Science.gov

Sample records for arvensis agg dipsacaceae

  1. Towards resolving the Knautia arvensis agg. (Dipsacaceae) puzzle: primary and secondary contact zones and ploidy segregation at landscape and microgeographic scales

    PubMed Central

    Kolář, Filip; Štech, Milan; Trávníček, Pavel; Rauchová, Jana; Urfus, Tomáš; Vít, Petr; Kubešová, Magdalena; Suda, Jan

    2009-01-01

    Background and Aims Detailed knowledge of variations in ploidy levels and their geographic distributions is one of the key tasks faced in polyploid research in natural systems. Flow cytometry has greatly facilitated the field of cytogeography by allowing characterization of ploidy levels at both the regional and population scale, and at multiple stages of the life cycle. In the present study, flow cytometry was employed to investigate the patterns and dynamics of ploidy variation in the taxonomically challenging complex Knautia arvensis (Dipsacaceae) and some of its allies (K. dipsacifolia, K. slovaca) in Central Europe. Methods DNA ploidy levels were estimated by DAPI flow cytometry in 5205 adult plants, 228 seedlings and 400 seeds collected from 292 Knautia populations in seven European countries. The flow cytometric data were supplemented with conventional chromosome counts. A subset of 79 accessions was subjected to estimation of the absolute genome size using propidium iodide flow cytometry. Key Results and Conclusions Five different ploidy levels (from 2x to 6x) were found, with triploids of K. arvensis being recorded for the first time. The species also exhibited variation in the monoploid genome size, corresponding to the types of habitats occupied (grassland diploid populations had larger genome sizes than relict and subalpine diploid populations). Disregarding relict populations, the distribution of 2x and 4x cytotypes was largely parapatric, with a diffuse secondary contact zone running along the north-west margin of the Pannonian basin. Spatial segregation of the cytotypes was also observed on regional and microgeographic scales. The newly detected sympatric growth of diploids and tetraploids in isolated relict habitats most likely represents the primary zone of cytotype contact. Ploidy level was found to be a major determinant of the strength of inter-cytotype reproductive barriers. While mixed 2x + 4x populations virtually lacked the intermediate

  2. Higher pollinator effectiveness by specialist than generalist flower-visitors of unspecialized Knautia arvensis (Dipsacaceae).

    PubMed

    Larsson, Magnus

    2005-12-01

    A critical issue in pollination ecology is the evolution of generalist pollination systems, and under which conditions floral specializations evolve from these. The gynodioecious herb Knautia arvensis (Dipsacaceae) exhibits a generalized pollination system, but is visited by both generalist and specialist flower-visitors. The present study tested pollinator effectiveness and pollinator importance of the pollen specialist solitary bee Andrena hattorfiana (Andrenidae) vs. the generalist flower-visitors to K. arvensis on the island of Oland, SE Sweden. Females of the specialist bee removed more pollen per inflorescence-visit than the major groups of generalist visitors such as bumblebees and flies. They also deposited more pollen per inflorescence-visit than any of the generalist visitor groups. The females have a preference for pollen-presenting vs. stigma-presenting inflorescences, a pattern shared with most of the generalist flower-visitors. Females of the specialist exert such a strong preference that they, despite their great pollinator effectiveness, make modest contribution to pollen transfer in K. arvensis. The females of A. hattorfiana accounted for 14.2% of the overall visits and 5.8% of the total pollination, the rest being performed by generalist visitors and males of A. hattorfiana. This study shows that pollinator effectiveness of a specialist can be superior while generalist flower-visitors select floral characters towards generalization through their greater contribution to overall pollen flow.

  3. Bringing together evolution on serpentine and polyploidy: spatiotemporal history of the diploid-tetraploid complex of Knautia arvensis (Dipsacaceae).

    PubMed

    Kolář, Filip; Fér, Tomáš; Štech, Milan; Trávníček, Pavel; Dušková, Eva; Schönswetter, Peter; Suda, Jan

    2012-01-01

    Polyploidization is one of the leading forces in the evolution of land plants, providing opportunities for instant speciation and rapid gain of evolutionary novelties. Highly selective conditions of serpentine environments act as an important evolutionary trigger that can be involved in various speciation processes. Whereas the significance of both edaphic speciation on serpentine and polyploidy is widely acknowledged in plant evolution, the links between polyploid evolution and serpentine differentiation have not yet been examined. To fill this gap, we investigated the evolutionary history of the perennial herb Knautia arvensis (Dipsacaceae), a diploid-tetraploid complex that exhibits an intriguing pattern of eco-geographic differentiation. Using plastid DNA sequencing and AFLP genotyping of 336 previously cytotyped individuals from 40 populations from central Europe, we unravelled the patterns of genetic variation among the cytotypes and the edaphic types. Diploids showed the highest levels of genetic differentiation, likely as a result of long term persistence of several lineages in ecologically distinct refugia and/or independent immigration. Recurrent polyploidization, recorded in one serpentine island, seems to have opened new possibilities for the local serpentine genotype. Unlike diploids, the serpentine tetraploids were able to escape from the serpentine refugium and spread further; this was also attributable to hybridization with the neighbouring non-serpentine tetraploid lineages. The spatiotemporal history of K. arvensis allows tracing the interplay of polyploid evolution and ecological divergence on serpentine, resulting in a complex evolutionary pattern. Isolated serpentine outcrops can act as evolutionary capacitors, preserving distinct karyological and genetic diversity. The serpentine lineages, however, may not represent evolutionary 'dead-ends' but rather dynamic systems with a potential to further influence the surrounding populations, e.g., via

  4. Bringing Together Evolution on Serpentine and Polyploidy: Spatiotemporal History of the Diploid-Tetraploid Complex of Knautia arvensis (Dipsacaceae)

    PubMed Central

    Kolář, Filip; Fér, Tomáš; Štech, Milan; Trávníček, Pavel; Dušková, Eva; Schönswetter, Peter; Suda, Jan

    2012-01-01

    Polyploidization is one of the leading forces in the evolution of land plants, providing opportunities for instant speciation and rapid gain of evolutionary novelties. Highly selective conditions of serpentine environments act as an important evolutionary trigger that can be involved in various speciation processes. Whereas the significance of both edaphic speciation on serpentine and polyploidy is widely acknowledged in plant evolution, the links between polyploid evolution and serpentine differentiation have not yet been examined. To fill this gap, we investigated the evolutionary history of the perennial herb Knautia arvensis (Dipsacaceae), a diploid-tetraploid complex that exhibits an intriguing pattern of eco-geographic differentiation. Using plastid DNA sequencing and AFLP genotyping of 336 previously cytotyped individuals from 40 populations from central Europe, we unravelled the patterns of genetic variation among the cytotypes and the edaphic types. Diploids showed the highest levels of genetic differentiation, likely as a result of long term persistence of several lineages in ecologically distinct refugia and/or independent immigration. Recurrent polyploidization, recorded in one serpentine island, seems to have opened new possibilities for the local serpentine genotype. Unlike diploids, the serpentine tetraploids were able to escape from the serpentine refugium and spread further; this was also attributable to hybridization with the neighbouring non-serpentine tetraploid lineages. The spatiotemporal history of K. arvensis allows tracing the interplay of polyploid evolution and ecological divergence on serpentine, resulting in a complex evolutionary pattern. Isolated serpentine outcrops can act as evolutionary capacitors, preserving distinct karyological and genetic diversity. The serpentine lineages, however, may not represent evolutionary ‘dead-ends’ but rather dynamic systems with a potential to further influence the surrounding populations, e

  5. Bringing together evolution on serpentine and polyploidy: spatiotemporal history of the diploid-tetraploid complex of Knautia arvensis (Dipsacaceae).

    PubMed

    Kolář, Filip; Fér, Tomáš; Štech, Milan; Trávníček, Pavel; Dušková, Eva; Schönswetter, Peter; Suda, Jan

    2012-01-01

    Polyploidization is one of the leading forces in the evolution of land plants, providing opportunities for instant speciation and rapid gain of evolutionary novelties. Highly selective conditions of serpentine environments act as an important evolutionary trigger that can be involved in various speciation processes. Whereas the significance of both edaphic speciation on serpentine and polyploidy is widely acknowledged in plant evolution, the links between polyploid evolution and serpentine differentiation have not yet been examined. To fill this gap, we investigated the evolutionary history of the perennial herb Knautia arvensis (Dipsacaceae), a diploid-tetraploid complex that exhibits an intriguing pattern of eco-geographic differentiation. Using plastid DNA sequencing and AFLP genotyping of 336 previously cytotyped individuals from 40 populations from central Europe, we unravelled the patterns of genetic variation among the cytotypes and the edaphic types. Diploids showed the highest levels of genetic differentiation, likely as a result of long term persistence of several lineages in ecologically distinct refugia and/or independent immigration. Recurrent polyploidization, recorded in one serpentine island, seems to have opened new possibilities for the local serpentine genotype. Unlike diploids, the serpentine tetraploids were able to escape from the serpentine refugium and spread further; this was also attributable to hybridization with the neighbouring non-serpentine tetraploid lineages. The spatiotemporal history of K. arvensis allows tracing the interplay of polyploid evolution and ecological divergence on serpentine, resulting in a complex evolutionary pattern. Isolated serpentine outcrops can act as evolutionary capacitors, preserving distinct karyological and genetic diversity. The serpentine lineages, however, may not represent evolutionary 'dead-ends' but rather dynamic systems with a potential to further influence the surrounding populations, e.g., via

  6. DU-AGG pilot plant design study

    SciTech Connect

    Lessing, P.A.; Gillman, H.

    1996-07-01

    The Idaho National Engineering Laboratory (INEL) is developing new methods to produce high-density aggregate (artificial rock) primarily consisting of depleted uranium oxide. The objective is to develop a low-cost method whereby uranium oxide powder (UO[sub 2], U[sub 3]O[sub ]8, or UO[sub 3]) can be processed to produce high-density aggregate pieces (DU-AGG) having physical properties suitable for disposal in low-level radioactive disposal facilities or for use as a component of high-density concrete used as shielding for radioactive materials. A commercial company, G-M Systems, conducted a design study for a manufacturing pilot plant to process DU-AGG. The results of that study are included and summarized in this report. Also explained are design considerations, equipment capacities, the equipment list, system operation, layout of equipment in the plant, cost estimates, and the proposed plan and schedule.

  7. Signaling specificity provided by the Arabidopsis thaliana heterotrimeric G-protein γ subunits AGG1 and AGG2 is partially but not exclusively provided through transcriptional regulation.

    PubMed

    Thung, Leena; Chakravorty, David; Trusov, Yuri; Jones, Alan M; Botella, José Ramón

    2013-01-01

    The heterotrimeric G-protein complex in Arabidopsis thaliana consists of one α, one ß and three γ subunits. While two of the γ subunits, AGG1 and AGG2 have been shown to provide functional selectivity to the Gßγ dimer in Arabidopsis, it is unclear if such selectivity is embedded in their molecular structures or conferred by the different expression patterns observed in both subunits. In order to study the molecular basis for such selectivity we tested genetic complementation of AGG1- and AGG2 driven by the respectively swapped gene promoters. When expressed in the same tissues as AGG1, AGG2 rescues some agg1 mutant phenotypes such as the hypersensitivity to Fusarium oxysporum and D-mannitol as well as the altered levels of lateral roots, but does not rescue the early flowering phenotype. Similarly, AGG1 when expressed in the same tissues as AGG2 rescues the osmotic stress and lateral-root phenotypes observed in agg2 mutants but failed to rescue the heat-stress induction of flowering. The fact that AGG1 and AGG2 are functionally interchangeable in some pathways implies that, at least for those pathways, signaling specificity resides in the distinctive spatiotemporal expression patterns exhibited by each γ subunit. On the other hand, the lack of complementation for some phenotypes indicates that there are pathways in which signaling specificity is provided by differences in the primary AGG1 and AGG2 amino acid sequences. PMID:23520518

  8. Distribution of AGG interruption patterns within nine world populations.

    PubMed

    Yrigollen, Carolyn M; Sweha, Stefan; Durbin-Johnson, Blythe; Zhou, Lili; Berry-Kravis, Elizabeth; Fernandez-Carvajal, Isabel; Faradz, Sultana Mh; Amiri, Khaled; Shaheen, Huda; Polli, Roberta; Murillo-Bonilla, Luis; Silva Arevalo, Gabriel de Jesus; Cogram, Patricia; Murgia, Alessandra; Tassone, Flora

    2014-11-01

    The CGG trinucleotide repeat within the FMR1 gene is associated with multiple clinical disorders, including fragile X-associated tremor/ataxia syndrome, fragile X-associated primary ovarian insufficiency, and fragile X syndrome. Differences in the distribution and prevalence of CGG repeat length and of AGG interruption patterns have been reported among different populations and ethnicities. In this study we characterized the AGG interruption patterns within 3,065 normal CGG repeat alleles from nine world populations including Australia, Chile, United Arab Emirates, Guatemala, Indonesia, Italy, Mexico, Spain, and United States. Additionally, we compared these populations with those previously reported, and summarized the similarities and differences. We observed significant differences in AGG interruption patterns. Frequencies of longer alleles, longer uninterrupted CGG repeat segments and alleles with greater than 2 AGG interruptions varied between cohorts. The prevalence of fragile X syndrome and FMR1 associated disorders in various populations is thought to be affected by the total length of the CGG repeat and may also be influenced by the AGG distribution pattern. Thus, the results of this study may be important in considering the risk of fragile X-related conditions in various populations.

  9. Distribution of AGG interruption patterns within nine world populations

    PubMed Central

    Yrigollen, Carolyn M.; Sweha, Stefan; Durbin-Johnson, Blythe; Zhou, Lili; Berry-Kravis, Elizabeth; Fernandez-Carvajal, Isabel; Faradz, Sultana MH; Amiri, Khaled; Shaheen, Huda; Polli, Roberta; Murillo-Bonilla, Luis; Silva Arevalo, Gabriel de Jesus; Cogram, Patricia; Murgia, Alessandra; Tassone, Flora

    2014-01-01

    Summary The CGG trinucleotide repeat within the FMR1 gene is associated with multiple clinical disorders, including fragile X-associated tremor/ataxia syndrome, fragile X-associated primary ovarian insufficiency, and fragile X syndrome. Differences in the distribution and prevalence of CGG repeat length and of AGG interruption patterns have been reported among different populations and ethnicities. In this study we characterized the AGG interruption patterns within 3,065 normal CGG repeat alleles from nine world populations including Australia, Chile, United Arab Emirates, Guatemala, Indonesia, Italy, Mexico, Spain, and United States. Additionally, we compared these populations with those previously reported, and summarized the similarities and differences. We observed significant differences in AGG interruption patterns. Frequencies of longer alleles, longer uninterrupted CGG repeat segments and alleles with greater than 2 AGG interruptions varied between cohorts. The prevalence of fragile X syndrome and FMR1 associated disorders in various populations is thought to be affected by the total length of the CGG repeat and may also be influenced by the AGG distribution pattern. Thus, the results of this study may be important in considering the risk of fragile X-related conditions in various populations. PMID:25606365

  10. Distribution of AGG interruption patterns within nine world populations.

    PubMed

    Yrigollen, Carolyn M; Sweha, Stefan; Durbin-Johnson, Blythe; Zhou, Lili; Berry-Kravis, Elizabeth; Fernandez-Carvajal, Isabel; Faradz, Sultana Mh; Amiri, Khaled; Shaheen, Huda; Polli, Roberta; Murillo-Bonilla, Luis; Silva Arevalo, Gabriel de Jesus; Cogram, Patricia; Murgia, Alessandra; Tassone, Flora

    2014-11-01

    The CGG trinucleotide repeat within the FMR1 gene is associated with multiple clinical disorders, including fragile X-associated tremor/ataxia syndrome, fragile X-associated primary ovarian insufficiency, and fragile X syndrome. Differences in the distribution and prevalence of CGG repeat length and of AGG interruption patterns have been reported among different populations and ethnicities. In this study we characterized the AGG interruption patterns within 3,065 normal CGG repeat alleles from nine world populations including Australia, Chile, United Arab Emirates, Guatemala, Indonesia, Italy, Mexico, Spain, and United States. Additionally, we compared these populations with those previously reported, and summarized the similarities and differences. We observed significant differences in AGG interruption patterns. Frequencies of longer alleles, longer uninterrupted CGG repeat segments and alleles with greater than 2 AGG interruptions varied between cohorts. The prevalence of fragile X syndrome and FMR1 associated disorders in various populations is thought to be affected by the total length of the CGG repeat and may also be influenced by the AGG distribution pattern. Thus, the results of this study may be important in considering the risk of fragile X-related conditions in various populations. PMID:25606365

  11. The plant-specific G protein γ subunit AGG3 influences organ size and shape in Arabidopsis thaliana.

    PubMed

    Li, Shengjun; Liu, Yaju; Zheng, Leiying; Chen, Liangliang; Li, Na; Corke, Fiona; Lu, Yaru; Fu, Xiangdong; Zhu, Zhengge; Bevan, Michael W; Li, Yunhai

    2012-05-01

    • Control of organ size and shape by cell proliferation and cell expansion is a fundamental developmental process, but the mechanisms that set the size and shape of determinate organs are largely unknown in plants. • Molecular, genetic, cytological and biochemical approaches were used to characterize the roles of the Arabidopsis thaliana G protein γ subunit (AGG3) gene in organ growth. • Here, we describe A. thaliana AGG3, which promotes petal growth by increasing the period of cell proliferation. Both the N-terminal region and the C-terminal domains of AGG3 are necessary for the function of AGG3. By contrast, analysis of a series of AGG3 derivatives with deletions in specific domains showed that the deletion of any of these domains cannot completely abolish the function of AGG3. The GFP-AGG3 fusion protein is localized to the plasma membrane. The predicted transmembrane domain plays an important role in the plasma membrane localization of AGG3. Genetic analyses revealed that AGG3 action requires a functional G protein α subunit (GPA1) and G protein β subunit (AGB1). • Our findings demonstrate that AGG3, GPA1 and AGB1 act in the same genetic pathway to influence organ size and shape in A. thaliana.

  12. FamAgg: an R package to evaluate familial aggregation of traits in large pedigrees

    PubMed Central

    Rainer, Johannes; Taliun, Daniel; D’Elia, Yuri; Pattaro, Cristian; Domingues, Francisco S.; Weichenberger, Christian X.

    2016-01-01

    Summary: Familial aggregation analysis is the first fundamental step to perform when assessing the extent of genetic background of a disease. However, there is a lack of software to analyze the familial clustering of complex phenotypes in very large pedigrees. Such pedigrees can be utilized to calculate measures that express trait aggregation on both the family and individual level, providing valuable directions in choosing families for detailed follow-up studies. We developed FamAgg, an open source R package that contains both established and novel methods to investigate familial aggregation of traits in large pedigrees. We demonstrate its use and interpretation by analyzing a publicly available cancer dataset with more than 20 000 participants distributed across approximately 400 families. Availability and implementation: The FamAgg package is freely available at the Bioconductor repository, http://www.bioconductor.org/packages/FamAgg. Contact: Christian.Weichenberger@eurac.edu Supplementary information: Supplementary data are available at Bioinformatics online. PMID:26803158

  13. AggModel: A soil organic matter model with measurable pools for use in incubation studies

    SciTech Connect

    Segoli, Moran; De Gryze, S.; Dou, Fugen; Lee, J.; Post, Wilfred M; Denef, K.; Six, Johan W U A

    2013-01-01

    Current soil organic matter (SOM) models are empirical in nature by employing few conceptual SOM pools that have a specific turnover time, but that are not measurable and have no direct relationship with soil structural properties. Most soil particles are held together in aggregates and the number, size and stability of these aggregates significantly affect the size and amount of organic matter contained in these aggregates, and its susceptibility to decomposition. While it has been shown that soil aggregates and their dynamics can be measured directly in the laboratory and in the field, the impact of soil aggregate dynamics on SOM decomposition has not been explicitly incorporated in ecosystem models. Here, we present AggModel, a conceptual and simulation model that integrates soil aggregate and SOM dynamics. In AggModel, we consider unaggregated and microaggregated soil that can exist within or external to macroaggregated soil. Each of the four aggregate size classes contains particulate organic matter and mineral-associated organic matter fractions. We used published data from laboratory incubations to calibrate and validate the biological and environmental effects on the rate of formation and breakdown of macroaggregates and microaggregates, and the organic matter dynamics within these different aggregate fractions. After calibration, AggModel explained more than 70% of the variation in aggregate masses and over 90% of the variation in aggregate-associated carbon. The model estimated the turnover time of macroaggregates as 32 days and 166 days for microaggregates. Sensitivity analysis of AggModel parameterization supported the notion that macroaggregate turnover rate has a strong control over microaggregate masses and, hence, carbon sequestration. In addition to AggModel being a proof-of-concept, the advantage of a model that is based on measurable SOM fractions is that its internal structure and dynamics can be directly calibrated and validated by using

  14. A DOUBLE NEUTRON STAR MERGER ORIGIN FOR THE COSMOLOGICAL RELATIVISTIC FADING SOURCE PTF11agg?

    SciTech Connect

    Wu, Xue-Feng; Gao, He; Ding, Xuan; Zhang, Bing; Dai, Zi-Gao; Wei, Jian-Yan

    2014-01-20

    The Palomar Transient Factory (PTF) team recently reported the discovery of a rapidly fading optical transient source, PTF11agg. A long-lived scintillating radio counterpart was identified, but the search for a high-energy counterpart showed negative results. The PTF team speculated that PTF11agg may represent a new class of relativistic outbursts. Here we suggest that a neutron star (NS)-NS merger system with a supra-massive magnetar central engine could be a possible source to power such a transient, if our line of sight is not on the jet axis direction of the system. These systems are also top candidates for gravitational wave sources to be detected in the advanced LIGO/Virgo era. We find that the PTF11agg data could be explained well with such a model, suggesting that at least some gravitational wave bursts due to NS-NS mergers may be associated with such a bright electromagnetic counterpart without a γ-ray trigger.

  15. Comparative Mitogenomics of Plant Bugs (Hemiptera: Miridae): Identifying the AGG Codon Reassignments between Serine and Lysine

    PubMed Central

    Wang, Pei; Song, Fan; Cai, Wanzhi

    2014-01-01

    Insect mitochondrial genomes are very important to understand the molecular evolution as well as for phylogenetic and phylogeographic studies of the insects. The Miridae are the largest family of Heteroptera encompassing more than 11,000 described species and of great economic importance. For better understanding the diversity and the evolution of plant bugs, we sequence five new mitochondrial genomes and present the first comparative analysis of nine mitochondrial genomes of mirids available to date. Our result showed that gene content, gene arrangement, base composition and sequences of mitochondrial transcription termination factor were conserved in plant bugs. Intra-genus species shared more conserved genomic characteristics, such as nucleotide and amino acid composition of protein-coding genes, secondary structure and anticodon mutations of tRNAs, and non-coding sequences. Control region possessed several distinct characteristics, including: variable size, abundant tandem repetitions, and intra-genus conservation; and was useful in evolutionary and population genetic studies. The AGG codon reassignments were investigated between serine and lysine in the genera Adelphocoris and other cimicomorphans. Our analysis revealed correlated evolution between reassignments of the AGG codon and specific point mutations at the antidocons of tRNALys and tRNASer(AGN). Phylogenetic analysis indicated that mitochondrial genome sequences were useful in resolving family level relationship of Cimicomorpha. Comparative evolutionary analysis of plant bug mitochondrial genomes allowed the identification of previously neglected coding genes or non-coding regions as potential molecular markers. The finding of the AGG codon reassignments between serine and lysine indicated the parallel evolution of the genetic code in Hemiptera mitochondrial genomes. PMID:24988409

  16. The reproductive strategies of the heterocarpic annual Calendula arvensis (Asteraceae)

    NASA Astrophysics Data System (ADS)

    Ruiz De Clavijo, E.

    2005-09-01

    Achene polymorphism and various aspects of the reproductive biology of the annual Calendula arvensis L. (Field marigold), were studied to determine the reproductive strategies of the plant. This species normally produces three types of achene: rostrate, cymbiform and annular. Rostrate and cymbiform achenes are larger and heavier than annular achenes, and are adapted to long-range dispersal (by epizoochory and anemochory, respectively). In contrast, annular achenes are smaller in size and weight, and are adapted to short-range dispersal. Achenes germinate over a broad range of temperatures (both in light and in darkness), exhibiting cymbiform achenes the highest germination percentages and annular achenes the lowest under all conditions tested. A fraction of the three types of achenes exhibit dormancy and presumably enter the soil seedbank. Achene types adapted for long-range dispersal (rostrate and cymbiform achenes) produce seedlings that are best able to emerge from deeper burial depths, and that are initially stronger and exhibit earlier flowering than the plants from the annular achenes (which are likely to disperse over shorter distances). These features, together with the fact that fruiting occurs even in the absence of pollinators (automatic geitonogamy), the different mechanisms for achene dispersal (zoochory, anemochory and myrmerochory), and the extended germination, flowering and fruiting periods, facilitate establishment and expansion of this species in unpredictable and disturbed habitats.

  17. Barriers to gene flow from oilseed rape (Brassica napus) into populations of Sinapis arvensis.

    PubMed

    Moyes, C L; Lilley, J M; Casais, C A; Cole, S G; Haeger, P D; Dale, P J

    2002-01-01

    One concern over growing herbicide-tolerant crops is that herbicide-tolerance genes may be transferred into the weeds they are designed to control. Brassica napus (oilseed rape) has a number of wild relatives that cause weed problems and the most widespread of these is Sinapis arvensis (charlock). Sinapis arvensis seed was collected from 102 populations across the UK, within and outside B. napus-growing areas. These populations were tested for sexual compatibility with B. napus and it was found that none of them hybridized readily in the glasshouse. In contrast to previous studies, we have found that hybrids can be formed naturally with S. arvensis as the maternal parent. Six diverse B. napus cultivars (Capricorn, Drakkar, Falcon, Galaxy, Hobson and Regent) were tested for their compatibility with S. arvensis but no cultivar hybridized readily in the glasshouse. We were unable to detect gene transfer from B. napus to S. arvensis in the field, confirming the extremely low probability of hybridization predicted from the glasshouse work. PMID:11903908

  18. Mentha arvensis exhibit better adaptive characters in contrast to Mentha piperita when subjugated to sustained waterlogging stress.

    PubMed

    Phukan, Ujjal J; Mishra, Sonal; Timbre, Khilesh; Luqman, Suaib; Shukla, Rakesh Kumar

    2014-05-01

    Waterlogging is becoming a critical threat to plants growing in areas prone to flooding. Some plants adapt various morphological and biochemical alterations which are regulated transcriptionally to cope with the situation. A comparative study of waterlogging response in two different varieties of Mentha namely Mentha piperita and Mentha arvensis was performed. M. arvensis showed better response towards waterlogging in comparison to M. piperita. M. arvensis maintained a healthy posture by utilizing its carbohydrate content; also, it showed a flourished vegetative growth under waterlogged condition. Soluble protein, chlorophyll content, relative water content, and nitric oxide scavenging activity were comparatively more salient in M. arvensis during this hypoxia treatment. Lipid peroxidation was less in M. arvensis. M. arvensis also showed vigorous outgrowth of adventitious roots to assist waterlogging tolerance. To further investigate the possible gene transcripts involved in this response, we did cDNA subtraction of waterlogging treated M. piperita and M. arvensis seedlings. cDNA subtraction has identified thirty seven novel putative Expressed Sequence Tags which were further classified functionally. Functional classification revealed that maximum percentage of proteins belonged to hypothetical proteins followed by proteins involved in biosynthesis. Some of the identified ESTs were further quantified for their induced expression in M. arvensis in comparison to M. piperita through quantitative real-time PCR.

  19. AggLb Is the Largest Cell-Aggregation Factor from Lactobacillus paracasei Subsp. paracasei BGNJ1-64, Functions in Collagen Adhesion, and Pathogen Exclusion In Vitro

    PubMed Central

    Miljkovic, Marija; Strahinic, Ivana; Tolinacki, Maja; Zivkovic, Milica; Kojic, Snezana; Golic, Natasa; Kojic, Milan

    2015-01-01

    Eleven Lactobacillus strains with strong aggregation abilities were selected from a laboratory collection. In two of the strains, genes associated with aggregation capability were plasmid located and found to strongly correlate with collagen binding. The gene encoding the auto-aggregation-promoting protein (AggLb) of Lactobacillus paracasei subsp. paracasei BGNJ1-64 was cloned using a novel, wide-range-host shuttle cloning vector, pAZILSJ. The clone pALb35, containing a 11377-bp DNA fragment, was selected from the SacI plasmid library for its ability to provide carriers with the aggregation phenotype. The complete fragment was sequenced and four potential ORFs were detected, including the aggLb gene and three surrounding transposase genes. AggLb is the largest known cell-surface protein in lactobacilli, consisting of 2998 aa (318,611 Da). AggLb belongs to the collagen-binding superfamily and its C-terminal region contains 20 successive repeats that are identical even at the nucleotide level. Deletion of aggLb causes a loss of the capacity to form cell aggregates, whereas overexpression increases cellular aggregation, hydrophobicity and collagen-binding potential. PCR screening performed with three sets of primers based on the aggLb gene of BGNJ1-64 enabled detection of the same type of aggLb gene in five of eleven selected aggregation-positive Lactobacillus strains. Heterologous expression of aggLb confirmed the crucial role of the AggLb protein in cell aggregation and specific collagen binding, indicating that AggLb has a useful probiotic function in effective colonization of host tissue and prevention of pathogen colonization. PMID:25955159

  20. Determination of the genotoxic effects of Convolvulus arvensis extracts on corn (Zea mays L.) seeds.

    PubMed

    Sunar, Serap; Yildirim, Nalan; Aksakal, Ozkan; Agar, Guleray

    2013-06-01

    In this research, the methanolic extracts of Convolvulus arvensis were tested for genotoxic and inhibitor activity on the total soluble protein content and the genomic template stability against corn Zea mays L. seed. The methanol extracts of leaf, stem and root of C. arvensis were diluted to 50, 75 and 100 μl concentrations and applied to corn seed. The total soluble protein and genomic template stability results were compared with the control. The results showed that especially 100 μl extracts of diluted leaf, stem and root had a strong inhibitory activity on the genomic template stability. The changes occurred in random amplification of polymorphic DNA (RAPD) profiles of C. arvensis extract treatment included variation in band intensity, loss of bands and appearance of new bands compared with control. Also, the results obtained from this study revealed that the increase in the concentrations of C. arvensis extract increased the total soluble protein content in maize. The results suggested that RAPD analysis and total protein analysis could be applied as a suitable biomarker assay for the detection of genotoxic effects of plant allelochemicals.

  1. Fructolysis effect of 50% ethanolic extract of Mentha arvensis Linn. (leaves) in seminal vesicles of rat.

    PubMed

    Mathur, R

    1991-01-01

    50% ethanolic extract of Mentha arvensis Linn. (leaves) has been found to reduce the fructose synthesis in seminal vesicles; as a result of which the viability of spermatozoa seems to be altered. Fertility testing revealed sterile matings till 30 days of last treatment.

  2. Deep RNA-Seq to unlock the gene bank of floral development in Sinapis arvensis.

    PubMed

    Liu, Jia; Mei, Desheng; Li, Yunchang; Huang, Shunmou; Hu, Qiong

    2014-01-01

    Sinapis arvensis is a weed with strong biological activity. Despite being a problematic annual weed that contaminates agricultural crop yield, it is a valuable alien germplasm resource. It can be utilized for broadening the genetic background of Brassica crops with desirable agricultural traits like resistance to blackleg (Leptosphaeria maculans), stem rot (Sclerotinia sclerotium) and pod shatter (caused by FRUITFULL gene). However, few genetic studies of S. arvensis were reported because of the lack of genomic resources. In the present study, we performed de novo transcriptome sequencing to produce a comprehensive dataset for S. arvensis for the first time. We used Illumina paired-end sequencing technology to sequence the S. arvensis flower transcriptome and generated 40,981,443 reads that were assembled into 131,278 transcripts. We de novo assembled 96,562 high quality unigenes with an average length of 832 bp. A total of 33,662 full-length ORF complete sequences were identified, and 41,415 unigenes were mapped onto 128 pathways using the KEGG Pathway database. The annotated unigenes were compared against Brassica rapa, B. oleracea, B. napus and Arabidopsis thaliana. Among these unigenes, 76,324 were identified as putative homologs of annotated sequences in the public protein databases, of which 1194 were associated with plant hormone signal transduction and 113 were related to gibberellin homeostasis/signaling. Unigenes that did not match any of those sequence datasets were considered to be unique to S. arvensis. Furthermore, 21,321 simple sequence repeats were found. Our study will enhance the currently available resources for Brassicaceae and will provide a platform for future genomic studies for genetic improvement of Brassica crops.

  3. Effect of Sulfate on Selenium Uptake And Chemical Speciation in Convolvulus Arvensis L

    SciTech Connect

    Cruz-Jimenez, G.; Peralta-Video, J.R.; Rosa, G.de la; Meitzner, G.; Parson, J.G.; Gardea-Torresdey, J.L.

    2007-08-08

    Hydroponic experiments were performed to study several aspects of Se uptake by C. arvensis plants. Ten day old seedlings were exposed for eight days to different combinations of selenate (SeO{sub 4}{sup 2-}), sulfate (SO{sub 4}{sup 2-}), and selenite (SeO{sub 3}{sup 2-}). The results showed that in C. arvensis, SO{sub 4}{sup 2-} had a negative effect (P < 0.05) on SeO{sub 4}{sup 2-} uptake. However, a positive interaction produced a significant increase in SO{sub 4}{sup 2-} uptake when SeO{sub 4}{sup 2-} was at high concentration in the media. X-ray absorption spectroscopy studies showed that C. arvensis plants converted more than 70% of the supplied SeO{sub 3}{sup 2-} into organoselenium compounds. However, only approximately 50% of the supplied SeO{sub 4}{sup 2-} was converted into organoselenium species while the residual 50% remained in the inorganic form. Analysis using LC-XANES fittings confirmed that the S metabolic pathway was affected by the presence of Se. The main Se compounds that resembled those Se species identified in C. arvensis were Se-cystine, Se-cysteine, SeO{sub 3}{sup 2-}, and SeO{sub 4}{sup 2-}, whereas for S the main compounds were cysteine, cystine, oxidized glutathione, reduced glutathione, and SO{sub 4}{sup 2-}. The results of these studies indicated that C. arvensis could be considered as a possible option for the restoration of soil moderately contaminated with selenium even in the presence of sulfate.

  4. Deep RNA-Seq to Unlock the Gene Bank of Floral Development in Sinapis arvensis

    PubMed Central

    Liu, Jia; Mei, Desheng; Li, Yunchang; Huang, Shunmou; Hu, Qiong

    2014-01-01

    Sinapis arvensis is a weed with strong biological activity. Despite being a problematic annual weed that contaminates agricultural crop yield, it is a valuable alien germplasm resource. It can be utilized for broadening the genetic background of Brassica crops with desirable agricultural traits like resistance to blackleg (Leptosphaeria maculans), stem rot (Sclerotinia sclerotium) and pod shatter (caused by FRUITFULL gene). However, few genetic studies of S. arvensis were reported because of the lack of genomic resources. In the present study, we performed de novo transcriptome sequencing to produce a comprehensive dataset for S. arvensis for the first time. We used Illumina paired-end sequencing technology to sequence the S. arvensis flower transcriptome and generated 40,981,443 reads that were assembled into 131,278 transcripts. We de novo assembled 96,562 high quality unigenes with an average length of 832 bp. A total of 33,662 full-length ORF complete sequences were identified, and 41,415 unigenes were mapped onto 128 pathways using the KEGG Pathway database. The annotated unigenes were compared against Brassica rapa, B. oleracea, B. napus and Arabidopsis thaliana. Among these unigenes, 76,324 were identified as putative homologs of annotated sequences in the public protein databases, of which 1194 were associated with plant hormone signal transduction and 113 were related to gibberellin homeostasis/signaling. Unigenes that did not match any of those sequence datasets were considered to be unique to S. arvensis. Furthermore, 21,321 simple sequence repeats were found. Our study will enhance the currently available resources for Brassicaceae and will provide a platform for future genomic studies for genetic improvement of Brassica crops. PMID:25192023

  5. Deep RNA-Seq to unlock the gene bank of floral development in Sinapis arvensis.

    PubMed

    Liu, Jia; Mei, Desheng; Li, Yunchang; Huang, Shunmou; Hu, Qiong

    2014-01-01

    Sinapis arvensis is a weed with strong biological activity. Despite being a problematic annual weed that contaminates agricultural crop yield, it is a valuable alien germplasm resource. It can be utilized for broadening the genetic background of Brassica crops with desirable agricultural traits like resistance to blackleg (Leptosphaeria maculans), stem rot (Sclerotinia sclerotium) and pod shatter (caused by FRUITFULL gene). However, few genetic studies of S. arvensis were reported because of the lack of genomic resources. In the present study, we performed de novo transcriptome sequencing to produce a comprehensive dataset for S. arvensis for the first time. We used Illumina paired-end sequencing technology to sequence the S. arvensis flower transcriptome and generated 40,981,443 reads that were assembled into 131,278 transcripts. We de novo assembled 96,562 high quality unigenes with an average length of 832 bp. A total of 33,662 full-length ORF complete sequences were identified, and 41,415 unigenes were mapped onto 128 pathways using the KEGG Pathway database. The annotated unigenes were compared against Brassica rapa, B. oleracea, B. napus and Arabidopsis thaliana. Among these unigenes, 76,324 were identified as putative homologs of annotated sequences in the public protein databases, of which 1194 were associated with plant hormone signal transduction and 113 were related to gibberellin homeostasis/signaling. Unigenes that did not match any of those sequence datasets were considered to be unique to S. arvensis. Furthermore, 21,321 simple sequence repeats were found. Our study will enhance the currently available resources for Brassicaceae and will provide a platform for future genomic studies for genetic improvement of Brassica crops. PMID:25192023

  6. Expression of terrain and surface geology in high-resolution helicopter-borne gravity gradient (AGG) data: examples from Great Sand Dunes National Park, Rio Grande Rift, Colorado

    USGS Publications Warehouse

    Drenth, Benjamin J.

    2013-01-01

    Airborne gravity gradient (AGG) data are rapidly becoming standard components of geophysical mapping programs, due to their advantages in cost, access, and resolution advantages over measurements of the gravity field on the ground. Unlike conventional techniques that measure the gravity field, AGG methods measure derivatives of the gravity field. This means that effects of terrain and near-surface geology are amplified in AGG data, and that proper terrain corrections are critically important for AGG data processing. However, terrain corrections require reasonable estimates of density for the rocks and sediments that make up the terrain. A recommended philosophical approach is to use the terrain and surface geology, with their strong expression in AGG data, to the interpreter’s advantage. An example of such an approach is presented here for an area with very difficult ground access and little ground gravity data. Nettleton-style profiling is used with AGG data to estimate the densities of the sand dunefield and adjacent Precambrian rocks from the area of Great Sand Dunes National Park in southern Colorado. Processing of the AGG data using the density estimate for the dunefield allows buried structures, including a hypothesized buried basement bench, to be mapped beneath the sand dunes.

