liu, L.-Y. Peng, H. Jiang, and Q. Gong, Phys. Rev. Lett. 110, 103601 (2013), 10.1103/PhysRevLett.110.103601]. By analyzing KERs together with the help of potential-energy curves exploration at the multireference configuration interaction level, we conclude that the sequential fragmentation occurs in the 2Π ,4Π , and 2Σ+ states of the CO2 3 + ion. The bond length and bond angle are also determined based on the linear fragmentation, indicating that electron impact fragmentation is a potential method to precisely reconstruct the geometry of neutral molecules.

  8. Research on data from the ATLAS experiment at CERN

    SciTech Connect

    Purohit, Milind V.

    2015-07-31

    In this report senior investigator Prof. Milind V. Purohit describes research done with data from the ATLAS experiment at CERN. This includes preparing papers on the performance of the CSC detector, searches for SUSY using a new modern ''big data'' technique, and a search for supersymmetry (SUSY) using the "zero leptons razor" (0LRaz) technique. The prediction of the W=Z+jets background processes by the ATLAS simulation prior to the fit is found to be overestimated in the phase space of interest. In all new signal regions presented in this analysis the number of events observed is consistent with the post-fit SM expectations. Assuming R-parity conservation, the limit on the gluino mass exceeds 1150 GeV at 95% confidence level, for an LSP mass smaller than 100 GeV. Other USC personnel who participated in this project during the period of this grant were a graduate student, Anton Kravchenko.

  9. Chekhov and Rossolimo: careers in medicine and neurology in Russia 100 years ago.

    PubMed

    Satran, Richard

    2005-01-11

    Neurology as a specialty was established at the close of the 19th century, especially in England, France, Germany, and the United States. It was not uncommon for US physicians to seek postgraduate training in those three Western European countries. However, Russian clinical investigators and scientists, who contributed to neurology and the neurosciences, rarely had their papers cited in Western medical publications. The medical careers of the well-known writer-physician Anton P. Chekhov and his contemporary G.I. Rossolimo, an academic neurologist at the University of Moscow, illustrate their contributions within the constraints of their autocratic society. Their work led to a better understanding of the complexities of human behavior, Chekhov through his enduring writings, and Rossolimo as a founder of neuropsychology and child neurology.

  10. [Street social education: historical, political and pedagogical bases].

    PubMed

    de Oliveira, Walter Ferreira

    2007-01-01

    This work is about street social education as a pedagogical system that started in Latin America in the late 1970s, as the street population formed mostly by children and adolescents called for attention. The first street social educators were 'pastoral' agents working at the praça da Sé a place with large numbers of street children in São Paulo. Based on the Liberation Theology and on the pedagogies developed by Paulo Freire, Celestine Freinet, Anton Makarenko, and Emília Ferreiro, the street educators developed a conceptual field and participated in the promulgation of the 1988 Federal Constitution, particularly by writing and introducing the 'Estatuto da Criança e do Adolescente' (the 'Child and Adolescent Statute'). Street social education is currently latent and suffering the consequences of program discontinuity caused by successive changes of government. It is, therefore important to know the conceptual proposals.

  11. iss042e101429

    NASA Image and Video Library

    2015-01-05

    ISS042E101429 (01/05/2014) --- This image, photographed by one of the Expedition 42 crew members aboard the International Space Station, shows the the Soyuz TMA-15M spacecraft on the left attached to the Rassvet module on the Earth-facing port of the Russian segment of the station that delivered Expedition 42 crewmembers Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos), Terry Virts of NASA and Samantha Cristoforetti of the European Space Agency on Nov. 24, 2014 , and to the right, the unpiloted ISS Progress 57 cargo craft that is docked to the Pirs Docking Compartment and which arrived at the station a month earlier on Oct. 29, 2014.

  12. Between the laboratory and the deep blue sea: space issues in the marine stations of Naples and Wimereux.

    PubMed

    de Bont, Raf

    2009-04-01

    In the 1870s, the life sciences witnessed the rise of a new site for scientific research: the marine station. This new workplace brought the laboratory of the biologist closer to the natural surroundings of the marine organisms that he/she was studying. It was therefore a site where the lab could be 'renaturalized'. In this paper, the extent of this 'renaturalization' is studied with regard to two stations. The first, Anton Dohrn's Stazione zoologica in Naples, was to become an international centre for laboratory research, while the second, Alfred Giard's marine station in Wimereux (France), turned out to be an important hub for field studies. Field-oriented animal life studies could be developed in Wimereux, whereas these were largely outshone by physiological and morphological research in Naples. I argue that differences in the physical and social organization of the two stations - or their 'ecologies' - accounted for the varying practices and types of knowledge found in Naples and Wimereux.

  13. The New Physics

    NASA Astrophysics Data System (ADS)

    Fraser, Gordon

    2009-08-01

    Introduction Gordon Fraser; Part I. Matter and the Universe: 1. Cosmology Wendy Freedman and Rocky Kolb; 2. Gravity Ronald Adler; 3. Astrophysics Arnon Dar; 4. Particles and the standard model Chris Quigg; 5. Superstrings Michael Green; Part II. Quantum Matter: 6. Atoms and photons Claude Cohen-Tannoudji and Jean Dalibard; 7. The quantum world of ultra-cold atoms Christopher Foot and William Phillips; 8. Superfluidity Henry Hall; 9. Quantum phase transitions Subir Sachdev; Part III. Quanta in Action: 10. Quantum entanglement Anton Zeilinger; 11. Quanta, ciphers and computers Artur Ekert; 12. Small-scale structure and nanoscience Yoseph Imry; Part IV. Calculation and Computation: 13. Nonlinearity Henry Abarbanel; 14. Complexity Antonio Politi; 15. Collaborative physics, e-science and the grid Tony Hey and Anne Trefethen; Part V. Science in Action: 16. Biophysics Cyrus Safinya; 17. Medical physics Nicolaj Pavel; 18. Physics and materials Robert Cahn; 19. Physics and society Ugo Amaldi.

  14. jsc2014e089253

    NASA Image and Video Library

    2014-10-30

    #3234a - (30 October 2014) --- At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 42/43 backup Flight Engineer Kjell Lindgren of NASA answers questions from reporters in front of a Soyuz simulator October 30 as part of his final qualification exams for flight. He along with Oleg Kononenko of the Russian Federal Space Agency (Roscosmos) and Kimiya Yui of the Japan Aerospace Exploration Agency (not pictured) are the backups to the prime crew --- Terry Virts of NASA, Anton Shkaplerov of Roscosmos and Samantha Cristoforetti of the European Space Agency --- who are in the final stages of training for launch November 24, Kazakh time, in the Soyuz TMA-15M spacecraft to begin a five and a half month mission on the International Space Station. Photo credit: NASA/Stephanie Stoll

  15. jsc2014e089254

    NASA Image and Video Library

    2014-10-30

    #3241 - (30 October 2014) --- At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 42/43 backup crewmembers Kjell Lindgren of NASA (left), Soyuz Commander Oleg Kononenko of the Russian Federal Space Agency (Roscosmos, center) and Kimiya Yui of the Japan Aerospace Exploration Agency (right) answer questions from reporters in front of a Soyuz simulator October 30 as part of their final qualification exams for flight. They are the backups to the prime crew --- Terry Virts of NASA, Anton Shkaplerov of Roscosmos and Samantha Cristoforetti of the European Space Agency --- who are in the final stages of training for launch November 24, Kazakh time, in the Soyuz TMA-15M spacecraft to begin a five and a half month mission on the International Space Station. Photo credit: NASA/Stephanie Stoll

  16. CiSE and Computational Physics: Undergraduate Physics Challenge

    NASA Astrophysics Data System (ADS)

    Donnelly, Denis

    2008-04-01

    The role of Computing in Science and Engineering (CiSE) in support of computational physics is discussed with emphasis on CiSE's computational physics challenge. Winners awards are 1500, 1000, and 500. Each winner also receives a copy of Mathematica plus modest travel support. The challenge was for undergraduates at any accredited educational institution. Applicants were to select a physically and computationally interesting problem of their own choosing. Awards are presented at this session. Student winners discuss their work in papers that follow. First prize winner is Yevgeny Binder, of Loyola University in Chicago -``PartonKit: A C Program for Fast Parton Evolution with the Rossi Method.'' Second prize winner is John Barrett, of the University of Massachusetts, Amherst - ``Analysis of Photon Transport in 3 Polarized Scintillating Target Proto-types.'' Third prize winner is Steven Anton, of the University of Delaware - ``Electron Wave Packet Propagation in Graphene Nanoribbons.''

  17. jsc2014e042133

    NASA Image and Video Library

    2014-05-08

    1183A: At Red Square in Moscow, the Expedition 40/41 backup and prime crewmembers pose for pictures on a stage May 8 that is set up for a concert May 9 to celebrate the Russian holiday of Victory Day May 9. From left to right are backup crewmembers Terry Virts of NASA, Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos), Samantha Cristoforetti of the European Space Agency, and prime crewmembers Alexander Gerst of the European Space Agency, Max Suraev of Roscosmos and Reid Wiseman of NASA. Gerst, Suraev and Wiseman are preparing for launch May 29, Kazakh time, in the Soyuz TMA-13M spacecraft from the Baikonur Cosmodrome in Kazakhstan for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  18. Self-consistent calculation of protein folding pathways

    NASA Astrophysics Data System (ADS)

    Orioli, S.; a Beccara, S.; Faccioli, P.

    2017-08-01

    We introduce an iterative algorithm to efficiently simulate protein folding and other conformational transitions, using state-of-the-art all-atom force fields. Starting from the Langevin equation, we obtain a self-consistent stochastic equation of motion, which directly yields the reaction pathways. From the solution of this set of equations we derive a stochastic estimate of the reaction coordinate. We validate this approach against the results of plain MD simulations of the folding of a small protein, which were performed on the Anton supercomputer. In order to explore the computational efficiency of this algorithm, we apply it to generate a folding pathway of a protein that consists of 130 amino acids and has a folding rate of the order of s-1.

  19. [Blood analysis 200 years ago--the theory and practice of hematoscopy in veterinary medicine].

    PubMed

    Schäffer, J

    1991-12-01

    Since antiquity the macroscopic judgement of blood obtained through phlebotomy was an important constituent of the medical diagnostic procedures. In the progress of blood sedimentation, the "eucrasia" or the "dyscrasia" of the humours became visible. This paper summarizes the historical and theoretical basis of the haematoscopy, and offers insight into the haemodiagnostic practices of a veterinarian at the end of the 18th century. The authority is the professor of veterinary art and medical advisor Anton Joseph Will (1752-1821), mental father and founder of the veterinary school in Munich, which opened its doors on the 1st of November 1790. Between 1786 and 1790, A. J. Will developed a research program to control animal diseases in Bavaria and examined several thousands of blood samples from healthy and sick animals. The different components of coagulated blood, infected with anthrax, were given to dogs. In this way, he could demonstrate experimentally the high infectiousness of anthrax.

  20. Rheological properties of carbon nanotubes-reinforced magnetorheological elastomer

    NASA Astrophysics Data System (ADS)

    Aziz, S. A. A.; Mazlan, SA; Nik Ismail, N. I.; Ubaidillah; Khairi, MHA; Yunus, NA

    2017-01-01

    Magnetorheological elastomer (MRE) based on the natural rubber with different types of multiwall carbon nanotubes (MWCNT) as additives were synthesized. MRE with pristine MWCNTs was prepared as a control and the carboxylated (MWCNT-COOH), as well as hydroxylated (MWCNT-OH) were introduced as new additives in MRE. Their rheological properties under different magnetic field were evaluated by using the rheometer (MCR 302, AntonPaar, Austria) equipped with the electromagnetic device. The dependency of MREs towards excitation frequencies under different magnetic field was investigated. It is shown that the storage modulus and loss factor of MRE with functionalized MWCNTs exhibited noticeable increment in MR performance compared to control parallel with the frequencies increment.

  1. Corporeal elements and principles in the learned German chymical tradition.

    PubMed

    Klein, Joel A

    2014-11-01

    This paper explores diverse conceptions of the physicality and tangibility of elements and principles in early modern chymistry. By tracing the development of natural philosophical and corpuscular ideas about material elements and principles among several physicans and chymists, including Thomas Erastus, Andreas Libavius, Daniel Sennert, and Anton Günther Billich, this article locates a learned tradition that developed predominantly in Germany, and which directly challenged a common understanding of matter held by major Paracelsians as well as authors from the French textbook tradition. Likewise, conceptions of incorporeal elements or principles are shown to have developed from the ideas of Paracelsus and Petrus Severinus, whereas authors in the learned tradition emphasised a particular interpretation of Aristotle. The article concludes by suggesting that chymical interpretations of material composition had an important influence throughout the seventeenth and eighteenth centuries, and that this provides further evidence that the so-called "compositional revolution" in chemistry was well underway prior to the eighteenth century.

  2. Effectively explore metastable states of proteins by adaptive nonequilibrium driving simulations

    NASA Astrophysics Data System (ADS)

    Wan, Biao; Xu, Shun; Zhou, Xin

    2017-03-01

    Nonequilibrium drivings applied in molecular dynamics (MD) simulations can efficiently extend the visiting range of protein conformations, but might compel systems to go far away from equilibrium and thus mainly explore irrelevant conformations. Here we propose a general method, called adaptive nonequilibrium simulation (ANES), to automatically adjust the external driving on the fly, based on the feedback of the short-time average response of system. Thus, the ANES approximately keeps the local equilibrium but efficiently accelerates the global motion. We illustrate the capability of the ANES in highly efficiently exploring metastable conformations in the deca-alanine peptide and find that the 0.2 -μ s ANES approximately captures the important states and folding and unfolding pathways in the HP35 solution by comparing with the result of the recent 398 -μ s equilibrium MD simulation on Anton [S. Piana et al., Proc. Natl. Acad. Sci. USA 109, 17845 (2012), 10.1073/pnas.1201811109].

  3. Radiometric Measurements of Tropospheric Water Properties in the Tropics

    NASA Astrophysics Data System (ADS)

    Küllmann, H.; Tan, B.; Warneke, T.; Notholt, J.; Mätzler, C.; Kämpfer, N.

    2009-04-01

    To understand the processes leading to climate change observations of tropical water vapour are of primal importance due to its dominant abundance as a greenhouse gas and its high variability. This applies particularly to the tropospheric region near the equator where only few measurements exist. The portable TRARA radiometer (on loan from the IAP Bern) is operated at the Anton de Kom University of Suriname in Paramaribo and measures continuously since mid of December 2006. The sensor consists of two channels at frequencies of 21 and 35 GHz to observe the integrated water vapour content of the troposphere. The tropospheric opacity is derived from hot/cold and tipping curve calibrations. The results of two years of microwave data using new statistical retrieval algorithms based on local sonde profiles (SHADOZ) which are available every other week at Paramaribo will be presented. In addition, the two-channel radiometer allows for studying the integrated liquid water path.

  4. The power of a musical instrument: Franklin, the Mozarts, Mesmer, and the glass armonica.

    PubMed

    Gallo, D A; Finger, S

    2000-11-01

    In 1761 Benjamin Franklin invented the armonica (often referred to as the glass harmonica), an instrument designed to simplify the playing of the musical glasses. The instrument immediately became popular and inspired compositions by Wolfgang Mozart, who had the opportunity to hear and play one at the house of Franz Anton Mesmer. Armonica music was used by Mesmer in his séances, because he felt it could promote healing by propagating a mystical fluid that he called animal magnetism through the body. After Mesmer's theories were debunked by a highly respected panel of scientists, the armonica fell out of vogue. Because Franklin was on the panel that examined the discredited mesmerism, he indirectly contributed to his own invention's demise.

  5. "Franklin: Science, Politics and France"

    NASA Astrophysics Data System (ADS)

    McClellan, James E., III

    2003-04-01

    This presentation traces Benjamin Franklin's career as a "civic scientist" in Old-Regime France. It outlines the initial - and not always positive - reception of Franklin's work on electricity by the community of French scientists in the 1750s. It sketches Franklin's subsequent elevation into the pantheon of French Enlightenment heros, and it details his work as a "civic scientist" while American envoy to France in the 1770s and 1780s, notably his service on the government-sponsored commissions that repudiated the scientific and medical claims of Franz Anton Mesmer. This presentation concludes by examining a few features of Franklin's career that are not completely congruent with our notion of what a "civic scientist" might be, a contrast that is intended to illuminate both Franklin and the concept of "civic scientist."

  6. The New Physics

    NASA Astrophysics Data System (ADS)

    Fraser, Gordon

    2006-04-01

    Introduction Gordon Fraser; Part I. Matter and the Universe: 1. Cosmology Wendy Freedman and Rocky Kolb; 2. Gravity Ronald Adler; 3. Astrophysics Arnon Dar; 4. Particles and the standard model Chris Quigg; 5. Superstrings Michael Green; Part II. Quantum Matter: 6. Atoms and photons Claude Cohen-Tannoudji and Jean Dalibard; 7. The quantum world of ultra-cold atoms Christopher Foot and William Phillips; 8. Superfluidity Henry Hall; 9. Quantum phase transitions Subir Sachdev; Part III. Quanta in Action: 10. Quantum entanglement Anton Zeilinger; 11. Quanta, ciphers and computers Artur Ekert; 12. Small-scale structure and nanoscience Yoseph Imry; Part IV. Calculation and Computation: 13. Nonlinearity Henry Abarbanel; 14. Complexity Antonio Politi; 15. Collaborative physics, e-science and the grid Tony Hey and Anne Trefethen; Part V. Science in Action: 16. Biophysics Cyrus Safinya; 17. Medical physics Nicolaj Pavel; 18. Physics and materials Robert Cahn; 19. Physics and society Ugo Amaldi.

  7. [A nosology for supernatural phenomena and the construction of the 'possessed' brain in the nineteenth century].

    PubMed

    Goncalves, Valeria Portugal; Ortega, Francisco

    2013-06-01

    At the end of the twentieth century, supernatural phenomena such as so called trances and possession by spirits received a scientific classification, which includes the numerous diagnoses of the dominant psychiatry. At the end of the nineteenth century we can observe a process of scientific categorization of phenomena considered to have originated in superstition or popular imagination. In this work we show how trances and spiritual possession were studied by Franz Anton Mesmer and his followers when developing the concept of magnetism; by James Braid during the creation of his theory of hypnosis; and by Jean Martin Charcot, which marked the entry of hysteria into nosological classification. Despite the differences between these schools, we identify the use of the brain and cerebral metaphors as the foundation of theories of the mind.

  8. Paul A. Cibis, MD: a pioneer of modern vitreoretinal surgery.

    PubMed

    Feibel, Robert M; Blodi, Christopher F

    2013-08-01

    Paul Anton Cibis (1911-1965) was one of the pioneers of modern vitreoretinal surgery. He reasoned that the pathology of complex retinal detachments was intravitreal fibrosis and concluded that the optimum surgery was the injection of liquid silicone oil into the vitreous cavity to dissect fibrous membranes from the retinal surface and use the silicone for retinal tamponade. Prior to the invention of pars plana vitrectomy, such surgery was innovative, even daring. These surgical techniques were an important advance in directly operating on the vitreous in retinal detachment surgery. However, Cibis' contributions to vitreoretinal surgery only occupied the last 10 years of his tragically short life. Prior to his practice in retinal surgery, he made contributions to basic research in physiologic optics, local retinal adaptation, and the effect of ionizing radiation and atomic energy on the globe.

  9. jsc2014e049405

    NASA Image and Video Library

    2014-05-17

    12-29-49: At the statue of the Russian Great Designer, Sergei Korolev, in the town of Baikonur, Kazakhstan, Expedition 40/41 backup crewmembers Terry Virts of NASA (left), Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos, center) and Samantha Cristoforetti of the European Space Agency (right) pose for pictures May 17. The trio is backing up the prime crew, Flight Engineer Alexander Gerst of the European Space Agency, Soyuz Commander Max Suraev of the Russian Federal Space Agency (Roscosmos) and NASA Flight Engineer Reid Wiseman, who will launch from Baikonur on May 29, Kazakh time, for a 5 ½ month mission on the International Space Station. NASA/Victor Zelentsov

  10. jsc2017e115217

    NASA Image and Video Library

    2017-09-08

    jsc2017e115217 (Sept.. 8, 2017) --- In the town of Baikonur, Kazakhstan, Expedition 53-54 backup crewmembers Shannon Walker of NASA, Anton Shkaplerov of Roscosmos and Scott Tingle of NASA pay tribute after laying flowers at the statue of Russia’s great space designer Sergey Korolev in a traditional ceremony Sept. 8. They are serving as backups to the prime crewmembers, Joe Acaba of NASA, Alexander Misurkin of Roscosmos and Mark Vande Hei of NASA, who will launch on Sept. 13 from the Baikonur Cosmodrome in Kazakhstan on the Soyuz MS-06 spacecraft for a five and a half month mission on the International Space Station. Credit: NASA/Victor Zelentsov

  11. Hidden images of holography: wavefront reconstruction of abnormalities within pulsed holographic recording

    NASA Astrophysics Data System (ADS)

    Richardson, Martin

    2014-02-01

    Unplanned images recorded within holographic space are of candid interest that can reshape audience definition crossing intellectual boundaries. This paper details three examples of off-axis Pulsed Laser transmission holograms that involve holographic portraits. These are movie director Martin Scorsese, former Royal Photographic Society President Mike Austin and a unique recently discovered early pulsed recording of Nick Phillips together with Anton Furst recorded in 1977. Each example was made when operating conditions for the pulsed ruby lasers were optimum, offering a coherence of several meters time-compressed into 25 ns. This gave rise to not only the portrait capture but also others present during the recording session inside the room. This optimum condition captured more than was intended resulting in images that, until now, have remained un-documented.

  12. jsc2011e025924

    NASA Image and Video Library

    2011-03-11

    At the headquarters of the Russian Federal Space Agency (Roscosmos) in Moscow March 11, 2011, Roscosmos Head Anatoly Perminov (center right), Alexei Krasnov, Roscosmos’ Head of Piloted Space Programs, and Joel Montalbano, NASA Director of Human Spaceflight Programs, Russia, discuss the upcoming launch of the Soyuz TMA-21 spacecraft with Expedition 27 prime crew members: Russian cosmonaut Alexander Samokutyaev (far right), cosmonaut Andrey Borisenko, and NASA astronaut Ron Garan, along with backup crewmembers Anton Shklaperov, Anatoly Ivanishin and Daniel Burbank. Samokutyaev, Borisenko and Garan are scheduled to launch to the International Space Station on March 30 (Kazakhstan time). The occasion was a traditional “tea” with Perminov prior to the crew’s departure for the Baikonur Cosmodrome in Kazakhstan March 17. Photo credit: NASA/Stephanie Stoll

  13. jsc2014e042134

    NASA Image and Video Library

    2014-05-08

    1227: At Red Square in Moscow, the Expedition 40/41 backup crewmembers pose for pictures with St. Basil’s Cathedral as their backdrop May 8, part of traditional pre-launch ceremonies. Samantha Cristoforetti of the European Space Agency (left), Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos, center) and Terry Virts of NASA (right), are the backups to prime crewmembers Alexander Gerst of the European Space Agency, Max Suraev of Roscosmos and Reid Wiseman of NASA who are preparing for launch May 29, Kazakh time, in the Soyuz TMA-13M spacecraft from the Baikonur Cosmodrome in Kazakhstan for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  14. jsc2011e203160

    NASA Image and Video Library

    2011-10-23

    With famed St. Basil’s Cathedral in the background, the prime and backup crews for the upcoming Expedition 30 launch to the International Space Station toured Red Square in Moscow October 24, 2011 as part of their ceremonial pre-launch activities. From right to left are prime crewmembers Anatoly Ivanishin, NASA’s Dan Burbank and Soyuz Commander Anton Shkaplerov. Along with backup crewmembers Sergei Revin and NASA’s Joe Acaba. Backup crewmember Gennady Padalka is not seen. At the far left with the crewmembers is NASA’s Joel Montalbano, the Director of Human Spaceflight Programs in Russia. Burbank, Shkaplerov and Ivanishin will launch on November 14 in the Soyuz TMA-22 spacecraft from the Baikonur Cosmodrome in Kazakhstan. Credit: NASA

  15. jsc2014e092327

    NASA Image and Video Library

    2014-11-07

    4064a: In Red Square in Moscow, Expedition 42/43 crewmembers Samantha Cristoforetti of the European Space Agency (foreground, left) and Terry Virts of NASA (foreground, right) walk by the famed St. Basil’s Cathedral Nov. 6 as they prepare to lay flowers at the Kremlin Wall where Russian space icons are interred. In the background are backup crewmembers Kimiya Yui of the Japan Aerospace Exploration Agency, Oleg Kononenko of the Russian Federal Space Agency (Roscosmos) and Kjell Lindgren of NASA. Cristoforetti, Virts and Anton Shkaplerov of Roscosmos will launch Nov. 24, Kazakh time from the Baikonur Cosmodrome in Kazakhstan on their Soyuz TMA-15M spacecraft for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  16. jsc2014e042136

    NASA Image and Video Library

    2014-05-08

    1262: With St. Basil’s Cathedral in Moscow’s Red Square in the background, the Expedition 40/41 prime and backup crewmembers pose for pictures at the Kremlin Wall May 8 after laying flowers at the spot where Russian space icons are interred. From left to right are prime crewmembers Alexander Gerst of the European Space Agency, Max Suraev of the Russian Federal Space Agency (Roscosmos) and Reid Wiseman of NASA and backup crewmembers Samantha Cristoforetti of the European Space Agency, Terry Virts of NASA and Anton Shkaplerov of Roscosmos. Gerst, Suraev and Wiseman are preparing for launch May 29, Kazakh time, in the Soyuz TMA-13M spacecraft from the Baikonur Cosmodrome in Kazakhstan for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  17. jsc2014e091112

    NASA Image and Video Library

    2014-10-31

    3608a: At the Gagarin Cosmonaut Training Center in Star City, Russia, Expedition 42/43 Soyuz Commander Anton Shkaplerov of the Russian Federal Space Agency (Roscosmos) flashes a thumbs up as he enters a Soyuz simulator October 31 for the second day of qualification exams. Overlooking Shkaplerov is a wall mural depicting the image of Yuri Gagarin, the first human to fly in space. Shkaplerov, NASA Flight Engineer Terry Virts and European Space Agency Flight Engineer Samantha Cristoforetti are preparing for launch in the Soyuz TMA-15M spacecraft from the Baikonur Cosmodrome in Kazakhstan Nov. 24, Kazakh time, for a 5 ½ month mission on the International Space Station. NASA/Stephanie Stoll

  18. [The attempts of Bishop Ivan Sintić (1792-1837) to treat snake and other animal bites: from intuition to scientific dispute].

    PubMed

    Velcic, Franjo

    2012-01-01

    This manuscript describes an attempt to treat snake and other animal bites using an ointment made of a plant Aster atticus (sternkraut, of the family Aster). The recipe for this ointment had passed from an Istrian Bernardo Alessandri to bishop Ivan Anton Sintić at the end of the 18th century. At the request by the Austrian administration of the Province of Zadar, Sintić published a booklet on how to prepare the plant and use it, and the administration distributed the booklet to local practitioners. Encouraged by the new therapy, physician Srećko Randić of Bakar, took it for the subject of his doctoral dissertation, an published it in Vienna in 1840. However, the efficiency of this therapy was disputed by the new island of Krk physician Ivan Krstitelj Kubić after years of follow up and investigation.

  19. Bless me reader for I have sinned: physicians and confessional writing.

    PubMed

    Wear, Delese; Jones, Therese

    2010-01-01

    From the poetry of William Carlos Williams, the novels of Walker Percy, and the short stories of Anton Chekov to the contemporary essays of Atul Gawande, physicians' contributions to literary genres have been significant. This article explores the specific form of confessional writing offered by physicians during the past half century, writing that often exposes medical error or negative feelings towards patients. A history of confessional practices as a legal tool, as religious practice, and as literary genre is offered, followed by analyses of selected confessional writings by physicians, many of them found in clinical journals such as Journal of the American Medical Association, Annals of Internal Medicine, and the Lancet. The authors of the narratives described here are engaged in several or all elements of the confessional sequence, which may offer them some resolution through the exposure and acknowledgment of their shared humanity with their patients and their expression of regret for any harm done.

  20. A review of the Magnus effect in aeronautics

    NASA Astrophysics Data System (ADS)

    Seifert, Jost

    2012-11-01

    The Magnus effect is well-known for its influence on the flight path of a spinning ball. Besides ball games, the method of producing a lift force by spinning a body of revolution in cross-flow was not used in any kind of commercial application until the year 1924, when Anton Flettner invented and built the first rotor ship Buckau. This sailboat extracted its propulsive force from the airflow around two large rotating cylinders. It attracted attention wherever it was presented to the public and inspired scientists and engineers to use a rotating cylinder as a lifting device for aircraft. This article reviews the application of Magnus effect devices and concepts in aeronautics that have been investigated by various researchers and concludes with discussions on future challenges in their application.

  1. Convergence and reproducibility in molecular dynamics simulations of the DNA duplex d(GCACGAACGAACGAACGC)

    PubMed Central

    Galindo-Murillo, Rodrigo; Roe, Daniel R.; Cheatham, Thomas E.

    2014-01-01

    Background The structure and dynamics of DNA are critically related to its function. Molecular dynamics (MD) simulations augment experiment by providing detailed information about the atomic motions. However, to date the simulations have not been long enough for convergence of the dynamics and structural properties of DNA. Methods MD simulations performed with AMBER using the ff99SB force field with the parmbsc0 modifications, including ensembles of independent simulations, were compared to long timescale MD performed with the specialized Anton MD engine on the B-DNA structure d(GCACGAACGAACGAACGC). To assess convergence, the decay of the average RMSD values over longer and longer time intervals was evaluated in addition to assessing convergence of the dynamics via the Kullback-Leibler divergence of principal component projection histograms. Results These MD simulations —including one of the longest simulations of DNA published to date at ~44 μs—surprisingly suggest that the structure and dynamics of the DNA helix, neglecting the terminal base pairs, are essentially fully converged on the ~1–5 μs timescale. Conclusions We can now reproducibly converge the structure and dynamics of B-DNA helices, omitting the terminal base pairs, on the μs time scale with both the AMBER and CHARMM C36 nucleic acid force fields. Results from independent ensembles of simulations starting from different initial conditions, when aggregated, match the results from long timescale simulations on the specialized Anton MD engine. General Significance With access to large-scale GPU resources or the specialized MD engine “Anton” it is possibly for a variety of molecular systems to reproducibly and reliably converge the conformational ensemble of sampled structures. PMID:25219455

  2. Increasing Scientific Confidence in Adverse Outcome Pathways: Application of Tailored Bradford-Hill Considerations for Evaluating Weight of Evidence.

    PubMed

    Becker, Richard A; Ankley, Gerald T; Edwards, Stephen W; Kennedy, Sean W; Linkov, Igor; Meek, Bette; Sachana, Magdalini; Segner, Helmut; Van Der Burg, Bart; Villeneuve, Daniel L; Watanabe, Haruna; Barton-Maclaren, Tara S

    2015-08-01

    Systematic consideration of scientific support is a critical element in developing and, ultimately, using adverse outcome pathways (AOPs) for various regulatory applications. Though weight of evidence (WoE) analysis has been proposed as a basis for assessment of the maturity and level of confidence in an AOP, methodologies and tools are still being formalized. The Organization for Economic Co-operation and Development (OECD) Users' Handbook Supplement to the Guidance Document for Developing and Assessing AOPs (OECD 2014a; hereafter referred to as the OECD AOP Handbook) provides tailored Bradford-Hill (BH) considerations for systematic assessment of confidence in a given AOP. These considerations include (1) biological plausibility and (2) empirical support (dose-response, temporality, and incidence) for Key Event Relationships (KERs), and (3) essentiality of key events (KEs). Here, we test the application of these tailored BH considerations and the guidance outlined in the OECD AOP Handbook using a number of case examples to increase experience in more transparently documenting rationales for assigned levels of confidence to KEs and KERs, and to promote consistency in evaluation within and across AOPs. The major lessons learned from experience are documented, and taken together with the case examples, should contribute to better common understanding of the nature and form of documentation required to increase confidence in the application of AOPs for specific uses. Based on the tailored BH considerations and defining questions, a prototype quantitative model for assessing the WoE of an AOP using tools of multi-criteria decision analysis (MCDA) is described. The applicability of the approach is also demonstrated using the case example aromatase inhibition leading to reproductive dysfunction in fish. Following the acquisition of additional experience in the development and assessment of AOPs, further refinement of parameterization of the model through expert

  3. Application of the adverse outcome pathway (AOP) concept to structure the available in vivo and in vitro mechanistic data for allergic sensitization to food proteins.

    PubMed

    van Bilsen, Jolanda H M; Sienkiewicz-Szłapka, Edyta; Lozano-Ojalvo, Daniel; Willemsen, Linette E M; Antunes, Celia M; Molina, Elena; Smit, Joost J; Wróblewska, Barbara; Wichers, Harry J; Knol, Edward F; Ladics, Gregory S; Pieters, Raymond H H; Denery-Papini, Sandra; Vissers, Yvonne M; Bavaro, Simona L; Larré, Colette; Verhoeckx, Kitty C M; Roggen, Erwin L

    2017-01-01

    .aopwiki.org platform to expand the mechanistic data, improve the confidence in each of the proposed KE and key event relations (KERs), and allow for the identification of new, or refinement of established KE and KERs.