  7. AggNet: Deep Learning From Crowds for Mitosis Detection in Breast Cancer Histology Images.

    PubMed

    Albarqouni, Shadi; Baur, Christoph; Achilles, Felix; Belagiannis, Vasileios; Demirci, Stefanie; Navab, Nassir

    2016-05-01

    The lack of publicly available ground-truth data has been identified as the major challenge for transferring recent developments in deep learning to the biomedical imaging domain. Though crowdsourcing has enabled annotation of large scale databases for real world images, its application for biomedical purposes requires a deeper understanding and hence, more precise definition of the actual annotation task. The fact that expert tasks are being outsourced to non-expert users may lead to noisy annotations introducing disagreement between users. Despite being a valuable resource for learning annotation models from crowdsourcing, conventional machine-learning methods may have difficulties dealing with noisy annotations during training. In this manuscript, we present a new concept for learning from crowds that handle data aggregation directly as part of the learning process of the convolutional neural network (CNN) via additional crowdsourcing layer (AggNet). Besides, we present an experimental study on learning from crowds designed to answer the following questions. 1) Can deep CNN be trained with data collected from crowdsourcing? 2) How to adapt the CNN to train on multiple types of annotation datasets (ground truth and crowd-based)? 3) How does the choice of annotation and aggregation affect the accuracy? Our experimental setup involved Annot8, a self-implemented web-platform based on Crowdflower API realizing image annotation tasks for a publicly available biomedical image database. Our results give valuable insights into the functionality of deep CNN learning from crowd annotations and prove the necessity of data aggregation integration.

  8. AggNet: Deep Learning From Crowds for Mitosis Detection in Breast Cancer Histology Images.

    PubMed

    Albarqouni, Shadi; Baur, Christoph; Achilles, Felix; Belagiannis, Vasileios; Demirci, Stefanie; Navab, Nassir

    2016-05-01

    The lack of publicly available ground-truth data has been identified as the major challenge for transferring recent developments in deep learning to the biomedical imaging domain. Though crowdsourcing has enabled annotation of large scale databases for real world images, its application for biomedical purposes requires a deeper understanding and hence, more precise definition of the actual annotation task. The fact that expert tasks are being outsourced to non-expert users may lead to noisy annotations introducing disagreement between users. Despite being a valuable resource for learning annotation models from crowdsourcing, conventional machine-learning methods may have difficulties dealing with noisy annotations during training. In this manuscript, we present a new concept for learning from crowds that handle data aggregation directly as part of the learning process of the convolutional neural network (CNN) via additional crowdsourcing layer (AggNet). Besides, we present an experimental study on learning from crowds designed to answer the following questions. 1) Can deep CNN be trained with data collected from crowdsourcing? 2) How to adapt the CNN to train on multiple types of annotation datasets (ground truth and crowd-based)? 3) How does the choice of annotation and aggregation affect the accuracy? Our experimental setup involved Annot8, a self-implemented web-platform based on Crowdflower API realizing image annotation tasks for a publicly available biomedical image database. Our results give valuable insights into the functionality of deep CNN learning from crowd annotations and prove the necessity of data aggregation integration. PMID:26891484

  9. [Phenotypic and phytochemical differences between Mentha arvensis L. and Mentha canadiensis L].

    PubMed

    Shelepova, O V; Voronkova, T V; Kondrat'eva, V V; Semenova, M V; Bidiukova, G F; Olekhnovich, L S

    2014-01-01

    A taxonomic study of anatomical, morphological, and phytochemical characteristics of Mentha arvensis L. and Mentha canadiensis L. using hierarchical cluster analysis has been conducted and the differences between the species studied have been revealed. The ratio between the lengths of the calyx tube and the calyx lobes, the number of secretory glands on the upper and lower surfaces of the leaf, and the composition of the essen- tial oil were shown to be the most appropriate parameters for classification.

  10. Quantitative Proteomics Analysis of Camelina sativa Seeds Overexpressing the AGG3 Gene to Identify the Proteomic Basis of Increased Yield and Stress Tolerance.

    PubMed

    Alvarez, Sophie; Roy Choudhury, Swarup; Sivagnanam, Kumaran; Hicks, Leslie M; Pandey, Sona

    2015-06-01

    Camelina sativa, a close relative of Arabidopsis, is an oilseed plant that is emerging as an important biofuel resource. The genome and transcriptome maps of Camelina have become available recently, but its proteome composition remained unexplored. A labeling LC-based quantitative proteomics approach was applied to decipher the Camelina seed proteome, which led to the identification of 1532 proteins. In addition, the effect of overexpression of the Arabidopsis G-protein γ subunit 3 (AGG3) on the Camelina seed proteome was elucidated to identify the proteomic basis of its increased seed size and improved stress tolerance. The comparative analysis showed a significantly higher expression of proteins involved in primary and secondary metabolism, nucleic acid and protein metabolism, and abscisic acid related responses, corroborating the physiological effects of AGG3 overexpression. More importantly, the proteomic data suggested involvement of the AGG3 protein in the regulation of oxidative stress and heavy metal stress tolerance. These observations were confirmed by the physiological and biochemical characterization of AGG3-overexpressing seeds, which exhibit a higher tolerance to exogenous cadmium in a glutathione-dependent manner. The activity of multiple redox-regulating enzymes is higher in seeds expressing enhanced levels of AGG3. Overall, these data provide critical evidence for the role of redox regulation by the AGG3 protein in mediating important seed-related traits.

  11. The STAT3 HIES mutation is a gain-of-function mutation that activates genes via AGG-element carrying promoters

    PubMed Central

    Xu, Li; Ji, Jin-Jun; Le, Wangping; Xu, Yan S.; Dou, Dandan; Pan, Jieli; Jiao, Yifeng; Zhong, Tianfei; Wu, Dehong; Wang, Yumei; Wen, Chengping; Xie, Guan-Qun; Yao, Feng; Zhao, Heng; Fan, Yong-Sheng; Chin, Y. Eugene

    2015-01-01

    Cytokine or growth factor activated STAT3 undergoes multiple post-translational modifications, dimerization and translocation into nuclei, where it binds to serum-inducible element (SIE, ‘TTC(N3)GAA’)-bearing promoters to activate transcription. The STAT3 DNA binding domain (DBD, 320–494) mutation in hyper immunoglobulin E syndrome (HIES), called the HIES mutation (R382Q, R382W or V463Δ), which elevates IgE synthesis, inhibits SIE binding activity and sensitizes genes such as TNF-α for expression. However, the mechanism by which the HIES mutation sensitizes STAT3 in gene induction remains elusive. Here, we report that STAT3 binds directly to the AGG-element with the consensus sequence ‘AGG(N3)AGG’. Surprisingly, the helical N-terminal region (1–355), rather than the canonical STAT3 DBD, is responsible for AGG-element binding. The HIES mutation markedly enhances STAT3 AGG-element binding and AGG-promoter activation activity. Thus, STAT3 is a dual specificity transcription factor that promotes gene expression not only via SIE- but also AGG-promoter activity. PMID:26384563

  12. Antimicrobial, antitumor and brine shrimp lethality assay of Ranunculus arvensis L. extracts.

    PubMed

    Bhatti, Muhammad Zeeshan; Ali, Amjad; Saeed, Asma; Saeed, Ahmad; Malik, Salman Akbar

    2015-05-01

    To investigate the antitumor activity, brine shrimp lethality assay, antibacterial and antifungal activity of Methanol Extract (ME), Water Extract (WE), Acetone Extract (AE), Chloroform Extract (CE), Methanol-Water Extract (MWE), Methanol-Acetone Extract (MAE), Methanol-Chloroform Extract (MCE) of Ranunculus arvensis (L.). Antitumor activity was evaluated with Agrobacterium tumefaciens (At10) induced potato disc assay. Cytotoxicity was evaluated with brine shrimp lethality assay. Antibacterial activity was evaluated with six bacterial strains including Escherichia coli, Enterobacter aerogenes, Bordetella bronchiseptica, Klebsiella pneumoniae, Micrococcus luteus and Streptococcus anginosus and antifungal screening was done against five fungal strains including Aspergillus niger, A. flavus, A. fumigates, Fusarium solani and Mucor species by using disc diffusion method. Best antitumor activity was obtained with ME and WE, having highest IC50 values 20.27 ± 1.62 and 93.01 ± 1.33μg/disc. Brine shrimp lethality assay showed LC50 values of AE, MAE and ME were obtained as 384.66 ± 9.42μg/ml, 724.11 ± 8.01μg/ml and 978.7 ±8.01 μg/ml respectively. WE of R. arvensis revealed weak antimicrobial result against the tested microorganisms. On the other hand, the antifungal activity of the plant extracts was found to be insignificant. These findings demonstrate that extracts of R. arvensis possesses significant antitumor activity. Further extensive study is necessary to assess the therapeutic potential of the plant. PMID:26004705

  13. Conspecific flowers of Sinapis arvensis are stronger competitors for pollinators than those of the invasive weed Bunias orientalis.

    PubMed

    Hochkirch, Axel; Mertes, Tamara; Rautenberg, Julia

    2012-03-01

    Biological invasions can affect the structure and function of ecosystems and threaten native plant species. Since most weeds rely on mutualistic relationships in their new environment, they may act as new competitors for pollinators. Pollinator competition is likely to be density dependent, but it is often difficult to disentangle competition caused by flower quality from effects caused by flower quantity. In order to test the effects of the presence and number of flowers of the invasive weed Bunias orientalis on the insect visitation rates in a native species (Sinapis arvensis), we performed two replacement experiments using plants with standardised flower numbers. The visitation rates in S. arvensis were significantly higher than in B. orientalis and the number of insect visits dropped significantly with increasing density of S. arvensis flowers. These results suggest that intraspecific competition among flowers of S. arvensis is stronger than the competitive effect of alien flowers. As flowers of B. orientalis do not seem to distract visitors from S. arvensis, it is unlikely that pollinator competition between these two plant species plays a crucial role. However, it cannot be excluded that mass blossom stands of B. orientalis may distract flower visitors from nativespecies.

  14. Conspecific flowers of Sinapis arvensis are stronger competitors for pollinators than those of the invasive weed Bunias orientalis

    NASA Astrophysics Data System (ADS)

    Hochkirch, Axel; Mertes, Tamara; Rautenberg, Julia

    2012-03-01

    Biological invasions can affect the structure and function of ecosystems and threaten native plant species. Since most weeds rely on mutualistic relationships in their new environment, they may act as new competitors for pollinators. Pollinator competition is likely to be density dependent, but it is often difficult to disentangle competition caused by flower quality from effects caused by flower quantity. In order to test the effects of the presence and number of flowers of the invasive weed Bunias orientalis on the insect visitation rates in a native species ( Sinapis arvensis), we performed two replacement experiments using plants with standardised flower numbers. The visitation rates in S. arvensis were significantly higher than in B. orientalis and the number of insect visits dropped significantly with increasing density of S. arvensis flowers. These results suggest that intraspecific competition among flowers of S. arvensis is stronger than the competitive effect of alien flowers. As flowers of B. orientalis do not seem to distract visitors from S. arvensis, it is unlikely that pollinator competition between these two plant species plays a crucial role. However, it cannot be excluded that mass blossom stands of B. orientalis may distract flower visitors from native species.

  15. Root growth responses of Anagallis arvensis L., primulaceae to air pollution.

    PubMed

    Khan, F A; Ghouse, A K

    1988-01-01

    The root growth response to air pollution in populations of Anagallis arvensis growing about 0.5, 2, 6, 12 and 20 km leeward from a power plant complex varied with the level of pollution, age of the stand and meteorological conditions. The roots were more affected by the pollutants at a young stage and the loss in net primary productivity was proportional to the pollution level. The populations up to 2 km from the source of pollution completed their life cycle quickly. The coal consumption rate at the power plant, relative humidity, wind direction and other environmental factors were found to influence the degree of growth response to air pollution.

  16. Nesting biology, morphological remarks, and description of the mature larva of Mellinus arvensis obscurus (Hymenoptera: Crabronidae) in Nepal

    SciTech Connect

    Boesi, R.; Polidori, C.; Andrietti, F.; Gayubo, S.F.; Tormos, J.; Asis, J.D.

    2007-03-15

    Recently re-named as a sub-species of Mellinus arvensis, Mellinus arvensis obscurus Handlirsch 1888 was investigated ecologically and morphologically in Nepal, in order to underline the most important differences with the well known M. arvensis arvensis. Mellinus arvensis obscurus females nested in clumped aggregations on inclined plains at high altitudes, both on sunny bare soil and on a shaded grassy one. Beginning of monsoon season probably interfered with wasp activity, and females performed few provisioning flights during the day. Prey consisted of a broad range of Diptera, except for one case of a spider. Many females were observed not provisioning a nest but floating on the nesting site, and many intraspecific interactions suggested a high degree of usurpation attempts. At least one species of flies and two of ants probably acted as natural enemies of the wasp. Morphological observations on females showed that the Nepal population shares more similarities (shape of tergite I, body punctation) with the European populations than with the closer Japanese population; melanization is strong, according to west-east and altitudinal cline. The mature larva of M. arvensis obscurus Handlirsch is described, illustrated, and compared with the other mature larva of the genus. The differences between both larvae mainly lie in the presence/absence, and number or differentiation of integumental structures. We conclude that morphological traits are more important than ecological and behavioral ones in distinguishing M. arvensis obscurus from M. arvensis arvensis. (author) [Spanish] En el presente articulo se aportan los resultados y conclusiones de un estudio, llevado a cabo en Nepal, en el que se abordaron aspectos ecologicos, comportamentales y morfologicos (tanto del ultimo estado de la fase larvaria como del adulto) de Mellinus arvensis obscurus Handlirsch 1888. El principal objetivo del estudio radicaba en mostrar las principales diferencias que separan a esta

  17. Shortening of the Lactobacillus paracasei subsp. paracasei BGNJ1-64 AggLb Protein Switches Its Activity from Auto-aggregation to Biofilm Formation.

    PubMed

    Miljkovic, Marija; Bertani, Iris; Fira, Djordje; Jovcic, Branko; Novovic, Katarina; Venturi, Vittorio; Kojic, Milan

    2016-01-01

    AggLb is the largest (318.6 kDa) aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains) and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody), an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III, and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation. PMID:27660628

  18. Shortening of the Lactobacillus paracasei subsp. paracasei BGNJ1-64 AggLb Protein Switches Its Activity from Auto-aggregation to Biofilm Formation

    PubMed Central

    Miljkovic, Marija; Bertani, Iris; Fira, Djordje; Jovcic, Branko; Novovic, Katarina; Venturi, Vittorio; Kojic, Milan

    2016-01-01

    AggLb is the largest (318.6 kDa) aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains) and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody), an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III, and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation. PMID:27660628

  19. Shortening of the Lactobacillus paracasei subsp. paracasei BGNJ1-64 AggLb Protein Switches Its Activity from Auto-aggregation to Biofilm Formation

    PubMed Central

    Miljkovic, Marija; Bertani, Iris; Fira, Djordje; Jovcic, Branko; Novovic, Katarina; Venturi, Vittorio; Kojic, Milan

    2016-01-01

    AggLb is the largest (318.6 kDa) aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains) and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody), an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III, and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation.

  20. Distribution of Pathogenic Genes aatA, aap, aggR, among Uropathogenic Escherichia coli (UPEC) and Their Linkage with StbA Gene.

    PubMed

    Nazemi, A; Mirinargasi, M; Merikhi, N; Sharifi, S H

    2011-07-01

    Urinary tract infection (UTI) with E. coli (UPEC) is one of the most common bacterial infections among human beings. In addition to the host predisposing factors, genes are also proposed to have an important role in the occurrence of UTIs. This study investigated the distribution of three pathogenic genes including aggR, aap and aatA among UPEC infected samples and their linkage with stbA, the essential gene for maintaining of pAA plasmid. A total of 244 samples were collected from patients with UTIs through clinical laboratories located in western side of Tehran (Iran) during years 2008-2009. E. coli isolation was performed according to standard laboratory methods. DNAs were extracted from samples using Boiling method, and the presence of aap, aggR, aatA and stbA genes were investigated by PCR. No pathogenic genes (aap, aggR, aatA) were found in 104 out of 244 UPEC samples, while 14 of them were carrying stbA gene. Out of 140 UPEC samples with pathogenic genes, 94 (46.6%) were carrying aap gene, 52 (23%) aggR gene, and 80 (35.4%) aatA gene. A total of 18 samples were also carrying all pathogenic genes together. Moreover, 44 out of 144 samples were carrying stbA gene. The results obtained by this study showed that the aggR, aap and aatA pathogenic genes have different existence patterns in different E. coli strains that infect different organs. Our study also showed that these three plasmid genes in EAEC strains are able to transpose in the genome and change their level of linkage with pAA plasmid essential gene stbA. Meanwhile, this study confirmed that aggR, aap and aatA genes are not specific to only EAEC strains.

  1. Corn mint (Mentha arvensis) extract diminishes acute Chlamydia pneumoniae infection in vitro and in vivo.

    PubMed

    Salin, Olli; Törmäkangas, Liisa; Leinonen, Maija; Saario, Elise; Hagström, Marja; Ketola, Raimo A; Saikku, Pekka; Vuorela, Heikki; Vuorela, Pia M

    2011-12-28

    Corn mint ( Mentha arvensis ) provides a good source of natural phenols such as flavone glycosides and caffeic acid derivatives, which may have prophylactic properties against inflammations. This study investigated whether corn mint extract would be beneficial against a universal respiratory tract pathogen, Chlamydia pneumoniae , infection. The extract inhibited the growth of C. pneumoniae CWL-029 in vitro in a dose-dependent manner. The inhibition was confirmed against a clinical isolate K7. The phenolic composition of the extract was analyzed by UPLC-ESI/Q-TOF/MS, the main components being linarin and rosmarinic acid. These compounds were active in vitro against C. pneumoniae. Linarin completely inhibited the growth at 100 μM. Inbred C57BL/6J mice were inoculated with C. pneumoniae K7. M. arvensis extract was given intraperitoneally once daily for 3 days prior to inoculation and continued for 10 days postinfection. The extract was able to diminish the inflammatory parameters related to C. pneumoniae infection and significantly (p = 0.019) lowered the number of C. pneumoniae genome equivalents detected by PCR at biologically relevant amounts.

  2. Transfer of Dicamba Tolerance from Sinapis arvensis to Brassica napus via Embryo Rescue and Recurrent Backcross Breeding

    PubMed Central

    Jugulam, M.; Ziauddin, Asma; So, Kenny K. Y.; Chen, Shu; Hall, J. Christopher

    2015-01-01

    Auxinic herbicides (e.g. dicamba) are extensively used in agriculture to selectively control broadleaf weeds. Although cultivated species of Brassicaceae (e.g. Canola) are susceptible to auxinic herbicides, some biotypes of Sinapis arvensis (wild mustard) were found dicamba resistant in Canada. In this research, dicamba tolerance from wild mustard was introgressed into canola through embryo rescue followed by conventional breeding. Intergeneric hybrids between S. arvensis (2n = 18) and B. napus (2n = 38) were produced through embryo rescue. Embryo formation and hybrid plant regeneration was achieved. Transfer of dicamba tolerance from S. arvensis into the hybrid plants was determined by molecular analysis and at the whole plant level. Dicamba tolerance was introgressed into B. napus by backcrossing for seven generations. Homozygous dicamba-tolerant B. napus lines were identified. The ploidy of the hybrid progeny was assessed by flow cytometry. Finally, introgression of the piece of DNA possibly containing the dicamba tolerance gene into B. napus was confirmed using florescence in situ hybridization (FISH). This research demonstrates for the first time stable introgression of dicamba tolerance from S. arvensis into B. napus via in vitro embryo rescue followed by repeated backcross breeding. Creation of dicamba-tolerant B. napus varieties by this approach may have potential to provide options to growers to choose a desirable herbicide-tolerant technology. Furthermore, adoption of such technology facilitates effective weed control, less tillage, and possibly minimize evolution of herbicide resistant weeds. PMID:26536372

  3. Transfer of Dicamba Tolerance from Sinapis arvensis to Brassica napus via Embryo Rescue and Recurrent Backcross Breeding.

    PubMed

    Jugulam, M; Ziauddin, Asma; So, Kenny K Y; Chen, Shu; Hall, J Christopher

    2015-01-01

    Auxinic herbicides (e.g. dicamba) are extensively used in agriculture to selectively control broadleaf weeds. Although cultivated species of Brassicaceae (e.g. Canola) are susceptible to auxinic herbicides, some biotypes of Sinapis arvensis (wild mustard) were found dicamba resistant in Canada. In this research, dicamba tolerance from wild mustard was introgressed into canola through embryo rescue followed by conventional breeding. Intergeneric hybrids between S. arvensis (2n = 18) and B. napus (2n = 38) were produced through embryo rescue. Embryo formation and hybrid plant regeneration was achieved. Transfer of dicamba tolerance from S. arvensis into the hybrid plants was determined by molecular analysis and at the whole plant level. Dicamba tolerance was introgressed into B. napus by backcrossing for seven generations. Homozygous dicamba-tolerant B. napus lines were identified. The ploidy of the hybrid progeny was assessed by flow cytometry. Finally, introgression of the piece of DNA possibly containing the dicamba tolerance gene into B. napus was confirmed using florescence in situ hybridization (FISH). This research demonstrates for the first time stable introgression of dicamba tolerance from S. arvensis into B. napus via in vitro embryo rescue followed by repeated backcross breeding. Creation of dicamba-tolerant B. napus varieties by this approach may have potential to provide options to growers to choose a desirable herbicide-tolerant technology. Furthermore, adoption of such technology facilitates effective weed control, less tillage, and possibly minimize evolution of herbicide resistant weeds.

  4. Transfer of Dicamba Tolerance from Sinapis arvensis to Brassica napus via Embryo Rescue and Recurrent Backcross Breeding.

    PubMed

    Jugulam, M; Ziauddin, Asma; So, Kenny K Y; Chen, Shu; Hall, J Christopher

    2015-01-01

    Auxinic herbicides (e.g. dicamba) are extensively used in agriculture to selectively control broadleaf weeds. Although cultivated species of Brassicaceae (e.g. Canola) are susceptible to auxinic herbicides, some biotypes of Sinapis arvensis (wild mustard) were found dicamba resistant in Canada. In this research, dicamba tolerance from wild mustard was introgressed into canola through embryo rescue followed by conventional breeding. Intergeneric hybrids between S. arvensis (2n = 18) and B. napus (2n = 38) were produced through embryo rescue. Embryo formation and hybrid plant regeneration was achieved. Transfer of dicamba tolerance from S. arvensis into the hybrid plants was determined by molecular analysis and at the whole plant level. Dicamba tolerance was introgressed into B. napus by backcrossing for seven generations. Homozygous dicamba-tolerant B. napus lines were identified. The ploidy of the hybrid progeny was assessed by flow cytometry. Finally, introgression of the piece of DNA possibly containing the dicamba tolerance gene into B. napus was confirmed using florescence in situ hybridization (FISH). This research demonstrates for the first time stable introgression of dicamba tolerance from S. arvensis into B. napus via in vitro embryo rescue followed by repeated backcross breeding. Creation of dicamba-tolerant B. napus varieties by this approach may have potential to provide options to growers to choose a desirable herbicide-tolerant technology. Furthermore, adoption of such technology facilitates effective weed control, less tillage, and possibly minimize evolution of herbicide resistant weeds. PMID:26536372

  5. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (sinapis arvensis)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of the Aegean and Marmara regions of Turkey, were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS...

  6. Unique AGG Interruption in the CGG Repeats of the FMR1 Gene Exclusively Found in Asians Linked to a Specific SNP Haplotype

    PubMed Central

    Limprasert, Pornprot; Thanakitgosate, Janpen; Jaruthamsophon, Kanoot; Sripo, Thanya

    2016-01-01

    Fragile X syndrome (FXS) is the most common inherited intellectual disability. It is caused by the occurrence of more than 200 pure CGG repeats in the FMR1 gene. Normal individuals have 6–54 CGG repeats with two or more stabilizing AGG interruptions occurring once every 9- or 10-CGG-repeat blocks in various populations. However, the unique (CGG)6AGG pattern, designated as 6A, has been exclusively reported in Asians. To examine the genetic background of AGG interruptions in the CGG repeats of the FMR1 gene, we studied 8 SNPs near the CGG repeats in 176 unrelated Thai males with 19–56 CGG repeats. Of these 176 samples, we identified AGG interruption patterns from 95 samples using direct DNA sequencing. We found that the common CGG repeat groups (29, 30, and 36) were associated with 3 common haplotypes, GCGGATAA (Hap A), TTCATCGC (Hap C), and GCCGTTAA (Hap B), respectively. The configurations of 9A9A9, 10A9A9, and 9A9A6A9 were commonly found in chromosomes with 29, 30, and 36 CGG repeats, respectively. Almost all chromosomes with Hap B (22/23) carried at least one 6A pattern, suggesting that the 6A pattern is linked to Hap B and may have originally occurred in the ancestors of Asian populations. PMID:27042357

  7. Does Cold Plasma Affect Breaking Dormancy and Seed Germination? A Study on Seeds of Lamb's Quarters (Chenopodium album agg.)

    NASA Astrophysics Data System (ADS)

    Božena, Šerá; Michal, Šerý; Vitězslav, Štrañák; Petr, Špatenka; Milan, tichý

    2009-12-01

    Low-pressure discharge is applied for stimulation of germination of two seed lots of Lamb's Quarters (Chenopodium album agg.) with different starting germinations (17%, 8%) and in different stages of dormancy. Different exposition durations with cold plasma treatment were applied. The variable of the ratio cumulative germination was calculated. The Richards' equation was used for curve-fitting and simulation of the growth curves. Population parameters, namely Vi - viability, Me - time, Qu - dispersion, and Sk - skewness, counted from the curves described the germination rate well. Significant differences among Qu confirmed the erratic dormancy and gradual germination of Lamb's Quarters. No difference in the Me parameter was found between two tested seed lots, and no interspecies characteristics were changed using low-pressure discharge. The results suggested that plasma treatment changed seed germination in Lamb's Quarters seeds.

  8. Ozone exposure of a weed community produces adaptive changes in seed populations of Spergula arvensis.

    PubMed

    Landesmann, Jennifer B; Gundel, Pedro E; Martínez-Ghersa, M Alejandra; Ghersa, Claudio M

    2013-01-01

    Tropospheric ozone is one of the major drivers of global change. This stress factor alters plant growth and development. Ozone could act as a selection pressure on species communities composition, but also on population genetic background, thus affecting life history traits. Our objective was to evaluate the consequences of prolonged ozone exposure of a weed community on phenotypic traits of Spergulaarvensis linked to persistence. Specifically, we predicted that the selection pressure exerted by high ozone concentrations as well as the concomitant changes in the weed community would drive population adaptive changes which will be reflected on seed germination, dormancy and longevity. In order to test seed viability and dormancy level, we conducted germination experiments for which we used seeds produced by S. arvensis plants grown within a weed community exposed to three ozone treatments during four years (0, 90 and 120 ppb). We also performed a soil seed bank experiment to test seed longevity with seeds coming from both the four-year ozone exposure experiment and from a short-term treatment conducted at ambient and added ozone concentrations. We found that prolonged ozone exposure produced changes in seed germination, dormancy and longevity, resulting in three S. arvensis populations. Seeds from the 90 ppb ozone selection treatment had the highest level of germination when stored at 75% RH and 25 °C and then scarified. These seeds showed the lowest dormancy level when being subjected to 5 ºC/5% RH and 25 ºC/75% followed by 5% RH storage conditions. Furthermore, ozone exposure increased seed persistence in the soil through a maternal effect. Given that tropospheric ozone is an important pollutant in rural areas, changes in seed traits due to ozone exposure could increase weed persistence in fields, thus affecting weed-crop interactions, which could ultimately reduce crop production.

  9. Ozone Exposure of a Weed Community Produces Adaptive Changes in Seed Populations of Spergula arvensis

    PubMed Central

    Landesmann, Jennifer B.; Gundel, Pedro E.; Martínez-Ghersa, M. Alejandra; Ghersa, Claudio M.

    2013-01-01

    Tropospheric ozone is one of the major drivers of global change. This stress factor alters plant growth and development. Ozone could act as a selection pressure on species communities composition, but also on population genetic background, thus affecting life history traits. Our objective was to evaluate the consequences of prolonged ozone exposure of a weed community on phenotypic traits of Spergulaarvensis linked to persistence. Specifically, we predicted that the selection pressure exerted by high ozone concentrations as well as the concomitant changes in the weed community would drive population adaptive changes which will be reflected on seed germination, dormancy and longevity. In order to test seed viability and dormancy level, we conducted germination experiments for which we used seeds produced by S. arvensis plants grown within a weed community exposed to three ozone treatments during four years (0, 90 and 120 ppb). We also performed a soil seed bank experiment to test seed longevity with seeds coming from both the four-year ozone exposure experiment and from a short-term treatment conducted at ambient and added ozone concentrations. We found that prolonged ozone exposure produced changes in seed germination, dormancy and longevity, resulting in three S. arvensis populations. Seeds from the 90 ppb ozone selection treatment had the highest level of germination when stored at 75% RH and 25 °C and then scarified. These seeds showed the lowest dormancy level when being subjected to 5 ºC/5% RH and 25 ºC/75% followed by 5% RH storage conditions. Furthermore, ozone exposure increased seed persistence in the soil through a maternal effect. Given that tropospheric ozone is an important pollutant in rural areas, changes in seed traits due to ozone exposure could increase weed persistence in fields, thus affecting weed-crop interactions, which could ultimately reduce crop production. PMID:24086640

  10. Pyrazinecarboxamides as potential elicitors of flavonolignan and flavonoid production in Silybum marianum and Ononis arvensis cultures in vitro.

    PubMed

    Tumova, Lenka; Tuma, Jiri; Dolezal, Martin

    2011-11-01

    The effect of new synthetic pyrazinecarboxamide derivatives as potential elicitors of flavonolignan and flavonoid production in Silybum marianum and Ononis arvensis cultures in vitro was investigated. Both tested elicitors increased the production of flavonolignans in S. marianum callus and suspension cultures and flavonoids in O. arvensis callus and suspension cultures. Compound I, 5-(2-hydroxybenzoyl)-pyrazine-2-carboxamide, has shown to be an effective elicitor of flavonolignans and taxifoline production in Silybum marianum culture in vitro. The maximum content of silydianin (0.11%) in S. marianum suspension culture was induced by 24 h elicitor application in concentration of 1.159 × 10⁻³ mol/L. The maximum content of silymarin complex (0.08%) in callus culture of S. marianum was induced by 168 h elicitor application of a concentration 1.159 × 10⁻⁴ mol/L, which represents contents of silydianin (0.03%), silychristin (0.01%) and isosilybin A (0.04%) compared with control. All three tested concentrations of compound II, N-(2-bromo-3-methylphenyl)-5-tert-butylpyrazin-2-carboxamide increased the flavonoid production in callus culture of O. arvensis in a statistically significant way. The best elicitation effect of all elicitor concentrations had the weakest c₃ concentration (8.36 × 10⁻⁶ mol/L) after 168 h time of duration. The maximum content of flavonoids (about 5,900%) in suspension culture of O. arvensis was induced by 48 h application of c₃ concentration (8.36 × 10⁻⁶ mol/L).

  11. Identification, quantification, spatiotemporal distribution and genetic variation of major latex secondary metabolites in the common dandelion (Taraxacum officinale agg.).

    PubMed

    Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias

    2015-07-01

    The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active. PMID:25682510

  12. Identification, quantification, spatiotemporal distribution and genetic variation of major latex secondary metabolites in the common dandelion (Taraxacum officinale agg.).

    PubMed

    Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias

    2015-07-01

    The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active.

  13. Layered Seed-Growth of AgGe Football-like Microspheres via Precursor-Free Picosecond Laser Synthesis in Water

    PubMed Central

    Zhang, Dongshi; Gökce, Bilal; Notthoff, Christian; Barcikowski, Stephan

    2015-01-01

    Hybrid particles are of great significance in terms of their adjustable optical, electronic, magnetic, thermal and mechanical properties. As a novel technique, laser ablation in liquids (LAL) is famous for its precursor-free, “clean” synthesis of hybrid particles with various materials. Till now, almost all the LAL-generated particles originate from the nucleation-growth mechanism. Seed-growth of particles similar to chemical methods seems difficult to be achieved by LAL. Here, we not only present novel patch-joint football-like AgGe microspheres with a diameter in the range of 1 ~ 7 μm achievable by laser ablation in distilled water but also find direct evidences of their layered seed growth mechanism. Many critical factors contribute to the formation of AgGe microspheres: fast laser-generated plasma process provide an excellent condition for generating large amount of Ge and Ag ions/atoms, their initial nucleation and galvanic replacement reaction, while cavitation bubble confinement plays an important role for the increase of AgGe nuclei and subsequent layered growth in water after bubble collapse. Driven by work function difference, Ge acts as nucleation agent for silver during alloy formation. This new seed-growth mechanism for LAL technique opens new opportunities to develop a large variety of novel hybrid materials with controllable properties. PMID:26334136

  14. Layered Seed-Growth of AgGe Football-like Microspheres via Precursor-Free Picosecond Laser Synthesis in Water

    NASA Astrophysics Data System (ADS)

    Zhang, Dongshi; Gökce, Bilal; Notthoff, Christian; Barcikowski, Stephan

    2015-09-01

    Hybrid particles are of great significance in terms of their adjustable optical, electronic, magnetic, thermal and mechanical properties. As a novel technique, laser ablation in liquids (LAL) is famous for its precursor-free, “clean” synthesis of hybrid particles with various materials. Till now, almost all the LAL-generated particles originate from the nucleation-growth mechanism. Seed-growth of particles similar to chemical methods seems difficult to be achieved by LAL. Here, we not only present novel patch-joint football-like AgGe microspheres with a diameter in the range of 1 ~ 7 μm achievable by laser ablation in distilled water but also find direct evidences of their layered seed growth mechanism. Many critical factors contribute to the formation of AgGe microspheres: fast laser-generated plasma process provide an excellent condition for generating large amount of Ge and Ag ions/atoms, their initial nucleation and galvanic replacement reaction, while cavitation bubble confinement plays an important role for the increase of AgGe nuclei and subsequent layered growth in water after bubble collapse. Driven by work function difference, Ge acts as nucleation agent for silver during alloy formation. This new seed-growth mechanism for LAL technique opens new opportunities to develop a large variety of novel hybrid materials with controllable properties.

  15. The effect of dielectric constants on noble metal/semiconductor SERS enhancement: FDTD simulation and experiment validation of Ag/Ge and Ag/Si substrates.

    PubMed

    Wang, Tao; Zhang, Zhaoshun; Liao, Fan; Cai, Qian; Li, Yanqing; Lee, Shuit-Tong; Shao, Mingwang

    2014-02-11

    The finite-difference time-domain (FDTD) method was employed to simulate the electric field distribution for noble metal (Au or Ag)/semiconductor (Ge or Si) substrates. The simulation showed that noble metal/Ge had stronger SERS enhancement than noble metal/Si, which was mainly attributed to the different dielectric constants of semiconductors. In order to verify the simulation, Ag nanoparticles with the diameter of ca. 40 nm were grown on Ge or Si wafer (Ag/Ge or Ag/Si) and employed as surface-enhanced Raman scattering substrates to detect analytes in solution. The experiment demonstrated that both the two substrates exhibited excellent performance in the low concentration detection of Rhodamine 6G. Besides, the enhancement factor (1.3 × 10(9)) and relative standard deviation values (less than 11%) of Ag/Ge substrate were both better than those of Ag/Si (2.9 × 10(7) and less than 15%, respectively), which was consistent with the FDTD simulation. Moreover, Ag nanoparticles were grown in-situ on Ge substrate, which kept the nanoparticles from aggregation in the detection. To data, Ag/Ge substrates showed the best performance for their sensitivity and uniformity among the noble metal/semiconductor ones.

  16. Constitutive or seed-specific overexpression of Arabidopsis G-protein γ subunit 3 (AGG3) results in increased seed and oil production and improved stress tolerance in Camelina sativa.

    PubMed

    Roy Choudhury, Swarup; Riesselman, Adam J; Pandey, Sona

    2014-01-01

    Heterotrimeric G-proteins consisting of Gα, Gβ and Gγ subunits play an integral role in mediating multiple signalling pathways in plants. A novel, recently identified plant-specific Gγ protein, AGG3, has been proposed to be an important regulator of organ size and mediator of stress responses in Arabidopsis, whereas its potential homologs in rice are major quantitative trait loci for seed size and panicle branching. To evaluate the role of AGG3 towards seed and oil yield improvement, the gene was overexpressed in Camelina sativa, an oilseed crop of the Brassicaceae family. Analysis of multiple homozygous T4 transgenic Camelina lines showed that constitutive overexpression of AGG3 resulted in faster vegetative as well as reproductive growth accompanied by an increase in photosynthetic efficiency. Moreover, when expressed constitutively or specifically in seed tissue, AGG3 was found to increase seed size, seed mass and seed number per plant by 15%-40%, effectively resulting in significantly higher oil yield per plant. AGG3 overexpressing Camelina plants also exhibited improved stress tolerance. These observations draw a strong link between the roles of AGG3 in regulating two critical yield parameters, seed traits and plant stress responses, and reveal an effective biotechnological tool to dramatically increase yield in agricultural crops. PMID:24102738

  17. Inorganic materials as ameliorants for soil remediation of metal toxicity to wild mustard (Sinapis arvensis L.).

    PubMed

    Ribeiro Filho, Mateus Rosas; Siqueira, José Oswaldo; Vangronsveld, Jaco; Soares, Cláudio Roberto Fonsêca Sousa; Curi, Nilton

    2011-01-01

    The ameliorating effects of different inorganic materials were investigated on a soil originating from a zinc smelter dumping site contaminated by toxic metals. Wild mustard (Sinapis arvensis L.) was used as a test plant. The soil was amended with different doses of mining sludge, Perferric Red Latosol (LVj), steel shots, cyclonic ash, silifertil, and superphosphate. The most effective amendments improved plant growth with 45% and reduced metal uptake by over 70% in comparison to untreated soil. Reductions in availability as estimated by BaCl2-extractable metals reached up to 90% for Zn and 65% for Cd as compared to unamended soil. These reductions were associated with lower shoot and root metal contents. Shoot Zn content was reduced from 1,369 microg g(-1) in plants grown on untreated soil to 377 microg g(-1) when grown on cyclonic ash amended soil while Cd decreased from 267 to 44 microg g(-1) in steel shots amended soil. Superphosphate addition had no ameliorating effect. On the contrary, it increased BaCl2-extractable amounts of Zn. Considering all parameters we determined, steel shots, cyclonic ash and silifertil are the most promising for remediating metal contaminated soil in the tropics. Further studies evaluating impacts, cost-effectiveness and durability of effects will be conducted. PMID:21598779

  18. The Effect of Convolvulus arvensis Dried Extract as a Potential Antioxidant in Food Models

    PubMed Central

    Mohd Azman, Nurul Aini; Gallego, Maria Gabriela; Juliá, Luis; Fajari, Lluis; Almajano, MaríaPilar

    2015-01-01

    In this study, the antioxidant activity of the Convolvulus arvensis Linn (CA) ethanol extract has been evaluated by different ways. The antioxidant activity of the extract assessed by 2,2′-azino-bis-3-ethylbenzothiazoline-6-sulphonic acid (ABTS) radical cation, the oxygen radical absorbance capacity (ORAC) and the ferric reducing antioxidant power (FRAP) was 1.62 mmol Trolox equivalents (TE)/g DW, 1.71 mmol TE/g DW and 2.11 mmol TE/g DW, respectively. CA ethanol extract exhibited scavenging activity against the methoxy radical initiated by the Fenton reaction and measured by Electron Paramagnetic Resonance (EPR). The antioxidant effects of lyophilised CA measured in beef patties containing 0.1% and 0.3% (w/w) CA stored in modified atmosphere packaging (MAP) (80% O2 and 20% CO2) was determined. A preliminary study of gelatine based film containing CA showed a strong antioxidant effect in preventing the degradation of lipid in muscle food. Thus, the present results indicate that CA extract can be used as a natural food antioxidant. PMID:26785344

  19. Participation of Photosynthesis in Floral Induction of the Long Day Plant Anagallis arvensis L. 1

    PubMed Central

    Quedado, Rosario M.; Friend, Douglas J.