  4. A comparison of different synchronization measures in electroencephalogram during propofol anesthesia.

    PubMed

    Liang, Zhenhu; Ren, Ye; Yan, Jiaqing; Li, Duan; Voss, Logan J; Sleigh, Jamie W; Li, Xiaoli

    2016-08-01

    Electroencephalogram (EEG) synchronization is becoming an essential tool to describe neurophysiological mechanisms of communication between brain regions under general anesthesia. Different synchronization measures have their own properties to reflect the changes of EEG activities during different anesthetic states. However, the performance characteristics and the relations of different synchronization measures in evaluating synchronization changes during propofol-induced anesthesia are not fully elucidated. Two-channel EEG data from seven volunteers who had undergone a brief standardized propofol anesthesia were then adopted to calculate eight synchronization indexes. We computed the prediction probability (P K ) of synchronization indexes with Bispectral Index (BIS) and propofol effect-site concentration (C eff ) to quantify the ability of the indexes to predict BIS and C eff . Also, box plots and coefficient of variation were used to reflect the different synchronization changes and their robustness to noise in awake, unconscious and recovery states, and the Pearson correlation coefficient (R) was used for assessing the relationship among synchronization measures, BIS and C eff . Permutation cross mutual information (PCMI) and determinism (DET) could predict BIS and follow C eff better than nonlinear interdependence (NI), mutual information based on kernel estimation (KerMI) and cross correlation. Wavelet transform coherence (WTC) in α and β frequency bands followed BIS and C eff better than that in other frequency bands. There was a significant decrease in unconscious state and a significant increase in recovery state for PCMI and NI, while the trends were opposite for KerMI, DET and WTC. Phase synchronization based on phase locking value (PSPLV) in δ, θ, α and γ1 frequency bands dropped significantly in unconscious state, whereas it had no significant synchronization in recovery state. Moreover, PCMI, NI, DET correlated closely with each other and they

  5. The adverse outcome pathway for rodent liver tumor promotion by sustained activation of the aryl hydrocarbon receptor.

    PubMed

    Becker, Richard A; Patlewicz, Grace; Simon, Ted W; Rowlands, J Craig; Budinsky, Robert A

    2015-10-01

    An Adverse Outcome Pathway (AOP) represents the existing knowledge of a biological pathway leading from initial molecular interactions of a toxicant and progressing through a series of key events (KEs), culminating with an apical adverse outcome (AO) that has to be of regulatory relevance. An AOP based on the mode of action (MOA) of rodent liver tumor promotion by dioxin-like compounds (DLCs) has been developed and the weight of evidence (WoE) of key event relationships (KERs) evaluated using evolved Bradford Hill considerations. Dioxins and DLCs are potent aryl hydrocarbon receptor (AHR) ligands that cause a range of species-specific adverse outcomes. The occurrence of KEs is necessary for inducing downstream biological responses and KEs may occur at the molecular, cellular, tissue and organ levels. The common convention is that an AOP begins with the toxicant interaction with a biological response element; for this AOP, this initial event is binding of a DLC ligand to the AHR. Data from mechanistic studies, lifetime bioassays and approximately thirty initiation-promotion studies have established dioxin and DLCs as rat liver tumor promoters. Such studies clearly show that sustained AHR activation, weeks or months in duration, is necessary to induce rodent liver tumor promotion--hence, sustained AHR activation is deemed the molecular initiating event (MIE). After this MIE, subsequent KEs are 1) changes in cellular growth homeostasis likely associated with expression changes in a number of genes and observed as development of hepatic foci and decreases in apoptosis within foci; 2) extensive liver toxicity observed as the constellation of effects called toxic hepatopathy; 3) cellular proliferation and hyperplasia in several hepatic cell types. This progression of KEs culminates in the AO, the development of hepatocellular adenomas and carcinomas and cholangiolar carcinomas. A rich data set provides both qualitative and quantitative knowledge of the progression of

  6. A wavelength dependent investigation of the indole photophysics via ionization and fragmentation pump-probe spectroscopies.

    PubMed

    Godfrey, T J; Yu, Hui; Biddle, Michael S; Ullrich, Susanne

    2015-10-14

    A wavelength dependent study investigating the low-lying (1)La and (1)Lb states, both possessing (1)ππ* character, and the (1)πσ* state in the deactivation process of indole is presented here. Relaxation dynamics following excitation at 241, 250, 260, 270, 273, and 282 nm are examined using three gas-phase, pump-probe spectroscopic techniques: (1) hydrogen atom (H-atom) time-resolved kinetic energy release (TR-KER), (2) time-resolved photoelectron spectroscopy (TR-PES), and (3) time-resolved ion yield (TR-IY). Applied in combination, a more complete picture of the indole relaxation dynamics may be gleaned. For instance, TR-PES experiments directly observe all relaxation pathways by probing the evolution of the excited states following photoexcitation; whereas, TR-KER measurements indirectly, yet specifically, probe for (1)πσ*-state activity through the detection of H-atoms eliminated along the indole nitrogen-hydrogen (N-H) stretch coordinate-a possible outcome of (1)πσ*-state relaxation in indole. In addition, mass information obtained via TR-IY monitors fragmentation dynamics that may occur within the neutral electronically excited and/or cationic states. The work herein assesses the onset and importance of the (1)πσ* state at various pump wavelengths by systematically tuning across the ultraviolet absorption spectrum of indole with a particular focus on those pump wavelengths longer than 263 nm, where the involvement of the (1)πσ* state is under current debate. As far as this experimental work is concerned, there does not appear to be any significant involvement by the (1)πσ* state in the indole relaxation processes following excitation at 270, 273, or 282 nm. This investigation also evaluates the primary orbital promotions contributing to the (1)La, (1)Lb, and (1)πσ* transitions based on ionization preferences observed in TR-PES spectra. Relaxation time constants associated with dynamics along these states are also reported for excitation at all

  7. Mapping the isotopic signature of methane in South-Eastern Spain: complementing biogeochemical long-term research with short term observations

    NASA Astrophysics Data System (ADS)

    Àgueda, Alba; Morguí, Josep Anton; Vazquez Garcia, Eusebi; Curcoll, Roger; Lowry, David; Fisher, Rebecca E.; Nisbet, Euan G.

    2016-04-01

    will be helpful in the validation of transport models. *Corresponding author: Josep Anton Morguí - josep-anton.morgui@ic3.cat "The research leading to these results has received funding from the European Community's Seventh Framework Programme (FP7/2007-2013) in the InGOS project under grant agreement n° 284274''

  8. The Zach family in Hungary

    NASA Astrophysics Data System (ADS)

    Vargha, Magda

    The Zach Family moved to Hungary. In the first decades of the 18th century the population was so low in Hungary that thousands of people moved into an almost empty country. In 1740 the physician Joseph Zach (1714-1792) came from Moravia to Esztergom which at that time had only 10 000 inhabitants. Soon he became the city doctor. It is very probable, that this was the place where he met Klara Sonntag, who became his wife. In any case, Zach moved to Pest, where he became the city doctor in 1746. The Invalide-Hospital built by Martinelli in 1726 was the biggest and most elegant house in Pest at that time - and it was giving shelter to 4000 invalids, whilst the city itself had only 11 000 inhabitants. There Zach became the ``protomedicus''. In 1751 Austrian Empress Maria Theresia visited this military hospital. She was so impressed by Zach's work that she honoured him with Hungarian nobility in 1765. From the corresponding official paper we know that he had three sons and three daughters. In 1791 he received citizenship in Pest. The Hungarian Magnates favoured the talented physician. The Lord Chief Justice Count György Fekete was also among his patients. His thirteen year-old son Count János Fekete became the godfather of Zach's son Franz Xaver Zach in 1754. It is very likely that Voltairian Count János Fekete influenced the personality of Franz Xaver von Zach. Galicia became Austrian Territory in 1772. Pater Liesganig was nominated to lead the Land-Survey Office of Galicia. Anton von Zach and Franz Xaver Zach were his co-workers in this very important task. At the same time Franz Zach became a professor of mechanics at Lemberg University and in its observatory he began his life-long astronomical observations. It is very probable that he joined the Freemasons here together with his godfather, now General, Jänos Fekete. Later they stayed in the same cities very often. The military and scientific works of the two Zach brothers Anton and Franz were so highly

  9. [Toxicologic risk assessment and prevention: rational and irrational approaches].

    PubMed

    Forth, W

    1996-12-01

    infectious diseases or diseases caused by parasites are far more serious than the exposure to any man made chemical product including the Seveso poison, i.e. 2,3,7,8-TCDD, and related compounds. Vice-versa, the assumption that naturally occurring poisons could be neglected may lead to fatal experiences as for instances the outbreak of St-Anton's fire, i.e. the gangraeneous type of ergot alacaloide intoxication after having swallowed claviceps purpurea poisoned "Müsli" produced by rye collected in the fields and ground in a hand mill. In Middle-Europe, since 1880, when the threshold of 0.1% claviceps purpurea in rye was established, no poisonous epidemia of St. Anton's fire was observed.

  10. Tracing ultrafast molecular transitions in C2H4 using two­color XUV pump­ XUV probe

    NASA Astrophysics Data System (ADS)

    Ray, D.; Sturm, F. P.; Wright, T. W.; Shivaram, N.; Bocharova, I.; Belkacem, A.; Weber, Th.

    2014-05-01

    We present the study of the ultrafast energy transfer near a conical intersection in C2H4, using an extreme ultraviolet (XUV) pump XUV probe scheme. The high harmonic pulses, which have sufficiently high flux to split into both pump and probe arms, are generated in a noble gas by IR pulses from our state of the art 30 mJ, 50 Hz laser system. The pulses are overlapped with the supersonic jet in our Momentum Imaging for TimE Resolved Studies (MISTERS) setup. The C2H4 is pumped by the 13.5 eV XUV pulses (9th harmonic) to populate the excited valence state (π*)2 orbitals. The double ionization of these molecular cations from this transient state is triggered by the 15th harmonic (22.5 eV) as the probe. The ionic fragments are imaged with the reaction microscope. The MISTERS setup allows us to do an ion-ion coincidence detection in full 3D momentum space. The Kinetic Energy Release (KER) distributions are studied as a function of pump probe delay to trace the evolution of the transient states. Supported by the Director, Office of Science, Office of Basic Energy Sciences, and by the Division of Chemical Sciences, Geosciences, and Biosciences of the U.S. Department of Energy at LBNL under Contract No. DE­AC02­05CH11231.

  11. Sedative and anticonvulsant effects of an alcoholic extract of Capparis decidua.

    PubMed

    Goyal, Manoj; Nagori, B P; Sasmal, D

    2009-10-01

    Capparis decidua (frock) Edgew (family Capparidaceae) is a xerophytic shrub, commonly known as karrel or ker, whose bark and shoot are used as analgesic, anti-inflammatory, hypolipidemic, and antidiabetic agents. The plant contains generous quantities of alkaloids. An alcoholic extract of aerial parts of C. decidua, including flowers and fruits, was screened for central nervous system (CNS) activity using conventional behavioral animal models. In the open field test all doses of C. decidua extract tested decreased the number of rearings, grooming, and fecal bolus (P < 0.001) when compared with control. In the barbiturate-induced sleeping test a significant (P < 0.001) a decrease in latency of sleeping and increase in sleeping time were observed at all doses (100, 200, and 300 mg/kg). C. decidua extract increased the percentage of animals exhibiting motor deficit in the rotarod test. In the pentylenetetrazole-induced seizures test the C. decidua extract dose-dependently decreased (P < 0.05) the number of animals with convulsions and increased convulsion latency (P < 0.001); none of the animals treated with extract died in the test. C. decidua extract decreased the duration of tonic hind leg extension in maximal electroshock-induced seizures (P < 0.001) when compared with control. The findings of the present animal study suggested that C. decidua has CNS depressant and anticonvulsant activities.

  12. Resistive wall mode feedback control in EXTRAP T2R with improved steady-state error and transient response

    NASA Astrophysics Data System (ADS)

    Brunsell, P. R.; Olofsson, K. E. J.; Frassinetti, L.; Drake, J. R.

    2007-10-01

    Experiments in the EXTRAP T2R reversed field pinch [P. R. Brunsell, H. Bergsåker, M. Cecconello et al., Plasma Phys. Control. Fusion 43, 1457 (2001)] on feedback control of m =1 resistive wall modes (RWMs) are compared with simulations using the cylindrical linear magnetohydrodynamic model, including the dynamics of the active coils and power amplifiers. Stabilization of the main RWMs (n=-11,-10,-9,-8,+5,+6) is shown using modest loop gains of the order G ˜1. However, other marginally unstable RWMs (n=-2,-1,+1,+2) driven by external field errors are only partially canceled at these gains. The experimental system stability limit is confirmed by simulations showing that the latency of the digital controller ˜50μs is degrading the system gain margin. The transient response is improved with a proportional-plus-derivative controller, and steady-state error is improved with a proportional-plus-integral controller. Suppression of all modes is obtained at high gain G ˜10 using a proportional-plus-integral-plus-derivative controller.

  13. Prioritizing individual genetic variants after kernel machine testing using variable selection.

    PubMed

    He, Qianchuan; Cai, Tianxi; Liu, Yang; Zhao, Ni; Harmon, Quaker E; Almli, Lynn M; Binder, Elisabeth B; Engel, Stephanie M; Ressler, Kerry J; Conneely, Karen N; Lin, Xihong; Wu, Michael C

    2016-12-01

    Kernel machine learning methods, such as the SNP-set kernel association test (SKAT), have been widely used to test associations between traits and genetic polymorphisms. In contrast to traditional single-SNP analysis methods, these methods are designed to examine the joint effect of a set of related SNPs (such as a group of SNPs within a gene or a pathway) and are able to identify sets of SNPs that are associated with the trait of interest. However, as with many multi-SNP testing approaches, kernel machine testing can draw conclusion only at the SNP-set level, and does not directly inform on which one(s) of the identified SNP set is actually driving the associations. A recently proposed procedure, KerNel Iterative Feature Extraction (KNIFE), provides a general framework for incorporating variable selection into kernel machine methods. In this article, we focus on quantitative traits and relatively common SNPs, and adapt the KNIFE procedure to genetic association studies and propose an approach to identify driver SNPs after the application of SKAT to gene set analysis. Our approach accommodates several kernels that are widely used in SNP analysis, such as the linear kernel and the Identity by State (IBS) kernel. The proposed approach provides practically useful utilities to prioritize SNPs, and fills the gap between SNP set analysis and biological functional studies. Both simulation studies and real data application are used to demonstrate the proposed approach. © 2016 WILEY PERIODICALS, INC.

  14. Adverse Outcome Pathway (AOP) Network Development for ...

    EPA Pesticide Factsheets

    Adverse outcome pathways (AOPs) are descriptive biological sequences that start from a molecular initiating event (MIE) and end with an adverse health outcome. AOPs provide biological context for high throughput chemical testing and further prioritize environmental health risk research. According to the Organization for Economic Co-operation and Development guidelines, AOPs are pathways with one MIE anchored to an adverse outcome (AO) by key events (KEs) and key event relationships (KERs). However, this approach does not always capture the cumulative impacts of multiple MIEs on the AO. For example, hepatic lipid flux due to chemical-induced toxicity initiates from multiple ligand-activated receptors and signaling pathways that cascade across biology to converge upon a common fatty liver (FL, also known as steatosis) outcome. To capture this complexity, a top-down strategy was used to develop a FL AOP network (AOPnet). Literature was queried based on the terms steatosis, fatty liver, cirrhosis, and hepatocellular carcinoma. Search results were analyzed for physiological and pathophysiological organ level, cellular and molecular processes, as well as pathway intermediates, to identify potential KEs and MIEs that are key for hepatic lipid metabolism, maintenance, and dysregulation. The analysis identified four apical KE nodes (hepatic fatty acid uptake, de novo fatty acid and lipid synthesis, fatty acid oxidation, and lipid efflux) juxtaposed to the FL AO. The apic

  15. Dissociative ionization and Coulomb explosion of CH3I in intense femto second laser fields

    NASA Astrophysics Data System (ADS)

    Zhang, Dongdong; Luo, Sizuo; Xu, Haifeng; Jin, Mingxing; Liu, Fuchun; Yan, Bing; Wang, Zhigang; Liu, Hang; Jiang, Dianwu; Eppink, André; Roeterdink, Wim; Stolte, Steven; Ding, Dajun

    2017-06-01

    The interaction of CH3I molecules with 100 fs 800 nm linearly polarized laser fields has been investigated at the intensity region from 2.6 × 1014 to 5.8 × 1014 W/cm2 by means of a velocity map imaging method. The kinetic energy distribution of the various atomic fragment ions I q+ ( q = 1-3) has been measured and reproduced by a fit of multiple Gaussian functions. Several dissociative ionization and Coulomb explosion channels were identified for I q+ ( q = 1-3). As expected for a geometric alignment dominated interaction process the anisotropic angular recoil distributions of the atomic ion fragments are peaked in the laser polarization direction. The kinetic energy release (KER) of I q+ ( q = 1-3) depending upon the laser intensity has been investigated. The relative weight of the various contributions from the identified dissociative ionization (DI) and Coulomb explosion (CE) channels is found to depend strongly on the laser intensity.

  16. Canna edulis leaf extract-mediated preparation of stabilized silver nanoparticles: Characterization, antimicrobial activity, and toxicity studies.

    PubMed

    Otari, S V; Pawar, S H; Patel, Sanjay K S; Singh, Raushan K; Kim, Sang-Yong; Lee, Jai Hyo; Zhang, Liaoyuan; Lee, Jung-Kul

    2017-01-12

    A novel approach to synthesize silver nanoparticles (AgNPs) using leaf extract of Canna edulis Ker-Gawl. (CELE) under ambient conditions is reported here. The as-prepared AgNPs were analyzed by UV-visible spectroscopy, transmission emission microscopy, X-ray diffraction, Fourier transform-infra red spectroscopy, energy-dispersive analysis of X-ray spectroscopy, zeta potential, and dynamic light scattering. The AgNPs showed excellent antimicrobial activity against various pathogens, including bacteria and various fungi. The biocompatibility of the AgNPs was analyzed in the L929 cell line using NRU and MTT assays. Acridine orange/ethidium bromide staining was used to determine whether the AgNPs had necrotic or apoptotic effects on L929 cells. The concentration of AgNPs required for 50% inhibition of growth of mammalian cells is far more than that required for inhibition of pathogenic microorganisms. Thus, CELE is a candidate for eco-friendly, clean, cost-effective, and non-toxic synthesis of AgNPs.

  17. [Study on identification of Gastrodia elata Bl. by Fourier self-deconvolution infrared spectroscopy].

    PubMed

    Cheng, Ze-Feng; Xu, Rui; Cheng, Cun-Gui

    2007-09-01

    In the present article the FTIR spectra of the wild and planting Gastrodia elata Bl. from different habitats and its confusable varieties such as Canna edulis Ker-Gawl, Colocasia esculenta (L.) Schott and Solanum tuberosum L. were obtained by horizontal attenuated total reflection infrared spectroscopy (HATR-FTIR), and were all transformed by Fourier self-deconvolution. The authors investigated the discrepancy extent of Fourier self-deconvolution of Gastrodia elata Bl and confusable varieties under various bandwidth and enhancement, and found that the discrepancy extent of Gastrodia elata Bl and confusable varieties was the most obvious when the bandwidth was between 75.0 and 76.0 and enhancement was 3.2. By adopting Fourier self-deconvolution infrared spectroscopy (FSD-IR) analytical method the samples were studied in detail. The results showed that we could find out the difference among them by means of Fourier self-deconvolution infrared spectroscopy, although it was very difficult to find out the difference in FSD-IR spectra of wild and planting Gastrodia elata Bl., and asexual reproduction and sexual reproduction Gastrodia elata Bl. The difference in FSD-IR spectra between Gastrodia elata Bl. and its confusable varieties is also very great. Therefore, this method can be used to recognize different Gastrodia elata Bl. and its confusable varieties simply, rapidly and accurately.

  18. Multiscale seismic attributes: source-corrected wavelet response and application to high-resolution seismic data

    NASA Astrophysics Data System (ADS)

    Ker, Stephan; Le Gonidec, Yves; Gibert, Dominique

    2012-09-01

    A wavelet-based method was presented in a previous work to introduce multiscale seismic attributes for high-resolution seismic data. Because of the limited frequency bandwidth of the seismic source, we observed distortions in the seismic attributes based on the wavelet response of the subsurface discontinuities (Le Gonidec et al.). In this paper, we go further in the seismic source-correction by considering Lévy alpha-stable distributions introduced in the formalism of the continuous wavelet transform (CWT). The wavelets are Gaussian derivative functions (GDF), characterized by a derivative order. We show that a high-resolution seismic source, after a classical signature processing, can be taken into account with a GDF. We demonstrate that in the framework of the Born approximation, the CWT of a seismic trace involving such a finite frequency bandwidth can be made equivalent to the CWT of the impulse response of the subsurface and is defined for a reduced range of dilations. We apply the method for the SYSIF seismic device (Marsset et al.; Ker et al.) and show that the source-corrections allow to define seismic attributes for layer thicknesses in the range [24; 115 cm]. We present the analysis for two seismic reflectors identified on a SYSIF profile, and we show that the source-corrected multiscale analysis quantifies their complex geometries.

  19. Anopheles (Kerteszia) lepidotus (Diptera: Culicidae), not the malaria vector we thought it was: Revised male and female morphology; larva, pupa, and male genitalia characters; and molecular verification

    PubMed Central

    HARRISON, BRUCE A.; RUIZ-LOPEZ, FREDDY; FALERO, GUILLERMO CALDERON; SAVAGE, HARRY M.; PECOR, JAMES E.; WILKERSON, RICHARD C.

    2015-01-01

    The name Anopheles (Kerteszia) lepidotus Zavortink, commonly used for an important malaria vector in the eastern cordillera of the Andes, is here corrected to An. pholidotus Zavortink. We discovered that An. (Ker.) specimens from Peru, and reared-associated specimens from Ecuador, had unambiguous habitus characters that matched those on the male holotype of An. lepidotus. However, the specimens do not exhibit characters of the female allotype and female paratypes of An. lepidotus, which are actually An. pholidotus. Our specimens are the first correctly associated females of An. lepidotus, which allow us to provide a new morphological interpretation for the adult habitus of this species. This finding is also corroborated by molecular data from a portion of the Cytochrome Oxidase I (COI) gene and ribosomal DNA Internal Transcribed Spacer 2 (rDNA ITS2). The pupal stage of An. lepidotus is described for the first time, and additional larval characters are also noted. Diagnostic morphological characters for the adult, pupal, and larval stages of An. pholidotus are provided to separate the two species. All stages of An. lepidotus are easily separated from other currently known species in subgenus Kerteszia and a new key to the females of An. (Kerteszia) is given. Previously published distribution, bionomics, and medical significance data are corrected and enhanced. PMID:26726290

  20. Elemental Mercury Oxidation over Fe-Ti-Mn Spinel: Performance, Mechanism, and Reaction Kinetics.

    PubMed

    Xiong, Shangchao; Xiao, Xin; Huang, Nan; Dang, Hao; Liao, Yong; Zou, Sijie; Yang, Shijian

    2017-01-03

    The design of a high-performance catalyst for Hg(0) oxidation and predicting the extent of Hg(0) oxidation are both extremely limited due to the uncertainties of the reaction mechanism and the reaction kinetics. In this work, Fe-Ti-Mn spinel was developed as a high-performance catalyst for Hg(0) oxidation, and the reaction mechanism and the reaction kinetics of Hg(0) oxidation over Fe-Ti-Mn spinel were studied. The reaction orders of Hg(0) oxidation over Fe-Ti-Mn spinel with respect to gaseous Hg(0) concentration and gaseous HCl concentration were approximately 1 and 0, respectively. Therefore, Hg(0) oxidation over Fe-Ti-Mn spinel mainly followed the Eley-Rideal mechanism (i.e., the reaction of gaseous Hg(0) with adsorbed HCl), and the rate of Hg(0) oxidation mainly depended on Cl(•) concentration on the surface. As H2O, SO2, and NO not only inhibited Cl(•) formation on the surface but also interfered with the interface reaction between gaseous Hg(0) and Cl(•) on the surface, Hg(0) oxidation over Fe-Ti-Mn spinel was obviously inhibited in the presence of H2O, SO2, and NO. Furthermore, the extent of Hg(0) oxidation over Fe-Ti-Mn spinel can be predicted according to the kinetic parameter kE-R, and the predicted result was consistent with the experimental result.

  1. HPLC - DAD analysis of lycorine in Amaryllidaceae species.

    PubMed

    Kaya, Gulen Irem; Cicek, Derya; Sarikaya, Buket; Onur, Mustafa Ali; Somer, Nehir Unver

    2010-06-01

    Lycorine, the most frequent alkaloid found in Amaryllidaceae plants, has been proven to have various biological activities. Therefore, it is important to quantify this compound in Amaryllidacaeae species. In this study, a reversed-phase high-performance liquid chromatographic method has been used and validated for the determination of lycorine in Amaryllidaceae plants. A simple method for the extraction of lycorine in low-mass plant samples was employed utilizing columns pre-packed with diatomaceous earth (Extrelut). This method was applied to the aerial parts and bulbs of Sternbergia sicula Tineo ex Guss., S. lutea (L.) Ker-Gawl. ex Sprengel and Pancratium maritimum L. (Amaryllidaceae) collected during two different vegetation periods. The chromatographic separation was performed using an isocratic system with a mobile phase of trifluoroacetic acid-water-acetonitrile (0.01:90:10) applied at a flow rate 1 mL min(-1) using diode array detector. Validation procedures showed that the method was specific, accurate and precise. The amount of lycorine in S. sicula samples ranged between 0.10-0.53%, whereas in those of S. lutea and P. maritimum, the range was 0.19-0.40% and 0.05-0.14%, respectively.

  2. Orientation dependence of the ionization of CO and NO in an intense femtosecond two-color laser field

    NASA Astrophysics Data System (ADS)

    Li, Hui; Ray, Dipanwita; de, Sankar; Cao, Wei; Laurent, Guillaume; Wang, Zhenhua; Thu Le, Anh; Cocke, C. Lewis; Znakovskaya, Irina; Kling, Matthias

    2012-06-01

    Two-color (800 nm and 400 nm) ultrashort (30±10 fs) laser pulses were used to ionize and dissociate CO and NO. The emission of C^+q, N^+q and O^+ fragments were measured with a velocity-map-imaging (VMI) system. The data show that the ionization rate is dependent on the orientation of the molecules with respect to the laser polarization. Both molecules ionize more easily when the electric field points from C to O in CO and from N to O in NO. The asymmetry of emission is much higher for CO than for NO. The sign of the asymmetry is not strongly dependent on kinetic energy release (KER). The favored ionization orientation is in agreement with the expectation of the molecular orbital Ammosov-Delone-Krainov (MO-ADK) [1] theory and with a Stark-corrected version of a strong-field-approximation (SFA) calculation [2]. [4pt] [1] X.M. Tong, et al., Phys. Rev. A 66, 033402 (2002).[0pt] [2] H. Li, et al., Phys. Rev. A 84, 043429 (2011).

  3. Excitation dynamics involving homogeneous multistate interactions: one and two color VMI and REMPI of HBr.

    PubMed

    Hróðmarsson, Helgi Rafn; Kartakoullis, Andreas; Zaouris, Dimitris; Glodic, Pavle; Wang, Huasheng; Samartzis, Peter C; Kvaran, Ágúst

    2017-05-10

    Velocity map imaging (VMI) data and mass resolved REMPI spectra are complementarily utilized to elucidate the involvement of homogeneous multistate interactions in excited state dynamics of HBr. The H(1)Σ(+)(v' = 0) and E(1)Σ(+)(v' = 1) Rydberg states and the V(1)Σ(+)(v'= m + 7) and V(1)Σ(+)(v'= m + 8) ion-pair states are explored as a function of rotational quantum number in the two-photon excitation region of 79 100-80 700 cm(-1). H(+) and Br(+) images were recorded by one- as well as two-color excitation schemes. Kinetic energy release (KER) spectra and angular distributions were extracted from the data. Strong-to-medium interactions between the E(1) and V(m + 8)/V(m + 7) states on one hand and the H(0) and V(m + 7)/V(m + 8) states on the other hand were quantified from peak shifts and intensity analysis of REMPI spectra. The effects of those interactions on subsequent photoionization and photolytic pathways of HBr were evaluated in one-color VMI experiments of the H(+) and two-color VMI experiments of the Br(+) photoproducts.

  4. Heat stress-induced response of the proteomes of leaves from Salvia splendens Vista and King

    PubMed Central

    2013-01-01

    Background Salvia splendens Ker-Gawl, most commonly used in China to add a splash of brilliant color to the surroundings during the warm season, is subject to heat stress, which can greatly affect its growth and yield. Results To gain a comprehensive understanding of heat-tolerance mechanisms of S. splendens, we assessed the heat-stress responses and characterized the proteomes of leaves from two varieties, Vista (heat resistant) and King (heat sensitive). Denaturing two-dimensional gel electrophoresis (2–DE) and tandem mass spectrometry were used to identify heat-responsive proteins. Heat stress induced the reversible inactivation of photosystem II reaction centers and increased the amounts of antioxidative enzymes, thereby decreasing oxidative damage. Vista leaves had a much greater ability than King leaves to develop light-protective and oxygen-scavenging systems in response to heat stress. More than 1213 leaf proteome spots were reproducibly detected in the gels, with a total of 33 proteins in each leaf type differentially regulated when Salvia splendens were heat stress treated. Of these proteins, 23 and 28 from Vista and King, respectively, were identified. Conclusions Most of the identified proteins are involved in photosynthesis, metabolism, protein processing, or stress response, indicating that many different processes work together to establish a new cellular homeostasis in response to heat stress. PMID:23773552

  5. Far infrared spectrum of Methanol-D2 in the lowest torsional state (e0)

    NASA Astrophysics Data System (ADS)

    Mukhopadhyay, Indra

    2016-03-01

    The infrared (IR) and far infrared (FIR) absorption spectra have been measured for the Methanol-D1 and D2 species in the wave number range of 20-1200 cm-1 at the Justus Liebig Universität in Giessen, Germany using a Brüker Fourier Transform spectrometer at a resolution of 0.002 cm-1. The spectra looked very complicated but analyses were possible for the lower lying states. At higher wave number regions spectra of few vibrational fundamental modes were visible. In this communication, the details of the assignments and analyses of the lowest lying internal rotational state (e0) for Methanol-D2 are reported. A catalog of about 900 assigned spectral lines has been prepared and is made available from the author to conserve space. As application of this work, it was possible to assign some optically pumped FIR laser lines to quantum states. The results should be useful for "radio astronomers" and in the field of optically pumped FIR and Sub-millimeter Wave (SMMW) lasers which are used in Tokamaks for plasma diagnostics and as local oscillators in radio detection from space.

  6. Classification of electron sub-tomograms with neural networks and its application to template-matching.

    PubMed

    Yu, Zhou; Frangakis, Achilleas S

    2011-06-01

    Classification of electron sub-tomograms is a challenging task, due the missing-wedge and the low signal-to-noise ratio of the data. Classification algorithms tend to classify data according to their orientation to the missing-wedge, rather than to the underlying signal. Here we use a neural network approach, called the Kernel Density Estimator Self-Organizing Map (KerDenSOM3D), which we have implemented in three-dimensions (3D), also having compensated for the missing-wedge, and we comprehensively compare it to other classification methods. For this purpose, we use various simulated macromolecules, as well as tomographically reconstructed in vitro GroEL and GroEL/GroES molecules. We show that the performance of this classification method is superior to previously used algorithms. Furthermore, we show how this algorithm can be used to provide an initial cross-validation of template-matching approaches. For the example of sub-tomogram classification extracted from cellular tomograms of Mycoplasma pneumonia and Spiroplasma melliferum cells, we show the bias of template-matching, and by using differing search and classification areas, we demonstrate how the bias can be significantly reduced.

  7. Optimum extraction of polysaccharides from Opuntia dillenii and evaluation of its antioxidant activities.

    PubMed

    Yang, Qin; Chen, Huaguo; Zhou, Xin; Zhang, Junzeng

    2013-09-12

    Response surface methodology (RSM) was applied to optimize the extraction of crude polysaccharides from Opuntia dillenii (Ker-Gaw) Haw. A three-level, four-variable Box-Behnken design was employed to obtain the best possible combination of extraction temperature (80-90 °C), extraction time (50-70 min), number of extraction cycle (1-3 times), and ratio of water to raw material (8:1-12:1, v/w) for maximum yield of crude polysaccharide. Besides, the antioxidant capacity of crude polysaccharide was evaluated by DPPH assay. The results showed that optimized extraction conditions were extraction temperature 85 °C, extraction time 63.7 min, extraction 2 times and ratio of water to raw material 11.14:1. Under these conditions, the experimental yield was 27.36 ± 0.21%, which is well in close agreement with the value (27.44%) predicted by RSM model. Pharmacological test showed that O. dillenii crude polysaccharides had a good antioxidant activity.

  8. Adverse Outcome Pathways – Organizing Toxicological ...

    EPA Pesticide Factsheets

    The number of chemicals for which environmental regulatory decisions are required far exceeds the current capacity for toxicity testing. High throughput screening (HTS) commonly used for drug discovery has the potential to increase this capacity. The adverse outcome pathway (AOP) concept has emerged as a natural framework for connecting high throughput toxicity testing (HTT) results to potential impacts on humans and wildlife populations. An AOP consists of two main components that describe the biological mechanisms driving toxicity. Key events represent biological processes essential for causing the adverse outcome that are also measurable experimentally. Key event relationships capture the biological processes connecting the key events. Evidence documented for each KER based on measurements of the KEs can provide the confidence needed for extrapolating HTT from early key events to overt toxicity represented by later key events based on the AOP. The IPCS mode of action (MOA) framework incorporates information required for making a chemical-specific toxicity determination. Given the close relationship between the AOP and MOA frameworks, it is possible to assemble an MOA by incorporating HTT results, chemical properties including absorption, distribution, metabolism, and excretion (ADME), and an AOP describing the biological basis of toxicity thereby streamlining the process. While current applications focus on the assessment of risk for environmental chemicals,

  9. Electron transfer mediated decay in NeXe triggered by K-LL Auger decay of Ne

    NASA Astrophysics Data System (ADS)

    Stumpf, Vasili; Scheit, Simona; Kolorenč, Přemysl; Gokhberg, Kirill

    2017-01-01

    In this article we present the results of an ab initio study of electron transfer mediated decay (ETMD) in NeXe dimer triggered by the K-LL Auger decay of Ne. We found that the Ne2+ (2p-21D)Xe and Ne2+ (2p-21S)Xe states which are strongly populated in the Auger process may decay by ETMD emitting a slow electron and leading to the Coulomb explosion of the dimer which results in Ne+ and Xe2+ ions. We also computed the corresponding decay widths, the ETMD electron spectra, and the kinetic energy release of the nuclei (KER) spectra. We showed that the spectra corresponding to the decaying states which derive from the two multiplets have completely different shape which reflects differing accessibility of the ETMD final states. Thus, in the Ne2+ (2p-21S)Xe state ETMD is allowed for all interatomic distances accessible in nuclear dynamics, while in the Ne2+ (2p-21D)Xe state the ETMD channels become closed one by one. This in turn leads to the different behavior of the ETMD decay widths and ultimately the spectra. We show how these differences make it possible to study ETMD of the two states separately in a coincident measurement. We also discuss how the dynamics which follow ETMD in the final state manifold may lead to the appearance of the unusual products: Ne, Xe3+ and a slow electron.