    1978-01-01

    The saturating photon flux density (400 to 700 nanometers) for induction of flowering of the long day plant Anagallis arvensis L. was 1,900 micromoles per square meter per second (6,000 foot-candles) when an 8-hour daylength was extended to 24 hours by a single period of supplementary irradiation. The saturating photon flux density for photosynthetic CO2 uptake during the same single supplementary light period was lower, at about 1,000 to 650 micromoles per square meter per second (3,000 to 2,000 foot-candles). The per cent flowering and mean number of floral buds per plant were significantly reduced when the light extension treatment was given in CO2-free air, and glucose (10 kilograms per cubic meter in water) relieved this effect. Glucose solution also significantly increased flowering of plants given supplementary light treatment in atmospheric air under a photon flux density of 80 micromoles per square meter per second. Increasing the CO2 concentration to 1.27 grams per cubic meter of CO2 in air during the supplementary light period did not increase flowering. It is concluded that high photon flux densities promote flowering of Anagallis through both increased photosynthesis and the photomorphogenic action of high irradiance. PMID:16660610

  20. Air pollution induced alterations in assimilate partitioning in Anagallis arvensis L

    SciTech Connect

    Khan, F.A.; Iqbal, M.; Ahmad, Z.; Saquib, M.; Ghouse, A.K.M. )

    1989-04-01

    The Thermal Power Plant Complex of Kasimpur (Aligarh, UP, India) emits enormous amounts of oxides of sulfur, nitrogen, and carbon as well as particulate matters on consuming 3192 MT of coal/day. These effluents induce significant alterations in carbon allocation in Anagallis arvensis populations. Monthly samples of 10 plants each were collected on random basis at seedling to mature stage from 0.5, 2, 6, 12 and 20 km leeward from the power plant. In oven dried samples, assimilate partitioning was noted to be more severely altered by the air pollutants in the seedling stage. In 2 and 3 months old populations, photosynthate allocation to root and shoot was not altered noticeably. Considerable changes in carbon allocation were noted in 4 mo old mature stage. The carbon allocation to fruit was 3 fold and to seed was about 4 fold greater in the population thriving 20 km away from the source than in those growing in the vicinity of the source. Assimilate partitioning was linearly related to the distance from power plant and the productivity of the populations.

  1. Development of a novel Sinapis arvensis disomic addition line in Brassica napus containing the restorer gene for Nsa CMS and improved resistance to Sclerotinia sclerotiorum and pod shattering.

    PubMed

    Wei, Wenhui; Li, Yunchang; Wang, Lijun; Liu, Shengyi; Yan, Xiaohong; Mei, Desheng; Li, Yinde; Xu, Yusong; Peng, Pengfei; Hu, Qiong

    2010-04-01

    An allo-cytoplasmic male sterile line, which was developed through somatic hybridization between Brassica napus and Sinapis arvensis (thus designated as Nsa CMS line), possesses high potential for hybrid production of rapeseed. In order to select for restorer lines, fertile plants derived from the same somatic hybridization combination were self-pollinated and testcrossed with the parental Nsa CMS line for six generations. A novel disomic alien addition line, B. napus-S. arvensis, has been successfully developed. GISH analysis showed that it contains one pair of chromosomes from S. arvensis and 19 pairs from B. napus, and retains stable and regular mitotic and meiotic processes. The addition line displays very strong restoration ability to Nsa CMS line, high resistance to Sclerotinia sclerotiorum and a low incidence of pod shattering. Because the addition line shares these very important agricultural characters, it is a valuable restorer to Nsa CMS line, and is named NR1 here (Nsa restorer no. 1).

  2. Isolation, characterization, sequencing and crystal structure of charybdin, a type 1 ribosome-inactivating protein from Charybdis maritima agg.

    PubMed

    Touloupakis, Eleftherios; Gessmann, Renate; Kavelaki, Kalliopi; Christofakis, Emmanuil; Petratos, Kyriacos; Ghanotakis, Demetrios F

    2006-06-01

    A novel, type 1 ribosome-inactivating protein designated charybdin was isolated from bulbs of Charybdis maritima agg. The protein, consisting of a single polypeptide chain with a molecular mass of 29 kDa, inhibited translation in rabbit reticulocytes with an IC50 of 27.2 nm. Plant genomic DNA extracted from the bulb was amplified by PCR between primers based on the N-terminal and C-terminal sequence of the protein from dissolved crystals. The complete mature protein sequence was derived by partial DNA sequencing and terminal protein sequencing, and was confirmed by high-resolution crystal structure analysis. The protein contains Val at position 79 instead of the conserved Tyr residue of the ribosome-inactivating proteins known to date. To our knowledge, this is the first observation of a natural substitution of a catalytic residue at the active site of a natural ribosome-inactivating protein. This substitution in the active site may be responsible for the relatively low in vitro translation inhibitory effect compared with other ribosome-inactivating proteins. Single crystals were grown in the cold room from PEG6000 solutions. Diffraction data collected to 1.6 A resolution were used to determine the protein structure by the molecular replacement method. The fold of the protein comprises two structural domains: an alpha + beta N-terminal domain (residues 4-190) and a mainly alpha-helical C-terminal domain (residues 191-257). The active site is located in the interface between the two domains and comprises residues Val79, Tyr117, Glu167 and Arg170.

  3. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (Sinapis arvensis).

    PubMed

    Topuz, Muhamet; Nemli, Yildiz; Fatima, Tahira; Mattoo, Autar K

    2015-01-01

    Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS genes from two such resistant ("R") biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197) to TCT (Ser 197) in KNF-R1 and CCT (Pro 197) to ACT (Thr 197) in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the "R" S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis "R" biotypes was revealed in the form of an altered seed dormancy behavior over 4-48 months of dry storage (after-ripening) compared to the susceptible ("S") biotypes. Seeds of the "S" biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the "R" biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months' of dry storage. The "R" biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of "R" and "S" biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, "R" seeds were significantly heavier than those of the "S" seeds. Differential seed germinability between "S" and "R" biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination. PMID:26258120

  4. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (Sinapis arvensis)

    NASA Astrophysics Data System (ADS)

    Topuz, Muhamet; Nemli, Yildiz; Fatima, Tahira; Mattoo, Autar

    2015-07-01

    Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS genes from two such resistant (‘R’) biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197) to TCT (Ser 197) in KNF-R1 and CCT (Pro 197) to ACT (Thr 197) in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the ‘R’ S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis ‘R’ biotypes was revealed in the form of an altered seed dormancy behavior over 4 to 48 months of dry storage (after-ripening) compared to the susceptible (‘S’) biotypes. Seeds of the ‘S’ biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the ‘R’ biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months’ of dry storage. The ‘R’ biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of ‘R’ and ‘S’ biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, ‘R’ seeds were significantly heavier than those of the ‘S’ seeds. Differential seed germinability between ‘S’ and ‘R’ biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination.

  5. Seed dormancy is modulated in recently evolved chlorsulfuron-resistant Turkish biotypes of wild mustard (Sinapis arvensis)

    PubMed Central

    Topuz, Muhamet; Nemli, Yildiz; Fatima, Tahira; Mattoo, Autar K.

    2015-01-01

    Biotypes of the broad-leaved wild mustard (Sinapis arvensis L.) found in wheat fields of Aegean and Marmara region of Turkey were characterized and shown to have developed resistance to sulfonylurea (chlorsulfuron), an inhibitor of acetolactate synthase (ALS). DNA sequence analysis of the ALS genes from two such resistant (“R”) biotypes, KNF-R1 and KNF-R2, revealed point mutations, CCT (Pro 197) to TCT (Ser 197) in KNF-R1 and CCT (Pro 197) to ACT (Thr 197) in KNF-R2; these substitutions are consistent with the presence of chlorsulfuron-insensitive ALS enzyme activity in the “R” S. arvensis biotypes. An additional phenotype of chlorsulfuron resistance in the Turkish S. arvensis “R” biotypes was revealed in the form of an altered seed dormancy behavior over 4–48 months of dry storage (after-ripening) compared to the susceptible (“S”) biotypes. Seeds of the “S” biotypes dry stored for 4 months had a higher initial germination, which sharply decreased with storage time, while the seeds of the “R” biotypes had lower germination after 4-months storage, rising sharply and peaking thereafter by 24 months' of dry storage. The “R” biotype seeds continued to maintain a higher germination percentage even after 48 months of after-ripening. The seed weight of “R” and “S” biotypes after-ripened for 4 months was similar but those after-ripened for 48 months differed, “R” seeds were significantly heavier than those of the “S” seeds. Differential seed germinability between “S” and “R” biotypes was found not a case of differential viability, temperature regimen or non-response to pro-germination hormone GA3. These studies are of relevance to ecological fitness of herbicide-resistant biotypes in terms of seed viability and germination. PMID:26258120

  6. Influence of Nitrate and Ammonia on Photosynthetic Characteristics and Leaf Anatomy of Moricandia arvensis1

    PubMed Central

    Winter, Klaus; Usuda, Hideaki; Tsuzuki, Mikio; Schmitt, Mark; Edwards, Gerald E.; Thomas, Richard J.; Evert, Ray F.

    1982-01-01

    The leaf anatomy and certain photosynthetic properties of nitrate- and ammonia-grown plants of Moricandia arvensis (L.) DC., a species previously reported to be a C3-C4 intermediate, were investigated. Nitrate-grown plants had a high level of malate in the leaves while ammonia-grown plants had low levels of malate. In young leaves of nitrate-grown plants, there was a diurnal fluctuation of malate content, increasing during the day and decreasing during the night. Titratable acidity remained low in leaves of both nitrate- and ammonia-grown plants. In nitrate-grown plants, the activity of phosphoenolpyruvate (PEP) carboxylase was about 2-fold higher than in ammonia-grown plants, the latter having activity typical of C3 species. Also, in nitrate-grown plants, the ratio of activities of ribulose 1,5-bisphosphate (RuBP) carboxylase/PEP carboxylase was lower than in ammonia-grown plants. Nitrate reductase activities were higher in nitrate- than in ammonia-grown plants and the greatest activity was found in younger leaves. With nitrate-grown plants, during a pulse-chase experiment the label in malate, as a percentage of the total labeled products, increased from about 7% after a 10-second pulse with 14CO2 up to 17% during a 5-minute chase with 12CO2. The pattern of 14C labeling in various metabolites suggests the primary carboxylation is through RuBP carboxylase with a secondary carboxylation through PEP carboxylase. In similar experiments, with ammonia-grown plants, the percentage label in malate was only 0% to 4% with no increase in malate labeling during the chase period. The CO2 compensation point was lower in nitrate-grown than ammonia-grown plants. There was no evidence of Kranz-like anatomy in either the nitrate or ammonia-grown plants. Mitochondria of bundle-sheath cells were strikingly positioned along the inner tangential wall. This might allow the chloroplasts of these cells to fix the mitochondrial photorespired CO2 more effectively and contribute to the low

  7. Bidirectional but asymmetrical sexual hybridization between Brassica carinata and Sinapis arvensis (Brassicaceae).

    PubMed

    Cheung, Kyle W; Razeq, Fakhria M; Sauder, Connie A; James, Tracey; Martin, Sara L

    2015-05-01

    With transgenic crop development it is important to evaluate the potential for transgenes to escape into populations of wild, weedy relatives. Ethiopian mustard (Brassica carinata, BBCC) is easily transformed and is being investigated for uses from biodiesel fuels to biopharmaceuticals. However, little work has been done evaluating its ability to cross with relatives such as wild mustard (Sinapsis arvensis, SrSr), an abundant, cosmopolitan weedy relative. Here we conducted bidirectional crosses with Ethiopian mustard as a maternal parent in 997 crosses and paternal parent in 1,109 crosses. Hybrids were confirmed using flow cytometry and species-specific ITS molecular markers and indicate a high hybridization rate of 6.43 % between Ethiopian mustard (♀) and wild mustard (♂) and a lower, but not insignificant, hybridization rate of 0.01 % in the reverse direction. The majority of the hybrids were homoploid (BCSr) with less than 1 % of pollen production of their parents and low seed production (0.26 seeds/pollination) in crosses and backcrosses indicating a potential for advanced generation hybrids. The accession used had a significant effect on hybrid seed production with different accessions of Ethopian mustard varying in their production of hybrid offspring from 2.69 to 16.34 % and one accession of wild mustard siring almost twice as many hybrid offspring per flower as the other. One pentaploid (BBCCSr) and one hexaploid (BBCCSrSr) hybrid were produced and had higher pollen viability, though no and low seed production, respectively. As wild mustard is self-incompatible and the outcrossing rate of Ethiopian mustard has been estimated as 30 % potential for hybrid production in the wild appears to be high, though the hybridization rate found here represents a worst case scenario as it does not incorporate pre-pollination barriers. Hybridization in the wild needs to be directly evaluated as does the propensity of Ethiopian mustard to volunteer. PMID:25698113

  8. Do the effects of crops on skylark (Alauda arvensis) differ between the field and landscape scales?

    PubMed Central

    Barbottin, Aude; Jiguet, Frédéric; Martin, Philippe

    2015-01-01

    The promotion of biodiversity in agricultural areas involves actions at the landscape scale, and the management of cropping patterns is considered an important means of achieving this goal. However, most of the available knowledge about the impact of crops on biodiversity has been obtained at the field scale, and is generally grouped together under the umbrella term “crop suitability.” Can field-scale knowledge be used to predict the impact on populations across landscapes? We studied the impact of maize and rapeseed on the abundance of skylark (Alauda arvensis). Field-scale studies in Western Europe have reported diverse impacts on habitat selection and demography. We assessed the consistency between field-scale knowledge and landscape-scale observations, using high-resolution databases describing crops and other habitats for the 4 km2 grid scales analyzed in the French Breeding Bird Survey. We used generalized linear models to estimate the impact of each studied crop at the landscape scale. We stratified the squares according to the local and geographical contexts, to ensure that the conclusions drawn were valid in a wide range of contexts. Our results were not consistent with field knowledge for rapeseed, and were consistent for maize only in grassland contexts. However, the effect sizes were much smaller than those of structural landscape features. These results suggest that upscaling from the field scale to the landscape scale leads to an integration of new agronomic and ecological processes, making the objects studied more complex than simple “crop ∗ species” pairs. We conclude that the carrying capacity of agricultural landscapes cannot be deduced from the suitability of their components. PMID:26213656

  9. Study of electric properties of amorphous AgGe1+xAs1-xS3 with content of carbon nanotubes

    NASA Astrophysics Data System (ADS)

    Melnikova, Nina; Kurochka, Kirill; Volkova, Yana

    2013-06-01

    Multicomponent copper and silver chalcogenides have been known as promising materials for scientific and applied purposes. These materials are also under intense investigation for application in a phase-change random access memory. In order to obtain materials with a high ionic conductivity component, glassy silver chalcogenides AgGe1+xAs1-xS3 with the addition of nanotubes were synthesized. In this work the study of electrical properties of the amorphous chalcogenide AgGe1.4As0.6S3 (x = 0.4) with carbon nanotube content at a frequency of the alternating-current electric field varying from 1 Hz to 5 MHz and on direct current at ambient pressure and at pressure up to 30 GPa are presented. The ion transport was confirmed by means DC measurements in cells with blocking ion component of conductivity electrodes. An evaluation of the proportion of ionic conductivity can make a preliminary conclusion that the ionic component of the conductivity of at least 98%. Analyze of the baric dependences of AC properties have shown that the dielectric loss tangent and the real part of an admittance of the AgGe1.4As0.6S3 with carbon nanotube content compound exponentially increase with a pressure increase from 1 up to 30 GPa. The study was supported in part by the Ural Federal University development program with the financial support of young scientists; and by the Russian Foundation for Basic Research, project No. 12-02-31607.

  10. Impact Assessment of Mercury Accumulation and Biochemical and Molecular Response of Mentha arvensis: A Potential Hyperaccumulator Plant

    PubMed Central

    Manikandan, R.; Sahi, S. V.; Venkatachalam, P.

    2015-01-01

    The present study was focused on examining the effect of Hg oxidative stress induced physiochemical and genetic changes in M. arvensis seedlings. The growth rate of Hg treated seedlings was decreased to 56.1% and 41.5% in roots and shoots, respectively, compared to the control. Accumulation of Hg level in both roots and shoots was increased with increasing the concentration of Hg. Superoxide dismutase (SOD), catalase (CAT), and ascorbate peroxidase (APX) activities were found to be increased with increasing the Hg concentration up to 20 mg/L; however, it was decreased at 25 mg/L Hg concentration. The POX enzyme activity was positively correlated with Hg dose. The changes occurring in the random amplification of ploymorphic DNA (RAPD) profiles generated from Hg treated seedlings included variations in band intensity, disappearance of bands, and appearance of new bands compared with the control seedlings. It was concluded that DNA polymorphisms observed with RAPD profile could be used as molecular marker for the evaluation of heavy metal induced genotoxic effects in plant species. The present results strongly suggested that Mentha arvensis could be used as a potential phytoremediator plant in mercury polluted environment. PMID:25654134

  11. Impact assessment of mercury accumulation and biochemical and molecular response of Mentha arvensis: a potential hyperaccumulator plant.

    PubMed

    Manikandan, R; Sahi, S V; Venkatachalam, P

    2015-01-01

    The present study was focused on examining the effect of Hg oxidative stress induced physiochemical and genetic changes in M. arvensis seedlings. The growth rate of Hg treated seedlings was decreased to 56.1% and 41.5% in roots and shoots, respectively, compared to the control. Accumulation of Hg level in both roots and shoots was increased with increasing the concentration of Hg. Superoxide dismutase (SOD), catalase (CAT), and ascorbate peroxidase (APX) activities were found to be increased with increasing the Hg concentration up to 20 mg/L; however, it was decreased at 25 mg/L Hg concentration. The POX enzyme activity was positively correlated with Hg dose. The changes occurring in the random amplification of ploymorphic DNA (RAPD) profiles generated from Hg treated seedlings included variations in band intensity, disappearance of bands, and appearance of new bands compared with the control seedlings. It was concluded that DNA polymorphisms observed with RAPD profile could be used as molecular marker for the evaluation of heavy metal induced genotoxic effects in plant species. The present results strongly suggested that Mentha arvensis could be used as a potential phytoremediator plant in mercury polluted environment.

  12. [Chemical composition and microstructural peculiarities of overground and underground vegetative organs of field restharrow (Ononis arvensis L.)].

    PubMed

    Sichinava, M B; Mchelidze, K Z; Churadze, M V; Alaniia, M D; Aneli, Dzh N

    2014-06-01

    The paper presents the results of the study of anatomy and chemical composition of Field Restharrow (Ononis arvensis L.). The existence of triterpene alcohol α-onocerin and isoflavons in the overground organs of the plant is established by chemical analysis. Oxycumarines - scopoletin and scopolin are isolated and identified. Morphological characterization of the whole plant is given. Anatomy of the vegetative organs of the species is examined. Among the main microstructural characteristics multilayer integumentary tissues, active periderm and sclerenchyma cells were specified in roots; and complex radial rays and structural units of wood, located radially, were observed in the central cylinder. Shoots are characterized with intensive pubescence. Mechanical tissues of different structures exist in the parenchime of crust and central cylinder of shoots. Vessels with spiral and spiro-annular thickened walls are located in the libriforms of wood. Leaves of Ononis arvensis are bifacial, mesophile is of dorsiventral structure; central conductive bunch is complex-collateral. Basal cells of upper and lower epidermis belong to of bent-walled type, where paracytal and anisocytal cells of stomatal apparatus are scattered chaotically. PMID:25020180

  13. Impact assessment of mercury accumulation and biochemical and molecular response of Mentha arvensis: a potential hyperaccumulator plant.

    PubMed

    Manikandan, R; Sahi, S V; Venkatachalam, P

    2015-01-01

    The present study was focused on examining the effect of Hg oxidative stress induced physiochemical and genetic changes in M. arvensis seedlings. The growth rate of Hg treated seedlings was decreased to 56.1% and 41.5% in roots and shoots, respectively, compared to the control. Accumulation of Hg level in both roots and shoots was increased with increasing the concentration of Hg. Superoxide dismutase (SOD), catalase (CAT), and ascorbate peroxidase (APX) activities were found to be increased with increasing the Hg concentration up to 20 mg/L; however, it was decreased at 25 mg/L Hg concentration. The POX enzyme activity was positively correlated with Hg dose. The changes occurring in the random amplification of ploymorphic DNA (RAPD) profiles generated from Hg treated seedlings included variations in band intensity, disappearance of bands, and appearance of new bands compared with the control seedlings. It was concluded that DNA polymorphisms observed with RAPD profile could be used as molecular marker for the evaluation of heavy metal induced genotoxic effects in plant species. The present results strongly suggested that Mentha arvensis could be used as a potential phytoremediator plant in mercury polluted environment. PMID:25654134

  14. Effect of Sclerotinia sclerotiorum on the disease development, growth, oil yield and biochemical changes in plants of Mentha arvensis

    PubMed Central

    Perveen, K.; Haseeb, A.; Shukla, P.K.

    2010-01-01

    Experiment was carried out to determine the effect of Sclerotinia sclerotiorum on the disease development, growth, oil yield and biochemical changes in the plants of Mentha arvensis. With the increase in initial inoculum levels of S. sclerotiorum a corresponding decrease in plant fresh and dry weights were recorded. The maximum reduction in the shoot-roots/suckers fresh weight and shoot-roots/suckers dry weights (39.8%, 43.6%, 40.3% and 42.9%), respectively, was observed at the highest initial inoculum level of 12 g fungal mycelium/5 kg soil as compared to uninoculated control. The infection of roots and suckers due to S. sclerotiorum increased with increasing initial inoculum levels. At the lowest initial inoculum (1.0 g mycelium/5 kg soil), infection was observed 18.0% and at the highest (12 g mycelium/5 kg soil), it was 80.2%. Significant (P ⩽ 0.01) reduction in oil yield, total chlorophyll, total phenol and total sugar content of M. arvensis plants was observed at the lowest inoculum level as compared to uninoculated control. PMID:23961091

  15. Eriophyoid mites (Acari: Prostigmata: Eriophyoidea) from Hungary: a new species on Agrimonia eupatoria (Rosaceae) and new record on Convolvulus arvensis (Convolvulaceae).

    PubMed

    Ripka, Géza

    2014-12-22

    A new species of eriophyoid mite, Aculus castriferrei n. sp., associated with Agrimonia eupatoria (Rosaceae) is described and illustrated from Hungary. Morphological differences distinguishing this vagrant species from other rosaceous inhabiting congeners are discussed. Aceria malherbae Nuzzaci is a new record for the eriophyoid fauna of Hungary after it was found causing severe damage symptoms to Convolvulus arvensis L. (Convolvulaceae).

  16. Effects of thermal power plant effluents on formation and senescence of reproductive parts of Anagallis arvensis L

    SciTech Connect

    Iqbal, M.; Khan, F.A.; Saquib, M.; Ahmad, Z.; Ghouse, A.K.M. )

    1989-04-01

    Oxides of sulfur, nitrogen and carbon and particulates are the major air pollutants emitted in huge amounts by the Thermal Power Plant Complex of Kasimpur (Aligarh, UP, India) running on 3192 MT of coal/day. These effluents significantly affect reproductive phase of Anagallis arvensis L. Samples of 10 plants each were randomly collected at monthly intervals at seedling to mature stage from 0.5, 2, 6, 12 and 20 km leeward from the power plant complex. Bud formation and flowering were delayed in the population thriving at 0.5 km from the pollution source. As a 2 month old stage, 60% of the population showed a decline in bud formation in the vicinity of the source compared to a heavy bud emergence in the whole population thriving 20 km away from it. Bud formation, flowering fruit set and seed set showed a correlation with multiple growth factors viz productivity, shoot length and distance from the source.

  17. Evolutionary processes in a continental island system: molecular phylogeography of the Aegean Nigella arvensis alliance (Ranunculaceae) inferred from chloroplast DNA.

    PubMed

    Bittkau, C; Comes, H P

    2005-11-01

    Continental shelf island systems, created by rising sea levels, provide a premier setting for studying the effects of past fragmentation, dispersal, and genetic drift on taxon diversification. We used phylogeographical (nested clade) and population genetic analyses to elucidate the relative roles of these processes in the evolutionary history of the Aegean Nigella arvensis alliance (= 'coenospecies'). We surveyed chloroplast DNA (cpDNA) variation in 455 individuals from 47 populations (nine taxa) of the alliance throughout its core range in the Aegean Archipelago and surrounding mainland areas of Greece and Turkey. The study revealed the presence of three major lineages, with largely nonoverlapping distributions in the Western, Central, and Eastern Aegean. There is evidence supporting the idea that these major lineages evolved in situ from a widespread (pan-Aegean) ancestral stock as a result of multiple fragmentation events, possibly due to the influence of post-Messinian sea flooding, Pleistocene eustatic changes and corresponding climate fluctuations. Over-sea dispersal and founder events appear to have played a rather insignificant role in the group's history. Rather, all analytical approaches identified the alliance as an organism group with poor seed dispersal capabilities and a susceptibility to genetic drift. In particular, we inferred that the observed level of cpDNA differentiation between Kikladian island populations of Nigella degenii largely reflects population history, (viz. Holocene island fragmentation) and genetic drift in the near absence of seed flow since their time of common ancestry. Overall, our cpDNA data for the N. arvensis alliance in general, and N. degenii in particular, indicate that historical events were important in determining the phylogeographical patterns seen, and that genetic drift has historically been relatively more influential on population structure than has cytoplasmic gene flow.

  18. Do seed mass and family affect germination and juvenile performance in Knautia arvensis? A study using failure-time methods

    NASA Astrophysics Data System (ADS)

    Vange, Vibekke; Heuch, Ivar; Vandvik, Vigdis

    2004-05-01

    Germination and seedling establishment are vulnerable stages in the plant life cycle. We investigated how seed mass and family (progeny origin) affect germination and juvenile performance in the grassland herb Knautia arvensis. Seeds were produced by cross-pollination by hand. The fate of 15 individually weighed seeds from each of 15 plants was followed during a 3-month growth chamber experiment. Progeny origin affected germination, both through seed mass and as an independent factor. Two groups of progenies could be distinguished by having rapid or delayed germination. The two groups had similar mean seed masses, but a positive relationship between seed mass and germination rate could be established only among the rapidly germinating progenies. These biologically relevant patterns were revealed because timing of germination was taken into account in the analyses, not only frequencies. Time-to-event data were analysed with failure-time methods, which gave more stable estimates for the relation between germination and seed mass than the commonly applied logistic regression. Progeny origin and seed mass exerted less impact on later characters like juvenile survival, juvenile biomass, and rosette number. These characters were not affected by the timing of germination under the competition-free study conditions. The decrease in the effect of progeny origin from the seed and germination to the juvenile stages suggests that parental effects other than those contributing to the offspring genotype strongly influenced the offspring phenotype at the earliest life stages. Further, the division of progeny germination patterns into two fairly distinct groups indicates that there was a genetic basis for the variation in stratification requirements among parental plants. Field studies are needed to elucidate effects of different timing of germination in the seasonal grasslands that K. arvensis inhabits.

  19. Production and characterization of an alloplasmic and monosomic addition line of Brassica rapa carrying the cytoplasm and one chromosome of Moricandia arvensis.

    PubMed

    Tsutsui, Kota; Jeong, Bum Hee; Ito, Yukiko; Bang, Sang Woo; Kaneko, Yukio

    2011-12-01

    Intergeneric hybridization was performed between Moricandia arvensis and four inbred lines of Brassica rapa following embryo rescue. Three F(1) hybrid plants were developed from three cross combinations of M. arvensis × B. rapa, and amphidiploids were synthesized by colchicine treatment. Six BC(1) plants were generated from a single cross combination of amphidipolid × B. rapa 'Ko1-303' through embryo rescue. One BC(2) and three BC(3) plants were obtained from successive backcrossing with B. rapa 'Ko1-303' employing embryo rescue. Alloplasmic and monosomic addition lines of B. rapa (Allo-MALs, 2n = 21) were obtained from backcrossed progeny of three BC(3) plants (2n = 21, 22 and 23) without embryo rescue. An alloplasmic line of B. rapa (2n = 20) degenerated before floliation on 1/2 MS medium due to severe chlorosis. Allo-MALs of B. rapa (2n = 21) showed stable male sterility without any abnormal traits in vegetative growth and female fertility. Molecular analyses revealed that the same chromosome and cytoplasm of M. arvensis had been added to each Allo-MAL of B. rapa. This Allo-MAL of B. rapa may be useful material for producing cytoplasmic male sterile lines of B. rapa.

  20. Comparative genomic in situ hybridization (cGISH) analysis of the genomic relationships among Sinapis arvensis, Brassica rapa and Brassica nigra.

    PubMed

    Mao, Shufang; Han, Yonghua; Wu, Xiaoming; An, Tingting; Tang, Jiali; Shen, Junjun; Li, Zongyun

    2012-06-01

    To further understand the relationships between the SS genome of Sinapis arvensis and the AA, BB genomes in Brassica, genomic DNA of Sinapis arvensis was hybridized to the metaphase chromosomes of Brassica nigra (BB genome), and the metaphase chromosomes and interphase nucleus of Brassica rapa (AA genome) by comparative genomic in situ hybridization (cGISH). As a result, every chromosome of B. nigra had signals along the whole chromosomal length. However, only half of the condensed heterochromatic areas in the interphase nucleus and the chromosomes showed rich signals in Brassica rapa. Interphase nucleus and the metaphase chromosomes of S. arvensis were simultaneously hybridized with digoxigenin-labeled genomic DNA of B. nigra and biotin-labeled genomic DNA of B. rapa. Signals of genomic DNA of B. nigra hybridized throughout the length of all chromosomes and all the condensed heterochromatic areas in the interphase nucleus, except chromosome 4, of which signals were weak in centromeric regions. Signals of the genomic DNA of B. rapa patterned the most areas of ten chromosomes and ten condensed heterochromatic areas, others had less signals. The results showed that the SS genome had homology with AA and BB genomes, but the homology between SS genome and AA genome was clearly lower than that between the SS genome and BB genome.

  1. Comparative genomic in situ hybridization (cGISH) analysis of the genomic relationships among Sinapis arvensis, Brassica rapa and Brassica nigra.

    PubMed

    Mao, Shufang; Han, Yonghua; Wu, Xiaoming; An, Tingting; Tang, Jiali; Shen, Junjun; Li, Zongyun

    2012-06-01

    To further understand the relationships between the SS genome of Sinapis arvensis and the AA, BB genomes in Brassica, genomic DNA of Sinapis arvensis was hybridized to the metaphase chromosomes of Brassica nigra (BB genome), and the metaphase chromosomes and interphase nucleus of Brassica rapa (AA genome) by comparative genomic in situ hybridization (cGISH). As a result, every chromosome of B. nigra had signals along the whole chromosomal length. However, only half of the condensed heterochromatic areas in the interphase nucleus and the chromosomes showed rich signals in Brassica rapa. Interphase nucleus and the metaphase chromosomes of S. arvensis were simultaneously hybridized with digoxigenin-labeled genomic DNA of B. nigra and biotin-labeled genomic DNA of B. rapa. Signals of genomic DNA of B. nigra hybridized throughout the length of all chromosomes and all the condensed heterochromatic areas in the interphase nucleus, except chromosome 4, of which signals were weak in centromeric regions. Signals of the genomic DNA of B. rapa patterned the most areas of ten chromosomes and ten condensed heterochromatic areas, others had less signals. The results showed that the SS genome had homology with AA and BB genomes, but the homology between SS genome and AA genome was clearly lower than that between the SS genome and BB genome. PMID:22804340

  2. Reconstructed structures of nanosized co islands on Ag/Ge(111) mean square root of 3 x mean square root of 3 surfaces.

    PubMed

    Fu, Tsu-Yi; Tsay, Sung-Lin; Lin, Chun-Liang

    2008-02-01

    Structural evolution of Co/Ag/Ge(111) at high temperatures was studied by using scanning tunneling microscopy and low energy electron diffraction. The mean square root of 3 x mean square root of 3-Ag layer between the substrate Ge( 11) and Co adatoms can avoid the formation of Co-Ge compounds below 800 K. The Co atoms nucleate to form islands where mean square root of 13 x mean square root of 13 or 2 x 2 reconstructions were observed after annealing between 373 K and 737 K. The mean square root of 13 x mean square root of 13 structure with mirror symmetry relative to [-211], [11-2], and [1-21] axes was observed for 1-2 layer Co islands. Co islands with over 2 layers appear 2 x 2 structure. All reconstruction structures of the nano-sized Co islands and substrate Ag/Ge(111) mean square root of 3 x mean square root of 3 surface were analyzed using the atomic hard sphere model. The bright protrusions of these reconstructions all sit in the centers of Ag or Ge trimers, which were predicted to have maximum binding energy.

  3. Soil nutritional status, not inoculum identity, primarily determines the effect of arbuscular mycorrhizal fungi on the growth of Knautia arvensis plants.

    PubMed

    Doubková, Pavla; Kohout, Petr; Sudová, Radka

    2013-10-01

    Arbuscular mycorrhizal (AM) symbiosis is among the factors contributing to plant survival in serpentine soils characterised by unfavourable physicochemical properties. However, AM fungi show a considerable functional diversity, which is further modified by host plant identity and edaphic conditions. To determine the variability among serpentine AM fungal isolates in their effects on plant growth and nutrition, a greenhouse experiment was conducted involving two serpentine and two non-serpentine populations of Knautia arvensis plants grown in their native substrates. The plants were inoculated with one of the four serpentine AM fungal isolates or with a complex AM fungal community native to the respective plant population. At harvest after 6-month cultivation, intraradical fungal development was assessed, AM fungal taxa established from native fungal communities were determined and plant growth and element uptake evaluated. AM symbiosis significantly improved the performance of all the K. arvensis populations. The extent of mycorrhizal growth promotion was mainly governed by nutritional status of the substrate, while the effect of AM fungal identity was negligible. Inoculation with the native AM fungal communities was not more efficient than inoculation with single AM fungal isolates in any plant population. Contrary to the growth effects, a certain variation among AM fungal isolates was revealed in terms of their effects on plant nutrient uptake, especially P, Mg and Ca, with none of the AM fungi being generally superior in this respect. Regardless of AM symbiosis, K. arvensis populations significantly differed in their relative nutrient accumulation ratios, clearly showing the plant's ability to adapt to nutrient deficiency/excess.

  4. Distribution of hydrogen-metabolizing bacteria in alfalfa field soil. [Medicago sativa L. ; Convolvulus arvensis L. ; Rhizobium meliloti

    SciTech Connect

    Cunningham, S.D.; Kapulnik, Y.; Phillips, D.A.

    1986-11-01

    H/sub 2/ evolved by alfalfa root nodules during the process of N/sub 2/ fixation may be an important factor influencing the distribution of soil bacteria. To test this hypothesis under field conditions, over 700 bacterial isolates were obtained from fallow soil or from the 3-mm layer of soil surrounding alfalfa (Medicago sativa L.) root nodules, alfalfa roots, or bindweed (Convolvulus arvensis L.) roots. Bacteria were isolated under either aerobic or microaerophilic conditions and were tested for their capacity to metabolize H/sub 2/. Isolates showing net H/sub 2/ uptake and /sup 3/H/sub 2/ incorporation activity under laboratory conditions were assigned a Hup/sup +/ phenotype, whereas organisms with significant H/sub 2/ output capacity were designated as a Hout/sup +/ phenotype. Under aerobic isolation conditions two Hup/sup +/ isolates were obtained, whereas under microaerophilic conditions five Hup/sup +/ and two Hout/sup +/ isolates were found. The nine isolates differed on the basis of 24 standard bacteriological characteristics or fatty acid composition. Five of the nine organisms were isolated from soil around root nodules, whereas the other four were found distributed among the other three soil environments. On the basis of the microaerophilic isolations, 4.8% of the total procaryotic isolates from soil around root nodules were capable of oxidizing H/sub 2/, and 1.2% could produce H/sub 2/. Two of the Hup/sup +/ isolates were identified as Rhizobium meliloti by root nodulation tests, but the fact that none of the isolates reduced C/sub 2/H/sub 2/ under the assay conditions suggested that the H/sub 2/ metabolism traits were associated with various hydrogenase systems rather than with nitrogenase activity.

  5. Comparative study of biological activities and phytochemical composition of two rose hips and their preserves: Rosa canina L. and Rosa arvensis Huds.

    PubMed

    Nađpal, Jelena D; Lesjak, Marija M; Šibul, Filip S; Anačkov, Goran T; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N

    2016-02-01

    The aim of this study was to compare phenolic profile, vitamin C content, antioxidant, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of two Rosa species: renowned Rosa canina L. and unexplored Rosa arvensis Huds. The liquid chromatography-tandem mass spectrometry analysis of 45 phenolics resulted in quantification of 14 compounds, with quercitrin, gallic and protocatechuic acids as the most dominant. High antioxidant potential of R. canina and a moderate activity of R. arvensis extracts were determined through several assays. Purée of both species and methanol extract of air-dried R. canina hips showed some anti-inflammatory (cyclooxygenase-1 and 12-lipooxygense inhibition potency) activity. Purée of R. canina exerted cytotoxic activity only against the HeLa cell line among several others (HeLa, MCF7, HT-29 and MRC-5). The presented results support traditional use of rose hips and their fruit preserves as food with health and nutritional benefits.

  6. Hybridization between transgenic Brassica napus L. and its wild relatives: Brassica rapa L., Raphanus raphanistrum L., Sinapis arvensis L., and Erucastrum gallicum (Willd.) O.E. Schulz.

    PubMed

    Warwick, S I; Simard, M-J; Légère, A; Beckie, H J; Braun, L; Zhu, B; Mason, P; Séguin-Swartz, G; Stewart, C N

    2003-08-01

    The frequency of gene flow from Brassica napus L. (canola) to four wild relatives, Brassica rapa L., Raphanus raphanistrum L., Sinapis arvensis L. and Erucastrum gallicum (Willd.) O.E. Schulz, was assessed in greenhouse and/or field experiments, and actual rates measured in commercial fields in Canada. Various marker systems were used to detect hybrid individuals: herbicide resistance traits (HR), green fluorescent protein marker (GFP), species-specific amplified fragment length polymorphisms (AFLPs) and ploidy level. Hybridization between B. rapa and B. napus occurred in two field experiments (frequency approximately 7%) and in wild populations in commercial fields (approximately 13.6%). The higher frequency in commercial fields was most likely due to greater distance between B. rapa plants. All F(1) hybrids were morphologically similar to B. rapa, had B. napus- and B. rapa-specific AFLP markers and were triploid (AAC, 2n=29 chromosomes). They had reduced pollen viability (about 55%) and segregated for both self-incompatible and self-compatible individuals (the latter being a B. napus trait). In contrast, gene flow between R. raphanistrum and B. napus was very rare. A single R. raphanistrum x B. napus F1 hybrid was detected in 32,821 seedlings from the HR B. napus field experiment. The hybrid was morphologically similar to R. raphanistrum except for the presence of valves, a B. napus trait, in the distorted seed pods. It had a genomic structure consistent with the fusion of an unreduced gamete of R. raphanistrum and a reduced gamete of B. napus (RrRrAC, 2n=37), both B. napus- and R. raphanistrum-specific AFLP markers, and had <1% pollen viability. No hybrids were detected in the greenhouse experiments (1,534 seedlings), the GFP field experiment (4,059 seedlings) or in commercial fields in Québec and Alberta (22,114 seedlings). No S. arvensis or E. gallicum x B. napus hybrids were detected (42,828 and 21,841 seedlings, respectively) from commercial fields in

  7. Hybridization between transgenic Brassica napus L. and its wild relatives: Brassica rapa L., Raphanus raphanistrum L., Sinapis arvensis L., and Erucastrum gallicum (Willd.) O.E. Schulz.

    PubMed

    Warwick, S I; Simard, M-J; Légère, A; Beckie, H J; Braun, L; Zhu, B; Mason, P; Séguin-Swartz, G; Stewart, C N

    2003-08-01

    The frequency of gene flow from Brassica napus L. (canola) to four wild relatives, Brassica rapa L., Raphanus raphanistrum L., Sinapis arvensis L. and Erucastrum gallicum (Willd.) O.E. Schulz, was assessed in greenhouse and/or field experiments, and actual rates measured in commercial fields in Canada. Various marker systems were used to detect hybrid individuals: herbicide resistance traits (HR), green fluorescent protein marker (GFP), species-specific amplified fragment length polymorphisms (AFLPs) and ploidy level. Hybridization between B. rapa and B. napus occurred in two field experiments (frequency approximately 7%) and in wild populations in commercial fields (approximately 13.6%). The higher frequency in commercial fields was most likely due to greater distance between B. rapa plants. All F(1) hybrids were morphologically similar to B. rapa, had B. napus- and B. rapa-specific AFLP markers and were triploid (AAC, 2n=29 chromosomes). They had reduced pollen viability (about 55%) and segregated for both self-incompatible and self-compatible individuals (the latter being a B. napus trait). In contrast, gene flow between R. raphanistrum and B. napus was very rare. A single R. raphanistrum x B. napus F1 hybrid was detected in 32,821 seedlings from the HR B. napus field experiment. The hybrid was morphologically similar to R. raphanistrum except for the presence of valves, a B. napus trait, in the distorted seed pods. It had a genomic structure consistent with the fusion of an unreduced gamete of R. raphanistrum and a reduced gamete of B. napus (RrRrAC, 2n=37), both B. napus- and R. raphanistrum-specific AFLP markers, and had <1% pollen viability. No hybrids were detected in the greenhouse experiments (1,534 seedlings), the GFP field experiment (4,059 seedlings) or in commercial fields in Québec and Alberta (22,114 seedlings). No S. arvensis or E. gallicum x B. napus hybrids were detected (42,828 and 21,841 seedlings, respectively) from commercial fields in

  8. Effect of aqueous extracts of Mentha arvensis (mint) and Piper betle (betel) on growth and citrinin production from toxigenic Penicillium citrinum.

    PubMed

    Panda, Pragyanshree; Aiko, Visenuo; Mehta, Alka

    2015-06-01

    Due to growing concern of consumers about chemical residues in food products, the demand for safe and natural food is increasing greatly. The use of natural additives such as spices and herbal oil as seasoning agents for their antimicrobial activity has been extensively investigated. This paper discusses the efficacy of the aqueous extract of mint (Mentha arvensis) and betel (Piper betle) on the mycelial growth and citrinin production of Penicillium citrinum. The present investigation revealed that mint extract inhibited citrinin production up to 73 % without inhibiting the mycelium growth. The citrinin production decreased with increase in the concentration of mint extract as observed from the data obtained from High pressure liquid chromatography. The samples also showed reduced cytotoxicity on HeLa cells. On the other hand betel extract resulted in stimulatory effect on citrinin production and mycelial growth. The study showed that mint extract has the potential to be used safely for restraining citrinin contamination.

  9. Bioactive Polyphenols from the Methanol Extract of Cnicus arvensis (L.) Roth Demonstrated Antinociceptive and Central Nervous System Depressant Activities in Mice

    PubMed Central

    Nesa, Mst. Luthfun; Jahan, Ismet Ara

    2015-01-01

    Cnicus arvensis is used by many ethnic groups for inflammation, pain, and other ailments. In this study, reducing sugar, carbohydrate, alkaloid, steroid, tannin, flavonoid, and saponin groups were identified using standard chromogenic method. In high-performance liquid chromatography, vanillic acid and epicatechin were identified in the extract. Antinociceptive test by acetic acid induced writhing inhibition resulted 43.17 and 95.08% inhibition for 100 and 200 mg/kg body weight, comparing with standard diclofenac Na with 74.86% inhibition for 25 mg/kg body weight. In formalin induced paw licking test for antinociceptive activity, the extract inhibited 69.87 and 75.55% licking for 150 and 300 mg/kg body weight comparing with the inhibition (68.56%) of diclofenac Na for 10 mg/kg body weight at first phase. At late phase, the extract showed 73.12 and 87.46% licking comparing with licking inhibition (71.69%) by diclofenac Na at the same dose. In open field test for CNS depressant activity, the extract showed depression of locomotor activity for 150 and 300 mg/kg body weight comparing with diazepam for 10 mg/kg body weight. All results were statistically significant (P < 0.01). The identified polyphenols are reputed for antinociceptive and CNS depressant activity. The present findings support the use of this plant in pain. PMID:25648520

  10. Efficacy of mint (Mentha arvensis) leaf and citrus (Citrus aurantium) peel extracts as natural preservatives for shelf life extension of chill stored Indian mackerel.

    PubMed

    Viji, Pankyamma; Binsi, Puthanpurakkal Kizhakkathil; Visnuvinayagam, Sivam; Bindu, Jaganath; Ravishankar, Chandragiri Nagarajarao; Srinivasa Gopal, Teralandur Krishnaswamy

    2015-10-01

    Efficacy of mint (Mentha arvensis) leaf and citrus (Citrus aurantium) peel extracts in retarding the quality changes in Indian mackerel during chilled storage was investigated. Mint leaf extract showed higher quantity of phenolics and superior in-vitro antioxidant activities than citrus peel extract. Gutted mackerel were given a dip treatment in mint extract (0.5 %, w/v) and citrus extract (1 % w/v), packed in LDPE pouches and stored at 0-2 °C. The biochemical quality indices viz. total volatile base nitrogen (TVB-N), trimethylamine nitrogen (TMA-N), free fattyacids (FFA) were significantly (p < 0.05) lower in mint extract (ME) treated fishes compared to citrus extract (CE) treated and control fishes (C) without any treatment. Plant extract treatment significantly inhibited lipid oxidation in mackerel as indicated by peroxide value (PV) and thiobarbituric acid reactive substances (TBARS). Aerobic plate count (APC) was markedly higher in C group followed by CE group throughout the storage period. As per sensory evaluation, shelf life of Indian mackerel was determined to be 11-13 days for C group, 13-15 days for CE group and 16-17 days for ME group, during storage at 0-2 °C. PMID:26396373

  11. Efficacy of mint (Mentha arvensis) leaf and citrus (Citrus aurantium) peel extracts as natural preservatives for shelf life extension of chill stored Indian mackerel.

    PubMed

    Viji, Pankyamma; Binsi, Puthanpurakkal Kizhakkathil; Visnuvinayagam, Sivam; Bindu, Jaganath; Ravishankar, Chandragiri Nagarajarao; Srinivasa Gopal, Teralandur Krishnaswamy

    2015-10-01

    Efficacy of mint (Mentha arvensis) leaf and citrus (Citrus aurantium) peel extracts in retarding the quality changes in Indian mackerel during chilled storage was investigated. Mint leaf extract showed higher quantity of phenolics and superior in-vitro antioxidant activities than citrus peel extract. Gutted mackerel were given a dip treatment in mint extract (0.5 %, w/v) and citrus extract (1 % w/v), packed in LDPE pouches and stored at 0-2 °C. The biochemical quality indices viz. total volatile base nitrogen (TVB-N), trimethylamine nitrogen (TMA-N), free fattyacids (FFA) were significantly (p < 0.05) lower in mint extract (ME) treated fishes compared to citrus extract (CE) treated and control fishes (C) without any treatment. Plant extract treatment significantly inhibited lipid oxidation in mackerel as indicated by peroxide value (PV) and thiobarbituric acid reactive substances (TBARS). Aerobic plate count (APC) was markedly higher in C group followed by CE group throughout the storage period. As per sensory evaluation, shelf life of Indian mackerel was determined to be 11-13 days for C group, 13-15 days for CE group and 16-17 days for ME group, during storage at 0-2 °C.

  12. Productivity and quality of volatile oil extracted from Mentha spicata and M. arvensis var. piperascens grown by a hydroponic system using the deep flow technique.

    PubMed

    Vimolmangkang, Sornkanok; Sitthithaworn, Worapan; Vannavanich, Danai; Keattikunpairoj, Sunisa; Chittasupho, Chuda

    2010-01-01

    The purpose of this study was to determine the differences between spearmint (Mentha spicata L.) and Japanese mint (M. arvensis L. var. piperascens Malinv.) cultivated in either soil or nutrient solution using the deep flow technique (DFT). The differences were measured in terms of harvest period (full bloom period) and quantity and chemical components of volatile oils. The spearmint and Japanese mint were cultivated in four different nutrient formulas: plant standard nutrient, plant standard nutrient with an amino acid mixture, plant standard nutrient with a sulphur compound, and a combination of plant standard nutrient with an amino acid mixture and a sulphur compound. We observed that cultivation of spearmint and Japanese mint in nutrient solution using DFT is an effective method to provide high production of volatile oil, since it results in an earlier harvest period and higher quantity of volatile oil. We determined that for spearmint an amino acid mixture is an appropriate nutrient supplement to enhance production of volatile oil with optimum carvone content. Finally, we observed high menthol content in Japanese mint grown in all four nutrient formulas; however, supplementation with a combination of sulphur fertilisation and amino acid mixture yields the highest quantity of volatile oil.

  13. Medicinal and aromatic plant materials as nitrification inhibitors for augmenting yield and nitrogen uptake of Japanese mint (Mentha arvensis L. Var. Piperascens).

    PubMed

    Kiran, Usha; Patra, D D

    2003-02-01

    Pot experiments were conducted to evaluate the relative performance of medicinal and aromatic plant materials and dicyandiamide (DCD) as nitrification inhibitors to regulate transformation of N from urea. Their effect on the efficiencies of use of N by Japanese mint (Mentha arvensis cv. Hy 77) was tested. Urea was coated with these materials viz., Mentha spicata, Artemisia annua or DCD at the rate of 5% (w/w) of fertilizer urea using an appropriate coating technique. Nimin (tetranortriterpenoids, an ethanol extract of neem (Azadirachta indica Juss) coating was done at the rate of 1% w/w of urea. Fertilizer nitrogen was applied at 100 and 200 mg kg(-1) soil. These natural coating materials significantly increased the herb and essential oil yields of the crop at both rates of fertilizer nitrogen compared to urea alone and were found to be as effective as DCD in retarding NO3- formation in soil. Herb yield increased by 6-81% when compared to uncoated urea. The increase in essential oil yield ranged between 3% and 68% due to coating. The effectiveness of the nitrification-inhibitor--coated urea, however, varied with the soils used and the rate of fertilizer nitrogen applied. The results suggest that the natural products could be potential nitrification inhibitors for increasing fertilizer N use efficiency.

  14. Modelling Skylarks (Alauda arvensis) to Predict Impacts of Changes in Land Management and Policy: Development and Testing of an Agent-Based Model

    PubMed Central

    Topping, Christopher J.; Odderskær, Peter; Kahlert, Johnny

    2013-01-01

    Agent-based simulation models provide a viable approach for developing applied models of species and systems for predictive management. However, there has been some reluctance to use these models for policy applications due to complexity and the need for improved testing and communication of the models. We present the development and testing of a comprehensive model for Skylark (Alauda arvensis) in Danish agricultural landscapes. The model is part of the ALMaSS system, which considers not only individual skylarks, but also the detailed dynamic environment from which they obtain the information necessary to simulate their behaviour. Population responses emerge from individuals interacting with each other and the environment. Model development and testing was carried out using pattern-oriented modelling. The testing procedure was based on the model's ability to represent detailed real world patterns of distribution and density, reproductive performance and seasonal changes in territory numbers. Data to support this was collected over a 13-year period and comprised detailed field observations of breeding birds and intensive surveys. The model was able to recreate the real world data patterns accurately; it was also able to simultaneously fit a number of other secondary system properties which were not formally a part of the testing procedure. The correspondence of model output to real world data and sensitivity analysis are presented and discussed, and the model's description is provided in ODdox format (a formal description inter-linked to the program code). Detailed and stringent tests for model performance were carried out, and standardised model description and open access to the source code were provided to open development of the skylark model to others. Over and above documenting the utility of the model, this open process is essential to engender the user trust and ensure continued development of these comprehensive systems for applied purposes. PMID:23762430

  15. Effect of gibberellic acid and calliterpenone on plant growth attributes, trichomes, essential oil biosynthesis and pathway gene expression in differential manner in Mentha arvensis L.

    PubMed

    Bose, Subir K; Yadav, Ritesh Kumar; Mishra, Smrati; Sangwan, Rajender S; Singh, A K; Mishra, B; Srivastava, A K; Sangwan, Neelam S

    2013-05-01

    Extensive research is going on throughout the world to find out new molecules from natural sources to be used as plant growth promoter. Mentha arvensis L. is the main source of menthol rich essential oil used commercially in various food, pharmaceutical and other preparations. Experiments were conducted on field grown plants for understanding the effect of calliterpenone (CA), a stereo-isomer of abbeokutone, in comparison to gibberellic acid (GA3) on growth attributes, trichomes, essential oil biosynthesis and expression of some oil biosynthetic pathway genes. The exogenous application of CA (1 μM, 10 μM and 100 μM) was found to be better in improving plant biomass and stolon yield, leaf area, branching and leaf stem ratio than with counterpart GA3 at the same concentrations. CA treated plants showed higher glandular trichome number, density and diameter and also correlated with enhanced oil biogenetic capacity as revealed by feeding labeled (14)C-sucrose for 72 h to excised shoots. Semi-quantitative PCR analysis of key pathway genes revealed differential up regulation under CA treatments. Transcript level of menthol dehydrogenase/menthone reductase was found highly up regulated in CA treated plants with increased content of menthone and menthol in oil. These findings demonstrate that CA positively regulated the yields by enhanced branching and higher density of trichomes resulting into higher accumulation of essential oil. The results suggest CA as a novel plant derived diterpenoid with growth promoting action and opens up new possibilities for improving the crop yields and essential oil biosynthesis in qualitative and quantitative manner. PMID:23514759

  16. Effect of gibberellic acid and calliterpenone on plant growth attributes, trichomes, essential oil biosynthesis and pathway gene expression in differential manner in Mentha arvensis L.

    PubMed

    Bose, Subir K; Yadav, Ritesh Kumar; Mishra, Smrati; Sangwan, Rajender S; Singh, A K; Mishra, B; Srivastava, A K; Sangwan, Neelam S

    2013-05-01

    Extensive research is going on throughout the world to find out new molecules from natural sources to be used as plant growth promoter. Mentha arvensis L. is the main source of menthol rich essential oil used commercially in various food, pharmaceutical and other preparations. Experiments were conducted on field grown plants for understanding the effect of calliterpenone (CA), a stereo-isomer of abbeokutone, in comparison to gibberellic acid (GA3) on growth attributes, trichomes, essential oil biosynthesis and expression of some oil biosynthetic pathway genes. The exogenous application of CA (1 μM, 10 μM and 100 μM) was found to be better in improving plant biomass and stolon yield, leaf area, branching and leaf stem ratio than with counterpart GA3 at the same concentrations. CA treated plants showed higher glandular trichome number, density and diameter and also correlated with enhanced oil biogenetic capacity as revealed by feeding labeled (14)C-sucrose for 72 h to excised shoots. Semi-quantitative PCR analysis of key pathway genes revealed differential up regulation under CA treatments. Transcript level of menthol dehydrogenase/menthone reductase was found highly up regulated in CA treated plants with increased content of menthone and menthol in oil. These findings demonstrate that CA positively regulated the yields by enhanced branching and higher density of trichomes resulting into higher accumulation of essential oil. The results suggest CA as a novel plant derived diterpenoid with growth promoting action and opens up new possibilities for improving the crop yields and essential oil biosynthesis in qualitative and quantitative manner.

  17. Effect of the vesicular-arbuscular mycorrhizal (VAM) fungus Glomus fasciculatum on the essential oil yield related characters and nutrient acquisition in the crops of different cultivars of menthol mint (Mentha arvensis) under field conditions.

    PubMed

    Gupta, M L; Prasad, Arun; Ram, Muni; Kumar, Sushil

    2002-01-01

    The effects of inoculation with vesicular-arbuscular mycorrhizal (VAM) fungus Glomusfasciculatum on the root colonization, growth, essential oil yield and nutrient acquisition of three cultivars of menthol mint (Mentha arvensis); Kalka, Shivalik and Gomti, were studied under field conditions. The VAM inoculation significantly increased the root colonization, plant height, fresh herbage and dry matter yield. oil content and oil yield as compared to non-inoculated cultivars. The effect of VAM inoculation on the root colonization, growth and yield of mint was more pronounced with the cv Shivalik than the cvs Kalka and Gomati, indicating Shivalik as a highly mycorrhizal dependent genotype. VAM inoculation significantly increased the uptake of N, P and K by shoot tissues of mint, but most markedly increased the uptake of P. The VAM-inoculated mint plants depleted the available N, P and K in the rhizosphere soil as compared to non-inoculated control plants, however the extent of nutrient depletion was greater for P than N and K. We conclude that the VAM inoculation could significantly increase the root colonization, growth, essential oil yield and nutrient acquisition of mint for obtaining economic production under field conditions.

  18. Consumption of Buglossoides arvensis seed oil is safe and increases tissue long-chain n-3 fatty acid content more than flax seed oil - results of a phase I randomised clinical trial.

    PubMed

    Lefort, Natalie; LeBlanc, Rémi; Giroux, Marie-Andrée; Surette, Marc E

    2016-01-01

    Enrichment of tissues with ≥20-carbon n-3 PUFA like EPA is associated with positive cardiovascular outcomes. Stearidonic acid (SDA; 18 : 4n-3) and α-linolenic acid (ALA; 18 : 3n-3) are plant-derived dietary n-3 PUFA; however, direct comparisons of their impact on tissue n-3 PUFA content are lacking. Ahiflower(®) oil extracted from Buglossoides arvensis seeds is the richest known non-genetically modified source of dietary SDA. To investigate the safety and efficacy of dietary Ahiflower oil, a parallel-group, randomised, double-blind, comparator-controlled phase I clinical trial was performed. Diets of healthy subjects (n 40) were supplemented for 28 d with 9·1 g/d of Ahiflower (46 % ALA, 20 % SDA) or flax seed oil (59 % ALA). Blood and urine chemistries, blood lipid profiles, hepatic and renal function tests and haematology were measured as safety parameters. The fatty acid composition of fasting plasma, erythrocytes, polymorphonuclear cells and mononuclear cells were measured at baseline and after 14 and 28 d of supplementation. No clinically significant changes in safety parameters were measured in either group. Tissue ALA and EPA content increased in both groups compared with baseline, but EPA accrual in plasma and in all cell types was greater in the Ahiflower group (time × treatment interactions, P ≤ 0·01). Plasma and mononuclear cell eicosatetraenoic acid (20 : 4n-3) and docosapentaenoic acid (22 : 5n-3) content also increased significantly in the Ahiflower group compared with the flax group. In conclusion, the consumption of Ahiflower oil is safe and is more effective for the enrichment of tissues with 20- and 22-carbon n-3 PUFA than flax seed oil. PMID:26793308

  19. Development of DU-AGG (Depleted Uranium Aggregate)

    SciTech Connect

    Lessing, P.A.

    1995-09-01

    Depleted uranium oxide (UO{sub 2} or U0{sub 3}) powder was mixed with fine mineral additives, pressed, and heated to about 1,250{degree}C. The additives were chemically constituted to result in an iron-enriched basalt (IEB). Melting and wetting of the IEB phase caused the urania powder compact to densify (sinter) via a liquid phase sintering mechanism. An inorganic lubricant was found to aid in green-forming of the body. Sintering was successful in oxidizing (air), inert (argon), or reducing (dry hydrogen containing) atmospheres. The use of ground U0{sub 3} powders (93 vol %) followed by sintering in a dry hydrogen-containing atmosphere significantly increased the density of samples (bulk density of 8.40 g/cm{sup 3} and apparent density of 9.48 g/cm{sup 3}, open porosity of 11.43%). An improvement in the microstructure (reduction in open porosity) was achieved when the vol % of U0{sub 3} was decreased to 80%. The bulk density increased to 8.59 g/cm{sup 3}, the apparent density decreased slightly to 8.82 g/cm{sup 3} (due to increase of low density IEB content), while the open porosity decreased to an excellent number of 2.78%. A representative sample derived from 80 vol % U0{sub 3} showed that most pores were closed pores and that, overall, the sample achieved the excellent relative density value of 94.1% of the estimated theoretical density (composite of U0{sub 2} and IEB). It is expected that ground powders of U0{sub 3} could be successfully used to mass produce lowcost aggregate using the green-forming technique of briquetting.

  20. Niche partitioning in arbuscular mycorrhizal communities in temperate grasslands: a lesson from adjacent serpentine and nonserpentine habitats.

    PubMed

    Kohout, Petr; Doubková, Pavla; Bahram, Mohammad; Suda, Jan; Tedersoo, Leho; Voříšková, Jana; Sudová, Radka

    2015-04-01

    Arbuscular mycorrhizal fungi (AMF) represent an important soil microbial group playing a fundamental role in many terrestrial ecosystems. We explored the effects of deterministic (soil characteristics, host plant life stage, neighbouring plant communities) and stochastic processes on AMF colonization, richness and community composition in roots of Knautia arvensis (Dipsacaceae) plants from three serpentine grasslands and adjacent nonserpentine sites. Methodically, the study was based on 454-sequencing of the ITS region of rDNA. In total, we detected 81 molecular taxonomical operational units (MOTUs) belonging to the Glomeromycota. Serpentine character of the site negatively influenced AMF root colonization, similarly as higher Fe concentration. AMF MOTUs richness linearly increased along a pH gradient from 3.5 to 5.8. Contrary, K and Cr soil concentration had a negative influence on AMF MOTUs richness. We also detected a strong relation between neighbouring plant community composition and AMF MOTUs richness. Although spatial distance between the sampled sites (c. 0.3-3 km) contributed to structuring AMF communities in K. arvensis roots, environmental parameters were key factors in this respect. In particular, the composition of AMF communities was shaped by the complex of serpentine conditions, pH and available soil Ni concentration. The composition of AMF communities was also dependent on host plant life stage (vegetative vs. generative). Our study supports the dominance of deterministic factors in structuring AMF communities in heterogeneous environment composed of an edaphic mosaic of serpentine and nonserpentine soils.

  1. Reversible migration of silver on memorized pathways in Ag-Ge40S60 films

    NASA Astrophysics Data System (ADS)

    Orava, J.; Kozicki, M. N.; Yannopoulos, S. N.; Greer, A. L.

    2015-07-01

    Reversible and reproducible formation and dissolution of silver conductive filaments are studied in Ag-photodoped thin-film Ge40S60 subjected to electric fields. A tip-planar geometry is employed, where a conductive-atomic-force microscopy tip is the tip electrode and a silver patch is the planar electrode. We highlight an inherent "memory" effect in the amorphous chalcogenide solid-state electrolyte, in which particular silver-ion migration pathways are preserved "memorized" during writing and erasing cycles. The "memorized" pathways reflect structural changes in the photodoped chalcogenide film. Structural changes due to silver photodoping, and electrically-induced structural changes arising from silver migration, are elucidated using Raman spectroscopy. Conductive filament formation, dissolution, and electron (reduction) efficiency in a lateral device geometry are related to operation of the nano-ionic Programmable Metallization Cell memory and to newly emerging chalcogenide-based lateral geometry MEMS technologies. The methods in this work can also be used for qualitative multi-parameter sampling of metal/amorphous-chalcogenide combinations, characterizing the growth/dissolution rates, retention and endurance of fractal conductive filaments, with the aim of optimizing devices.

  2. Acute toxicity, brine shrimp cytotoxicity, anthelmintic and relaxant potentials of fruits of Rubus fruticosus Agg

    PubMed Central

    2013-01-01

    Background Rubus fruticosus is used in tribal medicine as anthelmintic and an antispasmodic. In the current work, we investigated the anthelmintic and antispasmodic activities of crude methanol extract of fruits of R. fruticosus on scientific grounds. Acute toxicity and brine shrimp cytotoxicity activity of the extract were also performed. Methods Acute toxicity study of crude methanol extract of R. fruticosus was performed on mice. In vitro Brine shrimp cytotoxicity assay was performed on shrimps of Artemia salina. In vitro Anthelmintic activity was tested against Raillietina spiralis and Ascaridia galli. Relaxant activities were tested on spontaneous rabbits’ jejunal preparations. Calcium chloride curves were constructed to elucidate possible mode of action of the extract. Results LD 50 of the extract for acute toxicity studies was 887.75 ± 9.22 mg/ml. While CC 50 of the extract for Brine shrimps cytotoxicity assay was 13.28 ± 2.47 μg/ml. Test samples of crude methanolic extract of R. fruticosus (Rf.Cr) at concentration 20 mg/ml showed excellent anthelmintic activity against Raillietina spiralis. Anthelmintic activity was 1.37 times of albendazole against the Raillietina spiralis at concentration 40 mg/ml. At higher concentration (40 mg/ml), Rf.Cr has 89. 83% parasiticidal activity. The mean EC50 relaxation activity for spontaneous and KCl-induced contractions was 7.96 ± 0.1 and 6.45 ± 0.29 mg/ml, respectively. EC 50 (Log[Ca++]M) for control calcium chloride curves was −1.75 ± 0.01 vs. EC 50 −1.78 ± 0.06 in the presence of 3.0 mg/ml of Rf.Cr. Similarly, EC 50(Log[Ca++]M) in the absence and presence of verapamil (0.1 μM) were −2.46 ± 0.01 and −1.72 ± 0.02, respectively. Conclusions The anthelmintic and relaxant activities explained traditional uses of R. fruticosus on scientific grounds. Relaxant activity follows the inhibition of voltage gated channels. Although the plant extract has cytotoxic effects, yet it is evident from acute toxicity study that it is safe in concentration 100 mg/kg. Further work is required to isolate pharmacologically active compounds. PMID:23773797

  3. Morphological injury to cut-leaf teasel, Dipsacus laciniatus L. (Dipsacaceae) induced by the eriophyid mite Leipothrix dipsacivagus Petanovic et Rector (Acari: Eriophyoidea)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The eriophyid mite Leipothrix dipsacivagus Petanovic et Rector provokes severe malformations to its host plant, cut-leaf teasel (Dipsacus laciniatus L.), in the field. These injuries were examined at the morpho-anatomical level in infested plants collected in the field and experimentally infested p...

  4. Phenotypic Differences Among Leipothrix dipsacivagus Pet. et Rector and L. knautiae (Liro) (Acari: Prostigmata: Eriophyidae) Populations Inhabiting Dipsacus L. and Knautia L. (Dipsacaceae) Plants

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Only three eriophyoid mite species of the genus Leipothrix Keifer are known to occur on dipsacaceous plants including hosts in the genera Knautia (L.) Succisa Haller, and Dipsacus L.. These three species are similar, but differ in few key characters. Description of eriophyoids includes over 250 char...

  5. Effect of foliar treatments on distribution of /sup 14/C-glyphosate in Convolvulus arvensis L

    SciTech Connect

    Lauridson, T.C.

    1986-01-01

    Field bindweed is a perennial weed which produces shoots from buds on its roots. Herbicides, such as glyphosate (N-(phosphonomethyl)glycine) used for control of field bindweed usually do not kill all shoot buds on the roots, thus field bindweed often reinfests areas within 3 to 6 weeks of treatment. This dissertation deals with the development of a technique to change glyphosate distribution in field bindweed roots and could result in less shoot regrowth after glyphosate application. In field studies eight plant growth regulators were applied in September, 3 days before 2.24 kg/ha of 2.4-D((2,4-dichlorophenoxy) acetic acid) or 1.68 kg/ha of glyphosate. Eight months later, regrowth of shoots was least where glyphosate was applied at 0.028 kg/ha as a pretreatment, followed by a standard rate of 1.68 kg/ha. In subsequent greenhouse studies, typical patterns of shoot growth and /sup 14/C-glyphosate distribution in isolated root sections taken from 15-week-old intact plants were determined. In subsequent growth chamber studies, plants were decapitated to observe the effect of shoot apical dominance on /sup 14/C-glyphosate translocation. After /sup 14/C-glyphosate was applied, intact plants had about twice as much /sup 14/C in distal root sections as in proximal or middle root sections. Decapitated plants had more /sup 14/C in proximal and middle root sections than in distal sections, and about twice as much /sup 14/C was translocated to roots of decapitated plants than intact plants. Eight concentrations of 2,4,-D or glyphosate from 1 to 5000 ppm were applied in logarithmic series to 6-week old plants.

  6. Organic C dynamics and its conservation under wheat (Triticum aesetivum) - mint (Mentha arvensis)-Sesbania rostrata cropping in sub-tropical condition of northern Indo-Gangetic plains.

    PubMed

    Patra, D D; Chand, Sukhmal; Anwar, M

    2014-03-15

    Soil organic carbon (SOC) is accumulated or depleted as a result of cropping and management strategies. It plays a significant role in maintaining soil quality, plant productivity and mitigating greenhouse gas emission. We studied the long-term (20 years) influence of a wheat-mint-Sesbania cropping system on the SOC stock. Estimates of stabilization of SOC in different pools and a tentative C budget were also developed. Twenty years of cultivation caused a decrease in SOC only in control soils, which received no manure and fertilizer. However, it increased with balanced use of NPK inputs. Soil C stock decreased significantly with increased in soil depth 0-15 cm to 15-30 and 30-45 cm. About 6% (-2 to+14) of the C added in crop residues and green manure were stabilized in the soil. On an average 12%, 14%, 59%, 15% of the water stable aggregates were in the >2 mm, 2.0-0.25 mm, 0.25-0.05 mm, and <0-0.5 size fractions, respectively. Significant improvements in structural stability and nitrogen availability were detected in all the treatments compared to the control. The amount of organic C oxidizable by a modified Walkley and Black method, which involves using only half of the amount of sulphuric acid, is a more sensitive indicator of the improvement in soil quality parameters under investigation, namely SOC, and increases in mineralizable N and water stable aggregation than the standard method.

  7. Optimization of water and nitrogen application to menthol mint (Mentha arvensis L.) through sugarcane trash mulch in a sandy loam soil of semi-arid subtropical climate.

    PubMed

    Ram, Dasha; Ram, Muni; Singh, Ranjeet

    2006-05-01

    Studies were carried out to optimize the use of water and nutrients by the crop with three moisture regimes [0.9, 1.2 and 1.5 irrigation water:cumulative pan evaporation (IW:CPE) ratios], two variables of organic mulch (control and sugarcane trash at 7 t/ha) and three levels of nitrogen (0, 100 and 200 kg/ha). Soil moisture regimes maintained at 1.2 IW:CPE ratio significantly increased the crop growth and herb and essential oil yields as compared with that of 0.9 IW:CPE ratio. The increase in herb yield due to 1.5 and 1.2 IW:CPE ratios was recorded to be 28.5% and 19%, respectively, over the irrigation given at 0.9 IW:CPE ratio, with the corresponding increase in essential oil yield to the extent of 23.5% and 15.5%. Interaction effect of moisture regimes and nitrogen rates indicated that increasing levels of irrigation at the highest level of N (200 kg/ha) improved essential oil yield of the crop. Application of N at 200 kg/ha in the mulched plots significantly enhanced the N uptake by the crop and essential oil yield over the control and 100 kg N/ha applied in the mulched/or unmulched plots and 200 kg N/ha applied in the unmulched plots. Application of organic mulch and nitrogen at 200 kg/ha improved the water use efficiency (WUE) in menthol mint crop. Higher moisture regimes maintained up to 1.2 IW:CPE ratio increased the WUE. The quality of essential oil in terms of its major constituent, menthol, improved slightly with 1.2 IW:CPE ratio as compared to 0.9 and 1.5 IW:CPE ratios at first and second harvests of the crop. It is recommended that menthol mint crop could be grown profitably by providing 16 irrigations, that is 80 cm water (based on 1.2 IW:CPE ratio) and nitrogen at 200 kg/ha in the sugarcane trash mulched plots, which could give a highest benefit:cost ratio from menthol mint cropping.

  8. Organic C dynamics and its conservation under wheat (Triticum aesetivum) - mint (Mentha arvensis)-Sesbania rostrata cropping in sub-tropical condition of northern Indo-Gangetic plains.

    PubMed

    Patra, D D; Chand, Sukhmal; Anwar, M

    2014-03-15

    Soil organic carbon (SOC) is accumulated or depleted as a result of cropping and management strategies. It plays a significant role in maintaining soil quality, plant productivity and mitigating greenhouse gas emission. We studied the long-term (20 years) influence of a wheat-mint-Sesbania cropping system on the SOC stock. Estimates of stabilization of SOC in different pools and a tentative C budget were also developed. Twenty years of cultivation caused a decrease in SOC only in control soils, which received no manure and fertilizer. However, it increased with balanced use of NPK inputs. Soil C stock decreased significantly with increased in soil depth 0-15 cm to 15-30 and 30-45 cm. About 6% (-2 to+14) of the C added in crop residues and green manure were stabilized in the soil. On an average 12%, 14%, 59%, 15% of the water stable aggregates were in the >2 mm, 2.0-0.25 mm, 0.25-0.05 mm, and <0-0.5 size fractions, respectively. Significant improvements in structural stability and nitrogen availability were detected in all the treatments compared to the control. The amount of organic C oxidizable by a modified Walkley and Black method, which involves using only half of the amount of sulphuric acid, is a more sensitive indicator of the improvement in soil quality parameters under investigation, namely SOC, and increases in mineralizable N and water stable aggregation than the standard method. PMID:24531383

  9. Monoterpenoid glucoindole alkaloids and iridoids from Pterocephalus pinardii.

    PubMed

    Gülcemal, Derya; Masullo, Milena; Alankuş-Calişkan, Ozgen; Karayildirim, Tamer; Senol, Serdar G; Piacente, Sonia; Bedir, Erdal

    2010-03-01

    A new secondary metabolite, pterocephaline, along with the known cantleyoside, 7alpha-morroniside, 3beta,5alpha-tetrahydrodesoxycordifoline lactam, 5S-5-carboxyvincoside, sweroside, and loganin have been isolated from the aerial parts of P. pinardii (Dipsacaceae). Moreover, cantleyoside-methyl-hemiacetal and cantleyoside-dimethyl-acetal were obtained as seco-iridoid artifacts. The structures were elucidated by extensive spectroscopic methods including 1D-((1)H, (13)C and TOCSY) and 2D-NMR (DQF-COSY, HSQC and HMBC). Monoterpenoid glucoindole alkaloids were encountered for the first time in Dipsacaceae family.

  10. Gene and stress history interplay in emergence of PTSD-like features.

    PubMed

    Chakraborty, Nabarun; Meyerhoff, James; Gautam, Aarti; Muhie, Seid; Jibitu, Meskerem; De Lima, Thereza C M; Hammamieh, Rasha; Jett, Marti

    2015-10-01

    Systematically distinguishing genetic liability from other contributing factors is critical for designing a preventive strategy for post-traumatic stress disorder (PTSD). To address this issue, we investigated a murine model exposing C57BL/6j, DBA/2j and BALB/cj mice to repeated stress via exposure to conspecific aggressors (Agg-E). Naïve mice from each strain were subjected to the proximity of aggressor (Agg) mice for 6h using a 'cage-within-a-cage' paradigm, which was repeated for 5 or 10 days with intermittent and unpredictable direct contact with Agg mice. During the Agg-E stress, DBA/2j developed a different strategy to evade Agg mice, which potentially contributed to its phenotypic resilience to Agg-E stress. Although Agg mice inflicted C57BL/6j and BALB/cj with equivalent numbers of strikes, BALB/cj displayed a distinct behavioral phenotype with delayed exhibition of a number of PTSD-like features. By contrast, C57BL/6j mice displayed unique vulnerability to Agg-E stress induced myocardopathy, possibly attributable to their particular susceptibility to hypoxia. A group of genes (Bdnf, Ngf, Zwint, Cckbr, Slc6a4, Fkbp5) linked to PTSD and synaptic plasticity were significantly altered in C57BL/6j and BALB/cj Agg-E mice. Contributions of Agg-E stress history and genotypic heterogeneity emerged as the key mediators of PTSD-like features. Linking genetic components to specific phenotypic and pathological features could have potential clinical implications.

  11. A new species of Leipothrix Keifer, 1966 (Acari: Eriophyidae) on Dipsacus spp. in Europe and reassignment of two Epitrimerus spp. (Acari: Eriophyidae) to the genus Leipothrix

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new species of eriophyid mite, Leipothrix dipsacivagus n. sp., collected from Dipsacus laciniatus L. (Dipsacaceae) and D. fullonum L. in Serbia and Montenegro, Bulgaria, and France, is described and illustrated. Differential diagnosis is provided in comparison with Leipothrix knautiae (Liro) n. co...

  12. Host range testing and biology of Abia sericea (Cimbicidae), a candidate for biological control of invasive teasels (Dipsacus spp.) in North America

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Invasive teasels (Dipsacus spp., Dipsacaceae) are widespread in the USA, being present in 43 states and listed as noxious in five. The cimbicid sawfly Abia sericea (L.) is under evaluation as a potential agent for biological control of teasels. The host range, biology, and life history of this ins...

  13. Dual Lipid Modification of Arabidopsis Gγ-Subunits Is Required for Efficient Plasma Membrane Targeting1[C][W][OA

    PubMed Central

    Zeng, Qin; Wang, Xuejun; Running, Mark P.

    2007-01-01

    Posttranslational lipid modifications are important for proper localization of many proteins in eukaryotic cells. However, the functional interrelationships between lipid modification processes in plants remain unclear. Here we demonstrate that the two heterotrimeric G-protein γ-subunits from Arabidopsis (Arabidopsis thaliana), AGG1 and AGG2, are prenylated, and AGG2 is S-acylated. In wild type, enhanced yellow fluorescent protein-fused AGG1 and AGG2 are associated with plasma membranes, with AGG1 associated with internal membranes as well. Both can be prenylated by either protein geranylgeranyltransferase I (PGGT-I) or protein farnesyltransferase (PFT). Their membrane localization is intact in mutants lacking PFT activity and largely intact in mutants lacking PGGT-I activity but is disrupted in mutants lacking both PFT and PGGT-I activity. Unlike in mammals, Arabidopsis Gγs do not rely on functional Gα for membrane targeting. Mutation of the sixth to last cysteine, the putative S-acylation acceptor site, causes a dramatic change in AGG2 but not AGG1 localization pattern, suggesting S-acylation serves as an important additional signal for AGG2 to be targeted to the plasma membrane. Domain-swapping experiments suggest that a short charged sequence at the AGG2 C terminus contributes to AGG2's efficient membrane targeting compared to AGG1. Our data show the large degree to which PFT and PGGT-I can compensate for each other in plants and suggest that differential lipid modification plays an important regulatory role in plant protein localization. PMID:17220359

  14. Agglutinogens and fimbriae of Bordetella pertussis.

    PubMed

    Ashworth, L A; Robinson, A; Funnell, S; Gorringe, A R; Irons, L I; Seabrook, R N

    1988-01-01

    Agglutinogen 2 (AGG2) of Bordetella pertussis is a fimbrial antigen and therefore a potential adhesin and acellular vaccine component. AGG2 was found to dissociate only under harsh conditions into the subunits of mol. wt. 22500 seen in SDS-PAGE. Results from studies of agglutinogen 3 (AGG3) are presented which confirm previous findings from this Laboratory that AGG3 is also a fimbrial protein but with a subunit mol. wt. of 22000. The amino acid sequence of AGG2, deduced from the nucleotide sequence of the gene encoding it, was used as a basis for synthesis of three peptides. Coupled to Keyhole Limpet Haemocyanin (KLH), the peptides were immunogenic in mice, inducing antibodies which bound well to homologous peptide in ELISA but poorly to intact fimbriae. Monoclonal and polyclonal serotype-specific antibodies failed to react significantly with the peptides or their KLH-conjugates. These results indicate that the synthetic peptides do not represent the serotype 2 epitope. Mice immunized with purified AGG2 or AGG3 were found to be protected against respiratory infection with B. pertussis. Results presented here indicate that this protection is, to a large extent, serotype-specific and that immunization of mice with AGG2 or AGG3 can lead to a change in serotype of the infecting strain. These results are analogous to findings from epidemiological studies of the protection induced in children by whole cell vaccines. They reaffirm the importance of both AGG2 and AGG3 as components of whole cell and acellular vaccines. PMID:2908520

  15. Estimating the Reliability of Aggregated and Within-Person Centered Scores in Ecological Momentary Assessment

    ERIC Educational Resources Information Center

    Huang, Po-Hsien; Weng, Li-Jen

    2012-01-01

    A procedure for estimating the reliability of test scores in the context of ecological momentary assessment (EMA) was proposed to take into account the characteristics of EMA measures. Two commonly used test scores in EMA were considered: the aggregated score (AGGS) and the within-person centered score (WPCS). Conceptually, AGGS and WPCS represent…

  16. Etiological Distinctions between Aggressive and Non-Aggressive Antisocial Behavior: Results from a Nuclear Twin Family Model

    ERIC Educational Resources Information Center

    Burt, S. Alexandra; Klump, Kelly L.