  10. Anopheles (Kerteszia) cruzii (DIPTERA: CULICIDAE) IN PERIDOMICILIARY AREA DURING ASYMPTOMATIC MALARIA TRANSMISSION IN THE ATLANTIC FOREST: MOLECULAR IDENTIFICATION OF BLOOD-MEAL SOURCES INDICATES HUMANS AS PRIMARY INTERMEDIATE HOSTS

    PubMed Central

    Kirchgatter, Karin; Tubaki, Rosa Maria; Malafronte, Rosely dos Santos; Alves, Isabel Cristina; Lima, Giselle Fernandes Maciel de Castro; Guimarães, Lilian de Oliveira; Zampaulo, Robson de Almeida; Wunderlich, Gerhard

    2014-01-01

    Anopheles (Kerteszia) cruzii has been implicated as the primary vector of human and simian malarias out of the Brazilian Amazon and specifically in the Atlantic Forest regions. The presence of asymptomatic human cases, parasite-positive wild monkeys and the similarity between the parasites infecting them support the discussion whether these infections can be considered as a zoonosis. Although many aspects of the biology of An. cruzii have already been addressed, studies conducted during outbreaks of malaria transmission, aiming at the analysis of blood feeding and infectivity, are missing in the Atlantic Forest. This study was conducted in the location of Palestina, Juquitiba, where annually the majority of autochthonous human cases are notified in the Atlantic Forest of the state of São Paulo. Peridomiciliary sites were selected for collection of mosquitoes in a perimeter of up to 100 m around the residences of human malaria cases. The mosquitoes were analyzed with the purpose of molecular identification of blood-meal sources and to examine the prevalence of Plasmodium. A total of 13,441 females of An. (Ker.) cruzii were collected. The minimum infection rate was calculated at 0.03% and 0.01%, respectively, for P. vivax and P. malariae and only human blood was detected in the blood-fed mosquitoes analyzed. This data reinforce the hypothesis that asymptomatic human carriers are the main source of anopheline infection in the peridomiciliary area, making the probability of zoonotic transmission less likely to happen. PMID:25229220

  11. In vitro cytotoxicity of some Narcissus plants extracts.

    PubMed

    Shawky, Eman; Abou-Donia, Amina H; Darwish, Fikria A; Toaima, Soad M; Takla, Sarah S; Al Asaar, Mahmoud Mohamed

    2015-01-01

    This study compares the chloroform extracts of bulbs and roots of Narcissus papyraceus Ker Gawl. and Narcissus tazetta L. The cytotoxicity of the plant extracts was evaluated against human hepatocellular carcinoma cell line (HEPG2) and colon carcinoma cell line (HCT116) in comparison to doxorubicin. The extracts from the after-flowering (AF) bulbs of N. tazetta L. and N. papyraceus exhibited strong cytotoxic activity against HEPG2 (IC50: 2.2, 3.5 μg mL(-1)) and HCT116 (IC50: 4.2, 3.9 μg mL(-1)) cell lines, respectively. N. tazetta L. bulbs exhibited the least cell viability percentage in HepG-2 cell line (5.32%), while the AF root extracts of N. papyraceus exhibited the least cell viability percentage in HCT116 cell line (4.93%), when applied at a concentration of 50 μg mL(-1), thereby being more active than doxorubicin at the same concentration.

  12. Optimized single-number quantity for rating the airborne sound insulation of constructions: Living sounds.

    PubMed

    Virjonen, Petra; Hongisto, Valtteri; Oliva, David

    2016-12-01

    ISO 717-1 [(1996). International Organization for Standardization, Geneva, Switzerland] and ASTM 413 [(2010). American Society for Testing and Materials International] define various single-number quantities (SNQs) that are commonly used to rate objectively airborne sound insulation of constructions. Recent psychoacoustic evidence suggests that none of them is appropriate for a wide range of living sound stimuli. The purpose of the study was to develop an alternative compromising SNQ for the frequency range 50-5000 Hz that explains well the annoyance caused by various airborne living sounds transmitted from the neighboring dwelling. Optimal reference spectra for different living sounds were found by mathematical optimization. Experimental data from a psychoacoustic laboratory study [Hongisto, Oliva, and Keränen (2014). Acta Acust. Acust. 100, 848-863] were utilized. The subjects (n = 59) had evaluated the disturbance of living sounds that were electrically filtered to mimic transmission through commonly used wall structures. To find a high-performing reference spectrum for living sounds in general, the optimized reference spectra were averaged over all sound types. The resulting SNQ was called Rw + Copt. The related reference spectrum deviates significantly from the reference spectrum for living activities, C50-5000, below 315 Hz. The suggested SNQ correlates better with the subjective disturbance caused by living sounds than any of the present standardized SNQs of ISO 717-1 or ASTM 413.

  13. ETHNOGRAPHY OF THE DRUG SAFED – MUSALI IN INDIA : A REVIEW

    PubMed Central

    Patil, D.A.

    2001-01-01

    The drug safed-musali’ has always remained the subject of dispute and object of investigations. This paper evaluates comparatively its ethnomedicinal records as also those found in literature on the modern usage in Indian context alongwith the observations of the present author. The safedmusali belongs to the various species of two different well known liliaceous genera viz., Asparagus L. and Chlorophytum Ker-Gowl., and a least known orchidaceous genus Pachystoma Bl. It appears that the wide modern usage of safed-musali might have sprung from its ethnomedicinal leads in our country. The plant sources of its procurement although varied should be regarded only as surrogates for each other. The drug itself is a substitute for ‘Salep’ or ‘Salep-misri’. In the light of present investigation, it is surveyed, reviewed and highlighted pertinently. The attempts to cultivate different species which are implicated as safed-musali need a fillip for the betterment of tribal people and Indian societies at large. PMID:22557034

  14. The epithelial-mesenchymal transition induced by keratinocyte growth conditions is overcome by E6 and E7 from HPV16, but not HPV8 and HPV38: Characterization of global transcription profiles

    SciTech Connect

    Azzimonti, Barbara; Dell'Oste, Valentina; Borgogna, Cinzia; Mondini, Michele; Gugliesi, Francesca; De Andrea, Marco; Chiorino, Giovanna; Scatolini, Maria; Ghimenti, Chiara; Landolfo, Santo; Gariglio, Marisa

    2009-06-05

    The aim of this study was to evaluate the growth properties of primary human keratinocytes expressing E6 and E7 proteins, which are from either the beta- or alpha-genotypes, under different culture conditions. We demonstrated that keratinocytes expressing E6 and E7, from both HPV8 and 38, irreversibly underwent the epithelial-mesenchymal transition (EMT) when grown on plastic with FAD medium (F12/DMEM/5%FBS). Expression of E6/E7 from HPV16 was capable of fully overcoming the FAD-induced EMT. Immortalization was only observed in HPV16-transduced cell lines, while the more proliferating phenotype of both KerHPV8 and 38 was mainly related to FAD-induced EMT. Microarray analysis of exponentially growing cells identified 146 cellular genes that were differentially regulated in HPV16 compared to HPV8- and 38-transduced cells. A large accumulation of transcripts associated with epidermal development and differentiation was observed in HPV16-transduced cells, whereas transcripts of genes involved in the extracellular matrix, multicellular organismal processes, and inflammatory response were affected in HPV8 and 38-transduced cells.

  15. Fluorescent Aptamer Sensors

    NASA Astrophysics Data System (ADS)

    Chen, Hui William; Kim, Youngmi; Meng, Ling; Mallikaratchy, Prabodhika; Martin, Jennifer; Tang, Zhiwen; Shangguan, Dihua; O'Donoghue, Meghan; Tan, Weihong

    Aptamers are single-stranded nucleic acid probes that can be evolved to have high specificity and affinity for different targets. These targets include biomar-ker proteins, small molecules, and even whole live cells that express a variety of surface proteins of interest. Aptamers offer several advantages over protein-based molecular probes such as low immunogenic activity, flexible modification, and in vitro synthesis. In addition, aptamers used as molecular probes can be made with easy signaling for binding with their corresponding targets. There are a few different fluorescence-based signal transduction mechanisms, such as direct fluorophore labeling, fluorescence resonance energy transfer (FRET), fluorescence quenching, fluorescence anisotropy, and light-switching excimers. These signaling processes in combination with various labeling strategies of nucleic acid aptamers contribute to simple, rapid, sensitive, and selective biological assays. In this chapter, we discuss the optical signaling of aptamers for single proteins such as α-thrombin and platelet-derived growth factor (PDGF). We also present detailed discussion about fluorescent aptamers developed from cell-based systematic evolution of ligands by exponential enrichment (SELEX) for the recognition of different target tumor cells.

  16. Erysipelothrix rhusiopathiae bacteremia: a challenging diagnosis!

    PubMed

    Micaelo, Maïté; Rasmy, Pascal; Amara, Marlène; Lambert, Juliette; Coutard, Aymeric; Pangon, Béatrice

    2016-10-01

    Erysipelothrix rhusiopathiae, a Gram-positive bacillus, is reported to cause for cutaneous infections and endocarditis. We report a case of E. rhusiopathiae bacteremia without severe clinical illness. The patient, a 74-year-old man, is suffering from a chronic lymphoid leukemia (LLC). Following a trauma, the patient developed a bruise on the left inch. Because the site of shock seemed clinically infected, oral amoxicilline-acid clavulanic (AAC) treatment was started after withdrawn 1 set of blood cultures. These blood culture specimens yielded a Gram-positive bacillus identified as E. rhusiopathiae by mass spectrometry MALDI-TOF (Microflex Brüker). The strain was sensitive to beta-lactam, fluoroquinolones and macrolides, resistant to vancomycin (natural resistance), and amikacin but sensitive to gentamicin. After 5 days of treatment by AAC, the patient became apyretic. One year after this episode, we reported no further symptoms of infection, or endocarditis. The natural resistance of E. rhusiopathiae in glycopeptides underlines the importance of a microbiological diagnosis. Indeed, vancomycine can be the treatment of first intention in Gram-positive bacillus bacteremia. The identification of bacteria using mass spectrometry is available the same day of the blood culture positivity and allows to prescribe the most adapted antibiotic treatment for the patient.

  17. A hardware fast tracker for the ATLAS trigger

    NASA Astrophysics Data System (ADS)

    Asbah, Nedaa

    2016-09-01

    The trigger system of the ATLAS experiment is designed to reduce the event rate from the LHC nominal bunch crossing at 40 MHz to about 1 kHz, at the design luminosity of 1034 cm-2 s-1. After a successful period of data taking from 2010 to early 2013, the LHC already started with much higher instantaneous luminosity. This will increase the load on High Level Trigger system, the second stage of the selection based on software algorithms. More sophisticated algorithms will be needed to achieve higher background rejection while maintaining good efficiency for interesting physics signals. The Fast TracKer (FTK) is part of the ATLAS trigger upgrade project. It is a hardware processor that will provide, at every Level-1 accepted event (100 kHz) and within 100 microseconds, full tracking information for tracks with momentum as low as 1 GeV. Providing fast, extensive access to tracking information, with resolution comparable to the offline reconstruction, FTK will help in precise detection of the primary and secondary vertices to ensure robust selections and improve the trigger performance. FTK exploits hardware technologies with massive parallelism, combining Associative Memory ASICs, FPGAs and high-speed communication links.

  18. A conceptual framework to support exposure science research ...

    EPA Pesticide Factsheets

    While knowledge of exposure is fundamental to assessing and mitigating risks, exposure information has been costly and difficult to generate. Driven by major scientific advances in analytical methods, biomonitoring, computational tools, and a newly articulated vision for a greater impact in public health, the field of exposure science is undergoing a rapid transition that allows it to be more agile, predictive, and data- and knowledge-driven. A necessary element of this evolved paradigm is an organizational and predictive framework for exposure science that furthers the application of systems-based approaches. To enable such systems-based approaches, we proposed the Aggregate Exposure Pathway (AEP) concept to organize data and information emerging from an invigorated and expanding field of exposure science. The AEP framework is a layered structure that describes the elements of an exposure pathway, as well as the relationship between those elements. The basic building blocks of an AEP adopt the naming conventions used for Adverse Outcome Pathways (AOPs): Key Events (KEs) to describe the measurable, obligate steps through the AEP; and Key Event Relationships (KERs) describe the linkages between KEs. Importantly, the AEP offers an intuitive approach to organize exposure information from sources to internal site of action, setting the stage for predicting stressor concentrations at an internal target site. These predicted concentrations can help inform the r

  19. A conceptual framework to support exposure science research ...

    EPA Pesticide Factsheets

    While knowledge of exposure is fundamental to assessing and mitigating risks, exposure information has been costly and difficult to generate. Driven by major scientific advances in analytical methods, biomonitoring, computational tools, and a newly articulated vision for a greater impact in public health, the field of exposure science is undergoing a rapid transition that allows it to be more agile, predictive, and data- and knowledge-driven. A necessary element of this evolved paradigm is an organizational and predictive framework for exposure science that furthers the application of systems-based approaches. To enable such systems-based approaches, we proposed the Aggregate Exposure Pathway (AEP) concept to organize data and information emerging from an invigorated and expanding field of exposure science. The AEP framework is a layered structure that describes the elements of an exposure pathway, as well as the relationship between those elements. The basic building blocks of an AEP adopt the naming conventions used for Adverse Outcome Pathways (AOPs): Key Events (KEs) to describe the measurable, obligate steps through the AEP; and Key Event Relationships (KERs) describe the linkages between KEs. Importantly, the AEP offers an intuitive approach to organize exposure information from sources to internal site of action, setting the stage for predicting stressor concentrations at an internal target site. These predicted concentrations can help inform the r

  20. High resolution FTIR spectroscopic study of the ν4 band of CH 3CHF 2 enclosed in a flow of cold N 2 gas

    NASA Astrophysics Data System (ADS)

    Appadoo, Dominique R. T.; Robertson, Evan G.; McNaughton, Don

    2003-01-01

    An enclosive flow cooling (EFC) cell has been constructed, and coupled to a Brüker IFS 120HR high resolution Fourier transform spectrometer to record rotationally cold absorption spectra of gases of atmospheric interest at high spectral resolution. The new system has been characterized using N 2O, revealing that rotational temperatures as cold as 110 K are readily attainable using liquid nitrogen as a cryogen. Infrared spectra of the ν4 band of 1,1-difluoroethane (R152a), CH 3CHF 2, cooled in the EFC cell have been measured at a resolution of 0.0019 cm-1. Eight hundred and twenty rovibrational transitions of the weak ν4 band with 2⩽ J'⩽46 and Kc'⩽16 were assigned and fitted to Watson's A-reduced Hamiltonian. The ν4 CH 3 symmetric deformation ( a/c-type) was found to be coupled to the ν13 asymmetric deformation ( b-type) via an a-axis Coriolis interaction. In the ensuing analysis, values of spectroscopic constants were obtained for both the ν4 and dark ν13 states. Supporting ab initio calculations up to the MP2/TZV+(3 df,3 p) level are presented.

  1. Biochemical and molecular characterization of new keratinoytic protease from Actinomadura viridilutea DZ50.

    PubMed

    Ben Elhoul, Mouna; Zaraî Jaouadi, Nadia; Rekik, Hatem; Omrane Benmrad, Maroua; Mechri, Sondes; Moujehed, Emna; Kourdali, Sidali; El Hattab, Mohamed; Badis, Abdelmalek; Bejar, Samir; Jaouadi, Bassem

    2016-11-01

    A new extracellular thermostable keratinolytic protease, designated KERDZ, was purified and characterized from a thermophilic actinomycetes Actinomadura viridilutea DZ50 isolated from Algerian fishing port. The isolate exhibited high keratinase production when grown in chicken-feather meal media (18,000U/ml) after 96-h of incubation at 45°C. The enzyme was purified by ammonium sulfate precipitation (35-55%)-dialysis and heat treatment (30min at 75°C) followed by UNO S-1 FPLC cation exchange chromatography and size exclusion HPLC column. The biochemical characterizations carried on include physico-chemical determination and spectroscopic analysis. The MALDI-TOF/MS analysis revealed that the purified enzyme was a monomer with a molecular mass of 19536.10-Da. The sequence of the 25 N-terminal residues of KERDZ showed high homology with those of actinomycetes keratinases. Optimal activity was achieved at pH 11 and 80°C. KERDZ was completely inhibited by PMSF and DFP suggested its belonging to the serine keratinase family. KERDZ displayed higher levels of hydrolysis and catalytic efficiency than bacterial keratinases (KERAK-29, Actinase E, and KERAB) and subtilisins (subtilisin Carlsberg and subtilisin Novo). The kerDZ gene encoding KERDZ was isolated and its DNA sequence was determined. These properties make KERDZ a potential, promising and eco-friendly alternative to the conventional chemicals used for industrial applications.

  2. The Core Pattern Analysis on Chinese Herbal Medicine for Sjögren's syndrome: A Nationwide Population-Based Study.

    PubMed

    Chang, Ching-Mao; Chu, Hsueh-Ting; Wei, Yau-Huei; Chen, Fang-Pey; Wang, Shengwen; Wu, Po-Chang; Yen, Hung-Rong; Chen, Tzeng-Ji; Chang, Hen-Hong

    2015-04-29

    This large-scale survey aimed to evaluate frequencies and patterns of Chinese herbal medicine (CHM) used for Sjögren's syndrome (SS) in Taiwan by analyzing the National Health Insurance Research Database (NHIRD) for cases in which CHM was used as an alternative therapy to Western medicine for improving patients' discomforts. We analyzed cases of SS principal diagnosis (ICD-9:710.2) with a catastrophic illness certificate (CIC) in traditional Chinese medicine (TCM) outpatient clinics from three cohorts of the Longitudinal Health Insurance Database (LHID) in the NHIRD between 2002 and 2011. CHM prescription patterns for SS were evaluated from claimed visitation files and corresponding prescription files. There were 15,914 SS patients with CIC (SS/CIC), and we found only 130 SS/CIC cases visiting TCM clinics in LHID2000, 133 in LHID2005, and 126 in LHID2010. After removing duplicate data, 366 SS/CIC and 4,867 visits were analyzed. The 50-59 year age group showed the highest ratio (29.51%) in both women and men. "Qi-Ju-Di-Huang-Wan" and "Xuan-Shen" (Scrophularia ningpoensis Hemsl.) was the most commonly used formula and single herb, respectively. "Qi-Ju-Di-Huang-Wan, Gan-Lu-Yin, Xuan-Shen, Mai-Men-Dong (Ophiopogon japonicus (L. f.) Ker-Gawl.), and Sheng-Di-Huang (raw Rehmannia glutinosa Libosch)" were the core pattern prescriptions in treating SS/CIC.

  3. Lindblad theory of dynamical decoherence of quantum-dot excitons

    NASA Astrophysics Data System (ADS)

    Eastham, P. R.; Spracklen, A. O.; Keeling, J.

    2013-05-01

    We use the Bloch-Redfield-Wangsness theory to calculate the effects of acoustic phonons in coherent control experiments where quantum-dot excitons are driven by shaped laser pulses. This theory yields a generalized Lindblad equation for the density operator of the dot, with time-dependent damping and decoherence due to phonon transitions between the instantaneous dressed states. It captures similar physics to the form recently applied to Rabi oscillation experiments [Ramsay , Phys. Rev. Lett.0031-900710.1103/PhysRevLett.104.017402 104, 017402 (2010)] but guarantees positivity of the density operator. At sufficiently low temperatures, it gives results equivalent to those of fully non-Markovian approaches [Lüker , Phys. Rev. B1098-012110.1103/PhysRevB.85.121302 85, 121302 (2012)] but is significantly simpler to simulate. Several applications of this theory are discussed. We apply it to adiabatic rapid passage experiments and show how the pulses can be shaped to maximize the probability of creating a single exciton using a frequency-swept laser pulse. We also use this theory to propose and analyze methods to determine the phonon density of states experimentally, i.e., phonon spectroscopy, by exploring the dependence of the effective damping rates on the driving field.

  4. Comparison of bioactive components and pharmacological activities of ophiopogon japonicas extracts from different geographical origins.

    PubMed

    Zhao, Min; Xu, Wan-Feng; Shen, Han-Yuan; Shen, Pei-Qiang; Zhang, Jun; Wang, Dan-Dan; Xu, Han; Wang, Hong; Yan, Ting-Ting; Wang, Lin; Hao, Hai-Ping; Wang, Guang-Ji; Cao, Li-Juan

    2017-02-07

    Ophiopogon japonicus (Linn. f.) Ker-Gawl (O. japonicas), mainly cultivated in Sichuan and Zhejiang province in China, has different bioactive components and therefore their pharmacological activities. To explain the different clinical efficacy of O. japonicas derived preparations, herein we report differences of pharmacological activities between Sichuan and Zhejiang O. japonicas and behind them the exact differences of bioactive components. Based on a LC/MS-IT-TOF method, the differences of bioactive components between Sichuan and Zhejiang O. japonicas extracts were analyzed and respective characteristic components were picked out. We determined 39 ophiopogonones and 71 ophiopogonins compounds in Sichuan and Zhejiang O. japonicas extracts and found the contents of these compositions have several times difference. Evidenced by experimental data of pharmacological activities in inhibiting cardiomyocyte damage induced by H2O2, mouse macrophage cell inflammation induced by lipopolysaccharide and cytotoxicity in vitro, Zhejiang O. japonicas extract had a stronger antioxidant and anti-inflammatory capacity than Sichuan O. japonicas extract, and the two O. japonicas extracts exhibited selective cytotoxicity on different cancer cell lines in vitro. These data shed light on the links between bioactive components and pharmacological activities of O. japonicas derived preparations. Thus, geographical origin of O. japonicas should be considered to be a key factor in efficacy studies and further clinical application.

  5. Angiotensin II regulates phosphorylation of actin-associated proteins in human podocytes.

    PubMed

    Schenk, Laura K; Möller-Kerutt, Annika; Klosowski, Rafael; Wolters, Dirk; Schaffner-Reckinger, Elisabeth; Weide, Thomas; Pavenstädt, Hermann; Vollenbröker, Beate

    2017-08-02

    Within the kidney, angiotensin II (AngII) targets different cell types in the vasculature, tubuli, and glomeruli. An important part of the renal filtration barrier is composed of podocytes with their actin-rich foot processes. In this study, we used stable isotope labeling with amino acids in cell culture coupled to mass spectrometry to characterize relative changes in the phosphoproteome of human podocytes in response to short-term treatment with AngII. In 4 replicates, we identified a total of 17,956 peptides that were traceable to 2081 distinct proteins. Bioinformatic analyses revealed that among the increasingly phosphorylated peptides are predominantly peptides that are related to actin filaments, cytoskeleton, lamellipodia, mammalian target of rapamycin, and MAPK signaling. Among others, this screening approach highlighted the increased phosphorylation of actin-bundling protein, l-plastin (LCP1). AngII-dependent phosphorylation of LCP1 in cultured podocytes was mediated by the kinases ERK, p90 ribosomal S6 kinase, PKA, or PKC. LCP1 phosphorylation increased filopodia formation. In addition, treatment with AngII led to LCP1 redistribution to the cell margins, membrane ruffling, and formation of lamellipodia. Our data highlight the importance of AngII-triggered actin cytoskeleton-associated signal transduction in podocytes.-Schenk, L. K., Möller-Kerutt, A., Klosowski, R., Wolters, D., Schaffner-Reckinger, E., Weide, T., Pavenstädt, H., Vollenbröker, B. Angiotensin II regulates phosphorylation of actin-associated proteins in human podocytes. © FASEB.

  6. Adverse Outcome Pathway (AOP) Network Development for ...

    EPA Pesticide Factsheets

    Adverse outcome pathways (AOPs) are descriptive biological sequences that start from a molecular initiating event (MIE) and end with an adverse health outcome. AOPs provide biological context for high throughput chemical testing and further prioritize environmental health risk research. According to the Organization for Economic Co-operation and Development guidelines, AOPs are pathways with one MIE anchored to an adverse outcome (AO) by key events (KEs) and key event relationships (KERs). However, this approach does not always capture the cumulative impacts of multiple MIEs on the AO. For example, hepatic lipid flux due to chemical-induced toxicity initiates from multiple ligand-activated receptors and signaling pathways that cascade across biology to converge upon a common fatty liver (FL, also known as steatosis) outcome. To capture this complexity, a top-down strategy was used to develop a FL AOP network (AOPnet). Literature was queried based on the terms steatosis, fatty liver, cirrhosis, and hepatocellular carcinoma. Search results were analyzed for physiological and pathophysiological organ level, cellular and molecular processes, as well as pathway intermediates, to identify potential KEs and MIEs that are key for hepatic lipid metabolism, maintenance, and dysregulation. The analysis identified four apical KE nodes (hepatic fatty acid uptake, de novo fatty acid and lipid synthesis, fatty acid oxidation, and lipid efflux) juxtaposed to the FL AO. The apic

  7. Developing the concept of sustainability in nursing.

    PubMed

    Goodman, Benny

    2016-10-01

    Sustainability, and the related concept of climate change, is an emerging domain within nursing and nurse education. Climate change has been posited as a serious global health threat requiring action by health professionals and action at international level. Anåker & Elf undertook a concept analysis of sustainability in nursing based on Walker and Avant's framework. Their main conclusions seem to be that while defining attributes and cases can be established, there is not enough research into sustainability in the nursing literature. This paper seeks to develop their argument to argue that sustainability in nursing can be better understood by accessing non-nursing and grey literature and, for example, the literature in the developing web-based 'paraversity'. Without this understanding, and application in nursing scholarship, nurses will have a rather narrow understanding of sustainability and its suggested links with social and health inequalities and the dynamics underpinning unsustainable neoliberalist political economy. This understanding is based on the social and political determinants of health approach and the emerging domain of planetary health. However, this is a major challenge as it requires a critical reflection on what counts as nursing knowledge, a reflection which might reject sustainability and political economy as irrelevant to much of nursing practice.

  8. ZOONET: perspectives on the evolution of animal form. Meeting report.

    PubMed

    Fischer, Antje H L; Arboleda, Enrique; Egger, Bernhard; Hilbrant, Maarten; McGregor, Alistair P; Cole, Alison G; Daley, Allison C

    2009-11-15

    What drives evolution? This was one of the main questions raised at the final ZOONET meeting in Budapest, Hungary, in November 2008. The meeting marked the conclusion of ZOONET, an EU-funded Marie-Curie Research Training Network comprising nine research groups from all over Europe (Max Telford, University College London; Michael Akam, University of Cambridge; Detlev Arendt, EMBL Heidelberg; Maria Ina Arnone, Stazione Zoologica Anton Dohrn Napoli; Michalis Averof, IMBB Heraklion; Graham Budd, Uppsala University; Richard Copley, University of Oxford; Wim Damen, University of Cologne; Ernst Wimmer, University of Göttingen). ZOONET meetings and practical courses held during the past four years provided researchers from diverse backgrounds--bioinformatics, phylogenetics, embryology, palaeontology, and developmental and molecular biology--the opportunity to discuss their work under a common umbrella of evolutionary developmental biology (Evo Devo). The Budapest meeting emphasized in-depth discussions of the key concepts defining Evo Devo, and bringing together ZOONET researchers with external speakers who were invited to present their views on the evolution of animal form. The discussion sessions addressed four main topics: the driving forces of evolution, segmentation, fossils and phylogeny, and the future of Evo Devo.

  9. Investigating everyday measures through exploratory talk: whole class plenary intervention and landscape study at grade four

    NASA Astrophysics Data System (ADS)

    Gade, Sharada; Blomqvist, Charlotta

    2016-10-01

    We report an exploratory talk based, whole class plenary intervention, in relation to students' understanding of everyday measures and measurement, in a grade four classroom at a grade 4-6 school in Sweden. Extended, project related, teacher-researcher collaboration forms basis for such cultural historical activity theory or CHAT based efforts. As formative intervention, the conduct of the plenary is not pre-determined but embedded in ongoing curricular realities, with the agency of students and teacher promoted, pedagogical ideas reutilised and the role of researcher viewed as supporting design and growth of the intervention. Under Charlotta's guidance as teacher, the plenary is opportunity for her students to examine improbable scenarios such as, Can Eva and Anton measure the length of Sweden on foot, Can Lars and Iris measure their age in decimeters. A zone of proximal development is created, in which students make the transition from spontaneous to scientific concepts and learn how various units of measurement are objects-that-can-be-used-for-certain-purposes. With opportunity for critical and reflective inquiry, in a plenary designed to lead development, Charlotta's students look beyond the making of rote measurements and articulate a theory of measure in nascent terms. Such a landscape of teaching-learning is finally understood in terms of the nature of talk that was facilitated, the manner of pedagogy utilised, the style of teaching exercised and the kind of learning that was demanded of her students.

  10. Helgoland und die Erforschung der marinen Benthosalgen

    NASA Astrophysics Data System (ADS)

    Mollenhauer, D.; Lüning, K.

    1988-09-01

    Early phycological research on the island of Helgoland was performed by amateur phycologists from the adjacent coastal regions of Germany (Bremen, Hamburg, Lower Saxony and Schleswig-Holstein). These pioneers were followed by professionals, and by collectors from the mainland universities, particularly from Berlin. This second phase group includes the naturalist Christian Gottfried Ehrenberg, the zoologists Johannes Müller, Ernst Haeckel and Anton Dohrn, and the botanists Alexander Braun, Nathanael Pringsheim, and Ferdinand Cohn. The leading marine phycologist in Germany, towards the end of the 19th century, was Johannes Reinke, who finally worked at the University of Kiel. Paul Kuckuck's doctoral thesis had been supervised by Reinke who recommended him for the post of the first curator of botany at the Biological Station of Helgoland, which was founded in 1892. Kuckuck worked on the island from 1892 to 1914. After World War I, and after Kuckuck's untimely death, Wilhelm Nienburg became the second curator of botany on Helgoland, from 1921 to 1923. The next permanent phycologist on the island, from 1925 to 1936, was Ernst Schreiber. He was followed in 1936 by Peter Kornmann, who retired in 1972 but still continues as a research worker, together with Paul-Heinz Sahling, who started to work as a technical assistant under the guidance of Ernst Schreiber in 1927.

  11. Characterization of a Venom Peptide from a Crassispirid Gastropod

    PubMed Central

    Cabang, April B.; Imperial, Julita S.; Gajewiak, Joanna; Watkins, Maren; Corneli, Patrice Showers; Olivera, Baldomero M.; Concepcion, Gisela P.

    2011-01-01

    The crassispirids are a large branch of venomous marine gastropods whose venoms have not been investigated previously. We demonstrate that crassispirids comprise a major group of toxoglossate snails in a clade distinct from all turrids whose venoms have been analyzed. The isolation and biochemical definition of the first venom component from any crassispirid is described. Crassipeptide cce9a from Crassispira cerithina (Anton, 1838) was purified from crude venom by following biological activity elicited in young mice, lethargy and a lack of responsiveness to external stimuli. Using Edman sequencing and mass spectrometry, the purified peptide was shown to be 29 amino acid residues long, with the sequence: GSCGLPCHENRRCGWACYCDDGICKPLRV. The sequence assignment was verified through the analysis of a cDNA clone encoding the peptide. The peptide was chemically synthesized and folded; the synthetic peptide was biologically active and coelution with the native venom peptide was demonstrated. When injected into mice of various ages, the peptide elicited a striking shift in behavioral phenotype between 14 and 16 days, from lethargy to hyperactivity. PMID:21939682

  12. The astrological roots of mesmerism.

    PubMed

    Schaffer, Simon

    2010-06-01

    Franz Anton Mesmer's 1766 thesis on the influence of the planets on the human body, in which he first publicly presented his account of the harmonic forces at work in the microcosm, was substantially copied from the London physician Richard Mead's early eighteenth century tract on solar and lunar effects on the body. The relation between the two texts poses intriguing problems for the historiography of medical astrology: Mesmer's use of Mead has been taken as a sign of the Vienna physician's enlightened modernity while Mead's use of astro-meteorology has been seen as evidence of the survival of antiquated astral medicine in the eighteenth century. Two aspects of this problem are discussed. First, French critics of mesmerism in the 1780s found precedents for animal magnetism in the work of Paracelsus, Fludd and other early modern writers; in so doing, they began to develop a sophisticated history for astrology and astro-meteorology. Second, the close relations between astro-meteorology and Mead's project illustrate how the environmental medical programmes emerged. The making of a history for astrology accompanied the construction of various models of the relation between occult knowledge and its contexts in the enlightenment.

  13. Meeting report: 26th International Conference on Antiviral Research.

    PubMed

    Vere Hodge, R Anthony

    2013-10-01

    The 26th International Conference on Antiviral Research (ICAR) was held in San Francisco, California from May 11 to 15, 2013. This article summarizes the principal invited lectures at the meeting. The opening symposium on the legacy of the late Antonín Holý included presentations on his pioneering work with nucleotide analogs, which led to the development of several antiviral drugs including tenofovir. This drug has transformed the treatment of HIV infection and has recently become the first-line therapy for chronic hepatitis B. The Gertrude Elion Award lecturer described the anti-HIV activities of the CCR5 inhibitor cenicriviroc and the reverse transcriptase inhibitor festinavir®, and also reviewed the evaluation of biodegradable nanoparticles with adjuvant activity. The William Prusoff Award winner reported on the creation of NAOMI, a computer model with 21 enzymes to predict the activity of nucleoside analogs against hepatitis C virus (HCV). Other invited lecturers discussed the development of countermeasures against severe dengue and the potential of RNA virus capping and repair enzymes as drug targets. Topics in the clinical symposium included the current status of the anti-HCV compounds sovaprevir, ACH-3102, miravirsen and ALS-2200; the evaluation of single-tablet regimens for HIV infection; and the investigation of cytomegalovirus resistance to CMX001. Two chemistry minisymposia examined strategies and tactics in drug design and the use of in drug discovery. Copyright © 2013 The Author. Published by Elsevier B.V. All rights reserved.

  14. [Chekhov as a doctor].