    2012-01-01

    A recent meta-analysis of 103 studies Burt ("Clinical Psychology Review," 29:163-178, 2009a) highlighted the presence of etiological distinctions between aggressive (AGG) and non-aggressive rule-breaking (RB) dimensions of antisocial behavior, such that AGG was more heritable than was RB, whereas RB was more influenced by the shared environment.…

  17. An examination of abnormal grain growth in low strain nickel-200

    DOE PAGES

    Underwood, O.; Madison, J.; Martens, R. M.; Thompson, G. B.; Welsh, S.; Evans, J.

    2016-06-21

    Here, this study offers experimental observation of the effect of low strain conditions (ε < 10%) on abnormal grain growth (AGG) in Nickel-200. At such conditions, stored mechanical energy is low within the microstructure enabling one to observe the impact of increasing mechanical deformation on the early onset of AGG compared to a control, or nondeformed, equivalent sample. The onset of AGG was observed to occur at specific pairings of compressive strain and annealing temperature and an empirical relation describing the influence of thermal exposure and strain content was developed. The evolution of low-Σ coincident site lattice (CSL) boundaries andmore » overall grain size distributions are quantified using electron backscatter diffraction preceding, at onset and during ensuing AGG, whereby possible mechanisms for AGG in the low strain regime are offered and discussed.« less

  18. N-Acetylglucosaminylation of Serine-Aspartate Repeat Proteins Promotes Staphylococcus aureus Bloodstream Infection*

    PubMed Central

    Thomer, Lena; Becker, Samuel; Emolo, Carla; Quach, Austin; Kim, Hwan Keun; Rauch, Sabine; Anderson, Mark; LeBlanc, James F.; Schneewind, Olaf; Faull, Kym F.; Missiakas, Dominique

    2014-01-01

    Staphylococcus aureus secretes products that convert host fibrinogen to fibrin and promote its agglutination with fibrin fibrils, thereby shielding bacteria from immune defenses. The agglutination reaction involves ClfA (clumping factor A), a surface protein with serine-aspartate (SD) repeats that captures fibrin fibrils and fibrinogen. Pathogenic staphylococci express several different SD proteins that are modified by two glycosyltransferases, SdgA and SdgB. Here, we characterized three genes of S. aureus, aggA, aggB (sdgA), and aggC (sdgB), and show that aggA and aggC contribute to staphylococcal agglutination with fibrin fibrils in human plasma. We demonstrate that aggB (sdgA) and aggC (sdgB) are involved in GlcNAc modification of the ClfA SD repeats. However, only sdgB is essential for GlcNAc modification, and an sdgB mutant is defective in the pathogenesis of sepsis in mice. Thus, GlcNAc modification of proteins promotes S. aureus replication in the bloodstream of mammalian hosts. PMID:24344128

  19. An atypical heterotrimeric G-protein γ-subunit is involved in guard cell K⁺-channel regulation and morphological development in Arabidopsis thaliana.

    PubMed

    Chakravorty, David; Trusov, Yuri; Zhang, Wei; Acharya, Biswa R; Sheahan, Michael B; McCurdy, David W; Assmann, Sarah M; Botella, José Ramón

    2011-09-01

    Currently, there are strong inconsistencies in our knowledge of plant heterotrimeric G-proteins that suggest the existence of additional members of the family. We have identified a new Arabidopsis G-protein γ-subunit (AGG3) that modulates morphological development and ABA-regulation of stomatal aperture. AGG3 strongly interacts with the Arabidopsis G-protein β-subunit in vivo and in vitro. Most importantly, AGG3-deficient mutants account for all but one of the 'orphan' phenotypes previously unexplained by the two known γ-subunits in Arabidopsis. AGG3 has unique characteristics never before observed in plant or animal systems, such as its size (more than twice that of canonical γ-subunits) and the presence of a C-terminal Cys-rich domain. AGG3 thus represent a novel class of G-protein γ-subunits, widely spread throughout the plant kingdom but not present in animals. Homologues of AGG3 in rice have been identified as important quantitative trait loci for grain size and yield, but due to the atypical nature of the proteins their identity as G-protein subunits was thus far unknown. Our work demonstrates a similar trend in seeds of Arabidopsis agg3 mutants, and implicates G-proteins in such a crucial agronomic trait. The discovery of this highly atypical subunit reinforces the emerging notion that plant and animal G-proteins have distinct as well as shared evolutionary pathways. PMID:21575088

  20. Analysis of FMR1 (CGG)n alleles and FRAXA microsatellite haplotypes in the population of Greenland: implications for the population of the New World from Asia.

    PubMed

    Larsen, L A; Armstrong, J S; Grønskov, K; Hjalgrim, H; Brøndum-Nielsen, K; Hasholt, L; Nørgaard-Pedersen, B; Vuust, J

    1999-01-01

    The fragile X syndrome is caused by the expansion of a polymorphic (CGG)n tract in the promoter region of the FMR1 gene. Apparently the incidence of fragile X syndrome is rare in the population of Greenland. In order to examine population-related factors involved in stability of the (CGG)n sequence, DNA samples obtained randomly from the Greenlandic population were analysed for size and AGG interspersion pattern of the FMR1 (CGG)n region and associated DXS548-FRAXAC1 haplotypes. In addition a large Greenland family with unstable transmission in the premutation range was analysed. The (CGG)n allele sizes in the Greenland population showed a narrow distribution similar to that reported for Asian populations. DNA sequencing of alleles with 36 CGG repeats revealed an AGG(CGG)6 insertion previously reported exclusively in Asian populations and a high frequency of alleles with a (CGG)10AGG(CGG)9AGG(CGG)9 or (CGG)9AGG(CGG)9AGG(CGG)6AGG(CGG)9 sequence pattern was found. Thus the data confirm the Asian origin of the Greenlandic (Eskimo) population and indicates that some (CGG)n alleles have remained stable for 15-30,000 years, since the population of the New World arrived from Asia via the Bering Strait. PMID:10573009

  1. Recoding method that removes inhibitory sequences and improves HIV gene expression

    DOEpatents

    Rabadan, Raul; Krasnitz, Michael; Robins, Harlan; Witten, Daniela; Levine, Arnold

    2016-08-23

    The invention relates to inhibitory nucleotide signal sequences or "INS" sequences in the genomes of lentiviruses. In particular the invention relates to the AGG motif present in all viral genomes. The AGG motif may have an inhibitory effect on a virus, for example by reducing the levels of, or maintaining low steady-state levels of, viral RNAs in host cells, and inducing and/or maintaining in viral latency. In one aspect, the invention provides vaccines that contain, or are produced from, viral nucleic acids in which the AGG sequences have been mutated. In another aspect, the invention provides methods and compositions for affecting the function of the AGG motif, and methods for identifying other INS sequences in viral genomes.

  2. Digital data from the Great Sand Dunes airborne gravity gradient survey, south-central Colorado

    USGS Publications Warehouse

    Drenth, B.J.; Abraham, J.D.; Grauch, V.J.S.; Labson, V.F.; Hodges, G.

    2013-01-01

    This report contains digital data and supporting explanatory files describing data types, data formats, and survey procedures for a high-resolution airborne gravity gradient (AGG) survey at Great Sand Dunes National Park, Alamosa and Saguache Counties, south-central Colorado. In the San Luis Valley, the Great Sand Dunes survey covers a large part of Great Sand Dunes National Park and Preserve. The data described were collected from a high-resolution AGG survey flown in February 2012, by Fugro Airborne Surveys Corp., on contract to the U.S. Geological Survey. Scientific objectives of the AGG survey are to investigate the subsurface structural framework that may influence groundwater hydrology and seismic hazards, and to investigate AGG methods and resolution using different flight specifications. Funding was provided by an airborne geophysics training program of the U.S. Department of Defense's Task Force for Business & Stability Operations.

  3. EMERGING TECHNOLOGY BULLETIN: SPOUTED BED REACTOR

    EPA Science Inventory

    The Spouted Bed Reactor (SBR) technology utilizes the unique attributes of the "spouting " fluidization regime, which can provide heat transfer rates comparable to traditional fluid beds, while providing robust circulation of highly heterogeneous solids, concurrent with very agg...

  4. CTEPP OVERVIEW: A PILOT STUDY OF CHILDREN'S TOTAL EXPOSURE TO PERSISTENT PESTICIDES AND OTHER PERSISTENT ORGANIC POLLUTANTS

    EPA Science Inventory

    The research study, "Children's Total Exposure to Persistent Pesticides and Other Persistent Organic Pollutants," (CTEPP) is a pilot-scale project involving about 260 children in their everyday surroundings. The objectives of CTEPP are twofold: (1) To measure the agg...

  5. Antinociceptive activity of Astragalus gummifer gum (gum tragacanth) through the adrenergic system: A in vivo study in mice

    PubMed Central

    Bagheri, Seyyed Majid; Keyhani, Leila; Heydari, Mehrangiz; Dashti-R, Mohammad Hossein

    2015-01-01

    Background: In Iranian traditional medicine, gum obtained from Astragalus gummifer and some other species of Astragalus was used as analgesic agent. Objective: In this study, we investigated the antinociceptive effect of several concentrations (125, 250, and 500 μg/kg body weight) of Astragalus gummifer gum (AGG) on thermal and acetic acid induced pain in mice. Materials and Methods: AGG was dissolved in distillated water and injected i.p to male mice 15 minute before the onset of experiment. Writhing and hot-plate tests were applied to study the analgesic effect of AGG and compared with that of diclofenac sodium (30 mg/kg, i.p.) or morphine (8 mg/kg, i.p). To investigate the mechanisms involved in antinociception, yohimbine, naloxone, glibenclamide, and theophylline were used in writhing test. These drugs were injected intraperitoneally 15 min before the administration of AGG. The number of writhes were counted in 30 minutes and analyzed. Results: AGG exhibited a significant antinociceptive effect and the most effective dose of AGG was 500 μg/kg. The most maximum possible effect (%MPE) was observed (117.4%) 15 min after drug administration. The %inhibition of acetic acid-induced writhing in AGG 125, 250 and 500 was 47%, 50% and 54% vs %15 of control and 66.3% of diclofenac sodium group. The antinociceptive effect induced by this gum in the writhing test was reversed by the systemic administration of yohimbine (α2-adrenergic antagonist), but naloxone, glibenclamide, and theophylline did not reverse this effect. Conclusions: The findings of this study indicated that AGG induced its antinociceptive through the adrenergic system. PMID:25878459

  6. Typical Enteroaggregative Escherichia coli Is the Most Prevalent Pathotype among E. coli Strains Causing Diarrhea in Mongolian Children

    PubMed Central

    Sarantuya, Jav; Nishi, Junichiro; Wakimoto, Naoko; Erdene, Shirchin; Nataro, James P.; Sheikh, Jalaluddin; Iwashita, Mayumi; Manago, Kunihiro; Tokuda, Koichi; Yoshinaga, Masao; Miyata, Koichiro; Kawano, Yoshifumi

    2004-01-01

    Diarrhea remains one of the main sources of morbidity and mortality in the world, and a large proportion is caused by diarrheagenic Escherichia coli. In Mongolia, the epidemiology of diarrheagenic E. coli has not been well studied. A total of 238 E. coli strains from children with sporadic diarrhea and 278 E. coli strains from healthy children were examined by PCR for 10 virulence genes: enteropathogenic E. coli (EPEC) eae, tir, and bfpA; enterotoxigenic E. coli (ETEC) lt and st; enteroinvasive E. coli (EIEC) ipaH; enterohemorragic E. coli stx1 and stx2; and enteroaggregative E. coli (EAEC) aggR and astA. EAEC strains without AggR were identified by the HEp-2 cell adherence test. The detection of EAEC, ETEC, EPEC, and EIEC was significantly associated with diarrhea. The incidence of EAEC (15.1%), defined by either a molecular or a phenotypic assay, was higher in the diarrheal group than any other category (0 to 6.0%). The incidence of AggR-positive EAEC in the diarrheal group was significantly higher than in the control group (8.0 versus 1.4%; P = 0.0004), while that of AggR-negative EAEC was not (7.1 versus 4.3%). Nineteen AggR-positive EAEC strains harbored other EAEC virulence genes—aggA, 2 (5.5%); aafA, 4 (11.1%); agg-3a, 5 (13.8%); aap, 8 (22.2%); aatA, 11 (30.5%); capU, 9 (25.0%); pet, 6 (16.6%); and set, 3 (8.3%)—and showed 15 genotypes. EAEC may be an important pathogen of sporadic diarrhea in Mongolian children. Genetic analysis showed the heterogeneity of EAEC but illustrated the importance of the AggR regulon (denoting typical EAEC) as a marker for virulent EAEC strains. PMID:14715743

  7. Comparative Study of Bone Marrow and Blood B Cells in Infantile and Acquired Agammaglobulinemia

    PubMed Central

    Abdou, Nabih I.; Casella, Salvatore R.; Abdou, Nancy L.; Abrahamsohn, Ises A.

    1973-01-01

    The status of immunoglobulin (Ig) receptors of the bone marrow dependent (B) cells present in either the bone marrow (BM) or peripheral blood (PB) of three patients with infantile agammaglobulinemia (I-AGG), or seven patients with acquired agammaglobulinemia (A-AGG) is compared with those of 12 controls. Quantitative and qualitative changes of the different classes of Ig receptors on B cells were evaluated by their capacity to bind [125I]anti-Ig, to be stained with fluorescinated anti-Ig and their in vitro proliferative capacity upon incubation with the anti-Ig. Patients with I-AGG lacked B cells in both the BM and PB. Whereas BM cells of patients with A-AGG carried receptors similar to control cells, their blood B cells had fewer IgM, IgG, and IgA cells which failed to proliferate in vitro in the presence of the anti-Ig. An anti-IgM of the IgG class was detected in the sera of patients with A-AGG but not in sera of I-AGG. The isolated anti-IgM agglutinated human red cells coated with IgM. The anti-IgM partially blocked the binding of fluorescinated or radiolabeled anti-IgM to IgM peripheral blood lymphocytes of normal controls. The eluted anti-IgM in presence of complement was partially cytotoxic to normal cells. It is concluded that I-AGG-B cell defect is due to failure of B cell development in the bone marrow compartment whereas the peripheral exclusion of IgM cells by an anti-IgM with the subsequent failure of differentiation of both IgG and IgA cells could be an important mechanism in A-AGG-B cell defect. PMID:4580388

  8. Normal and Shear Interactions between Hyaluronan–Aggrecan Complexes Mimicking Possible Boundary Lubricants in Articular Cartilage in Synovial Joints

    PubMed Central

    2012-01-01

    Using a surface force balance, normal and shear interactions have been measured between two atomically smooth surfaces coated with hyaluronan (HA), and with HA/aggrecan (Agg) complexes stabilized by cartilage link protein (LP). Such HA/Agg/LP complexes are the most abundant mobile macromolecular species permeating articular cartilage in synovial joints and have been conjectured to be present as boundary lubricants at its surface. The aim of the present study is to gain insight into the extremely efficient lubrication when two cartilage surfaces slide past each other in healthy joints, and in particular to elucidate the possible role in this of the HA/Agg/LP complexes. Within the range of our parameters, our results reveal that the HA/Agg/LP macromolecular surface complexes are much better boundary lubricants than HA alone, likely because of the higher level of hydration, due to the higher charge density, of the HA/Agg/LP layers with respect to the HA alone. However, the friction coefficients (μ) associated with the mutual interactions and sliding of opposing HA/Agg/LP layers (μ ≈ 0.01 up to pressure P of ca. 12 atm, increasing sharply at higher P) suggest that such complexes by themselves cannot account for the remarkable boundary lubrication observed in mammalian joints (up to P > 50 atm). PMID:23074968

  9. Rose Prickles and Asparagus Spines--Different Hook Structures as Attachment Devices in Climbing Plants.

    PubMed

    Gallenmüller, Friederike; Feus, Amélie; Fiedler, Kathrin; Speck, Thomas

    2015-01-01

    Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis 'Splendens', Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots). Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis 'Splendens' three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar). In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis 'Splendens' prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1) a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2) occurrence of a diversity of shape and geometry within one individual, (3) failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm²) and (4) failure of the hooks without severe stem damage (at least in the tested wild species). PMID:26629690

  10. Rose Prickles and Asparagus Spines--Different Hook Structures as Attachment Devices in Climbing Plants.

    PubMed

    Gallenmüller, Friederike; Feus, Amélie; Fiedler, Kathrin; Speck, Thomas

    2015-01-01

    Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis 'Splendens', Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots). Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis 'Splendens' three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar). In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis 'Splendens' prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1) a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2) occurrence of a diversity of shape and geometry within one individual, (3) failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm²) and (4) failure of the hooks without severe stem damage (at least in the tested wild species).

  11. Rose Prickles and Asparagus Spines – Different Hook Structures as Attachment Devices in Climbing Plants

    PubMed Central

    Fiedler, Kathrin

    2015-01-01

    Functional morphology and biomechanical properties of hook structures functioning as attachment devices in the leaning climbers Rosa arvensis, Rosa arvensis ‘Splendens‘, Asparagus falcatus and Asparagus setaceus are analysed in order to investigate the variability in closely related species as well as convergent developments of hook structure and properties in distant systematic lineages (monocots and dicots). Prickles and spines were characterised by their size, orientation and the maximum force measured at failure in mechanical tests performed with traction forces applied at different angles. In Rosa arvensis and Rosa arvensis ‘Splendens‘ three types of prickles differing largely in geometrical and mechanical properties are identified (prickles of the wild species and two types of prickles in the cultivar). In prickles of Rosa arvensis no particular orientation of the prickle tip is found whereas in the cultivar Rosa arvensis ‘Splendens‘ prickles gradually gain a downward-orientation due to differential growth in the first weeks of their development. Differences in mechanical properties and modes of failure are correlated to geometrical parameters. In Asparagus falcatus and Asparagus setaceus spines are composed of leaf tissue, stem tissue and tissue of the axillary bud. Between species spines differ in size, orientation, distribution along the stem, tissue contributions and mechanical properties. The prickles of Rosa arvensis and its cultivar and the spines of the studied Asparagus species have several traits in common: (1) a gradual change of cell size and cell wall thickness, with larger cells in the centre and smaller thick-walled cells at the periphery of the hooks, (2) occurrence of a diversity of shape and geometry within one individual, (3) failure of single hooks when submitted to moderate mechanical stresses (Fmax/basal area < 35 N/mm²) and (4) failure of the hooks without severe stem damage (at least in the tested wild species). PMID

  12. A large family of anti‐activators accompanying XylS/AraC family regulatory proteins

    PubMed Central

    Yan, Michael B.; Tran, Minh; Wright, Nathan; Luzader, Deborah H.; Kendall, Melissa M.; Ruiz‐Perez, Fernando; Nataro, James P.

    2016-01-01

    Summary AraC Negative Regulators (ANR) suppress virulence genes by directly down‐regulating AraC/XylS members in Gram‐negative bacteria. In this study, we sought to investigate the distribution and molecular mechanisms of regulatory function for ANRs among different bacterial pathogens. We identified more than 200 ANRs distributed in diverse clinically important gram negative pathogens, including Vibrio spp., Salmonella spp., Shigella spp., Yersinia spp., Citrobacter spp., enterotoxigenic (ETEC) and enteroaggregative E. coli (EAEC), and members of the Pasteurellaceae. By employing a bacterial two hybrid system, pull down assays and surface plasmon resonance (SPR) analysis, we demonstrate that Aar (AggR‐activated regulator), a prototype member of the ANR family in EAEC, binds with high affinity to the central linker domain of AraC‐like member AggR. ANR‐AggR binding disrupted AggR dimerization and prevented AggR‐DNA binding. ANR homologs of Vibrio cholerae, Citrobacter rodentium, Salmonella enterica and ETEC were capable of complementing Aar activity by repressing aggR expression in EAEC strain 042. ANR homologs of ETEC and Vibrio cholerae bound to AggR as well as to other members of the AraC family, including Rns and ToxT. The predicted proteins of all ANR members exhibit three highly conserved predicted α‐helices. Site‐directed mutagenesis studies suggest that at least predicted α‐helices 2 and 3 are required for Aar activity. In sum, our data strongly suggest that members of the novel ANR family act by directly binding to their cognate AraC partners. PMID:27038276

  13. Adjusting particle-size distributions to account for aggregation in tephra-deposit model forecasts

    NASA Astrophysics Data System (ADS)

    Mastin, Larry G.; Van Eaton, Alexa R.; Durant, Adam J.

    2016-07-01

    Volcanic ash transport and dispersion (VATD) models are used to forecast tephra deposition during volcanic eruptions. Model accuracy is limited by the fact that fine-ash aggregates (clumps into clusters), thus altering patterns of deposition. In most models this is accounted for by ad hoc changes to model input, representing fine ash as aggregates with density ρagg, and a log-normal size distribution with median μagg and standard deviation σagg. Optimal values may vary between eruptions. To test the variance, we used the Ash3d tephra model to simulate four deposits: 18 May 1980 Mount St. Helens; 16-17 September 1992 Crater Peak (Mount Spurr); 17 June 1996 Ruapehu; and 23 March 2009 Mount Redoubt. In 192 simulations, we systematically varied μagg and σagg, holding ρagg constant at 600 kg m-3. We evaluated the fit using three indices that compare modeled versus measured (1) mass load at sample locations; (2) mass load versus distance along the dispersal axis; and (3) isomass area. For all deposits, under these inputs, the best-fit value of μagg ranged narrowly between ˜ 2.3 and 2.7φ (0.20-0.15 mm), despite large variations in erupted mass (0.25-50 Tg), plume height (8.5-25 km), mass fraction of fine ( < 0.063 mm) ash (3-59 %), atmospheric temperature, and water content between these eruptions. This close agreement suggests that aggregation may be treated as a discrete process that is insensitive to eruptive style or magnitude. This result offers the potential for a simple, computationally efficient parameterization scheme for use in operational model forecasts. Further research may indicate whether this narrow range also reflects physical constraints on processes in the evolving cloud.

  14. Identification and phenology of Hyalesthes obsoletus (Hemiptera: Auchenorrhyncha: Cixiidae) nymphal instars.

    PubMed

    Cargnus, E; Pavan, F; Mori, N; Martini, M

    2012-10-01

    Urtica dioica and Convolvulus arvensis are the main host plants of Hyalesthes obsoletus and play an important role in the epidemiology of Bois noir of grapevines. The earliest survey, which was carried out to compare the phenology of nymphal instars on U. dioica and C. arvensis, had highlighted some problems in the identification of the instars. Therefore, the correct identification of nymphs to species and instar level became a preliminary aim of this research. Adults and nymphs attributable to H. obsoletus were collected during 2008-2010 in three flatland vineyard habitats of northern Italy on U. dioica, C. arvensis and Artemisia verlotorum. Nymphs and morphologically identified adults of H. obsoletus were submitted to molecular identification. Morphometric and morphological studies were carried out on nymphs collected in the field or obtained in laboratory rearings. Molecular methods not only confirmed the identity of adults, but also allowed the assignment of the nymphs to this species. Morphometric and morphological characteristics (e.g. body and head-thoracic lengths, number of thoracic pits) showed the existence of five nymphal instars. Morphometric differences between newly hatched and older first-instar nymphs were observed. A key to distinguish the five instars was proposed. Evident differences between H. obsoletus nymphs studied here and elsewhere were identified. According to differences in adult-flight period, an earlier phenology of nymphs on C. arvensis than on U. dioica was observed. In particular, the typical overwintering instar was the second on U. dioica and the third on C. arvensis.

  15. Global Goss grain growth and grain boundary characteristics in magnetostrictive Galfenol sheets

    NASA Astrophysics Data System (ADS)

    Na, S. M.; Flatau, A. B.

    2013-12-01

    Single Goss grains were globally grown in magnetostrictive Galfenol thin sheets via an abnormal grain growth (AGG) process. The sample behaves like single crystal Galfenol, exhibiting large magnetostriction along the <100> axes. Small variations in surface energy conditions, which were governed by different flow rates of 0.5% H2S gas in argon during annealing, had a significant impact of the development of AGG. AGG with a fully developed Goss (011) grain over 95% of the sample surface is very reproducible and feasible for a broad range of annealing conditions. In addition, the <100> orientation of the single-crystal-like Galfenol sheet aligns exactly with the rolling direction, and produces magnetostriction values of ˜300 ppm. AGG often produces isolated grains inside Goss grains due to anisotropic properties of grain boundaries. To better understand island formation mechanisms, grain orientation and grain boundary characteristics of island grains in Goss-oriented Galfenol thin sheets were also investigated. We examined samples annealed either under an argon atmosphere or under a sulfur atmosphere, and characterized the observed island grain boundaries in terms of grain misorientation angles. Trends in measured and simulated data on misorientation angles indicate that the presence of (001) island grain boundaries with angles higher than 45° can be explained by the high energy grain boundary (HEGB) model, whereas (111) boundaries with intermediate angles (20°-45°) cannot. The role of low energy coincident site lattice (CSL) boundaries on AGG in both annealing cases was found to be negligible.

  16. Aggregation behavior of N-alkyl perfluorooctanesulfonamides in dimethyl sulfoxide solution.

    PubMed

    Li, Guo-Li; Gao, Yan-An; Li, Xin-Wei; Liu, Jie; Zheng, Li-Qiang; Xing, Hang; Xiao, Jin-Xin

    2010-02-15

    N-alkyl perfluorooctanesulfonamides (C8F17SO2NHCnH2n+1, FC8-HCn, n = 2, 4, 6, 8) were shown to form aggregates in dimethyl sulfoxide (DMSO). Surface tension results revealed that the dissolution of FC8-HCn reduced the surface tension of DMSO in a manner analogous to common surfactants in aqueous solutions. Maximum surface excess amount (Gamma(max)) and minimum surface area per molecule (Amin) at the air-liquid interface were estimated. Gamma(max) decreases and Amin increases with an increase of the hydrocarbon chain length of FC8-HCn. Steady-state fluorescence and NMR measurements demonstrated that both fluorocarbon and hydrocarbon chains of FC8-HCn molecules were incorporated inside the aggregates. UV-vis spectroscopy confirmed the formation of aggregates and determined the critical micelle concentration (cmc) of FC8-HC6 and FC8-HC8 solutions. The thermodynamic parameters DeltaG(0)(agg), DeltaH(0)(agg), and DeltaS(0)(agg) for the aggregate formation of FC8-HCn in DMSO derived from the temperature dependence of the cmc revealed that the aggregate formation is an enthalpy-driven process, which was further confirmed by isothermal titration calorimetry (ITC) measurements. Moreover, the absolute values of DeltaG(0)(agg) and DeltaH(0)(agg) increase with an increase of the hydrocarbon chain length of FC8-HCn at 298 K.

  17. The evolution of the mitochondrial genetic code in arthropods revisited.

    PubMed

    Abascal, Federico; Posada, David; Zardoya, Rafael

    2012-04-01

    A variant of the invertebrate mitochondrial genetic code was previously identified in arthropods (Abascal et al. 2006a, PLoS Biol 4:e127) in which, instead of translating the AGG codon as serine, as in other invertebrates, some arthropods translate AGG as lysine. Here, we revisit the evolution of the genetic code in arthropods taking into account that (1) the number of arthropod mitochondrial genomes sequenced has triplicated since the original findings were published; (2) the phylogeny of arthropods has been recently resolved with confidence for many groups; and (3) sophisticated probabilistic methods can be applied to analyze the evolution of the genetic code in arthropod mitochondria. According to our analyses, evolutionary shifts in the genetic code have been more common than previously inferred, with many taxonomic groups displaying two alternative codes. Ancestral character-state reconstruction using probabilistic methods confirmed that the arthropod ancestor most likely translated AGG as lysine. Point mutations at tRNA-Lys and tRNA-Ser correlated with the meaning of the AGG codon. In addition, we identified three variables (GC content, number of AGG codons, and taxonomic information) that best explain the use of each of the two alternative genetic codes.

  18. Friction-Stir-Welded and Spin-Formed End Domes for Cryogenic Tanks

    NASA Technical Reports Server (NTRS)

    Hales, S. J.; Tayon, W. A.; Domack, M. S.

    2012-01-01

    Manufacturing of single-piece end domes for cryogenic tanks employing spin forming of tailored, friction-stir-welded blanks of Al-Li alloy 2195 plate offers cost and reliability benefits. The introduction of plastic deformation into a friction stir weld is a unique feature of the proposed manufacturing route. This investigation addressed abnormal grain growth [AGG] within the friction stir weldments during postfabrication processing of a prototype dome. The phenomenon of AGG was observed during the solution heat treatment [SHT] phase of T8 tempering and is a major concern for meeting specifications. Such abrupt microstructural transitions can be detrimental to notch-sensitive mechanical properties, such as ductility and/or fracture toughness. If the issue of AGG cannot be resolved, then the acceptance of this approach as a viable manufacturing route may be in jeopardy. The innovative approach adopted in this investigation was the insertion of a stand-alone, Intermediate Annealing Treatment [IAT] between the spin forming and T8 processing operations. A simple, recovery annealing step was deemed to be the most readily-scalable solution when fabricating thin-walled, ellipsoidal domes. The research effort culminated in the development of an effective IAT, which resulted in a significant decrease in AGG following SHT. The processing philosophy adopted in designing the IAT is outlined and the microstructural reasons for success are discussed. The analytical results presented are consistent with promoting continuous grain growth during the IAT, thereby suppressing AGG during the SHT.

  19. Investigation of Abnormal Grain Growth in a Friction Stir Welded and Spin-Formed Al-Li Alloy 2195 Crew Module

    NASA Technical Reports Server (NTRS)

    Tayon, Wesley A.; Domack, Marcia S.; Hoffman, Eric K.; Hales, Stephen J.

    2013-01-01

    In order to improve manufacturing efficiency and reduce structural mass and costs in the production of launch vehicle structures, NASA is pursuing a wide-range of innovative, near-net shape manufacturing technologies. A technology that combines friction stir welding (FSW) and spin-forming has been applied to manufacture a single-piece crew module using Aluminum-Lithium (AL-Li) Alloy 2195. Plate size limitations for Al-Li alloy 2195 require that two plates be FSW together to produce a spin-forming blank of sufficient size to form the crew module. Subsequent forming of the FSW results in abnormal grain growth (AGG) within the weld region upon solution heat treatment (SHT), which detrimentally impacts strength, ductility, and fracture toughness. The current study seeks to identify microstructural factors that contribute to the development of AGG. Electron backscatter diffraction (EBSD) was used to correlate driving forces for AGG, such as stored energy, texture, and grain size distributions, with the propensity for AGG. Additionally, developmental annealing treatments prior to SHT are examined to reduce or eliminate the occurrence of AGG by promoting continuous, or uniform, grain growth

  20. Mitigating Abnormal Grain Growth for Friction Stir Welded Al-Li 2195 Spun Formed Domes

    NASA Technical Reports Server (NTRS)

    Chen, Po-Shou; Russell, Carolyn

    2012-01-01

    Formability and abnormal grain growth (AGG) are the two major issues that have been encountered for Al alloy spun formed dome development using friction stir welded blanks. Material properties that have significant influence on the formability include forming range and strain hardening exponent. In this study, tensile tests were performed for two 2195 friction stir weld parameter sets at 400 F to study the effects of post weld anneal on the forming range and strain hardening exponent. It was found that the formability can be enhanced by applying a newly developed post weld anneal to heat treat the friction stir welded panels. This new post weld anneal leads to a higher forming range and much improved strain hardening exponent. AGG in the weld nugget is known to cause a significant reduction of ductility and fracture toughness. This study also investigated how AGG may be influenced by the heating rate to the solution heat treatment temperature. After post-weld annealing, friction stir welds were strained to 15% and 39% by compression at 400 F before they were subjected to SHT at 950 F for 1 hour. Salt bath SHT is very effective in reducing the grain size as it helps arrest the onset of AGG and promote normal recrystallization and grain growth. However, heat treating a 18 ft dome using a salt bath is not practical. Efforts are continuing at Marshall Space Flight Center to identify the welding parameters and heat treating parameters that can help mitigate the AGG in the friction stir welds.

  1. Anthiovulatory activity of five indigenous plants in rabbits.

    PubMed

    Kapoor, M; Garg, S K; Mathur, V S

    1974-08-01

    The petroleum ether, alcoholic, and aqueous extracts of 5 indigenous plants, known to have antifertility activity in female rats and mice (Areca catechu Linn, Carica papaya Linn, Daucus carota Linn, Mentha arvensis Linn and polygonum hydropiper Linn), were evaluated for their possible antiovulatory activity in rabbits with copper-induced ovulation. The alcoholic extract of Mentha arvensis (leaves) and the petroleum ether extract of the roots of Polygonum hydropiper were the most successful agents, inhibiting ovulation in 60% of the animals. All the other extracts inhibited ovulation in 40%, or less, of the animals.

  2. Trace elements in lesser scaup (Aythya affinis) from the Mississippi flyway

    USGS Publications Warehouse

    Custer, Christine M.; Custer, T.W.; Anteau, M.J.; Afton, A.D.; Wooten, D.E.

    2003-01-01

    Previous research reported that concentrations of selenium in the livers of 88a??95% of lesser scaup from locations in Lake Erie, Lake St. Clair, and Lake Michigan, USA were either elevated (10a??33 A?g/g dry weight [dw]) or in the potentially harmful range (>33 A?g/g dw). In order to determine the geographic extent of these high selenium concentrations, we collected lesser scaup in Louisiana, Arkansas, Illinois, Minnesota, Wisconsin, and Manitoba and analyzed the livers for 19 trace elements. We found that all trace element concentrations, except for selenium, generally were low. Arsenic, which usually is not detected in liver samples, was detected in Louisiana and may be related to past agricultural usages. Chromium, which also is not usually detected, was only present in lesser scaup from Arkansas and may be related to fertilizer applications. Cadmium and mercury concentrations did not differ among locations and concentrations were low. Selenium concentrations in Arkansas (geometric mean=4.2 A?g/g dw) were significantly lower than those in Louisiana (10.7 A?g/g dw), Illinois (10.5 A?g/g dw), and Minnesota (8.0 A?g/gdw); concentrations in Wisconsin and Manitoba were intermediate (6.6 and 6.5 A?g/g dw). About 25% of lesser scaup livers contained elevated selenium concentrations; however, none were in the harmful range. We concluded that selenium concentrations in lesser scaup in the Mississippi Flyway are elevated in some individuals, but not to the extent that has been documented in the industrial portions of the Great Lakes.

  3. Determination of the aggregation number and charge of ionic surfactant micelles from the stepwise thinning of foam films.

    PubMed

    Anachkov, Svetoslav E; Danov, Krassimir D; Basheva, Elka S; Kralchevsky, Peter A; Ananthapadmanabhan, Kavssery P

    2012-11-15

    The stepwise thinning (stratification) of liquid films, which contain micelles of an ionic surfactant, depends on the micelle aggregation number, N(agg), and charge, Z. Vice versa, from the height of the step and the final film thickness one can determine N(agg), Z, and the degree of micelle ionization. The determination of N(agg) is based on the experimental fact that the step height is equal to the inverse cubic root of the micelle concentration. In addition, Z is determined from the final thickness of the film, which depends on the concentration of counterions dissociated from the micelles in the bulk. The method is applied to micellar solutions of six surfactants, both anionic and cationic: sodium dodecylsulfate (SDS), cetyl trimethylammonium bromide (CTAB), cetylpyridinium chloride (CPC), sodium laurylethersulfates with 1 and 3 ethylene oxide groups (SLES-1EO and SLES-3EO), and potassium myristate. The method has the following advantages: (i) N(agg) and Z are determined simultaneously, from the same set of experimental data; (ii) N(agg) and Z are determined for each given surfactant concentration (i.e. their concentration dependence is obtained), and (iii) N(agg) and Z can be determined even for turbid solutions, like those of carboxylates, where the micelles coexist with acid-soap crystallites, so that the application of other methods is difficult. The results indicate that the micelles of greater aggregation number have a lower degree of ionization, which can be explained with the effect of counterion binding. The proposed method is applicable to the concentration range, in which the films stratify and the micelles are spherical. This is satisfied for numerous systems representing scientific and practical interest.

  4. [The influence of mutations at ATG triplets of the open reading frame SUP35 on viability of the yeast Saccharomyces cerevisiae].

    PubMed

    Riabinkova, N A; Borkhsenius, A S; Inge-Vechtomov, S G

    2009-02-01

    The open reading frame SUP35 encoding the translation termination eRF3 factor vital to life contains three ATG codons (ATG1, ATG124, and ATG254). Previously, other authors detected two SUP35 transcripts: a major one that corresponds to the full-length open reading frame and a minor transcript that corresponds to the 3' terminal site of SUP35 starting at the third ATG codon (ATG254). In this work, mutations at triplets ATG1, ATG124, and ATG254 were obtained as well as double mutations, which combine the point mutation in one of three ATG triplets and a deletion at the site for binding with the transcription factor Abf1 within the SUP35 (sup35-deltaAbf1) promoter. The influence of these mutations on the yeast viability was analyzed. Mutations at triplets ATG124 and ATG254 did not affect yeast viability in their own right or in the background of deletion sup35-deltaAbf1. Mutation sup35-AGG1 (ATG1-->AGG) causes the lethal effect in cells grown on media containing glucose as the sole source of carbon. The replacement of glucose by galactose, or histidine starvation, partially restore the viability of sup35-AGG1 mutants, but not that of double mutants sup35-deltaAbf1,AGG1. The restoration of sup35-AGG1 mutant viability under these conditions can be explained by either the appearance (or enhancement) of the production of short peptides synthesized on the mRNA triplets SUP35 AUG124 and AUG254, or by the enhanced production of the full-length SUP35 transcript coupled with translation initiation from the noncanonical AGG1 codon. These data confirm that the expression of gene SUP35 at the transcription and(or) translation level is regulated by environmental conditions.

  5. Novel aggregative adherence fimbria variant of enteroaggregative Escherichia coli.

    PubMed

    Jønsson, Rie; Struve, Carsten; Boisen, Nadia; Mateiu, Ramona Valentina; Santiago, Araceli E; Jenssen, Håvard; Nataro, James P; Krogfelt, Karen A

    2015-04-01

    Enteroaggregative Escherichia coli (EAEC) organisms belong to a diarrheagenic pathotype known to cause diarrhea and can be characterized by distinct aggregative adherence (AA) in a stacked-brick pattern to cultured epithelial cells. In this study, we investigated 118 EAEC strains isolated from the stools of Danish adults with traveler's diarrhea. We evaluated the presence of the aggregative adherence fimbriae (AAFs) by a multiplex PCR, targeting the four known major subunit variants as well as their usher-encoding genes. Almost one-half (49/118) of the clinical isolates did not possess any known AAF major fimbrial subunit, despite the presence of other AggR-related loci. Further investigation revealed the presence of an AAF-related gene encoding a yet-uncharacterized adhesin, termed agg5A. The sequence of the agg5DCBA gene cluster shared fimbrial accessory genes (usher, chaperone, and minor pilin subunit genes) with AAF/III, as well as the signal peptide present in the beginning of the agg3A gene. The complete agg5DCBA gene cluster from a clinical isolate, EAEC strain C338-14, with the typical stacked-brick binding pattern was cloned, and deletion of the cluster was performed. Transformation to a nonadherent E. coli HB101 and complementation of the nonadherent C338-14 mutant with the complete gene cluster restored the AA adhesion. Overall, we found the agg5A gene in 12% of the 118 strains isolated from Denmark, suggesting that this novel adhesin represents an important variant.