    PubMed

    Rooijmans, H G M

    2003-03-01

    Anton Chekhov (1860-1904) was not only a writer, but also a doctor. One might think that he was primarily concerned with writing, but he also dedicated himself fully to being a doctor. When he had to give up his practice in 1897 upon urgent medical advice, he experienced it as a great loss. As a medic he often felt unsure and believed that he failed in his duties. This did not change the fact that many patients called upon him for assistance. They were probably also fond of him because of his genuine interest in their living conditions and because of his compassion. In terms of his scientific activities, his attempt to have his visit in 1890 to the Russian penal colony Sakhalin recognised as a dissertation failed. In many ways, Chekhov was a hard-working idealist, but one without illusions. Doctors appear as the main character or one of the main characters in 25 of Chekhov's hundreds of stories as well as in various plays. Although Chekhov undoubtedly will have incorporated his own experiences into his works, he did not give a picture of his own medical activities in the doctors he portrayed. A large number of the doctors he describes are depressed, nervous or irritable. Others are naïve and clumsy, while others still are skeptic, cynical or disillusioned. In some of the descriptions the image of Chekhov as a doctor may be observed.

  15. Doctors in Court, Honour, and Professional Ethics: Two Scandals in Imperial Germany*

    PubMed Central

    Maehle, Andreas-Holger

    2013-01-01

    Summary Comparing two public medical affairs which involved disciplinary proceedings and libel actions, one from Bavaria and one from Prussia, this article analyzes the dynamics behind legal conflicts over doctors’ professional ethics in Imperial Germany. In both the case of Dr Maurice Hutzler, who committed suicide after conflicts with senior colleagues at the Gisela Children’s Hospital and a sentence of the court of honour of the Munich Medical District Society, and the Berlin ‘patient trade’ affair, in which the medical professors Ernst von Leyden, Hermann Senator, Karl Anton Ewald and Carl Posner were accused of having made payments to middlemen for bringing them lucrative private patients, notions of personal and professional honour played a central role. The Munich case highlighted shortcomings of the Bavarian medical court of honour system, which was less developed than its Prussian counterpart. The analysis of the two cases suggests that the ethics of medical practice in early twentieth-century Germany should be viewed as part of a culture of honour. PMID:22303773

  16. [The celebrity of Polish and French medicine--Józef Julian Franciszek Feliks Babiński (1857-1932)].

    PubMed

    Skalski, Janusz H; Gładki, Marcin; Pypłacz, Dariusz

    2007-07-01

    The paper presents a biography of Polish and French medical scientist, Józef Julian Franciszek Feliks Babiński (1857-1932), a son of Polish exiles to France after the unsuccessful insurrection against the Russian occupants. Born in Paris, Babiński considered Poland as his own home-country, being faithful and grateful citizen of France, his adopted country. He made his neurological department in Paris a world famous medical centre at the turn of the 20th century. Currently for every student of medicine or physician practitioner, the name of Babiński immediately associates with the "toe phenomenon" (phénomène des orteils). The discovery of this "sign" (1896) is the crowning point of Babiński's work in semiology. He was a co-author of discoveries known under eponym names of syndromes: Babinski-Nageotte, Babinski-Fröhlich, Anton-Babinski and many others. Babiński emphasized his Polish origins, expressing his feeling towards two home countries (1922): "I am proud to have two countries--to one, I owe the knowledge, to the other, the country of my ancestors, the elements of my Polish soul...".

  17. A new three-dimensional magneto-viscoelastic model for isotropic magnetorheological elastomers

    NASA Astrophysics Data System (ADS)

    Agirre-Olabide, I.; Lion, A.; Elejabarrieta, M. J.

    2017-03-01

    In this work, a four-parameter fractional derivative viscoelastic model was developed to describe the dynamic shear behaviour of magnetorheological elastomers (MREs) as a function of the matrix, particle content and magnetic field. The material parameters were obtained from experimental data measured with a Physica MCR 501 rheometer from the Anton Paar Company, equipped with a magnetorheological cell. The synthetised isotropic MRE samples were based on room-temperature vulcanising silicone rubber and spherical carbonyl iron powder micro particles as fillers, and seven volumetric particle contents were studied. The influence of particle contents was included in each parameter of the four-parameter fractional derivative model. The dependency of the storage modulus as a function of an external magnetic field (magnetorheological (MR) effect) was studied, and a dipole–dipole interaction model was used. A new three-dimensional magneto-viscoelastic model was developed to couple the viscoelastic model, the particle-matrix interaction and the magneto-induced modulus model, which predicts the influence of the magnetic field and the particle content in the MR effect of isotropic MREs.

  18. A Compendium of Volatile Organic Compounds (VOCs) Released By Human Cell Lines

    PubMed Central

    Filipiak, Wojciech; Mochalski, Pawel; Filipiak, Anna; Ager, Clemens; Cumeras, Raquel; Davis, Cristina E.; Agapiou, Agapios; Unterkofler, Karl; Troppmair, Jakob

    2016-01-01

    Volatile organic compounds (VOCs) offer unique insights into ongoing biochemical processes in healthy and diseased humans. Yet, their diagnostic use is hampered by the limited understanding of their biochemical or cellular origin and their frequently unclear link to the underlying diseases. Major advancements are expected from the analyses of human primary cells, cell lines and cultures of microorganisms. In this review, a database of 125 reliably identified VOCs previously reported for human healthy and diseased cells was assembled and their potential origin is discussed. The majority of them have also been observed in studies with other human matrices (breath, urine, saliva, feces, blood, skin emanations). Moreover, continuing improvements of qualitative and quantitative analyses, based on the recommendations of the ISO-11843 guidelines, are suggested for the necessary standardization of analytical procedures and better comparability of results. The data provided contribute to arriving at a more complete human volatilome and suggest potential volatile biomarkers for future validation. Dedication: This review is dedicated to the memory of Prof. Dr. Anton Amann, who sadly passed away on January 6, 2015. He was motivator and motor for the field of breath research. PMID:27160536

  19. [Neurology and literature].

    PubMed

    Iniesta, I

    2010-10-01

    Literature complements medical literature in the academic and clinical development of neurologists. The present article explores the contributions of writers of fiction on neurology. Literary works of fiction with particular reference to neurology. A symbiosis between writers of fiction and doctors has been well recognised. From Shakespeare to Cervantes by way of Dickens and Cela to writer - physicians such as Anton Chekhov or António Lobo Antunes have contributed through their medically informed literature to the better understanding of neurology. Some writers like Dostoevsky, Machado de Assis and Margiad Evans have written about their own experiences with disease thus bringing new insights to medicine. Furthermore, some neurological disorders have been largely based on literary descriptions. For instance, Dostoevsky's epilepsy has been retrospectively analysed by famous neurologists including Freud, Alajouanine or Gastaut, whilst his writings and biography have prompted others like Waxman and Geschwind to describe typical behavioural changes in temporal lobe epilepsy, finding their source of inspiration in Dostoevsky. Likewise, Cirignotta et al have named an unusual type of seizure after the Russian novelist. Inspired by Lewis Carroll, Todd introduced the term Alice in Wonderland Syndrome to refer to visual distortions generally associated with migraine. Writers of fiction offer a humanised perception of disease by contributing new insights into the clinical history, informing about the subjective experience of the illness and helping to eradicate the stigma associated to neurological disorders.

  20. [Music therapy in the behavior therapeutic combined treatment concept. Comparison between alcoholics with neurotic personality structure and patients with behavior disturbances].

    PubMed

    Formann-Radl, I

    1980-01-01

    From times immemorial, music closely associating with magic, played a significant part in the art of healing and in religion itself. It is not an invention of modern technical age and today it is legitimately involved in the overall rehabilitation programms in psychiatry. We have therefore attempted to conduct a study on this subject. The present investigation compares the behaviour of 100 alcoholics and 100 patients with neurotic personality disturbances drawn from the catchment areas of the Psychiatric University Clinic Vienna/Austria and the Anton-Proksch-Institut in Vienna-Kalksburg with regard to their respone to this type of therapy. We found that music provides a substantial contribution in reinforcing the basic ethical concept of the person concerned. It also breaks the barriere of expressivity by enriching the pool fo potential vocabulary. It appears to be the ideal medium of free communication. Investigation has to be continued, but music therapy will never develop from an ancilliary treatment into a therapeutic method in its own right. However, the music therapist should be prepared if necessary to allow for useful deviations from the traditional lines of musical concepts in his efforts to reduce the state of anxiety in his patients and prevent further deterioration instinct and traditional values, thus strengthening the ethical concept.

  1. Re-Entrant Structure for Robust Superhydrophobicity and Drag Reduction

    NASA Astrophysics Data System (ADS)

    Zhao, Hong; Gad-El-Hak, Mohamed

    2014-11-01

    A re-entrant structure is required for superoleophobicity by effectively pinning low-surface-tension liquids from wetting the textures and forming a solid-liquid-air composite interface. In this work, we examine the contribution of a re-entrant structure to the robustness of superhydrophobicity and skin-friction reduction capabilities. Textured surfaces with wavy sidewall pillars provide re-entrant structures and are used as model surfaces. Gibbs energy analysis is conducted to study the pinning sites and wetting stability. The wetting robustness against pressure is characterized by breakthrough pressure, which is obtained by conservation of energy and force balance at the pinning sites. The slip length and slip velocity are evaluated through a shear stress and strain rate correlation, which is obtained using an Anton Paar rheometer. Gibbs energy analysis indicates that the breakthrough pressure provided by the wavy sidewall structure for water is about 18 times of that on the straight sidewall structure. This is mostly due to the energy barrier at the re-entrant structure. When a contact line advances onto and pins at the re-entrant structure, its slip performance degrades due to the increased no-slip fraction on the composite interface, but Cassie-Baxter state still remains.

  2. AIDS and Africa. Introduction.

    PubMed

    Kopelman, Loretta M; van Niekerk, Anton A

    2002-04-01

    Sub-Saharan Africa is the epicenter of the HIV/AIDS epidemic, and in this issue of the Journal, seven authors discuss the moral, social and medical implications of having 70% of those stricken living in this area. Anton A. van Niekerk considers complexities of plague in this region (poverty, denial, poor leadership, illiteracy, women's vulnerability, and disenchantment of intimacy) and the importance of finding responses that empower its people. Solomon Benatar reinforces these issues, but also discusses the role of global politics in sub-Saharan Africa, especially discrimination, imperialism and its exploitation by first world countries. Given the public health crisis, Udo Schüklenk and Richard E. Ashcroft defend compulsory licensing of essential HIV/AIDS medications on consequentialist grounds. Keymanthri Moodley discusses the importance of conducting research and the need to understand a moderate form of communitarianism, also referred to as "ubuntu" or "communalism", to help some Africans understand research as an altruistic endeavour. Godfrey B. Tangwa also defends traditional African values of empathy and ubuntu, discussing how they should be enlisted to fight this pandemic. Loretta M. Kopelman criticizes the tendency among those outside Africa to dismiss the HIV/AIDS pandemic, attributing one source to the ubiquitous and misguided punishment theory of disease. The authors conclude that good solutions must be cooperative ventures among countries within and outside of sub-Saharan Africa with far more support from wealthy countries.

  3. Present at the creation: the clinical pastoral movement and the origins of the dialogue between religion and psychiatry.

    PubMed

    Hart, Curtis W; Div, M

    2010-12-01

    The contemporary dialogue between religion and psychiatry has its roots in what is called the clinical pastoral movement. The early leaders of the clinical pastoral movement (Anton Boisen, Elwood Worcester, Helen Flanders Dunbar, and Richard Cabot) were individuals of talent, even genius, whose lives and work intersected one another in the early decades of the twentieth century. Their legacy endures in the persons they inspired and continue to inspire and in the professional organizations and academic programs that profit from their pioneering work. To understand them and the era of their greatest productivity is to understand some of what psychiatry and religion have to say to each other. Appreciating their legacy requires attention to the context of historical movements and forces current in America at the end of the nineteenth and the beginning of the twentieth century that shaped religious, psychiatric, and cultural discourse. This essay attempts to provide an introduction to this rich and fascinating material. This material was first presented as a Grand Rounds lecture at The New York Presbyterian Hospital, Payne Whitney Westchester in the Department of Psychiatry, Weill Cornell Medical College.

  4. Detection of biological threats. A challenge for directed molecular evolution.

    PubMed

    Petrenko, Valery A; Sorokulova, Iryna B

    2004-08-01

    The probe technique originated from early attempts of Anton van Leeuwenhoek to contrast microorganisms under the microscope using plant juices, successful staining of tubercle bacilli with synthetic dyes by Paul Ehrlich and discovery of a stain for differentiation of gram-positive and gram-negative bacteria by Hans Christian Gram. The technique relies on the principle that pathogens have unique structural features, which can be recognized by specifically labeled organic molecules. A hundred years of extensive screening efforts led to discovery of a limited assortment of organic probes that are used for identification and differentiation of bacteria. A new challenge--continuous monitoring of biological threats--requires long lasting molecular probes capable of tight specific binding of pathogens in unfavorable conditions. To respond to the challenge, probe technology is being revolutionized by utilizing methods of combinatorial chemistry, phage display and directed molecular evolution. This review describes how molecular evolution methods are applied for development of peptide, antibody and phage probes, and summarizes the author's own data on development of landscape phage probes against Salmonella typhimurium. The performance of the probes in detection of Salmonella is illustrated by a precipitation test, enzyme-linked immunosorbent assay (ELISA), fluorescence-activated cell sorting (FACS) and fluorescent, optical and electron microscopy.

  5. A brief historical survey of "Peyronie's disease".

    PubMed

    Musitelli, Sergio; Bossi, Maurizio; Jallous, Hussein

    2008-07-01

    Historians of medicine and urology, sexology, and andrology in particular maintain that many other physicians, surgeons, anatomists, and pathologists have already described "Peyronie's disease" some centuries before the author after whom it has been called, François Gigot de La Peyronie (1678-1747). To perform a brief historical survey of Peyronie's disease. Methods. A literature review was performed. The main surgeons and anatomists who previously observed and described penile curvature prior to François Gigot de La Peyronie are Theodoricus Borgognoni (1205-1298), Guilielmus of Saliceto (circa 1210-1276), Gabriele Falloppio (or Falloppia) (1523-1562), Andreas Vesalius (1514-1564), Giulio Cesare Aranzi (or Aranzio) (1530-1589), Claas Pieterzoon Tulp (Nicholaus Tulpius) (1593-1674), and Anton Frederik Ruysch (1638-1731), who was said to have left the first "postmortem" illustration of the disease in a copperplate engraving in 1691. The original texts could easily prove that none of the alleged "precursors" of La Peyronie did ever describe, treat, and cure real cases of Peyronie's disease, and that to award them this merit was somewhat far-fetched, with only Guilielmus of Saliceto and Falloppio possibly excepted.

  6. Preparation and properties of environmental-friendly coatings based on carboxymethyl cellulose nitrate ester & modified alkyd.

    PubMed

    Duan, Hongtao; Shao, Ziqiang; Zhao, Ming; Zhou, Zhenwen

    2016-02-10

    Amphipathic coating basic film-forming material carboxymethyl cellulose nitrate ester (CMCN) was synthesized and characterizations of CMCN with different ratio of functional groups were studied. Ratios of functional groups on each repeating units of CMCN have great importance in the decision of CMCN properties using as an amphipathic coating basic film-forming material and ratios of functional groups were the most concerned of the study. Ratios of functional groups on each repeating units of CMCN were measured by elemental analyzer and calculated. Series of experiments were conducted using different ratios of functional groups of CMCN. Thermal properties of CMCN were measured by FT-IR and TG. Densities of CMCN powders were measured. Aqueous coatings based on CMCN/alkyd (after chemical modified by coconut oil) were prepared and morphology & rheology of CMCN hydrophilic dispersions were measured using an Anton-Paar-Strasse 20A-8054 Graz analyzer. Contact angles between films based on CMCN and deionized water were recorded. Other properties of films were measured. CMCN with the etherification of carboxymethyl groups at 0.35-0.40, nitrate ester groups at 1.96-2.19 and hydroxyl groups at 0.46-0.64 per d-glucose was considered as the best film forming material. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. On the history of gout: paleopathological evidence from the Medici family of Florence.

    PubMed

    Giuffra, Valentina; Minozzi, Simona; Vitiello, Angelica; Fornaciari, Antonio

    2017-01-01

    Throughout history, gout has been referred to as the "disease of the kings", and has been clearly associated with the lifestyle of the aristocratic social classes. According to the written sources, several members of the famous Medici family of Florence suffered from an arthritic disease that contemporary physicians called "gout". A paleopathological study carried out on the skeletal remains of some members of the family, exhumed from their tombs in the Church of San Lorenzo in Florence, offered a unique opportunity to directly investigate the evidence of the arthritic diseases affecting this elite group. The skeletal remains of several members of the family were examined macroscopically and submitted to x-ray investigation. The results of the study allowed us to ascertain that the so-called "gout of the Medici" should be considered the clinical manifestation of three different joint conditions: diffuse idiopathic skeletal hyperostosis, rheumatoid arthritis and uratic gout. In particular, uric acid gout was diagnosed in the Grand Duke Ferdinand I (1549-1609). Recently, a new case of this disease was diagnosed in Anton Francesco Maria (1618-1659), a probable illegitimate member of the family. With this new case, uratic gout was observed in 2 out of 9 adult males, leading to suppose that the disease should have been a common health problem within the family. The aetiology of the disease has to be searched in environmental factors, since both historical and paleonutritional studies demonstrated that the diet of this aristocratic court was rich in meat and wine.