  6. Determination of the aggregation number and charge of ionic surfactant micelles from the stepwise thinning of foam films.

    PubMed

    Anachkov, Svetoslav E; Danov, Krassimir D; Basheva, Elka S; Kralchevsky, Peter A; Ananthapadmanabhan, Kavssery P

    2012-11-15

    The stepwise thinning (stratification) of liquid films, which contain micelles of an ionic surfactant, depends on the micelle aggregation number, N(agg), and charge, Z. Vice versa, from the height of the step and the final film thickness one can determine N(agg), Z, and the degree of micelle ionization. The determination of N(agg) is based on the experimental fact that the step height is equal to the inverse cubic root of the micelle concentration. In addition, Z is determined from the final thickness of the film, which depends on the concentration of counterions dissociated from the micelles in the bulk. The method is applied to micellar solutions of six surfactants, both anionic and cationic: sodium dodecylsulfate (SDS), cetyl trimethylammonium bromide (CTAB), cetylpyridinium chloride (CPC), sodium laurylethersulfates with 1 and 3 ethylene oxide groups (SLES-1EO and SLES-3EO), and potassium myristate. The method has the following advantages: (i) N(agg) and Z are determined simultaneously, from the same set of experimental data; (ii) N(agg) and Z are determined for each given surfactant concentration (i.e. their concentration dependence is obtained), and (iii) N(agg) and Z can be determined even for turbid solutions, like those of carboxylates, where the micelles coexist with acid-soap crystallites, so that the application of other methods is difficult. The results indicate that the micelles of greater aggregation number have a lower degree of ionization, which can be explained with the effect of counterion binding. The proposed method is applicable to the concentration range, in which the films stratify and the micelles are spherical. This is satisfied for numerous systems representing scientific and practical interest. PMID:22935484

  7. Fast, Real-Time, Animated Displays

    NASA Technical Reports Server (NTRS)

    Kahlbaum, William M.; Ownbey, Katrina

    1990-01-01

    Displays for Advanced Concepts Simulator (ACS) generated on Adage Raster Display System 3000 (RDS 3000). Improved programming techniques developed, and revisions to language implementation made. Both types of changes took better advantage of high-speed characteristics of RDS 3000 hardware. Increases in speed resulted from: utilization of parallel-processing capabilities of AGG4, and use of AGG4 to take advantage of certain high-speed characteristics of display memory not previously used. Result was fourfold increase in animation-update rate to 16 frames per second.

  8. Potential benefits of genomic selection on genetic gain of small ruminant breeding programs.

    PubMed

    Shumbusho, F; Raoul, J; Astruc, J M; Palhiere, I; Elsen, J M

    2013-08-01

    In conventional small ruminant breeding programs, only pedigree and phenotype records are used to make selection decisions but prospects of including genomic information are now under consideration. The objective of this study was to assess the potential benefits of genomic selection on the genetic gain in French sheep and goat breeding designs of today. Traditional and genomic scenarios were modeled with deterministic methods for 3 breeding programs. The models included decisional variables related to male selection candidates, progeny testing capacity, and economic weights that were optimized to maximize annual genetic gain (AGG) of i) a meat sheep breeding program that improved a meat trait of heritability (h(2)) = 0.30 and a maternal trait of h(2) = 0.09 and ii) dairy sheep and goat breeding programs that improved a milk trait of h(2) = 0.30. Values of ±0.20 of genetic correlation between meat and maternal traits were considered to study their effects on AGG. The Bulmer effect was accounted for and the results presented here are the averages of AGG after 10 generations of selection. Results showed that current traditional breeding programs provide an AGG of 0.095 genetic standard deviation (σa) for meat and 0.061 σa for maternal trait in meat breed and 0.147 σa and 0.120 σa in sheep and goat dairy breeds, respectively. By optimizing decisional variables, the AGG with traditional selection methods increased to 0.139 σa for meat and 0.096 σa for maternal traits in meat breeding programs and to 0.174 σa and 0.183 σa in dairy sheep and goat breeding programs, respectively. With a medium-sized reference population (nref) of 2,000 individuals, the best genomic scenarios gave an AGG that was 17.9% greater than with traditional selection methods with optimized values of decisional variables for combined meat and maternal traits in meat sheep, 51.7% in dairy sheep, and 26.2% in dairy goats. The superiority of genomic schemes increased with the size of the

  9. Implications of molecular characters for the phylogeny of the Microbotryaceae (Basidiomycota: Urediniomycetes)

    PubMed Central

    Kemler, Martin; Göker, Markus; Oberwinkler, Franz; Begerow, Dominik

    2006-01-01

    Background Anther smuts of the basidiomycetous genus Microbotryum on Caryophyllaceae are important model organisms for many biological disciplines. Members of Microbotryum are most commonly found parasitizing the anthers of host plants in the family Caryophyllaceae, however they can also be found on the anthers of members of the Dipsacaceae, Lamiaceae, Lentibulariaceae, and Portulacaceae. Additionally, some members of Microbotryum can be found infecting other organs of mainly Polygonaceae hosts. Based on ITS nrDNA sequences of members of almost all genera in Microbotryaceae, this study aims to resolve the phylogeny of the anther smuts and their relationship to the other members of the family of plant parasites. A multiple analysis strategy was used to correct for the effects of different equally possible ITS sequence alignments on the phylogenetic outcome, which appears to have been neglected in previous studies. Results The genera of Microbotryaceae were not clearly resolved, but alignment-independent moderate bootstrap support was achieved for a clade containing the majority of the Microbotryum species. The anther parasites appeared in two different well-supported lineages whose interrelationship remained unresolved. Whereas bootstrap support values for some clades were highly vulnerable to alignment conditions, other clades were more robustly supported. The differences in support between the different alignments were much larger than between the phylogenetic optimality criteria applied (maximum parsimony and maximum likelihood). Conclusion The study confirmed, based on a larger dataset than previous work, that the anther smuts on Caryophyllaceae are monophyletic and that there exists a native North American group that diverged from the European clade before the radiation of the European species. Also a second group of anther smuts was revealed, containing parasites on Dipsacaceae, Lamiaceae, and Lentibulariaceae. At least the majority of the parasites of

  10. Diurnal effects on Mentha canadensis oil yields and composition at two different harvests

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Japanese cornmint, also known as menthol mint, (Mentha canadensis L. syn M. arvensis var canadensis L.), is an essential oil crop cultivated in several countries in Asia and South America. The plant is currently the only commercially viable source for natural menthol due to the high concentration of...

  11. Furlough Mushrooms

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The manuscript provides a protocol for preserving two species of mushroom (Agaricus campestris or meadow mushroom, and A. arvensis or horse mushroom) in strong wine. Mushrooms are kept at a low boil for 10 minutes, placed in clean canning jars, and covered with wine (12% ethanol) or fortified wine (...

  12. FMR1 in global populations

    SciTech Connect

    Kunst, C.B.; Zerylnick, C.; Karickhoff, L.

    1996-03-01

    Fragile X syndrome, a frequent form of inherited mental retardation, results from the unstable expansion of a cryptic CGG repeat within the 5{prime} UTR region of the FMR1 gene. The CGG repeat is normally polymorphic in length, and the content is frequently interrupted by AGG triplets. These interruptions are believed to stabilize the repeat, and their absence, leading to long tracts of perfect CGG repeats, may give rise to predisposed alleles. In order to examine the stability of normal FMR1 alleles, the repeat length of 345 chromosomes from nine global populations was examined with the content also determined from 114 chromosomes as assessed by automated DNA sequencing. The FMR1 alleles, defined by the CGG repeat, as well as by the haplotypes of nearby polymorphic loci, were very heterogeneous, although the level of variation correlated with the age and/or genetic history of a particular population. Native American alleles, interrupted by three AGG repeats, exhibited marked stability over 7,000 years. However, in older African populations, parsimony analysis predicts the occasional loss of an AGG, leading to more perfect CGG repeats. These data therefore support the suggestion that AGG interruptions enhance the stability of the FMR1 repeat and indicate that the rare loss of these interruptions leads to alleles with longer perfect CGG-repeat tracts. 42 refs., 4 figs., 2 tabs.

  13. Predicting Recidivism with the Personality Assessment Inventory in a Sample of Sex Offenders Screened for Civil Commitment as Sexually Violent Predators

    ERIC Educational Resources Information Center

    Boccaccini, Marcus T.; Murrie, Daniel C.; Hawes, Samuel W.; Simpler, Amber; Johnson, Jeremy

    2010-01-01

    We examined the ability of scores from the Personality Assessment Inventory (PAI; Morey, 1991) to predict postrelease (M = 4.90 years follow-up) arrests in a sample of 1,412 sex offenders. We focused on scores from 4 PAI measures conceptually relevant to offending, including the Antisocial Features (ANT), Aggression (AGG), and Dominance (DOM)…

  14. Differences in the Toxicological Potential of 2D versus Aggregated Molybdenum Disulfide in the Lung.

    PubMed

    Wang, Xiang; Mansukhani, Nikhita D; Guiney, Linda M; Ji, Zhaoxia; Chang, Chong Hyun; Wang, Meiying; Liao, Yu-Pei; Song, Tze-Bin; Sun, Bingbing; Li, Ruibin; Xia, Tian; Hersam, Mark C; Nel, André E

    2015-10-01

    2D molybdenum disulfide (MoS2 ) has distinct optical and electronic properties compared to aggregated MoS2 , enabling wide use of these materials for electronic and biomedical applications. However, the hazard potential of MoS2 has not been studied extensively. Here, a comprehensive analysis of the pulmonary hazard potential of three aqueous suspended forms of MoS2 -aggregated MoS2 (Agg-MoS2 ), MoS2 exfoliated by lithiation (Lit-MoS2 ), and MoS2 dispersed by Pluronic F87 (PF87-MoS2 )-is presented. No cytotoxicity is detected in THP-1 and BEAS-2B cell lines. However, Agg-MoS2 induces strong proinflammatory and profibrogenic responses in vitro. In contrast, Lit- and PF87-MoS2 have little or no effect. In an acute toxicity study in mice, Agg-MoS2 induces acute lung inflammation, while Lit-MoS2 and PF87-MoS2 have little or no effect. In a subchronic study, there is no evidence of pulmonary fibrosis in response to all forms of MoS2 . These data suggest that exfoliation attenuates the toxicity of Agg-MoS2 , which is an important consideration toward the safety evaluation and use of nanoscale MoS2 materials for industrial and biological applications.

  15. CTEPP-OH DATA COLLECTED ON FORM 03:HOUSE/BUILDING CHARACTERISTICS OBSERVATION SURVEY FOR THE DAY CARE CENTER

    EPA Science Inventory

    This data set contains data concerning the physical characteristics of the day care center and identified possible sources of pollutants for CTEPP-OH.

    The Children’s Total Exposure to Persistent Pesticides and Other Persistent Pollutant (CTEPP) study was one of the largest agg...

  16. Rubus Iconography: Antiquity to the Renaissance

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Rubus images from late Antiquity to the Renaissance are described and assessed for botanical and horticultural information. The earliest surviving European blackberry (R. fruticosus L. sp. agg.) image is found on folio 83 in the Juliana Anicia Codex (Codex Vindobonensis) of 512 CE which contains cop...

  17. A large family of antivirulence regulators modulates the effects of transcriptional activators in Gram-negative pathogenic bacteria.

    PubMed

    Santiago, Araceli E; Ruiz-Perez, Fernando; Jo, Noah Y; Vijayakumar, Vidhya; Gong, Mei Q; Nataro, James P

    2014-05-01

    We have reported that transcription of a hypothetical small open reading frame (orf60) in enteroaggregative E. coli (EAEC) strain 042 is impaired after mutation of aggR, which encodes a global virulence activator. We have also reported that the cryptic orf60 locus was linked to protection against EAEC diarrhea in two epidemiologic studies. Here, we report that the orf60 product acts as a negative regulator of aggR itself. The orf60 protein product lacks homology to known repressors, but displays 44-100% similarity to at least fifty previously undescribed small (<10 kDa) hypothetical proteins found in many gram negative pathogen genomes. Expression of orf60 homologs from enterotoxigenic E. coli (ETEC) repressed the expression of the AraC-transcriptional ETEC regulator CfaD/Rns and its regulon in ETEC strain H10407. Complementation in trans of EAEC 042orf60 by orf60 homologs from ETEC and the mouse pathogen Citrobacter rodentium resulted in dramatic suppression of aggR. A C. rodentium orf60 homolog mutant showed increased levels of activator RegA and increased colonization of the adult mouse. We propose the name Aar (AggR-activated regulator) for the clinically and epidemiologically important orf60 product in EAEC, and postulate the existence of a large family of homologs among pathogenic Enterobacteriaceae and Pasteurellaceae. We propose the name ANR (AraC Negative Regulators) for this family. PMID:24875828

  18. Effects of selective serotonin antagonism on central neurotransmission

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Serotonergic and dopaminergic mediation of aggression has been evidenced in numerous studies. However, these studies have met with varying and sometimes conflicting results. Here we test the hypothesis that hens with genetic propensity for high and low aggressiveness exhibit distinctly different agg...

  19. Dormancy and germination of Chenopodium album seeds from different latitudes in Europe and the USA

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Twelve seed lots of Chenopodium album agg. from Canada, Czech Republic, Denmark, Finland, Italy, Norway, Portugal, Spain, Sweden, United Kingdom and the USA were characterized for responses to chilling, light, potassium nitrate and temperature. The research is part of a multi-location experiment per...

  20. Differences in the Toxicological Potential of Two-Dimensional versus Aggregated Molybdenum Disulfide in the Lung

    PubMed Central

    Wang, Xiang; Mansukhani, Nikhita D.; Guiney, Linda M.; Ji, Zhaoxia; Chang, Chong Hyun; Wang, Meiying; Liao, Yu-Pei; Song, Tze-Bin; Sun, Bingbing; Li, Ruibin; Xia, Tian; Hersam, Mark C.; Nel, André E.

    2015-01-01

    Two-dimensional molybdenum disulfide (MoS2) has distinct optical and electronic properties compared to aggregated MoS2, enabling wide use of these materials for electronic and biomedical applications. However, the hazard potential of MoS2 has not been studied extensively. Here, we present a comprehensive analysis of the pulmonary hazard potential of three aqueous suspended forms of MoS2: aggregated MoS2 (Agg-MoS2), MoS2 exfoliated by lithiation (Lit-MoS2) and MoS2 dispersed by Pluronic F87 (PF87-MoS2). No cytotoxicity was detected in THP-1 and BEAS-2B cell lines. However, Agg-MoS2 induced strong pro-inflammatory and pro-fibrogenic responses in vitro. In contrast, Lit- and PF87-MoS2 had little or no effect. In an acute toxicity study in mice, Agg-MoS2 induced acute lung inflammation, while Lit-MoS2 and PF87-MoS2 had little or no effect. In a sub-chronic study, there was no evidence of pulmonary fibrosis in response to all forms of MoS2. These data suggest that exfoliation attenuates the toxicity of Agg-MoS2, which is an important consideration towards the safety evaluation and use of nanoscale MoS2 materials for industrial and biological applications. PMID:26237579

  1. Helix unfolding in unsolvated peptides.

    PubMed

    Kinnear, B S; Hartings, M R; Jarrold, M F

    2001-06-20

    The conformations of unsolvated Ac-K(AGG)(5)+H(+) and Ac-(AGG)(5)K+H(+) peptides (Ac = acetyl, A = alanine, G = glycine, and K = lysine) have been examined by ion mobility measurements over a wide temperature range (150-410 K). The Ac-K(AGG)(5)+H(+) peptide remains a globule (a compact, roughly spherical structure) over the entire temperature range, while both an alpha-helix and a globule are found for Ac-(AGG)(5)K+H(+) at low temperature. As the temperature is raised the alpha-helix unfolds. Rate constants for loss of the helix (on a millisecond time scale) have been determined as a function of temperature and yield an Arrhenius activation energy and preexponential factor of 38.2 +/- 1.0 kJ mol(-1) and 6.5 +/- 3.7 x 10(9) s(-1), respectively. The alpha-helix apparently does not unfold directly into the globule, but first converts into a long-lived intermediate which survives to a significantly higher temperature before converting. According to molecular dynamics simulations, there is a partially untwisted helical conformation that has both a low energy and a well-defined geometry. This special structure lies between the helix and globule and may be the long-lived intermediate. PMID:11403597

  2. Aggressive versus Nonaggressive Antisocial Behavior: Distinctive Etiological Moderation by Age

    ERIC Educational Resources Information Center

    Burt, S. Alexandra; Neiderhiser, Jenae M.

    2009-01-01

    Research has supported the existence of distinct behavioral patterns, demographic correlates, and etiologic mechanisms for aggressive (AGG) versus nonaggressive but delinquent (DEL) antisocial behavior. Though behavioral genetic studies have the potential to further crystallize these dimensions, inconsistent results have limited their…

  3. A Large Family of Antivirulence Regulators Modulates the Effects of Transcriptional Activators in Gram-negative Pathogenic Bacteria

    PubMed Central

    Santiago, Araceli E.; Ruiz-Perez, Fernando; Jo, Noah Y.; Vijayakumar, Vidhya; Gong, Mei Q.; Nataro, James P.

    2014-01-01

    We have reported that transcription of a hypothetical small open reading frame (orf60) in enteroaggregative E. coli (EAEC) strain 042 is impaired after mutation of aggR, which encodes a global virulence activator. We have also reported that the cryptic orf60 locus was linked to protection against EAEC diarrhea in two epidemiologic studies. Here, we report that the orf60 product acts as a negative regulator of aggR itself. The orf60 protein product lacks homology to known repressors, but displays 44–100% similarity to at least fifty previously undescribed small (<10 kDa) hypothetical proteins found in many gram negative pathogen genomes. Expression of orf60 homologs from enterotoxigenic E. coli (ETEC) repressed the expression of the AraC-transcriptional ETEC regulator CfaD/Rns and its regulon in ETEC strain H10407. Complementation in trans of EAEC 042orf60 by orf60 homologs from ETEC and the mouse pathogen Citrobacter rodentium resulted in dramatic suppression of aggR. A C. rodentium orf60 homolog mutant showed increased levels of activator RegA and increased colonization of the adult mouse. We propose the name Aar (AggR-activated regulator) for the clinically and epidemiologically important orf60 product in EAEC, and postulate the existence of a large family of homologs among pathogenic Enterobacteriaceae and Pasteurellaceae. We propose the name ANR (AraC Negative Regulators) for this family. PMID:24875828

  4. Analysis of FMR1 (CGG)(n) alleles and DXS548-FRAXAC1 haplotypes in three European circumpolar populations: traces of genetic relationship with Asia.

    PubMed

    Larsen, L A; Vuust, J; Nystad, M; Evseeva, I; Van Ghelue, M; Tranebjaerg, L

    2001-09-01

    Fragile X syndrome, the most common form of inherited mental retardation, is caused by expansion of a (CGG)(n) repeat located in the FMR1 gene. The molecular factors involved in the mutation process from stable (CGG)(n) alleles towards unstable alleles are largely unknown, although family transmission studies and population studies have suggested that loss of AGG interruptions in the (CGG)(n) repeat is essential. We have analysed the AGG interspersion pattern of the FMR1 (CGG)(n) repeat and the haplotype distribution of closely located microsatellite markers DXS548 and FRAXAC1, in three circumarctic populations: Norwegians, Nenets and Saami. The data confirm the conservation, reported in all human populations studied so far, of an AGG interruption for each 9-10 CGG and support the stabilising effect of AGG interruptions. The data also indicate the existence of chromosomes of Asian origin in the Saami and Nenets population, thereby confirming a genetic relationship between Northern Europe and Asia. DXS548-FRAXAC1 haplotype frequencies were compared between 24 Norwegian fragile X males and 119 normal males. Significant linkage disequilibrium were found between the fragile X mutation and haplotype 6-4 and between normal (CGG)(n) alleles and haplotype 7-3.

  5. Neighborhood as a predictor of non-aggressive, but not aggressive, antisocial behaviors in adulthood

    PubMed Central

    Burt, S. Alexandra; Klump, Kelly L.; Kashy, Deborah A.; Gorman-Smith, Deborah; Neiderhiser, Jenae M.

    2015-01-01

    Background Prior meta-analytic work has highlighted important etiological distinctions between aggressive (AGG) and non-aggressive rule-breaking (RB) dimensions of antisocial behavior. Among these is the finding that RB is influenced by the environment more than is AGG. Relatively little research, however, has sought to identify the specific environmental experiences that contribute to this effect. Method The current study examined whether adults residing in the same neighborhood (N = 1,915 participants in 501 neighborhoods) were more similar in their AGG and RB than would be expected by chance. Analyses focused on simple multi-level models, with the participant as the lower-level unit and the neighborhood as the upper-level unit. Results Results revealed little-to-no evidence of neighborhood-level variance in AGG. By contrast, 11+% of the variance in RB could be predicted from participant neighborhood, results that persisted even when considering the possibility of genetic relatedness across participants and neighborhood selection effects. Moreover, 17% of this neighborhood-level variance in RB was accounted for by neighborhood structural characteristics and social processes. Discussion Findings bolster prior suggestions that broader contextual experiences, like the structural and social characteristics of one's neighborhood, contribute in a meaningful way to RB in particular. Our results also tentatively imply that this association may be environmental in origin. Future work should seek to develop additional, stronger designs capable of more clearly leveraging genetic un-relatedness to improve causal inferences regarding the environment. PMID:26040779

  6. Retroviral expression of the hepatitis B virus x gene promotes liver cell susceptibility to carcinogen-induced site specific mutagenesis.

    PubMed

    Sohn, S; Jaitovitch-Groisman, I; Benlimame, N; Galipeau, J; Batist, G; Alaoui-Jamali, M A

    2000-06-30

    Mutational inactivation of the tumor suppressor gene p53 is common in hepatocellular carcinomas (HCC). AGG to AGT transversion in codon 249 of exon 7 of the p53 gene occurs in over 50% of HCC from endemic regions, where both chronic infection with the hepatitis B virus (HBV) and exposure to carcinogens such as aflatoxin B1 (AFB1) prevail. In this study, we report the effect of the HBV x protein (HBx) on carcinogen-induced cytotoxicity and AGG to AGT mutation in codon 249 of the p53 gene in the human liver cell line CCL13. Expression of HBx, as revealed by its transactivation function, results in enhanced cell susceptibility to cytotoxicity induced by the AFB1 active metabolite, AFB1-8,9-epoxide, and benzo(a)pyrene diol-epoxide. Under similar conditions, expression of HBx promotes apoptosis in a subset of cell population. Exposure to AFB1-8, 9-epoxide alone induces a low frequency of AGG to AGT mutation in codon 249 of the p53 gene, as determined by an allele-specific polymerase chain reaction (AS-PCR) assay. However, expression of HBx enhances the frequency of AFB1-epoxide-induced AGG to AGT mutation compared to control cells. In summary, this study demonstrates that expression of HBx enhances liver cell susceptibility to carcinogen-induced mutagenesis, possibly through alteration of the balance between DNA repair and apoptosis, two cellular defense mechanisms against genotoxic stress. PMID:10856831

  7. What phylogeny and gene genealogy analyses reveal about homoplasy in citrus microsatellite alleles

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sixty-five microsatellite alleles from three Simple Sequence Repeat (SSR) loci (cAGG9, CCT01 and GT03) of various Citrus, Fortunella or Poncirus accessions were cloned and sequenced to determine their mode of evolution. This data was used to assess sequence variation by calculating the average numb...

  8. Heterotrimeric G Proteins Serve as a Converging Point in Plant Defense Signaling Activated by Multiple Receptor-Like Kinases1[C][W][OA

    PubMed Central

    Liu, Jinman; Ding, Pingtao; Sun, Tongjun; Nitta, Yukino; Dong, Oliver; Huang, Xingchuan; Yang, Wei; Li, Xin; Botella, José Ramón; Zhang, Yuelin

    2013-01-01

    In fungi and metazoans, extracellular signals are often perceived by G-protein-coupled receptors (GPCRs) and transduced through heterotrimeric G-protein complexes to downstream targets. Plant heterotrimeric G proteins are also involved in diverse biological processes, but little is known about their upstream receptors. Moreover, the presence of bona fide GPCRs in plants is yet to be established. In Arabidopsis (Arabidopsis thaliana), heterotrimeric G protein consists of one Gα subunit (G PROTEIN α-SUBUNIT1), one Gβ subunit (ARABIDOPSIS G PROTEIN β-SUBUNIT1 [AGB1]), and three Gγs subunits (ARABIDOPSIS G PROTEIN γ-SUBUNIT1 [AGG1], AGG2, and AGG3). We identified AGB1 from a suppressor screen of BAK1-interacting receptor-like kinase1-1 (bir1-1), a mutant that activates cell death and defense responses mediated by the receptor-like kinase (RLK) SUPPRESSOR OF BIR1-1. Mutations in AGB1 suppress the cell death and defense responses in bir1-1 and transgenic plants overexpressing SUPPRESSOR OF BIR1-1. In addition, agb1 mutant plants were severely compromised in immunity mediated by three other RLKs, FLAGELLIN-SENSITIVE2 (FLS2), Elongation Factor-TU RECEPTOR (EFR), and CHITIN ELICITOR RECEPTOR KINASE1 (CERK1), respectively. By contrast, G PROTEIN α-SUBUNIT1 is not required for either cell death in bir1-1 or pathogen-associated molecular pattern-triggered immunity mediated by FLS2, EFR, and CERK1. Further analysis of agg1 and agg2 mutant plants indicates that AGG1 and AGG2 are also required for pathogen-associated molecular pattern-triggered immune responses mediated by FLS2, EFR, and CERK1, as well as cell death and defense responses in bir1-1. We hypothesize that the Arabidopsis heterotrimeric G proteins function as a converging point of plant defense signaling by mediating responses initiated by multiple RLKs, which may fulfill equivalent roles to GPCRs in fungi and animals. PMID:23424249

  9. Sequence analysis of the fragile X trinucleotide repeat: Correlations with stability and haplotype and implications for the origin of fragile X alleles

    SciTech Connect

    Snow, K.; Tester, D.J.; Kruckeberg, K.E.; Thibodeau, S.N.

    1994-09-01

    Fragile X (FX) syndrome is associated with amplification of a CGG trinucleotide repeat in the 5{prime} untranslated region of the gene FMR-1. To address mechanism of instability and concern related to overlap between sizes of normal stable alleles and FX unstable alleles, we have sequenced 165 alleles to analyze patterns of AGG interruptions within the CGG repeat, and have typed the (CA)n at DXS548 for 204 chromosomes. Overall, our data is consistent with the idea that the length of uninterrupted CGG repeats determines instability. For 17 stably transmitted alleles with total repeat lengths between 33 and 51, the longest stretch of uninterrupted CGGs was 41. In contrast, for 13 premutation alleles, the shortest stretch of uninterrupted CGGs was 48, suggesting a threshold for expansion between 41 and 48 pure CGGs. For expansion from a premutation to a full mutation, the threshold appears to be {ge}70 uninterrupted repeats. Interestingly, an AGG was detected in some carriers of a full mutation. Comparison of the number of {open_quote}shadow bands{close_quote} in PCR products from similar size alleles with different AGG interruption patterns supports replication slippage as a potential mechanism, i.e. replication slippage occurs more readily as the length of pure repeat increases. Alleles with high total repeat lengths but up to 3 AGGs may be relatively protected against expansion, whereas smaller alleles with pure CGG sequence could be at higher risk for instability. Comparison of sequence data and DXS548 (CA)n data revealed specific sequence trends for each of the DXS548 alleles, explaining the previously reported haplotype association with FX. Incorporating these observations into models for the origin of FX alleles, we consider replication slippage, unequal crossover within the CGG repeat region, recombination between FMR-1 and DXS548, and loss of AGGs by A to C transversion.

  10. Aggregated Particle-size distributions for tephra-deposit model forecasts

    NASA Astrophysics Data System (ADS)

    Mastin, L. G.; Durant, A. J.; Van Eaton, A. R.

    2015-12-01

    The accuracy of models that forecast atmospheric transport and deposition of tephra to anticipate hazards during volcanic eruptions is limited by the fact that fine ash tends to aggregate and fall out more rapidly than the individual constituent particles. Aggregation is generally accounted for by representing fine ash as aggregates with density ρagg and a log-normal size range with median μagg and standard deviation σagg. Values of these parameters likely vary with eruption type, grain size, and atmospheric conditions. To date, no studies have examined how the values vary from one eruption or deposit to another. In this study, we used the Ash3d tephra model to simulate four deposits: 18 May 1980 Mount St. Helens, 16-17 September 1992 Crater Peak (Mount Spurr), Alaska, 17 June 1996 Ruapehu, and 23 March 2009 Mount Redoubt volcano. In 158 simulations, we systematically varied μagg (1-2.3Φ) and σagg (0.1-0.3Φ), using ellipsoidal aggregates with =600 kg m-3 and a shape factor F≡((b+c)/2a)=0.44 . We evaluated the goodness of fit using three statistical comparisons: modeled versus measured (1) mass load at individual sample locations; (2) mass load versus distance along the dispersal axis; and (3) isomass area. For all deposits, the best-fit μagg ranged narrowly between ~1.6-2.0Φ (0.33-0.25mm), despite large variations in erupted mass (0.25-50 Tg), plume height (8.5-25 km), mass fraction of fine (<0.063mm) ash (3-59%), atmospheric temperature, aggregation mechanism, and water content between these eruptions. This close agreement suggests that the aggregation process may be modeled as a discrete process that is agnostic to the eruptive style or magnitude of eruption. This result paves the way to a simple, computationally-efficient parameterization of aggregation that is suitable for use in operational deposit forecasts. Further research may indicate whether this narrow range also reflects physical constraints on processes in the evolving cloud.

  11. Chemical composition and biological activities of the essential oil from Anredera cordifolia grown in Brazil.

    PubMed

    Souza, Lucéia Fátima; de Barros, Ingrid Bergman Inchausti; Mancini, Emilia; De Martino, Laura; Scandolera, Elia; De Feo, Vincenzo

    2014-07-01

    The chemical composition of the essential oil of Anredera cordifolia (Ten.) Steenis (Basellaceae), grown in Brazil, was studied by means of GC and GC-MS analysis. In all, 19 compounds were identified, accounting for 91.6% of the total oil; hydrocarbons were the main constituents (67.7%). The essential oil was evaluated for its in vitro potential phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Sinapis arvensis L., and Phalaris canariensis L. seeds. At 1.25 microg/mL and 0.625 microg/mL, the oil significantly promoted the germination of S. arvensis. Moreover, the antimicrobial activity of the essential oil was assayed against ten bacterial strains. The essential oil showed a weak inhibitory activity against the Gram-positive pathogens. PMID:25230514

  12. Elemental characterization of wild edible plants from countryside and urban areas.

    PubMed

    Renna, Massimiliano; Cocozza, Claudio; Gonnella, Maria; Abdelrahman, Hamada; Santamaria, Pietro

    2015-06-15

    Thirteen elements (Na, K, Ca, Mg, Fe, Mn, Cu, Zn, Cr, Co, Cd, Ni and Pb) in 11 different wild edible plants (WEP) (Amaranthus retroflexus, Foeniculum vulgare, Cichorium intybus, Glebionis coronaria, Sonchus spp., Borago officinalis, Diplotaxis tenuifolia, Sinapis arvensis, Papaver rhoeas, Plantago lagopus and Portulaca oleracea) collected from countryside and urban areas of Bari (Italy) were determined. B.officinalis and P.rhoeas could represent good nutritional sources of Mn and Fe, respectively, as well as A.retroflexus and S.arvensis for Ca. High intake of Pb and Cd could come from P.lagopus and A.retroflexus (1.40 and 0.13 mg kg(-1) FW, respectively). WEP may give a substantial contribution to the elements intake for consumers, but in some cases they may supply high level of elements potentially toxic for human health. Anyway, both ANOVA and PCA analyses have highlighted the low influence of the harvesting site on the elements content. PMID:25660854

  13. A new genus of water mites (Acari, Hydrachnidia, Wettinidae) from bromeliad phytotelmata in the Brazilian Atlantic rainforest

    PubMed Central

    Pešić, Vladimir; Piccoli, Gustavo Cauê de Oliveira; de Araújo, Marcel Santos; Rezende, José Marcos

    2015-01-01

    Abstract Adults of Bromeliacarus cardoso gen. n., sp. n. are described from phytotelmata of Quesnelia arvensis (Vellozo) Mez. (Bromeliaceae) in the subtropical area of the Atlantic rainforest, São Paulo State, Brazil. The new genus Bromeliacarus is proposed and diagnosed, based primarily on the autapomorphic presence of 7–9 pairs of acetabula flanking the gonopore. A possible relationship between Bromeliacarus and other Wettinidae are discussed. PMID:26312017

  14. Does hybridization with a widespread congener threaten the long-term persistence of the Eastern Alpine rare local endemic Knautia carinthiaca?

    PubMed

    Čertner, Martin; Kolář, Filip; Schönswetter, Peter; Frajman, Božo

    2015-10-01

    Interspecific hybridization, especially when regularly followed by backcrossing (i.e., introgressive hybridization), conveys a substantial risk for many endangered organisms. This is particularly true for narrow endemics occurring within distributional ranges of widespread congeners. An excellent example is provided by the plant genus Knautia (Caprifoliaceae): Locally endemic K. carinthiaca is reported from two isolated populations in southern Austria situated within an area predominantly occupied by widespread K. arvensis. While K. carinthiaca usually inhabits low-competition communities on rocky outcrops, K. arvensis occurs mainly in dry to mesic managed grasslands, yet both species can coexist in marginal environments and were suspected to hybridize. Flow cytometry revealed that diploid K. carinthiaca only occurs at its locus classicus, whereas the second locality is inhabited by the morphologically similar but tetraploid K. norica. In the, therefore, single population of K. carinthiaca, flow cytometry and AFLP fingerprinting showed signs of introgressive hybridization with diploid K. arvensis. Hybridization patterns were also reflected in intermediate habitat preferences and morphology of the hybrids. Environmental barriers to gene flow seem to prevent genetic erosion of K. carinthiaca individuals from the core ecological niches, restricting most introgressed individuals to peripheral habitats. Efficient conservation of K. carinthiaca will require strict protection of its habitat and ban on forest clear cuts in a buffer zone to prevent invasion of K. arvensis. We demonstrate the large potential of multidisciplinary approaches combining molecular, cytometric, and ecological tools for a reliable inventory and threat assessment of rare species. PMID:26664677

  15. The efficiency of adjuvants combined with flupyrsulfuron-methyl plus metsulfuron-methyl (Lexus XPE) on weed control.

    PubMed

    Heremans, B; Isebaert, S; Verhoeven, R; Haesaert, G

    2007-01-01

    This paper presents the results of laboratory tests on a selection of weeds (Viola arvensis, Polygonum persicaria, Chamomilla recutita, Chenopodium album, Veronica persicaria, Alopecurus myosusroides) to investigate the efficiency of flupyrsulfuron-methyl plus metsutfuronmethyl (Lexus XPE) in combination with different adjuvants. The efficiency of the herbicide improved in combination of adjuvants. The level of phytotoxicity of the adjuvants-herbicide treatments appllied varied among the different weed species. PMID:18399424

  16. Antibodies to spermatozoa. VII humoral and cellular aspects of sperm inmunity and infertility.

    PubMed

    Shulman, S; Patel, S; Stamm, E

    1976-01-01

    The occurrence of sperm antibody in serum and cervical mucus of women from intertile couples in the serum of their male partners, as well as cellular immunity to sperm, has been studied by agglutination and immobilization techniques. For a total of about 260 couples, the tests on serum showed that 18% of the women and 8% of the men were positive by the Kibrick technique and that 15% of the women and 4% of the men were positive by the F-D technique. The women who were positive in their cervical mucus were 8% of the group by the K-agg (Kibrick agglutination) technique, 2% by the MIS-agg. (Microscale agglutination) technique, and 40% by the MIS-imm. (Microscale immobilization) tecnique. In considering all three techniques. 42% of a group of 132 women were positive. Cellular immunity to sperm, by the Migration Inhibition method, was positive in 18% and zero per cent of infertile and fertile women, respectively.

  17. Enteroaggregative Escherichia coli from humans and animals differ in major phenotypical traits and virulence genes.

    PubMed

    Uber, Ana Paula; Trabulsi, Luiz R; Irino, Kinue; Beutin, Lothar; Ghilardi, Angela C R; Gomes, Tânia A T; Liberatore, Ana Maria A; de Castro, Antônio F P; Elias, Waldir P

    2006-03-01

    Enteroaggregative Escherichia coli (EAEC) is characterized by the expression of the aggregative adherence pattern to cultured epithelial cells. In this study, we determined the phenotypic and genotypic relationships among 86 EAEC strains of human and animal (calves, piglets and horses) feces. Serotypes and the presence of EAEC virulence markers were determined, and these results were associated with ribotyping. Strains harboring aggR (typical EAEC) of human origin were found carrying several of the searched markers, while atypical EAEC harbored none or a few markers. The strains of animal origin were classified as atypical EAEC (strains lacking aggR) and harbored only irp2 or shf. Strains from humans and animals belonged to several different serotypes, although none of them prevailed. Sixteen ribotypes were determined, and there was no association with virulence genes profiles or serotypes. Relationship was not found among the strains of this study, and the assessed animals may not represent a reservoir of human pathogenic typical EAEC.

  18. Investigation into the Influence of Post-Weld Heat Treatment on the Friction Stir Welded AA6061 Al-Alloy Plates with Different Temper Conditions

    NASA Astrophysics Data System (ADS)

    İpekoğlu, Güven; Erim, Seçil; Çam, Gürel

    2014-02-01

    In this study, the effect of post-weld heat treatment (PWHT) on the microstructure and mechanical properties of friction stir butt-joined AA6061 Al-alloy plates both in O and T6-temper conditions was investigated by detailed microstructural investigations and microhardness measurements, in combination with transverse tensile testing. It was determined that the PWHT might result in abnormal grain growth (AGG) in the weld zone particularly in the joints produced in O-temper condition depending on the weld parameters used during friction stir welding. The PWHT generally led to an improvement in the mechanical properties even if AGG took place. Thus, the post-weld heat-treated joints exhibited mechanical properties much higher than those of respective as-welded plates and comparable to those of the respective base plates.

  19. Fc receptor-mediated phagocytosis, superoxide production and calcium signaling of beta 2 integrin-deficient bovine neutrophils.

    PubMed

    Nagahata, H; Sawada, C; Higuchi, H; Teraoka, H; Yamaguchi, M

    1997-01-01

    Fc receptor for immunoglobulin G-mediated phagocytosis, superoxide production and intracellular calcium ([Ca2+]i) signaling of complement receptor type 3 (CR3)-deficient neutrophils from a heifer with leukocyte adhesion deficiency (BLAD) were compared to those of control heifers. The mean phagocytic activity of IgG-coated yeasts and aggregated bovine IgG (Agg-IgG)-induced superoxide production of CR3-deficient neutrophils were 10% and 77.9%, respectively, of those of control neutrophils. The [Ca2+]i signals in CR3-deficient neutrophils stimulated with Agg-IgG or concanavalin A were different with mean peak [Ca2+]i concentrations of 78% and 41.9%, respectively, of those of control neutrophils. These findings suggest that Fc receptor-mediated neutrophil functions are closely dependent on the presence of CR3 (CD11b/CD18) on the neutrophil cell surfaces. PMID:9343828

  20. Phenomenology of Abnormal Grain Growth in Systems with Nonuniform Grain Boundary Mobility

    NASA Astrophysics Data System (ADS)

    DeCost, Brian L.; Holm, Elizabeth A.

    2016-07-01

    We have investigated the potential for nonuniform grain boundary mobility to act as a persistence mechanism for abnormal grain growth (AGG) using Monte Carlo Potts model simulations. The model system consists of a single initially large candidate grain embedded in a matrix of equiaxed grains, corresponding to the abnormal growth regime before impingement occurs. We assign a mobility advantage to grain boundaries between the candidate grain and a randomly selected subset of the matrix grains. We observe AGG in systems with physically reasonable fractions of fast boundaries; the probability of abnormal growth increases as the density of fast boundaries increases. This abnormal growth occurs by a series of fast, localized growth events that counteract the tendency of abnormally large grains to grow more slowly than the surrounding matrix grains. Resulting abnormal grains are morphologically similar to experimentally observed abnormal grains.

  1. Genetic diversity of mitochondrial cytochrome b gene in Chinese native buffalo.

    PubMed

    Lei, C Z; Zhang, C M; Weining, S; Campana, M G; Bower, M A; Zhang, X M; Liu, L; Lan, X Y; Chen, H

    2011-08-01

    The origins of the domestic water buffalo remain contentious. To better understand the origins of Chinese water buffalo, we sequenced the complete mitochondrial cytochrome b (MT-CYB) gene from 270 individuals representing 13 Chinese domestic swamp buffalo populations. We found genetic evidence of introgression of river buffalo into Chinese swamp buffalo herds. Swamp buffalo haplotypes can be divided into two highly divergent lineages (A and B), suggesting that Chinese native swamp buffalo have two maternal origins. We found that the A→G transition in the buffalo MT-CYB gene stop codon resulted in buffalo haplotypes being terminated by one of two stop codons: AGA or AGG. AGA is common to river buffalo and lineage A of swamp buffalo, while AGG is specific to lineage B of swamp buffalo. Lineage A appears to have been domesticated in China. Further genetic evidence is required to clarify the origins of lineage B.

  2. Cloning and expression of a novel lactococcal aggregation factor from Lactococcus lactis subsp. lactis BGKP1

    PubMed Central

    2011-01-01

    Background Aggregation may play a main role in the adhesion of bacteria to the gastrointestinal epithelium and their colonization ability, as well as in probiotic effects through co-aggregation with intestinal pathogens and their subsequent removal. The aggregation phenomenon in lactococci is directly associated with the sex factor and lactose plasmid co-integration event or duplication of the cell wall spanning (CWS) domain of PrtP proteinase. Results Lactococcus lactis subsp. lactis BGKP1 was isolated from artisanal semi-hard homemade cheese and selected due to its strong auto-aggregation phenotype. Subsequently, non-aggregating derivative (Agg-) of BGKP1, designated as BGKP1-20, was isolated, too. Comparative analysis of cell surface proteins of BGKP1 and derivative BGKP1-20 revealed a protein of approximately 200 kDa only in the parental strain BGKP1. The gene involved in aggregation (aggL) was mapped on plasmid pKP1 (16.2 kb), cloned and expressed in homologous and heterologous lactococci and enterococci. This novel lactococcal aggregation protein was shown to be sufficient for cell aggregation in all tested hosts. In addition to the aggL gene, six more ORFs involved in replication (repB and repX), restriction and modification (hsdS), transposition (tnp) and possible interaction with mucin (mbpL) were also located on plasmid pKP1. Conclusion AggL is a new protein belonging to the collagen-binding superfamily of proteins and is sufficient for cell aggregation in lactococci. PMID:22182285

  3. Detection of virulence-associated genes characteristic of intestinal Escherichia coli pathotypes, including the enterohemorrhagic/enteroaggregative O104:H4, in bovines from Germany and Spain.

    PubMed

    Cabal, Adriana; Geue, Lutz; Gómez-Barrero, Susana; Barth, Stefanie; Bárcena, Carmen; Hamm, Katharina; Porrero, M Concepción; Valverde, Aránzazu; Cantón, Rafael; Menge, Christian; Gortázar, Christian; Domínguez, Lucas; Álvarez, Julio

    2015-08-01

    Cattle are reservoirs of enterohemorrhagic Escherichia coli; however, their role in the epidemiology of other pathogenic E. coli remains undefined. A new set of quantitative real-time PCR assays for the direct detection and quantification of nine virulence-associated genes (VAGs) characteristic of the most important human E. coli pathotypes and four serotype-related genes (wzxO104 , fliCH4 , rbfO157 , fliCH7 ) that can be used as a surveillance tool for detection of pathogenic strains was developed. A total of 970 cattle fecal samples were collected in slaughterhouses in Germany and Spain, pooled into 134 samples and analyzed with this tool. stx1, eae and invA were more prevalent in Spanish samples whereas bfpA, stx2, ehxA, elt, est and the rbfO157 /fliCH7 combination were observed in similar proportions in both countries. Genes characteristic of the hybrid O104:H4 strain of the 2011 German outbreak (stx2/aggR/wzxO104 /fliCH4 ) were simultaneously detected in six fecal pools from one German abattoir located near the outbreak epicenter. Although no isolate harboring the full stx2/aggR/wzxO104 /fliCH4 combination was cultured, sequencing of the aggR positive PCR products revealed 100% homology to the aggR from the outbreak strain. Concomitant detection by this direct approach of VAGs from a novel human pathogenic E. coli strain in cattle samples implies that the E. coli gene pool in these animals can be implicated in de novo formation of such highly-virulent strains. The application of this set of qPCRs in surveillance studies could be an efficient early-warning tool for the emergence of zoonotic E. coli in livestock.

  4. Co-Detection of Virulent Escherichia coli Genes in Surface Water Sources

    PubMed Central

    Ndlovu, Thando; Le Roux, Marcellous; Khan, Wesaal; Khan, Sehaam

    2015-01-01

    McNemar’s test and the Pearson Chi-square were used to assess the co-detection and observed frequency, respectively, for potentially virulent E. coli genes in river water. Conventional multiplex Polymerase Chain Reaction (PCR) assays confirmed the presence of the aggR gene (69%), ipaH gene (23%) and the stx gene (15%) carried by Enteroaggregative E. coli (EAEC), Enteroinvasive E. coli (EIEC) and Enterohermorrhagic E. coli (EHEC), respectively, in river water samples collected from the Berg River (Paarl, South Africa). Only the aggR gene was present in 23% of samples collected from the Plankenburg River system (Stellenbosch, South Africa). In a comparative study, real-time multiplex PCR assays confirmed the presence of aggR (EAEC) in 69%, stx (EHEC) in 15%, ipaH (EIEC) in 31% and eae (EPEC) in 8% of the river water samples collected from the Berg River. In the Plankenburg River, aggR (EAEC) was detected in 46% of the samples, while eae (EPEC) was present in 15% of the water samples analyzed using real-time multiplex PCR in the Plankenburg River. Pearson Chi-square showed that there was no statistical difference (p > 0.05) between the conventional and real-time multiplex PCRs for the detection of virulent E. coli genes in water samples. However, the McNemar’s test showed some variation in the co-detection of virulent E. coli genes, for example, there was no statistical difference in the misclassification of the discordant results for stx versus ipaH, which implies that the ipaH gene was frequently detected with the stx gene. This study thus highlights the presence of virulent E. coli genes in river water and while early detection is crucial, quantitative microbial risk analysis has to be performed to identify and estimate the risk to human health. PMID:25659126

  5. TGF{beta}1 polymorphisms and late clinical radiosensitivity in patients treated for gynecologic tumors

    SciTech Connect

    Ruyck, Kim de . E-mail: kim.deruyck@UGent.be; Van Eijkeren, Marc; Claes, Kathleen; Bacher, Klaus; Vral, Anne; Neve, Wilfried de; Thierens, Hubert

    2006-07-15

    Purpose: To investigate the association between six transforming growth factor {beta}1 gene (TGF{beta}1) polymorphisms (-1.552delAGG, -800G>A, -509C>T, Leu10Pro, Arg25Pro, Thr263Ile) and the occurrence of late normal tissue reactions after gynecologic radiotherapy (RT). Methods and Materials: Seventy-eight women with cervical or endometrial cancer and 140 control individuals were included in the study. According to the Common Terminology Criteria for Adverse Events version 3.0 (CTCAEv3.0) scale, 25 patients showed late adverse RT reactions (CTC2+), of whom 11 had severe complications (CTC3+). Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP), single base extension and genotyping assays were performed to examine the polymorphic sites in TGF{beta}1. Results: Homozygous variant -1.552delAGG, -509TT, and 10Pro genotypes were associated with the risk of developing late severe RT reactions. Triple (variant) homozygous patients had a 3.6 times increased risk to develop severe RT reactions (p = 0.26). Neither the -800A allele, nor the 25Pro allele or the 263Ile allele were associated with clinical radiosensitivity. There was perfect linkage disequilibrium (LD) between the -1.552delAGG and the -509C>T polymorphisms, and tight LD between the -1.552/-509 and the Leu10Pro polymorphisms. Haplotype analysis revealed two major haplotypes but could not distinguish radiosensitive from nonradiosensitive patients. Conclusions: The present study shows that homozygous variant TGF{beta}1 -1.552delAGG, -509TT, and 10Pro genotypes may be associated with severe clinical radiosensitivity after gynecologic RT.

  6. Functional characteristics of enhanced Fc receptor expression of beta 2 integrin-deficient bovine mononuclear phagocytes.

    PubMed

    Nagahata, H; Higuchi, H; Goji, N; Noda, H; Kuwabara, M

    1996-01-01

    Fc receptor expression, cytoplasmic Ca2+ signaling, chemiluminescent (CL) response, and electron spin resonance (ESR) combined with spin trapping of blood mononuclear phagocytes from control heifers and a heifer with leukocyte adhesion deficiency (LAD) were evaluated to elucidate the relationships between complement receptor type 3 (CR3) and Fc receptor expression and their functional responses. The mean fluorescence intensity of fluorescein isothiocyanate (FITC)-conjugated anti-bovine IgG bound to mononuclear phagocytes from the heifer with LAD was 1.8-fold higher than that of control heifers. The mean increments of cytoplasmic Ca2+ concentrations of mononuclear phagocytes from the heifer with LAD stimulated with OPZ, Agg-IgG, and PMA were 39.4 (P < 0.05), 118, and 71.6% compared with those of control heifers. A 1.27-fold increase in the CL response relative to control heifers was detected when mononuclear phagocytes from the heifer with LAD were stimulated with Agg-IgG. The OPZ-induced CL response of mononuclear phagocytes from the heifer with LAD was significantly (P < 0.05) decreased, whereas the PMA-induced CL response was similar to that of control heifers. The ESR spectrum of mononuclear phagocytes from the heifer with LAD was increased when stimulated with Agg-IgG, and was impaired when stimulated by OPZ compared with that of control heifers. The ESR spectrum of mononuclear phagocytes stimulated with PMA was similar in control heifers and the heifer with LAD. Fc receptors on mononuclear phagocytes from the heifer with LAD were enhanced, and their cytoplasmic Ca2+ signaling, CL response, and ESR-spin trapping when stimulated with Agg-IgG and OPZ appeared to be associated with enhanced Fc receptors. PMID:8805104

  7. Prion Disease Induces Alzheimer Disease-Like Neuropathologic Changes

    PubMed Central

    Tousseyn, Thomas; Bajsarowicz, Krystyna; Sánchez, Henry; Gheyara, Ania; Oehler, Abby; Geschwind, Michael; DeArmond, Bernadette; DeArmond, Stephen J.

    2016-01-01

    We examined the brains of 266 patients with prion diseases (PrionD) and found that 46 (17%) had Alzheimer disease (AD)-like changes. To explore potential mechanistic links between PrionD and AD, we exposed human brain aggregates (Hu BrnAggs) to brain homogenate from a patient with sporadic Creutzfeldt-Jakob disease (CJD) and found that the neurons in the Hu BrnAggs produced many β-amyloid (β42) inclusions, whereas uninfected, control-exposed Hu BrnAggs did not. Western blots of 20-pooled CJD-infected BrnAggs verified higher Aβ42 levels than controls. We next examined the CA1 region of the hippocampus from 14 patients with PrionD and found that 5 patients had low levels of scrapie-associated prion protein (PrPSc), many Aβ42 intraneuronal inclusions, low APOE-4, and no significant nerve cell loss. Seven patients had high levels of PrPSc, low Aβ42, high APOE-4 and 40% nerve cell loss, suggesting that APOE-4 and PrPSc together cause neuron loss in PrionD. There were also increased levels of hyperphosphorylated tau protein (Hτ) and Hτ-positive neuropil threads and neuron bodies in both PrionD and AD groups. The brains of 6 age-matched control patients without dementia did not contain Aβ42 deposits; however, there were rare Hτ-positive threads in 5 controls and 2 controls had a few Hτ-positive nerve cell bodies. We conclude that PrionD may trigger biochemical changes similar to AD and suggest that PrionD are diseases of PrPSc, Aβ42, APOE-4 and abnormal tau. PMID:26226132

  8. Design of tetraplex specific ligands: cyclic naphthalene diimide.

    PubMed

    Esaki, Yugo; Islam, Md Monirul; Fujii, Satoshi; Sato, Shinobu; Takenaka, Shigeori

    2014-06-01

    Cyclic naphthalene diimide 1 bound to hybrid-type tetraplex DNA from 5'-AGGG(TTAGGG)3-3' (K = 8.6 × 10(6) M(-1)) with 260-fold greater affinity than binding to a double stranded oligonucleotide consisting of 5'-GGG AGG TTT CGC-3' and 3'-CCC TCC AAA GCG-5' (nK = 3.3 × 10(4) M(-1)) with 0.5 μM of IC50 for telomerase activity. PMID:24752309

  9. Anaplastic ganglioglioma: a report of three cases and review of the literature

    PubMed Central

    Lucas, John Thomas; Huang, Andrew Jonathan; Mott, Ryan T.; Lesser, Glenn J.; Tatter, Stephen Bradley; Chan, Michael David

    2015-01-01

    Gangliogliomas are rare tumors of the central nervous system that are thought to arise from a glioneuronal precursor and consist of both neuronal and glial elements. Grade III, or anaplastic ganglioglioma (AGG), most commonly affects children and young adults, generally arises in a supratentorial location, is highly epileptogenic, and often results in diffuse local and distant failure within the craniospinal axis. Pathologically, these tumors are graded by the degree of malignancy in their glial portion and radiologic diagnosis is difficult due to the wide variation in its degree of solid and cystic components, contrast uptake, and calcification patterns. This report presents three cases of AGG, with initial treatment including subtotal resection followed by conformal radio-therapy. In the case where the AGG developed in the setting of an existent low-grade astrocytoma, the patient received no chemotherapy. Both of the other de novo cases were managed with adjuvant chemoradiotherapy with temozolomide. Recurrence occurred at 6, 16, and 20 months following therapy. Two of the three patients experienced symptomatic decline at recurrence, but experienced Karnofsky performance status (KPS) improvement after salvage therapy, including the reduction of cranial neuropathy and balance. All patients had a significant reduction in presenting symptoms following salvage therapy. Patients died at 23, 20, and 22 months following initial surgical management, respectively. A review of anaplastic and malignant gangliogliomas is presented in the context of these three cases. PMID:25862009

  10. Aggregative adherence fimbriae I (AAF/I) mediate colonization of fresh produce and abiotic surface by Shiga toxigenic enteroaggregative Escherichia coli O104:H4.

    PubMed

    Nagy, Attila; Xu, Yunfeng; Bauchan, Gary R; Shelton, Daniel R; Nou, Xiangwu

    2016-07-16

    The Shiga toxigenic Escherichia coli O104:H4 isolated during the 2011 European outbreak expresses Shiga toxin 2a and possess virulence genes associated with the enteroaggregative E. coli (EAEC) pathotype. It produces plasmid encoded aggregative adherence fimbriae I (AAF/I) which mediate cell aggregation and biofilm formation in human intestine and promote Shiga-toxin adsorption, but it is not clear whether the AAF/I fimbriae are involved in the colonization and biofilm formation on food and environmental matrices such as the surface of fresh produce. We deleted the gene encoding for the AAF/I fimbriae main subunit (AggA) from an outbreak associated E. coli O104:H4 strain, and evaluated the role of AAF/I fimbriae in the adherence and colonization of E. coli O104:H4 to spinach and abiotic surfaces. The deletion of aggA did not affect the adherence of E. coli O104:H4 to these surfaces. However, it severely diminished the colonization and biofilm formation of E. coli O104:H4 on these surfaces. Strong aggregation and biofilm formation on spinach and abiotic surfaces were observed with the wild type strain but not the isogenic aggA deletion mutant, suggesting that AAF/I fimbriae play a crucial role in persistence of O104:H4 cells outside of the intestines of host species, such as on the surface of fresh produce.

  11. Characterization and biofilm forming ability of diarrhoeagenic enteroaggregative Escherichia coli isolates recovered from human infants and young animals.

    PubMed

    Vijay, Deepthi; Dhaka, Pankaj; Vergis, Jess; Negi, Mamta; Mohan, Vysakh; Kumar, Manesh; Doijad, Swapnil; Poharkar, Krupali; Kumar, Ashok; Malik, Satyaveer Singh; Barbuddhe, Sukhadeo Baliram; Rawool, Deepak B

    2015-02-01

    Enteroaggregative Escherichia coli (EAEC) is an important pathotype that causes infection in humans and animals. EAEC isolates (n=86) recovered from diarrhoeal cases in human infants (37) and young animals (49) were characterized as 'typical' and/or 'atypical' EAEC strains employing PCR for virulence associated genes (cvd432, aaiA, astA, pilS, irp2, ecp, pic, aggR, aafA, aggA, and agg3A). Besides, biofilm formation ability of human and animal EAEC isolates was assessed using microtiter plate assay. In addition, the transcriptional profile of biofilm associated genes (fis and ecp) was also evaluated and correlated with biofilm formation assay for few selected EAEC isolates of human and animal origins. Overall, a diverse virulence gene profile was observed for the EAEC isolates of human and animal origins as none of the EAEC isolates revealed the presence of all the genes that were targeted. Nine 'typical' EAEC isolates were identified (6 from humans and 3 from animals) while, the majority of the isolates were 'atypical' EAEC strains. Isolation and identification of three 'typical' EAEC isolates from animals (canines) appears to be the first report globally. Further, based on the observations of the biofilm formation assay, the study suggested that human EAEC isolates in particular were comparatively more biofilm producers than that of the animal EAEC isolates. The fis gene was highly expressed in majority of 'typical' EAEC isolates and the ecp gene in 'atypical' EAEC isolates.

  12. Effect of gamma irradiation on rheological properties of polysaccharides exuded by A. fluccosus and A. gossypinus.

    PubMed

    Alijani, Samira; Balaghi, Sima; Mohammadifar, Mohammad Amin

    2011-11-01

    In this study, Iranian gum tragacanth (GT) exudates from Astragalus fluccosus (AFG) and Astragalus gossypinus (AGG) were irradiated at 3, 7, 10 and 15 kGy. Fourier transform infrared spectroscopy (FTIR) data showed that irradiation did not induce changes in the chemical structure of either type of gum. Although particle size distribution and both steady shear and dynamic rheological properties were considerably affected by the irradiation process, the magnitude of the effect of irradiation on each of the rheological and size variables was different for the hydrocolloids. For instance, for AGG, increasing the irradiation dose from 3 to 10 kGy, the d(0.5) and D[3,2] values were reduced by one-sixth to one-eighth fold. Colour measurement revealed that the radiation process led to an increase in the yellow index and b* values for both types of GT in powder form, but it was more pronounced for AGG samples. Irradiation led to an approximate 13-fold increase in redness in AFG. Surface and shape changes of the gum crystals were studied by scanning electron microscope (SEM) and a smoother surface for irradiated samples was detected. The notable changes in functional properties of each variety of irradiated gum should be taken into consideration before using the radiation technology as a commercial tool for sterilisation.

  13. Dynamic Abnormal Grain Growth in Refractory Metals

    NASA Astrophysics Data System (ADS)

    Noell, Philip J.; Taleff, Eric M.

    2015-11-01

    High-temperature plastic deformation of the body-centered cubic (BCC) refractory metals Mo and Ta can initiate and propagate abnormal grains at significantly lower temperatures and faster rates than is possible by static annealing alone. This discovery reveals a new and potentially important aspect of abnormal grain growth (AGG) phenomena. The process of AGG during plastic deformation at elevated temperatures, termed dynamic abnormal grain growth (DAGG), was observed at homologous temperatures between 0.52 and 0.72 in both Mo and Ta sheet materials; these temperatures are much lower than those for previous observations of AGG in these materials during static annealing. DAGG was used to repeatedly grow single crystals several centimeters in length. Investigations to date have produced a basic understanding of the conditions that lead to DAGG and how DAGG is affected by microstructure in BCC refractory metals. The current state of understanding for DAGG is reviewed in this paper. Attention is given to the roles of temperature, plastic strain, boundary mobility and preexisting microstructure. DAGG is considered for its potential useful applications in solid-state crystal growth and its possibly detrimental role in creating undesired abnormal grains during thermomechanical processing.

  14. Uropathogenic Escherichia coli (UPEC) strains may carry virulence properties of diarrhoeagenic E. coli.

    PubMed

    Abe, Cecilia M; Salvador, Fábia A; Falsetti, Ivan N; Vieira, Mônica A M; Blanco, Jorge; Blanco, Jesús E; Blanco, Miguel; Machado, Antônia M O; Elias, Waldir P; Hernandes, Rodrigo T; Gomes, Tânia A T

    2008-04-01

    To analyze whether Escherichia coli strains that cause urinary tract infections (UPEC) share virulence characteristics with the diarrheagenic E. coli (DEC) pathotypes and to recognize their genetic diversity, 225 UPEC strains were examined for the presence of various properties of DEC and UPEC (type of interaction with HeLa cells, serogroups and presence of 30 virulence genes). No correlation between adherence patterns and serogroups was observed. Forty-five serogroups were found, but 64% of the strains belonged to one of the 12 serogroups (O1, O2, O4, O6, O7, O14, O15, O18, O21, O25, O75, and O175) and carried UPEC virulence genes (pap, hly, aer, sfa, cnf). The DEC genes found were: aap, aatA, aggC, agg3C, aggR, astA, eae, ehly, iha, irp2, lpfA(O113), pet, pic, pilS, and shf. Sixteen strains presented aggregative adherence and/or the aatA sequence, which are characteristics of enteroaggregative E. coli (EAEC), one of the DEC pathotypes. In summary, certain UPEC strains may carry DEC virulence properties, mostly associated to the EAEC pathotype. This finding raises the possibility that at least some faecal EAEC strains might represent potential uropathogens. Alternatively, certain UPEC strains may have acquired EAEC properties, becoming a potential cause of diarrhoea.

  15. Investigation of the micellar properties of the tocopheryl polyethylene glycol succinate surfactants TPGS 400 and TPGS 1000 by steady state fluorometry.

    PubMed

    Sadoqi, M; Lau-Cam, C A; Wu, S H

    2009-05-15

    This study has investigated the micellar properties of the d-alpha-tocopheryl polyethylene glycol succinate esters 400 (TPGS 400) and 1000 (TPGS 1000) in terms of critical micellar concentration (CMC), apparent aggregation number (N(agg)), microviscosity and micropolarity using steady state fluorescence techniques and fluorescent probes. In addition it has compared these properties against those of a Triton-type surfactant such as Triton X-100. The CMC values for TPGS 400, TPGS 1000 and Triton X-100 were 1.51 mM, 0.02 mM and 0.19 mM, respectively. The N(agg) values for TPGS 1000 and Triton X-100 were, respectively, 10 and 63. Due to the cloudiness of its aqueous solutions, no attempt was made to evaluate the microviscosity and to obtain the N(agg) for TPGS 400. Microviscosity at the probe site for all three surfactants was high and rather similar in spite of differences among their CMC values. The ability of TPGS 400 and TPGS 1000 to provide an environment for the fluorescence quenching of micelle-solubilized pyrene appears to be associated with their hydrophobic aromatic domains. To our knowledge the present study is the first attempt at systematically studying the micellar properties of the two most widely used TPGS compounds and of comparing these properties against each other and against those of an established nonionic surfactant.

  16. Arabidopsis heterotrimeric G proteins regulate immunity by directly coupling to the FLS2 receptor

    PubMed Central

    Liang, Xiangxiu; Ding, Pingtao; Lian, Kehui; Wang, Jinlong; Ma, Miaomiao; Li, Lin; Li, Lei; Li, Meng; Zhang, Xiaojuan; Chen, She; Zhang, Yuelin; Zhou, Jian-Min

    2016-01-01

    The Arabidopsis immune receptor FLS2 perceives bacterial flagellin epitope flg22 to activate defenses through the central cytoplasmic kinase BIK1. The heterotrimeric G proteins composed of the non-canonical Gα protein XLG2, the Gβ protein AGB1, and the Gγ proteins AGG1 and AGG2 are required for FLS2-mediated immune responses through an unknown mechanism. Here we show that in the pre-activation state, XLG2 directly interacts with FLS2 and BIK1, and it functions together with AGB1 and AGG1/2 to attenuate proteasome-mediated degradation of BIK1, allowing optimum immune activation. Following the activation by flg22, XLG2 dissociates from AGB1 and is phosphorylated by BIK1 in the N terminus. The phosphorylated XLG2 enhances the production of reactive oxygen species (ROS) likely by modulating the NADPH oxidase RbohD. The study demonstrates that the G proteins are directly coupled to the FLS2 receptor complex and regulate immune signaling through both pre-activation and post-activation mechanisms. DOI: http://dx.doi.org/10.7554/eLife.13568.001 PMID:27043937

  17. Coleopterans associated with plants that form phytotelmata in subtropical and temperate Argentina, South America.

    PubMed

    Campos, Raúl E; Fernández, Liliana A

    2011-01-01

    A list of the most common plants that form phytotelmata and their associated coleopterans (aquatic, semi-aquatic and terrestrial) from the northeastern subtropical and temperate area of Argentina, South America with biological and behavioral observations is presented in this study. Species of Poaceae (n = 3), Bromeliaceae (5), Apiaceae (6), Araceae (2), Urticaceae (1), Marantaceae (1), Arecaceae (1), Dipsacaceae (1) and Cyperaceae (1) were identified as phytotelmata. Aquatic species of Scirtidae (2), Dytiscidae (2), and Hydrophilidae (4), semi-aquatic Chelonariidae (2), and terrestrial species of Carabidae (3), Staphylinidae (5), Histeridae (1), Elateridae (1), Cantharidae (1), Cleridae (1), Tenebrionidae (1), Meloidae (1), Anthicidae (1), Chrysomelidae (3), Curculionidae (7) and Apionidae (1) were identified from six species of Eryngium L. (Apiales: Apiaceae), two species of Guadua Kunth (Poales: Poaceae), Aechmea distichantha Lemaire (Poales: Bromeliaceae), and from fallen leaves of Euterpe edulis Martius (Arecales: Arecaceae) from the temperate and subtropical area. The highest species richness was recorded in Eryngium phytotelmata. Fifteen species of beetles inhabit Eryngium cabrerae Pontiroli, 11 in E. horridum Malme, 7 in E. stenophyllum Urban, 4 in E. aff. serra Chamisso and Schlechtendal., 3 in E. elegans Chamisso and Schlechtendal, 2 in E. eburneum Decne and E. pandanifolium Chamisso and Schlechtendal. From bamboo, 6 species of coleopterans were collected from Guadua trinii (Nees) Nees ex Ruprecht and 4 from G. chacoensis (Rojas) Londoño and Peterson. Three species of aquatic coleopterans were recorded from A. distichantha and only one from E. edulis.

  18. Coleopterans Associated with Plants that form Phytotelmata in Subtropical and Temperate Argentina, South America

    PubMed Central

    Campos, Raúl E.; Fernández, Liliana A.

    2011-01-01

    A list of the most common plants that form phytotelmata and their associated coleopterans (aquatic, semi-aquatic and terrestrial) from the northeastern subtropical and temperate area of Argentina, South America with biological and behavioral observations is presented in this study. Species of Poaceae (n = 3), Bromeliaceae (5), Apiaceae (6), Araceae (2), Urticaceae (1), Marantaceae (1), Arecaceae (1), Dipsacaceae (1) and Cyperaceae (1) were identified as phytotelmata. Aquatic species of Scirtidae (2), Dytiscidae (2), and Hydrophilidae (4), semi-aquatic Chelonariidae (2), and terrestrial species of Carabidae (3), Staphylinidae (5), Histeridae (1), Elateridae (1), Cantharidae (1), Cleridae (1), Tenebrionidae (1), Meloidae (1), Anthicidae (1), Chrysomelidae (3), Curculionidae (7) and Apionidae (1) were identified from six species of Eryngium L. (Apiales: Apiaceae), two species of Guadua Kunth (Poales: Poaceae), Aechmea distichantha Lemaire (Poales: Bromeliaceae), and from fallen leaves of Euterpe edulis Martius (Arecales: Arecaceae) from the temperate and subtropical area. The highest species richness was recorded in Eryngium phytotelmata. Fifteen species of beetles inhabit Eryngium cabrerae Pontiroli, 11 in E. horridum Malme, 7 in E. stenophyllum Urban, 4 in E. aff. serra Chamisso and Schlechtendal., 3 in E. elegans Chamisso and Schlechtendal, 2 in E. eburneum Decne and E. pandanifolium Chamisso and Schlechtendal. From bamboo, 6 species of coleopterans were collected from Guadua trinii (Nees) Nees ex Ruprecht and 4 from G. chacoensis (Rojas) Londoño and Peterson. Three species of aquatic coleopterans were recorded from A. distichantha and only one from E. edulis. PMID:22236084

  19. Coleopterans associated with plants that form phytotelmata in subtropical and temperate Argentina, South America.

    PubMed

    Campos, Raúl E; Fernández, Liliana A

    2011-01-01

    A list of the most common plants that form phytotelmata and their associated coleopterans (aquatic, semi-aquatic and terrestrial) from the northeastern subtropical and temperate area of Argentina, South America with biological and behavioral observations is presented in this study. Species of Poaceae (n = 3), Bromeliaceae (5), Apiaceae (6), Araceae (2), Urticaceae (1), Marantaceae (1), Arecaceae (1), Dipsacaceae (1) and Cyperaceae (1) were identified as phytotelmata. Aquatic species of Scirtidae (2), Dytiscidae (2), and Hydrophilidae (4), semi-aquatic Chelonariidae (2), and terrestrial species of Carabidae (3), Staphylinidae (5), Histeridae (1), Elateridae (1), Cantharidae (1), Cleridae (1), Tenebrionidae (1), Meloidae (1), Anthicidae (1), Chrysomelidae (3), Curculionidae (7) and Apionidae (1) were identified from six species of Eryngium L. (Apiales: Apiaceae), two species of Guadua Kunth (Poales: Poaceae), Aechmea distichantha Lemaire (Poales: Bromeliaceae), and from fallen leaves of Euterpe edulis Martius (Arecales: Arecaceae) from the temperate and subtropical area. The highest species richness was recorded in Eryngium phytotelmata. Fifteen species of beetles inhabit Eryngium cabrerae Pontiroli, 11 in E. horridum Malme, 7 in E. stenophyllum Urban, 4 in E. aff. serra Chamisso and Schlechtendal., 3 in E. elegans Chamisso and Schlechtendal, 2 in E. eburneum Decne and E. pandanifolium Chamisso and Schlechtendal. From bamboo, 6 species of coleopterans were collected from Guadua trinii (Nees) Nees ex Ruprecht and 4 from G. chacoensis (Rojas) Londoño and Peterson. Three species of aquatic coleopterans were recorded from A. distichantha and only one from E. edulis. PMID:22236084

  20. Phytochemical analysis of the essential oils of 10 endemic Cephalaria species from Turkey.

    PubMed

    Sarıkahya, N Böke; Kayce, P; Halay, E; Göktürk, R S; Sümbül, H; Kırmızıgül, S

    2013-01-01

    The volatile composition of 10 endemic Cephalaria (Dipsacaceae) species (Cephalaria gazipashensis, Cephalaria lycica, Cephalaria paphlagonica, Cephalaria elmaliensis, Cephalaria stellipilis, Cephalaria scoparia, Cephalaria isaurica, Cephalaria cilicica, Cephalaria elazigensis var. purpurea and Cephalaria davisiana) was investigated. The essential oil mixtures were obtained by steam distillation in a Clevenger-type apparatus. Twenty-eight components were identified by GC-FID and GC-MS techniques. While total volatile percentages ranged from 68.99% to 84.57%, the total essential oil yields ranged between 38.15% and 64.05%. Geraniol, α-cedrene and p-cymene were determined as the main components. Geraniol was detected as a major component in C. cilicica (14.64%), and α-cedrene was detected as a major component with 26.03% for C. lycica, 16.93% for C. scoparia, 13.01% for C. davisiana and 10.94% for C. paphlagonica. Cephalaria scoparia, C. davisiana and C. gazipashensis have considerable amount of p-cymene as 12.86%, 12.70% and 11.16%, respectively. This was the first essential oil report concerning the Cephalaria genus. PMID:22757667

  1. Conservation biological control in strawberry: effect of different pollen on development, survival, and reproduction of Neoseiulus californicus (Acari: Phytoseiidae).

    PubMed

    Gugole Ottaviano, María F; Cédola, Claudia V; Sánchez, Norma E; Greco, Nancy M

    2015-12-01

    Wild vegetation surrounding crops may provide temporary habitat and potential food sources for phytoseiids in different seasons. Monthly vegetation samples of wild plants adjacent to strawberry plants and wild plants in a vegetation strip close to the crop were taken. The frequency of Neoseiulus californicus, Tetranychus urticae and other mites and insects was recorded. In addition, in a laboratory assay, the survival, developmental time and fecundity of females fed on pollen of strawberry and pollen of wild plants where N. californicus was recorded during their flowering, were estimated. Pollen from Urtica urens, Lamium amplexicaule, Convolvulus arvensis, Sonchus oleraceous, Galega officinalis, and Fragaria x ananassa (strawberry) allowed development of N. californicus to adult, but not reproduction. Survival was 70-80 % when fed on pollen from S. oleraceus, G. officinalis and C. arvensis, 80-90 % when fed on pollen from U. urens and F. x ananassa, and more than 90 % when fed on T. urticae and on pollen from L. amplexicaule. In autumn and winter, U. urens, L. amplexicaule and S. oleraceous could promote the persistence of N. californicus when prey density in strawberry is low, offering T. urticae, thrips and pollen. In summer, pollen of C. arvensis and G. officinalis would contribute to the persistence of N. californicus when the strawberry crop is ending and offers scarce food resources. Although the pollen of these plants would not enable the predator population to increase, the presence of these plants in the vicinity of strawberry could contribute to the persistence of N. californicus population and help to limit T. urticae growth when this pest begins to colonize the crop.

  2. Conservation biological control in strawberry: effect of different pollen on development, survival, and reproduction of Neoseiulus californicus (Acari: Phytoseiidae).

    PubMed

    Gugole Ottaviano, María F; Cédola, Claudia V; Sánchez, Norma E; Greco, Nancy M

    2015-12-01

    Wild vegetation surrounding crops may provide temporary habitat and potential food sources for phytoseiids in different seasons. Monthly vegetation samples of wild plants adjacent to strawberry plants and wild plants in a vegetation strip close to the crop were taken. The frequency of Neoseiulus californicus, Tetranychus urticae and other mites and insects was recorded. In addition, in a laboratory assay, the survival, developmental time and fecundity of females fed on pollen of strawberry and pollen of wild plants where N. californicus was recorded during their flowering, were estimated. Pollen from Urtica urens, Lamium amplexicaule, Convolvulus arvensis, Sonchus oleraceous, Galega officinalis, and Fragaria x ananassa (strawberry) allowed development of N. californicus to adult, but not reproduction. Survival was 70-80 % when fed on pollen from S. oleraceus, G. officinalis and C. arvensis, 80-90 % when fed on pollen from U. urens and F. x ananassa, and more than 90 % when fed on T. urticae and on pollen from L. amplexicaule. In autumn and winter, U. urens, L. amplexicaule and S. oleraceous could promote the persistence of N. californicus when prey density in strawberry is low, offering T. urticae, thrips and pollen. In summer, pollen of C. arvensis and G. officinalis would contribute to the persistence of N. californicus when the strawberry crop is ending and offers scarce food resources. Although the pollen of these plants would not enable the predator population to increase, the presence of these plants in the vicinity of strawberry could contribute to the persistence of N. californicus population and help to limit T. urticae growth when this pest begins to colonize the crop. PMID:26459375

  3. Joint action of benzoxazinone derivatives and phenolic acids.

    PubMed

    Jia, Chunhong; Jia, Chunghong; Kudsk, Per; Mathiassen, Solvejg K

    2006-02-22

    The joint action of binary and ternary mixtures of benzoxazinone derivatives and phenolic acids was studied using the additive dose model (ADM) as reference model. The activity of fixed-ratio mixtures of phenolic acids [ferulic acid (FA), p-coumaric acid (CA), vanillic acid (VA), and p-hydroxybenzoic acid (HBA)] and benzoxazinone derivatives [2,4-dihydroxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA), 6-methoxybenzoxazolin-2-one (MBOA), benzoxazolin-2-one (BOA), 2-aminophenol (AP), and N-(2-hydroxyphenyl)acetamide (HPAA)] on Lolium perenne and Myosotis arvensis root growth was assessed in Petri dishes. Root length was recorded 6 days after seeding, and EC(50) and EC(90) values were estimated using nonlinear regression analyses. The benzoxazinone derivatives were found to be more phytotoxic than the phenolic acids, particularly on M. arvensis. Binary mixtures of phenolic acids responded predominantly additively on both plant species. Deviations from additivity were species-specific with antagonistic responses on L. perenne and synergistic responses on M. arvensis. Similarly, binary mixtures of benzoxazinone derivatives also followed the ADM, although synergistic responses were observed for BOA + AP and BOA + HPAA. Binary and ternary mixtures of benzoxazinone derivatives and phenolic acids responded primarily antagonistically; however, a significant synergistic performance was observed with DIMBOA + FA and DIMBOA + VA on L. perenne. These results do not support the assumption that allelopathic effects of wheat can be attributed to synergistic effects of otherwise weakly active allelopathic compounds, and it is suggested that future research be directed toward identifying and studying the effects of other potential allelochemicals including the degradation products of the most abundant wheat allelochemicals.

  4. Results of a screening programme to identify plants or plant extracts that inhibit ruminal protein degradation.

    PubMed

    Selje, N; Hoffmann, E M; Muetzel, S; Ningrat, R; Wallace, R J; Becker, K

    2007-07-01

    One aim of the EC Framework V project, 'Rumen-up' (QLK5-CT-2001-00 992), was to find plants or plant extracts that would inhibit the nutritionally wasteful degradation of protein in the rumen. A total of 500 samples were screened in vitro using 14C-labelled casein in a 30-min incubation with ruminal digesta. Eight were selected for further investigation using a batch fermentation system and soya protein and bovine serum albumin as proteolysis substrates; proteolysis was monitored over 12 h by the disappearance of soluble protein and the production of branched SCFA and NH3. Freeze-dried, ground foliage of Peltiphyllum peltatum, Helianthemum canum, Arbutus unedo, Arctostaphylos uva-ursi and Knautia arvensis inhibited proteolysis (P < 0.05), while Daucus carota, Clematis vitalba and Erica arborea had little effect. Inhibition by the first four samples appeared to be caused by the formation of insoluble tannin-protein complexes. The samples were rich in phenolics and inhibition was reversed by polyethyleneglycol. In contrast, K. arvensis contained low concentrations of phenolics and no tannins, had no effect in the 30-min assay, yet inhibited the degradation rate of soluble protein (by 14 %, P < 0.0001) and the production of branched SCFA (by 17 %, P < 0.05) without precipitating protein in the 12-h batch fermentation. The effects showed some resemblance to those obtained in parallel incubations containing 3 mum-monensin, suggesting that K. arvensis may be a plant-derived feed additive that can suppress growth and activity of key proteolytic ruminal micro-organisms in a manner similar to that already well known for monensin. PMID:17445338

  5. Seasonal phenology of interactions involving short-lived annual plants, a multivoltine herbivore and its endoparasitoid wasp.