  8. History of Neurosurgery in Palestine.

    PubMed

    Darwazeh, Rami; Darwazeh, Mazhar; Sun, Xiaochuan

    2017-08-01

    Palestinian neurosurgery started with Dr. Antone Tarazi as the first Palestinian neurosurgeon. Before that, there was no organized neurosurgery specialty, and general surgeons performed neurosurgical procedures. Here we review the history of neurosurgery and neurosurgical applications in Palestine, evaluate some limitations of the current system, and discuss major challenges to improving this system. We collected information from various sources in either English or Arabic. The development of neurosurgery and neurosurgical training in Palestine began in 1960 with the first center established in Jerusalem, which provided much-needed neurosurgical services and training in the fields of neurosurgery and neurology. Palestine has produced a number of its own neurosurgeons and has promoted further progress by establishing the Palestinian Neurosurgical Society in 2014. Today, there are 34 neurosurgeons (including 1 female neurosurgeon) and 17 residents providing expert care in 17 centers across Palestine, along with 1 neurosurgical residency program. Neurosurgery in Palestine has faced many challenges, some of which have been overcome. However, there remain many challenges, which will require much time and effort to surmount. Political stabilization is a significant factor in the progress of neurosurgery in Palestine. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Sergei Winogradsky: a founder of modern microbiology and the first microbial ecologist.

    PubMed

    Dworkin, Martin

    2012-03-01

    Sergei Winogradsky, was born in Russia in 1856 and was to become a founder of modern microbiology. After his Master's degree work on the nutrition and growth physiology of the yeast Mycoderma vini at the University of St. Petersburg, he joined the laboratory of Anton DeBary in Strassburg. There he carried out his studies on the sulfur-oxidizing bacterium Beggiatoa which resulted in his formulation of the theory of chemolithotrophy. He then joined the Swiss Polytechnic Institute in Zurich where he did his monumental work on bacterial nitrification. He isolated the first pure cultures of the nitrifying bacteria and confirmed that they carried out the separate steps of the conversion of ammonia to nitrite and of nitrite to nitrate. This led directly to the concept of the cycles of sulfur and nitrogen in Nature. He returned to Russia and there was the first to isolate a free-living dinitrogen-fixing bacterium. In the flush of success, he retired from science and spent 15 years on his familial estate in the Ukraine. The Russian revolution forced him to flee Russia. He joined the Pasteur Institute in Paris where he spent his remaining 24 years initiating and developing the field of microbial ecology. He died in 1953.

  10. Rheological Characterization and Cluster Classification of Iranian Commercial Foods, Drinks and Desserts to Recommend for Esophageal Dysphagia Diets

    PubMed Central

    ZARGARAAN, Azizollaah; OMARAEE, Yasaman; RASTMANESH, Reza; TAHERI, Negin; FADAVI, Ghasem; FADAEI, Morteza; MOHAMMADIFAR, Mohammad Amin

    2013-01-01

    Abstract Background In the absence of dysphagia-oriented food products, rheological characterization of available food items is of importance for safe swallowing and adequate nutrient intake of dysphagic patients. In this way, introducing alternative items (with similar ease of swallow) is helpful to improve quality of life and nutritional intake of esophageal cancer dysphagia patients. The present study aimed at rheological characterization and cluster classification of potentially suitable foodstuffs marketed in Iran for their possible use in dysphagia diets. Methods In this descriptive study, rheological data were obtained during January and February 2012 in Rheology Lab of National Nutrition and Food Technology Research Institute Tehran, Iran. Steady state and oscillatory shear parameters of 39 commercial samples were obtained using a Physica MCR 301 rheometer (Anton-Paar, GmbH, Graz, Austria). Matlab Fuzzy Logic Toolbox (R2012 a) was utilized for cluster classification of the samples. Results Using an extended list of rheological parameters and fuzzy logic methods, 39 commercial samples (drinks, main courses and desserts) were divided to 5 clusters and degree of membership to each cluster was stated by a number between 0 and 0.99. Conclusion Considering apparent viscosity of foodstuffs as a single criterion for classification of dysphagia-oriented food products is shortcoming of current guidelines in dysphagia diets. Authors proposed to some revisions in classification of dysphagia-oriented food products and including more rheological parameters (especially, viscoelastic parameters) in the classification. PMID:26060647

  11. The second joint Kemali-IBRO Mediterranean school of neuroscience is the first for invertebrate neuroscience.

    PubMed

    Yilmaz, A; Chabaud, M A

    2011-12-01

    This meeting was held at the Stazione Zoologica Anton Dohrn, Naples, Italy, from 6th-13th July 2011. It was sponsored through a collaboration between IBRO (the International Brain Research Organisation) and the Kemali Foundation. Notably, it is the first IBRO sponsored School specifically in invertebrate neuroscience. The meeting was attended by early career researchers from countries around the Mediterranean basin and highlighted the research opportunities that this field can offer to neuroscientists at the start of their careers. Students participating in the School were introduced to a range of important invertebrate model systems. The utility of these models in addressing fundamental neurobiological problems, especially those relating to human neurological disorders, was extensively discussed. In this review, two of the participating students provide a summary of this meeting with a view to encouraging support for further activity in this arena in the future. One of the aims of the Kemali foundation is to foster enduring collaborations between scientists in the Mediterranean region. Given the enthusiastic networking both during and after the meeting, there is much promise that this goal will be realised.

  12. Microwave Irradiation on Halloysite-Polypropylene Nanocomposites

    NASA Astrophysics Data System (ADS)

    Espino, Omar; Yust, Brian; Chipara, Dorina; Ajayan, Pullickel; Chipara, Alin; Chipara, Mircea; Utrgv Collaboration; Rice Collaboration

    Halloysite is an unique cyllindrical nanoclay characterized by poor electrical and thermal conductivity, which may become the filler of choice for the reinforcement of polymeric matrix, where electrical or thermal insulation are required. The main limits in the use of halloysite as replacement for carbon nanotube (CNT) are: 1. Smaller aspect ratio as halloysites are typically shorter than CNTs. 2. Smaller Young modulus of halloysites compared with CNTs. 3. Reduced thermal stability due to the loss of water upon heating. A research on halloysite dispersed within isotactic polypropylene is reported. To improve the interface between the halloysite and the polymeric matrix a microwave irradiation step has been considered. The local heating of the halloysite nanotubes is mediated by the absorbed/structural water content of the nanoclay. Nanocomposites loaded by various amounts of halloysite ranging from 0 % to 20 % wt. have been prepared by melt mixing by using a Haake RheoMixer. The as obtained nanocomposites have been subjected to microwave irradiation at 75 W in an Anton Paar Monowave 300 system and various irradiation times ranging from 5, 10, 15, 30, 45, and 60 minutes. The effect of microwave irradiation has been studied by Raman and FTIR spectroscopy

  13. “Colossal” Breakthrough: The Callosal Puncture as a Precursor to Third Ventriculostomy

    PubMed Central

    Chesler, D. A.; Pendleton, C.; Jallo, G. I.; Quiñones-Hinojosa, A.

    2015-01-01

    Background In 1908, Anton and von Bramann proposed the Balkenstich method, a corpus callosum puncture which created a communication between the ventricle and subarachnoid space. This method offered the benefit of providing continuous CSF diversion without the implantation of cannula or other shunting devices, yet it received only slight reference in the literature of the time. It remained a novel and perhaps underutilized approach at the time Cushing began expanding his neurosurgical practice at the Johns Hopkins Hospital. Materials and Methods Following IRB approval, and through the courtesy of the Alan Mason Chesney Archives, the surgical records of the Johns Hopkins Hospital for the period 1896–1912 were reviewed. Patients operated upon by Harvey Cushing were selected. Results 7 patients underwent puncture of the corpus callosum for treatment of hydrocephalus. 6 patients were treated for obstructive hydrocephalus secondary to presumed intracranial lesions. 1 patient was treated for congenital hydrocephalus. Conclusion The series reported here documents Cushing’s early use of the corpus callosum puncture to divert CSF in patients with obstructive hydrocephalus secondary to intracranial tumors, as well as an attempt to use the procedure in a pediatric patient with congenital hydrocephalus. Notably, 3 patients developed new onset left-sided weakness post-operatively, possibly due to retraction injury upon the supplementary motor intra-operative manipulations. PMID:22278787

  14. The effect of temperature on rheological properties of endodontic sealers.

    PubMed

    Rai, Roshni U; Singbal, Kiran P; Parekh, Vaishali

    2016-01-01

    The purpose of this study was to investigate temperature-dependent rheological properties of three endodontic sealers MTA Fillapex (Angelus, Brazil), AH Plus (Dentsply, Germany), and EndoREZ (Ultradent, USA). Five samples of each group of endodontic sealers (n = 30) were freshly mixed and placed on the plate of a rheometer (MCR 301, AntonPaar, Physica) and examined at 25°C and 37°C temperature, respectively. Rheological properties of the sealers were calculated according to the loss modulus (G″), storage modulus (G'), loss factor (Tan δ), and complex viscosity (η*) using dynamic oscillatory shear tests. Statistical analysis (Wilcoxon signed-rank test) demonstrated that MTA Fillapex exhibited higher loss modulus (G″ > G') and a crossover region. AH Plus and EndoREZ had a higher storage modulus (G' > G″) at both temperatures. Loss factor (Tan δ) of MTA Fillapex was the highest compared to AH Plus, followed by EndoREZ. With a temperature change from 25°C to 37°C, MTA Fillapex exhibited a decrease while AH Plus exhibited an increase and, EndoREZ exhibited the least change, in complex viscosity (η*). EndoREZ exhibited better rheological properties compared to the other two test sealers.

  15. Rheological Characterization and Cluster Classification of Iranian Commercial Foods, Drinks and Desserts to Recommend for Esophageal Dysphagia Diets.

    PubMed

    Zargaraan, Azizollaah; Omaraee, Yasaman; Rastmanesh, Reza; Taheri, Negin; Fadavi, Ghasem; Fadaei, Morteza; Mohammadifar, Mohammad Amin

    2013-12-01

    In the absence of dysphagia-oriented food products, rheological characterization of available food items is of importance for safe swallowing and adequate nutrient intake of dysphagic patients. In this way, introducing alternative items (with similar ease of swallow) is helpful to improve quality of life and nutritional intake of esophageal cancer dysphagia patients. The present study aimed at rheological characterization and cluster classification of potentially suitable foodstuffs marketed in Iran for their possible use in dysphagia diets. In this descriptive study, rheological data were obtained during January and February 2012 in Rheology Lab of National Nutrition and Food Technology Research Institute Tehran, Iran. Steady state and oscillatory shear parameters of 39 commercial samples were obtained using a Physica MCR 301 rheometer (Anton-Paar, GmbH, Graz, Austria). Matlab Fuzzy Logic Toolbox (R2012 a) was utilized for cluster classification of the samples. Using an extended list of rheological parameters and fuzzy logic methods, 39 commercial samples (drinks, main courses and desserts) were divided to 5 clusters and degree of membership to each cluster was stated by a number between 0 and 0.99. Considering apparent viscosity of foodstuffs as a single criterion for classification of dysphagia-oriented food products is shortcoming of current guidelines in dysphagia diets. Authors proposed to some revisions in classification of dysphagia-oriented food products and including more rheological parameters (especially, viscoelastic parameters) in the classification.

  16. The effect of temperature on rheological properties of endodontic sealers

    PubMed Central

    Rai, Roshni U.; Singbal, Kiran P.; Parekh, Vaishali

    2016-01-01

    Aim: The purpose of this study was to investigate temperature-dependent rheological properties of three endodontic sealers MTA Fillapex (Angelus, Brazil), AH Plus (Dentsply, Germany), and EndoREZ (Ultradent, USA). Materials and Methods: Five samples of each group of endodontic sealers (n = 30) were freshly mixed and placed on the plate of a rheometer (MCR 301, AntonPaar, Physica) and examined at 25°C and 37°C temperature, respectively. Rheological properties of the sealers were calculated according to the loss modulus (G″), storage modulus (G′), loss factor (Tan δ), and complex viscosity (η*) using dynamic oscillatory shear tests. Results: Statistical analysis (Wilcoxon signed-rank test) demonstrated that MTA Fillapex exhibited higher loss modulus (G″ > G′) and a crossover region. AH Plus and EndoREZ had a higher storage modulus (G′ > G″) at both temperatures. Loss factor (Tan δ) of MTA Fillapex was the highest compared to AH Plus, followed by EndoREZ. With a temperature change from 25°C to 37°C, MTA Fillapex exhibited a decrease while AH Plus exhibited an increase and, EndoREZ exhibited the least change, in complex viscosity (η*). Conclusions: EndoREZ exhibited better rheological properties compared to the other two test sealers. PMID:27099414

  17. Rheological properties of a reclaimed waste tire rubber through high-pressure high-temperature sintering

    NASA Astrophysics Data System (ADS)

    Ubaidillah, Yunus, N. A.; Aziz, S. A. A.; Wahab, N. A. A.; Mazlan, S. A.

    2017-01-01

    High-Pressure High-Temperature (HPHT) sintering method has successfully revulcanized waste tire rubber (WTR) without any additional virgin rubber. The crumb rubber cleaned from its fabric and metals was reclaimed by applying high pressure (25 MPa) and high temperature (200 °C) for an hour along with common vulcanization agents such as sulfur, zinc oxide, and stearic acid. Dynamic properties of reclaimed WTR were assessed through shear rheology test on MCR302 Rheometer, Anton Paar, Austria. The results indicated that under steady test, the yield stress occurred at 31 kPa at 5% linear viscoelastic limit. The storage modulus ranged from 0.6 to 0.7 MPa under excitation frequency of 0.1 to 100 Hz and 1% strain amplitude. Under ramp strain amplitude, the storage modulus showed Payne Effect phenomenon at 0.8 to 1 % strain amplitude and 1 Hz excitation frequency. In general, the resulted dynamic properties was comparable with non-reclaimed rubber based on a literature survey. The results confirmed that HPHT sintering method was capable of reclaiming 100% WTR without an additional virgin rubber and achieving acceptable dynamic properties.

  18. The design and analysis of new musical bells

    NASA Astrophysics Data System (ADS)

    McLachlan, Neil M.

    2004-05-01

    The design and analysis of a series of new musical bells will be presented in this paper. Modal analysis of a wide range of bell-like geometries using FEA revealed the presence and significance of transverse axial modes in unconstrained bell models, leading to a new understanding of the relationships between bell geometry and modal behavior. This understanding was used to adjust simple parametric models of bell geometry to arrive at appropriate geometries to begin numerical shape optimization for the design of bells with a range of desired overtone tunings. Pitch salience is well known to depend on the degree of harmonic relationships between pure tones in complex stimuli. Bells intended to produce a single, highly salient pitch were designed and manufactured with up to the first 7 overtones tuned to the harmonic series. Other bells with overtones tuned to subsets of two or three harmonic series were also designed and manufactured. These bells were intended to produce multiple pitch perceptions of approximately equal strength. Spectral analysis and range of numerical psycho-acoustic models are used to evaluate the sounds of manufactured bells against these design objectives. [I would like to acknowledge the close collaboration of Dr. Anton Hasell of Australian Bell.

  19. An Equation of State for Hypersaline Water in Great Salt Lake, Utah, USA

    USGS Publications Warehouse

    Naftz, D.L.; Millero, F.J.; Jones, B.F.; Green, W.R.

    2011-01-01

    Great Salt Lake (GSL) is one of the largest and most saline lakes in the world. In order to accurately model limnological processes in GSL, hydrodynamic calculations require the precise estimation of water density (??) under a variety of environmental conditions. An equation of state was developed with water samples collected from GSL to estimate density as a function of salinity and water temperature. The ?? of water samples from the south arm of GSL was measured as a function of temperature ranging from 278 to 323 degrees Kelvin (oK) and conductivity salinities ranging from 23 to 182 g L-1 using an Anton Paar density meter. These results have been used to develop the following equation of state for GSL (?? = ?? 0.32 kg m-3): ?? - ??0 = 184.01062 + 1.04708 * S - 1.21061*T + 3.14721E - 4*S2 + 0.00199T2 where ??0 is the density of pure water in kg m-3, S is conductivity salinity g L-1, and T is water temperature in degrees Kelvin. ?? 2011 U.S. Government.

  20. Knock on brick. [use of masonry for energy efficiency

    SciTech Connect

    Browning, W. ); Arcidi, P.

    1993-03-01

    In 1978, the Netherlands International Bank (NMB) needed a new image and a new headquarters in Amsterdam. It was created by an interdisciplinary team: architects, construction engineers, landscape architects, energy experts, artists, and bank employees worked for three years on the design. The architect Anton Alberts describes the building as [open quotes]anthroposophical,[close quotes] bases on Rudolph Steiner's design philosophy, where the orthogonal gives way to organic volumes and forms to elicit humane spaces with a spiritual sensibility. The integration of building design, daylighting, and energy systems has yielded impressive results. NMB's former headquarters consumed 422,801 BTU of primary energy per square foot each year. The new building consumes only 35,246 BTU per square foot. By way of comparison, an adjacent bank, constructed at approximately the same time and cost, consumes five times the energy per square foot. Construction costs of $162 per square foot (in 1991 dollars) include land, structure, landscaping, art, furniture, and equipment. Costs attributed to the energy systems were approximately $700,000, but estimates for the annual energy savings are $2.6 million. Using early 1980s technologies the energy measures had a three-month payback.