    PubMed

    Fei, Minghui; Gols, Rieta; Harvey, Jeffrey A

    2014-01-01

    Spatial-temporal realism is often missing in many studies of multitrophic interactions, which are conducted at a single time frame and/or involving interactions between insects with a single species of plant. In this scenario, an underlying assumption is that the host-plant species is ubiquitous throughout the season and that the insects always interact with it. We studied interactions involving three naturally occurring wild species of cruciferous plants, Brassica rapa, Sinapis arvensis and Brassica nigra, that exhibit different seasonal phenologies, and a multivoltine herbivore, the large cabbage white butterfly, Pieris brassicae, and its gregarious endoparasitoid wasp, Cotesia glomerata. The three plants have very short life cycles. In central Europe, B. rapa grows in early spring, S. arvensis in late spring and early summer, and B. nigra in mid to late summer. P. brassicae generally has three generations per year, and C. glomerata at least two. This means that different generations of the insects must find and exploit different plant species that may differ in quality and which may be found some distance from one another. Insects were either reared on each of the three plant species for three successive generations or shifted between generations from B. rapa to S. arvensis to B. nigra. Development time from neonate to pupation and pupal fresh mass were determined in P. brassicae and egg-to-adult development time and body mass in C. glomerata. Overall, herbivores performed marginally better on S. arvensis and B. nigra plants than on B. rapa plants. Parasitoids performance was closely tailored with that of the host. Irrespective as to whether the insects were shifted to a new plant in successive generations or not, development time of P. brassicae and C. glomerata decreased dramatically over time. Our results show that there were some differences in insect development on different plant species and when transferred from one species to another. However, all three

  6. Replication and encapsidation of the viroid-like satellite RNA of lucerne transient streak virus are supported in divergent hosts by cocksfoot mottle virus and turnip rosette virus.

    PubMed

    Sehgal, O P; Sinha, R C; Gellatly, D L; Ivanov, I; AbouHaidar, M G

    1993-04-01

    Cocksfoot mottle sobemovirus supports replication and encapsidation of the viroid-like satellite RNA (sat-RNA) of lucerne transient streak virus (LTSV) in two monocotyledonous species, Triticum aestivum and Dactylis glomerata. Additionally, LTSV sat-RNA replicates effectively in the presence of turnip rosette sobemovirus in Brassica rapa, Raphanus raphanistrum and Sinapsis arvensis, but not in Thlaspi arvense or Nicotiana bigelovii, indicating that host species markedly influence this interaction. Previous reports of the association between LTSV sat-RNA and helper sobemoviruses were limited to dicotyledonous hosts. Our results demonstrate that the biological interaction between these two entities spans divergent dicotyledonous and monocotyledonous species.

  7. Seasonal phenology of interactions involving short-lived annual plants, a multivoltine herbivore and its endoparasitoid wasp.

    PubMed

    Fei, Minghui; Gols, Rieta; Harvey, Jeffrey A

    2014-01-01

    Spatial-temporal realism is often missing in many studies of multitrophic interactions, which are conducted at a single time frame and/or involving interactions between insects with a single species of plant. In this scenario, an underlying assumption is that the host-plant species is ubiquitous throughout the season and that the insects always interact with it. We studied interactions involving three naturally occurring wild species of cruciferous plants, Brassica rapa, Sinapis arvensis and Brassica nigra, that exhibit different seasonal phenologies, and a multivoltine herbivore, the large cabbage white butterfly, Pieris brassicae, and its gregarious endoparasitoid wasp, Cotesia glomerata. The three plants have very short life cycles. In central Europe, B. rapa grows in early spring, S. arvensis in late spring and early summer, and B. nigra in mid to late summer. P. brassicae generally has three generations per year, and C. glomerata at least two. This means that different generations of the insects must find and exploit different plant species that may differ in quality and which may be found some distance from one another. Insects were either reared on each of the three plant species for three successive generations or shifted between generations from B. rapa to S. arvensis to B. nigra. Development time from neonate to pupation and pupal fresh mass were determined in P. brassicae and egg-to-adult development time and body mass in C. glomerata. Overall, herbivores performed marginally better on S. arvensis and B. nigra plants than on B. rapa plants. Parasitoids performance was closely tailored with that of the host. Irrespective as to whether the insects were shifted to a new plant in successive generations or not, development time of P. brassicae and C. glomerata decreased dramatically over time. Our results show that there were some differences in insect development on different plant species and when transferred from one species to another. However, all three

  8. Induced Changes in the Amino Acid Profile of Biomphalaria alexandrina Molluscan Host to Schistosoma mansoni Using Sublethal Concentrations of Selected Plant Molluscicides

    NASA Astrophysics Data System (ADS)

    Sanad Soliman, Mahmoud; El-Ansary, Afaf

    Amino acid profiles of control and Solanum nigrum, Ambrosia maritima, Thymelaea hirsute, Sinapis arvensis, Peganum haramala and Callistemon lanceolatus-treated Biomphalaria alexandrina snails were investigated in a trial to correlate the amino acid profile of treated snails to their previously reported molluscicidal and biological effects. Amino acid profiles of the snails were greatly manipulated with the treatment of dry powdered sublethal concentrations of the six studied plant molluscicides. The disturbed amino acid profiles of treated snails were discussed in relation to the decrease in snail's egg laying capacity, reduction of their compatibility for the development of the schistosome larvae and cercarial penetration of mammalian skin.

  9. Airborne gravity gradiometer surveying of petroleum systems under Lake Tanganyika, Tanzania

    NASA Astrophysics Data System (ADS)

    Roberts, Doug; Chowdhury, Priyanka Roy; Lowe, Sharon Jenny; Christensen, Asbjorn Norlund

    2016-02-01

    The Lake Tanganyika South petroleum exploration block covers the southern portion of the Tanzanian side of Lake Tanganyika and is located within the East African Rift System. The rifting process has formed rotated fault blocks which provide numerous play types in the resulting basins. Interpretation of 2D seismic data from 1984 indicated that sufficient sediment thickness is present for hydrocarbon generation. The prospectivity of the lake sediment sequence is enhanced by large oil discoveries further north along the rift system at Lake Albert in Uganda. Airborne gravity gradiometry (AGG) has been used in the Lake Albert region to delineate the structural framework of sedimentary basins. Based on this analogy, in 2010 Beach Energy commissioned CGG to fly a FALCON AGG and high-resolution airborne magnetic survey over the Lake Tanganyika South block to provide data for mapping the basin architecture and estimating the depth to magnetic basement. A total of nearly 28000 line kilometres of data were acquired. The subsequent interpretation incorporated the AGG and magnetic data with available 2D seismic data, elevation model data, bathymetry, Landsat and regional geology information. The integrated data interpretation revealed that the Lake Tanganyika rifting structures occur as half-grabens that were formed through reactivation of Precambrian fault structures. Two major depocentres were identified in the magnetic depth-to-basement map in the north and in the west-central part of the survey area with sediment thicknesses in excess of 4 km and 3 km, respectively. Smaller, shallower depocentres (with less than 3 km of sediment) occur in the south-western region. This information was used to plan a 2100 km 2D marine seismic survey that was recorded in 2012. An interpretation of the results from the seismic survey confirmed a rifting structure similar to that encountered further north at Lake Albert in Uganda. Several targets were identified from the seismic sections for

  10. Extra-Large G Proteins Expand the Repertoire of Subunits in Arabidopsis Heterotrimeric G Protein Signaling.

    PubMed

    Chakravorty, David; Gookin, Timothy E; Milner, Matthew J; Yu, Yunqing; Assmann, Sarah M

    2015-09-01

    Heterotrimeric G proteins, consisting of Gα, Gβ, and Gγ subunits, are a conserved signal transduction mechanism in eukaryotes. However, G protein subunit numbers in diploid plant genomes are greatly reduced as compared with animals and do not correlate with the diversity of functions and phenotypes in which heterotrimeric G proteins have been implicated. In addition to GPA1, the sole canonical Arabidopsis (Arabidopsis thaliana) Gα subunit, Arabidopsis has three related proteins: the extra-large GTP-binding proteins XLG1, XLG2, and XLG3. We demonstrate that the XLGs can bind Gβγ dimers (AGB1 plus a Gγ subunit: AGG1, AGG2, or AGG3) with differing specificity in yeast (Saccharomyces cerevisiae) three-hybrid assays. Our in silico structural analysis shows that XLG3 aligns closely to the crystal structure of GPA1, and XLG3 also competes with GPA1 for Gβγ binding in yeast. We observed interaction of the XLGs with all three Gβγ dimers at the plasma membrane in planta by bimolecular fluorescence complementation. Bioinformatic and localization studies identified and confirmed nuclear localization signals in XLG2 and XLG3 and a nuclear export signal in XLG3, which may facilitate intracellular shuttling. We found that tunicamycin, salt, and glucose hypersensitivity and increased stomatal density are agb1-specific phenotypes that are not observed in gpa1 mutants but are recapitulated in xlg mutants. Thus, XLG-Gβγ heterotrimers provide additional signaling modalities for tuning plant G protein responses and increase the repertoire of G protein heterotrimer combinations from three to 12. The potential for signal partitioning and competition between the XLGs and GPA1 is a new paradigm for plant-specific cell signaling.

  11. Role of C-terminal domain and transmembrane helices 5 and 6 in function and quaternary structure of major intrinsic proteins: analysis of aquaporin/glycerol facilitator chimeric proteins.

    PubMed

    Duchesne, Laurence; Pellerin, Isabelle; Delamarche, Christian; Deschamps, Stephane; Lagree, Valerie; Froger, Alexandrine; Bonnec, Georgette; Thomas, Daniel; Hubert, Jean-Francois

    2002-06-01

    We previously observed that aquaporins and glycerol facilitators exhibit different oligomeric states when studied by sedimentation on density gradients following nondenaturing detergent solubilization. To determine the domains of major intrinsic protein (MIP) family proteins involved in oligomerization, we constructed protein chimeras corresponding to the aquaporin AQPcic substituted in the loop E (including the proximal part of transmembrane domain (TM) 5) and/or the C-terminal part (including the distal part of TM 6) by the equivalent domain of the glycerol channel aquaglyceroporin (GlpF) (chimeras called AGA, AAG, and AGG). The analogous chimeras of GlpF were also constructed (chimeras GAG, GGA, and GAA). cRNA corresponding to all constructs were injected into Xenopus oocytes. AQPcic, GlpF, AAG, AGG, and GAG were targeted to plasma membranes. Water or glycerol membrane permeability measurements demonstrated that only the AAG chimera exhibited a channel function corresponding to water transport. Analysis of all proteins expressed either in oocytes or in yeast by velocity sedimentation on sucrose gradients following solubilization by 2% n-octyl glucoside indicated that only AQPcic and AAG exist in tetrameric forms. GlpF, GAG, and GAA sediment in a monomeric form, whereas GGA and AGG were found mono/dimeric. These data bring new evidence that, within the MIP family, aquaporins and GlpFs behave differently toward nondenaturing detergents. We demonstrate that the C-terminal part of AQPcic, including the distal half of TM 6, can be substituted by the equivalent domain of GlpF (AAG chimera) without modifying the transport specificity. Our results also suggest that interactions of TM 5 of one monomer with TM 1 of the adjacent monomer are crucial for aquaporin tetramer stability. PMID:11927589

  12. Submicromolar Aβ42 reduces hippocampal glutamate receptors and presynaptic markers in an aggregation-dependent manner

    PubMed Central

    Wisniewski, Meagan L.; Hwang, Jeannie; Bahr, Ben A.

    2011-01-01

    Synaptic pathology in Alzheimer's disease brains is thought to involve soluble Aβ42 peptide. Here, sterile incubation in PBS caused small Aβ42 oligomer formation as well as heterogeneous, 6E10-immunopositive aggregates of 80-100 kDa. High molecular weight aggregates (H-agg) formed in a time-dependent manner over an extended 30-day period. Interestingly, an inverse relationship between dimeric and H-agg formation was more evident when incubations were performed at 37°C as compared to 23°C, thus providing an experimental strategy with which to address synaptic compromise produced by the different Aβ aggregates. H-agg species formed faster and to higher levels at 37°C compared to 23°C, and the two aggregate preparations were evaluated in hippocampal slice cultures, a sensitive system for monitoring synaptic integrity. Applied daily at 80-600 nM for 7 days, the Aβ42 preparations caused dose-dependent and aggregation-dependent declines in α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) and N-methyl-D-aspartate (NMDA) receptor subunits as well as in presynaptic components. Unlike the synaptic effects, Aβ42 induced only trace cellular degeneration that was CA1 specific. The 37°C preparation was less effective at decreasing synaptic markers, corresponding with its reduced levels of Aβ42 monomers and dimers. Aβ42 dimers decayed significantly faster at 37°C than 23°C, and more rapidly than monomers at either temperature. These findings indicate that Aβ42 can self-aggregate into potent synaptotoxic oligomers as well as into larger aggregates that may serve to neutralize the toxic formations. These results will add to the growing debate concerning whether high molecular weight Aβ complexes that form amyloid plaques are protective through the sequestration of oligomeric species. PMID:21978994

  13. Gravity gradiometry and seismic interpretation integration using spatially guided fuzzy c-means clustering inversion

    NASA Astrophysics Data System (ADS)

    Rapstine, Thomas D.

    Gravity gradiometry has been used as a geophysical tool to image salt structure in hydrocarbon exploration. The knowledge of the location, orientation, and spatial extent of salt bodies helps characterize possible petroleum prospects. Imaging around and underneath salt bodies can be challenging given the petrophysical properties and complicated geometry of salt. Methods for imaging beneath salt using seismic data exist but are often iterative and expensive, requiring a refinement of a velocity model at each iteration. Fortunately, the relatively strong density contrast between salt and background density structure pro- vides the opportunity for gravity gradiometry to be useful in exploration, especially when integrated with other geophysical data such as seismic. Quantitatively integrating multiple geophysical data is not trivial, but can improve the recovery of salt body geometry and petrophysical composition using inversion. This thesis provides two options for quantitatively integrating seismic, AGG, and petrophysical data that may aid the imaging of salt bodies. Both methods leverage and expand upon previously developed deterministic inversion methods. The inversion methods leverage seismically derived information, such as horizon slope and salt body interpretation, to constrain the inversion of airborne gravity gradiometry data (AGG) to arrive at a density contrast model. The first method involves constraining a top of salt inversion using slope in a seismic image. The second method expands fuzzy c-means (FCM) clustering inversion to include spatial control on clustering based on a seismically derived salt body interpretation. The effective- ness of the methods are illustrated on a 2D synthetic earth model derived from the SEAM Phase 1 salt model. Both methods show that constraining the inversion of AGG data using information derived from seismic images can improve the recovery of salt.

  14. Complete mitochondrial genome of Palawan peacock-pheasant Polyplectron napoleonis (Galliformes, Phasianidae).

    PubMed

    Quach, Tommy; Brooks, Daniel M; Miranda, Hector C

    2016-01-01

    The complete mitochondrial genome of the Palawan peacock-pheasant Polyplectron napoleonis is 16,710 bp and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and a control-region. All protein-coding genes use the standard ATG start codon, except for cox1 which has GTG start codon. Seven out of 13 PCGs have TAA stop codons, two have AGG (cox1 and nd6), and three PCGs (nd2, cox2 and nd4) have incomplete stop codon of just T- - nucleotide.

  15. Discovery of a cosmological, relativistic outburst via its rapidly fading optical emission

    SciTech Connect

    Cenko, S. Bradley; Nugent, Peter E.; Miller, Adam A.; Bloom, Joshua S.; Filippenko, Alexei V.; Kulkarni, S. R.; Horesh, Assaf; Carpenter, John; Perley, Daniel A.; Groot, Paul J.; Hallinan, G.; Corsi, Alessandra; Fox, Derek B.; Frail, Dale A.; Gruber, D.; Rau, Arne; Gal-Yam, Avishay; Ofek, Eran O.; MacLeod, Chelsea L.; Kasliwal, Mansi M.; and others

    2013-06-01

    We report the discovery by the Palomar Transient Factory (PTF) of the transient source PTF11agg, which is distinguished by three primary characteristics: (1) bright (R {sub peak} = 18.3 mag), rapidly fading (ΔR = 4 mag in Δt = 2 days) optical transient emission; (2) a faint (R = 26.2 ± 0.2 mag), blue (g' – R = 0.17 ± 0.29 mag) quiescent optical counterpart; and (3) an associated year-long, scintillating radio transient. We argue that these observed properties are inconsistent with any known class of Galactic transients (flare stars, X-ray binaries, dwarf novae), and instead suggest a cosmological origin. The detection of incoherent radio emission at such distances implies a large emitting region, from which we infer the presence of relativistic ejecta. The observed properties are all consistent with the population of long-duration gamma-ray bursts (GRBs), marking the first time such an outburst has been discovered in the distant universe independent of a high-energy trigger. We searched for possible high-energy counterparts to PTF11agg, but found no evidence for associated prompt emission. We therefore consider three possible scenarios to account for a GRB-like afterglow without a high-energy counterpart: an 'untriggered' GRB (lack of satellite coverage), an 'orphan' afterglow (viewing-angle effects), and a 'dirty fireball' (suppressed high-energy emission). The observed optical and radio light curves appear inconsistent with even the most basic predictions for off-axis afterglow models. The simplest explanation, then, is that PTF11agg is a normal, on-axis long-duration GRB for which the associated high-energy emission was simply missed. However, we have calculated the likelihood of such a serendipitous discovery by PTF and find that it is quite small (≈2.6%). While not definitive, we nonetheless speculate that PTF11agg may represent a new, more common (>4 times the on-axis GRB rate at 90% confidence) class of relativistic outbursts lacking associated high

  16. Eukaryotic tRNA paradox.

    PubMed

    Mitra, Sanga; Samadder, Arpa; Das, Pijush; Das, Smarajit; Chakrabarti, Jayprokas

    2015-01-01

    tRNAs are widely believed to segregate into two classes, I and II. Computational analysis of eukaryotic tRNA entries in Genomic tRNA Database, however, leads to new, albeit paradoxical, presence of more than a thousand class-I tRNAs with uncharacteristic long variable arms (V-arms), like in class-II. Out of 62,202 tRNAs from 69 eukaryotes, as many as 1431 class-I tRNAs have these novel extended V-arms, and we refer to them as paradoxical tRNAs (pxtRNAs). A great majority of these 1431 pxtRNA genes are located in intergenic regions, about 18% embedded in introns of genes or ESTs, and just one in 3'UTR. A check on the conservations of 2D and 3D base pairs for each position of these pxtRNAs reveals a few variations, but they seem to have almost all the known features (already known identity and conserved elements of tRNA). Analyses of the A-Box and B-Box of these pxtRNA genes in eukaryotes display salient deviations from the previously annotated conserved features of the standard promoters, whereas the transcription termination signals are just canonical and non-canonical runs of thymidine, similar to the ones in standard tRNA genes. There is just one such pxtRNA(ProAGG) gene in the entire human genome, and the availability of data allows epigenetic analysis of this human pxtRNA(ProAGG) in three different cell lines, H1 hESC, K562, and NHEK, to assess the level of its expression. Histone acetylation and methylation of this lone pxtRNA(ProAGG) gene in human differ from that of the nine standard human tRNA(ProAGG) genes. The V-arm nucleotide sequences and their secondary structures in pxtRNA differ from that of class-II tRNA. Considering these differences, hypotheses of alternative splicing, non-canonical intron and gene transfer are examined to partially improve the Cove scores of these pxtRNAs and to critically question their antecedence and novelty. PMID:25692737

  17. HOBAN project: towards the development of radiation-tolerant fiber-based temperature sensors for nuclear industry

    NASA Astrophysics Data System (ADS)

    Morana, A.; Girard, S.; Marin, E.; Rizzolo, S.; Marcandella, C.; Paillet, P.; Périsse, J.; Kuhnhenn, J.; Grelin, J.; Melin, G.; Robin, T.; Cadier, B.; Boukenter, A.; Ouerdane, Y.; Macé, J.-R.

    2015-09-01

    HOBAN (Development of Hard Optical Fiber BrAgg GratiNgs Sensors) is an European H2020 project granted by Kic InnoEnergy and aiming the development of fiber-based temperature and strain monitoring systems that can withstand harsh nuclear environment (350°C temperature and MGy dose levels). The objective will be achieved by employing `ad hoc' fiber Bragg grating (FBG) sensors and their associated instrumentation system which will bring to the market new tools for optimizing the running and the services in current and future nuclear power plants. We'll present the challenges associated with this project and recent advances at the OFS conference.

  18. ACHIEVING LIPID TARGETS IN ADULTS WITH TYPE 2 DIABETES--THE SANDS STUDY

    PubMed Central

    Russell, Marie; Silverman, Angela; Fleg, Jerome L.; Lee, Elisa T.; Mete, Mihriye; Weir, Matthew; Wilson, Charlton; Yeh, Fawn; Howard, Barbara V.; Howard, Wm. James

    2010-01-01

    Background Although lipid management in diabetes is standard practice, goals often are neither met nor maintained. Strategies for achieving lower targets have not been explored. The Stop Atherosclerosis in Native Diabetics Study (SANDS) randomized patients with diabetes to standard versus aggressive lipid and blood pressure goals for 36 months. Objective To report strategies used to achieve and maintain lipid goals and to report adverse events (AEs). Methods Adults with type 2 diabetes and no history of cardiovascular disease (N=499) were randomized to standard (low-density lipoprotein cholesterol [LDL-C]≤100 mg/dL, non-high-density lipoprotein cholesterol [non-HDL-C]≤130 mg/dL) or aggressive (LDL-C≤70 mg/dL, non-HDL-C≤100 mg/dL) targets. An algorithm started with statin monotherapy, adding intestinally acting agents as required to reach LDL-C targets. Triglyceride [TG]-lowering agents were next used to reach non-HDL-C goals. Lipid management was performed by mid-level practitioners, with physician consultation, using point-of-care lipid determinations. Results On average, both groups achieved the LDL-C and non-HDL-C goals within 12 months and maintained them throughout the study. At 36 months, mean (SD) LDL-C and non-HDL-C were 72 (24) and 102 (29) mg/dL in the aggressive group (AGG) and 104 (20) and 138 (26) mg/dL, respectively, in the standard group (STD); systolic blood pressure targets were 115 and 130 mmHg, respectively. 68% of participants reached target LDL-C for >50% of the visits and 46% for >75% of visits. At 36 months, the AGG averaged 1.5 lipid lowering medications and the STD 1.2. Statins were used in 91% and 68% of the AGG and STD; ezetimibe by 31% and 10%; fibrates by 8% and 18%. No serious adverse events (SAEs) were observed; AEs occurred in 18% of the AGG and 14% of the STD. Conclusion Standard and aggressive lipid targets can be safely maintained in diabetic patients. Standardized algorithms, point-of-care lipid testing, and non

  19. Whole mitogenome of the Endangered dwarf sawfish Pristis clavata (Rajiformes: Pristidae).

    PubMed

    Feutry, Pierre; Kyne, Peter M; Grewe, Peter M; Chen, Xiao; Liu, Min

    2015-04-01

    In this study, we describe the first complete mitochondrial sequence for the Endangered dwarf sawfish Pristis clavata. The base composition of the 16,804 bp long mitogenome is 31.9% A, 26.5% C, 13.3% G and 28.3% T and the gene arrangement and transcriptional direction are the same as those found in most vertebrates. All protein-coding genes start with ATG except the COI gene, which starts with GTG. Stop codons include incomplete T, AGG and TAA; however, TAG is not found in the mitogenome of this euryhaline elasmobranch species.

  20. Characterization of cardiac quiescence from retrospective cardiac computed tomography using a correlation-based phase-to-phase deviation measure

    SciTech Connect

    Wick, Carson A.; McClellan, James H.; Arepalli, Chesnal D.; Auffermann, William F.; Henry, Travis S.; Khosa, Faisal; Coy, Adam M.; Tridandapani, Srini

    2015-02-15

    Purpose: Accurate knowledge of cardiac quiescence is crucial to the performance of many cardiac imaging modalities, including computed tomography coronary angiography (CTCA). To accurately quantify quiescence, a method for detecting the quiescent periods of the heart from retrospective cardiac computed tomography (CT) using a correlation-based, phase-to-phase deviation measure was developed. Methods: Retrospective cardiac CT data were obtained from 20 patients (11 male, 9 female, 33–74 yr) and the left main, left anterior descending, left circumflex, right coronary artery (RCA), and interventricular septum (IVS) were segmented for each phase using a semiautomated technique. Cardiac motion of individual coronary vessels as well as the IVS was calculated using phase-to-phase deviation. As an easily identifiable feature, the IVS was analyzed to assess how well it predicts vessel quiescence. Finally, the diagnostic quality of the reconstructed volumes from the quiescent phases determined using the deviation measure from the vessels in aggregate and the IVS was compared to that from quiescent phases calculated by the CT scanner. Three board-certified radiologists, fellowship-trained in cardiothoracic imaging, graded the diagnostic quality of the reconstructions using a Likert response format: 1 = excellent, 2 = good, 3 = adequate, 4 = nondiagnostic. Results: Systolic and diastolic quiescent periods were identified for each subject from the vessel motion calculated using the phase-to-phase deviation measure. The motion of the IVS was found to be similar to the aggregate vessel (AGG) motion. The diagnostic quality of the coronary vessels for the quiescent phases calculated from the aggregate vessel (P{sub AGG}) and IVS (P{sub IV} {sub S}) deviation signal using the proposed methods was comparable to the quiescent phases calculated by the CT scanner (P{sub CT}). The one exception was the RCA, which improved for P{sub AGG} for 18 of the 20 subjects when compared to P

  1. In vitro screening for the tumoricidal properties of international medicinal herbs.

    PubMed

    Mazzio, Elizabeth A; Soliman, Karam F A

    2009-03-01

    There is growing use of anticancer complementary and alternative medicines (CAMs) worldwide. The purpose of the current study is to assess a sizeable variety of natural and plant sources of diverse origin, to ascertain prospective research directives for cancer treatment and potential new chemotherapy drug sources. In this study, 374 natural extracts (10 microg/mL-5 mg/mL) were evaluated for dose-dependent tumoricidal effects using immortal neuroblastoma of spontaneous malignant origin. The findings indicate no pattern of tumoricidal effects by diverse plants with similar families/genus under the classes Pinopsida, Equisetopsida, Lycopodiosida, Filicosida, Liliopsida Monocotyledons or Magnoliopsida Dicotyledons. The results indicate that many of the most commonly used CAMs exhibited relatively weak tumoricidal effects including cats claw, astragalus, ginseng, echinacea, mistletoe, milk thistle, slippery elm, cayenne, chamomile, don quai, meadowsweet, motherwort and shepherd's purse. The data demonstrate that the most potent plant extracts were randomly dispersed within the plantae kingdom (LC(50) = 31-490 microg/mL) in order of the lowest LC(50) Dioscorea villosa (Dioscoreaceae) > Sanguinaria canadensis (Papaveraceae) > Dipsacus asper (Dipsacaceae) > Populus balsamifera (Salicaceae) > Boswellia carteri (Burseraceae) > Cyamopsis psoralioides (Fabaceae) > Rhamnus cathartica (Rhamnaceae) > Larrea tridentate (Zygophyllaceae) > Dichroa febrifuga (Hydrangeaceae) > Batschia canescens (Boraginaceae) > Kochia scoparia (Chenopodiaceae) > Solanum xanthocarpum (Solanaceae) > Opoponax chironium (Umbelliferae) > Caulophyllum thalictroides (Berberidaceae) > Dryopteris crassirhizoma (Dryopteridaceae) > Garcinia cambogia (Clusiaceae) > Vitex agnus-castus (Verbenaceae) > Calamus draco (Arecaceae). These findings show tumoricidal effect by extracts of wild yam root, bloodroot, teasel root, bakuchi seed, dichroa root, kanta kari, garcinia fruit, mace, dragons blood and the biblically

  2. In Vitro Screening for the Tumoricidal Properties of International Medicinal Herbs

    PubMed Central

    Mazzio, Elizabeth A.; Soliman, Karam F. A.

    2009-01-01

    There is growing use of anticancer complementary and alternative medicines (CAMs) worldwide. The purpose of the current study is to assess a sizeable variety of natural and plant sources of diverse origin, to ascertain prospective research directives for cancer treatment and potential new chemotherapy drug sources. In this study, 374 natural extracts (10 μg/mL-5 mg/mL) were evaluated for dose-dependent tumoricidal effects using immortal neuroblastoma of spontaneous malignant origin. The findings indicate no pattern of tumoricidal effects by diverse plants with similar families/genus under the classes Pinopsida, Equisetopsida, Lycopodiosida, Filicosida, Liliopsida Monocotyledons or Magnoliopsida Dicotyledons. The results indicate that many of the most commonly used CAMs exhibited relatively weak tumoricidal effects including cats claw, astragalus, ginseng, echinacea, mistletoe, milk thistle, slippery elm, cayenne, chamomile, don quai, meadowsweet, motherwort and shepherd's purse. The data demonstrate that the most potent plant extracts were randomly dispersed within the plantae kingdom (LC50 = 31-490 μg/mL) in order of the lowest LC50 Dioscorea villosa (Dioscoreaceae) > Sanguinaria canadensis (Papaveraceae) > Dipsacus asper (Dipsacaceae) > Populus balsamifera (Salicaceae) > Boswellia carteri (Burseraceae) > Cyamopsis psoralioides (Fabaceae) > Rhamnus cathartica (Rhamnaceae) > Larrea tridentate (Zygophyllaceae) > Dichroa febrifuga (Hydrangeaceae) > Batschia canescens (Boraginaceae) > Kochia scoparia (Chenopodiaceae) > Solanum xanthocarpum (Solanaceae) > Opoponax chironium (Umbelliferae) > Caulophyllum thalictroides (Berberidaceae) > Dryopteris crassirhizoma (Dryopteridaceae) > Garcinia cambogia (Clusiaceae) > Vitex agnus-castus (Verbenaceae) > Calamus draco (Arecaceae). These findings show tumoricidal effect by extracts of wild yam root, bloodroot, teasel root, bakuchi seed, dichroa root, kanta kari, garcinia fruit, mace, dragons blood and the biblically referenced

  3. Stimulation Versus Inhibition—Bioactivity of Parthenin, A Phytochemical From Parthenium hysterophorus L.

    PubMed Central

    Belz, Regina G.

    2008-01-01

    Parthenium hysterophorus L. is an invasive weed that biosynthesizes several phytochemi-cals. The sesquiterpene lactone parthenin receives most attention regarding allelopathy of the plant or potential herbicidal properties. Since parthenin exhibits dose-dependent phy-totoxicity with low dose stimulation, this study investigated the occurrence and temporal features of parthenin hormesis in Sinapis arvensis L. sprayed with parthenin under semi-natural conditions. Dose/response studies showed that the occurrence and the magnitude of hormesis depended on climatic conditions and the parameter measured. Within the tested dose range, stimulatory responses were only observed under less-stressful conditions and were most pronounced for leaf area growth [138 % of control; 13 days after treatment (DAT)]. Temporal assessment of leaf area development showed that doses causing a stimulatory response at the end of the experiment (< 0.42 ± 0.04 kg/ha; 13 DAT) were initially inhibitory up to ED50 values (2 DAT). This clearly demonstrated an over-compensatory response. Inhibition of leaf area at 13 DAT reached ED50 values on average at 0.62 ±0.12 kg/ha, and S. arvensis was completely inhibited at doses exceeding 1.81 ±0.56 kg/ha (ED90). Based on these findings, implications of parthenin hormesis are discussed with respect to allelopathy of P. hysterophorus and exploitation of growth stimulatory responses in agriculture. PMID:18648571

  4. Albanian violets of the section Melanium, their morphological variability, genetic similarity and their adaptations to serpentine or chalk soils.

    PubMed

    Słomka, Aneta; Godzik, Barbara; Szarek-Łukaszewska, Grażyna; Shuka, Lulëzim; Hoef-Emden, Kerstin; Bothe, Hermann

    2015-02-01

    Violets of the section Melanium from Albanian serpentine and chalk soils were examined for their taxonomic affiliations, their ability to accumulate heavy metals and their colonization by arbuscular mycorrhizal fungi (AMF). The sequence analysis of the ITS1-5.8S rDNA-ITS2 region showed that all the sampled six Albanian violets grouped between Viola lutea and Viola arvensis, but not with Viola tricolor. The fine resolution of the ITS sequences was not sufficient for a further delimitation of the Albanian violets within the V. lutea-V. arvensis clade. Therefore, the Albanian violets were classified by a set of morphological characters. Viola albanica, Viola dukadjinica and Viola raunsiensis from serpentine soils as well as Viola aetolica from a chalk meadow were unambiguously identified, whereas the samples of Viola macedonica showed high morphological variability. All the violets, in both roots and shoots contained less than or similar levels of heavy metals as their harboring soils, indicating that they were heavy metal excluders. All the violets were strongly colonized by AMF with the remarkable exception of V. albanica. This violet lived as a scree creeper in shallow serpentine soil where the concentration of heavy metals was high but those of P, K and N were scarce.

  5. Determination of fungal pathogens of common weed species in the vicinity of Tokat, Turkey.

    PubMed

    Kadioğlu, I; Karamanli, N; Yanar, Y

    2010-01-01

    This study was carried out to determine the fungal pathogens on Chenopodium album L., Cirsium arvense (L.) Scop., Convolvulus arvensis L., Cynodon dactylon (L.) Pers., Delphinium consolida L., Portulaca oleracea L., Rumex crispus L., Solanum nigrum L., Sorghum halepense (L.) Pers. and Xanthium strumarium L. which were common weed species of agricultural areas. Surveys were conducted in May-June and August-September in 2004-2005 growing seasons. During the surveys density and frequency of the above mentioned weed species were also determined and number of infected plants was counted in each sampling area. Infected weed samples were collected from each sampling point and brought to the laboratory in polyethylene bags and the pathogens were identified at genus or species level. As a result of two year surveys, ten fungal pathogens were determined on eight weed species. The most important fungal pathogens determined on common weed species were as follow; Peronospora farinosa (Fr.) Fr. on C. album, and Septoria convolvuli DC., Erysiphe convolvuli DC., and Puccinia punctiformis (Strauss) Roehrl. on C. arvensis. These fungal diseases were observed mainly on the weeds located at the borders of fields. Infection rates of these pathogens reached up to 21.2% in some of the survey areas. Further studies should be conducted to evaluate the efficacy of these pathogen under in vitro and in vivo conditions.

  6. The choice of bromeliads as a microhabitat by Scinax argyreornatus (Anura, Hylidae).

    PubMed

    Pederassi, J; Lima, M S C S; Peixoto, O L; Souza, C A S

    2012-05-01

    The association of anurans to bromeliads presents different degrees of interaction such as: eventual, obligatory and bromeligen. The frog species Scinax argyreornatus shows a regular association with these plants. The goal of this study is to characterise the degree of association between the frog S. argyreornatus to different species of bromeliads. We identified which species of bromeliad is regularly associated with S. argyreornatus and recognised which factors interfere with this association preference. We analysed the Concentration of Relative Dominance of frogs per bromeliad species. As possible criteria for frog association preference to different bromeliads species we established the analysis of leaves number, length and width, number of leaf axils, stored water in the axils, pH and relative humidity, among other organographic components. Our observations were analyzed by ANOVA followed by the Tukey test. We also evaluated the preference for association by the constancy of Bodenheimer. The correlation matrix indicated that the relative humidity is the factor responsible for the frog-bromeliads association, except for Aechmea sp.. However Aechmea sp. was the species with greater constancy of occupation followed by Quesnelia arvensis and Neoregelia johannis. According to our statistical results, Aechmea sp. and Q. arvensis are not different regarding organographic parameters, but differ from N. johannis. Our observations suggest that the bromeliads organographic structure and the relative humidity are key conditions which influence the preferences of S. argyreornatus to bromeliad species, while the other features showed no correlation. PMID:22735128

  7. Allelopathic potential of Trifolium resupinatum and T. alexandrium on seed germination of four weed species.

    PubMed

    Maighany, Fariba; Ghorbanli, Mahlagha; Khalghani, Javad; Najafpour, Morteza

    2007-04-01

    Laboratory studies were conducted to determine the seed germination of Amaranthus retroflexus, Convolvulus arvensis, Secale cereale and Sinapis arvensis as affected by water-and methanol-soluble constituents of Persian and Berseem clovers. Aboveground tissues of the clovers were collected during flowering stage and dried. Three concentrations of aqueous and methanolic extracts were used: full-strength (33.3 g L(-1)), half-strength (16.7 g L(-1)) and quarter-strength (8.3 g L(-1)). The weed seeds were placed in petri dishes contained the legume extract, or distilled water (control). Percent seed germination was taken after a week. In general, seed germination of the weed species declined progressively with increasing concentration of the clover extracts. It was found that wild mustard exhibited the greatest sensitivity to both the legume extracts. Compared with aqueous extract, methanolic extract caused more decline in seed germination of the weeds. In addition, compared to Persian clover, Berseem clover was stronger inhibitor of seed germination. Therefore, the amounts of allelochemicals may be different in these clovers. Field bindweed showed the least sensitivity to both the legume extracts. Therefore, field bindweed had probably more tolerance to the allelochemicals produced by the clover species.

  8. A natural plant growth promoter calliterpenone from a plant Callicarpa macrophylla Vahl improves the plant growth promoting effects of plant growth promoting rhizobacteria (PGPRs).

    PubMed

    Maji, Deepamala; Barnawal, Deepti; Gupta, Aakansha; King, Shikha; Singh, A K; Kalra, A

    2013-05-01

    Experiments were conducted to evaluate the efficacy of calliterpenone, a natural plant growth promoter from a shrub Callicarpa macrophylla Vahl., in enhancing the growth and yield promoting effects of plant growth promoting rhizobacteria (PGPRs), in menthol mint (Mentha arvensis L).This study is based on our previous results indicating the microbial growth promotion by calliterpenone and assumption that application of calliterpenone along with PGPRs will improve the population of PGPRs resulting in higher impacts on plant growth and yield. Of the 15 PGPRs (identified as potent ones in our laboratory), 25 μl of 0.01 mM calliterpenone (8.0 μg/100 ml) was found to be useful in improving the population of nine PGPRs in culture media. The five selected strains of PGPRs exhibiting synergy with calliterpenone in enhancing growth of maize compared to PGPR or calliterpenone alone were selected and tested on two cultivars (cvs. Kosi and Kushal) of M. arvensis. Of the five strains, Bacillus subtilis P-20 (16S rDNA sequence homologous to Accession No NR027552) and B. subtilis Daz-26 (16SrDNA sequence homologuos to Accession No GU998816) were found to be highly effective in improving the herb and essential oil yield in the cultivars Kushal and Kosi respectively when co-treated with calliterpenone. The results open up the possibilities of using a natural growth promoter along with PGPRs as a bio-agri input for sustainable and organic agriculture.

  9. Overview of currently available Japanese acellular pertussis vaccines and future problems.

    PubMed

    Kamiya, H; Nii, R

    1988-01-01

    Acellular pertussis diphtheria, tetanus vaccine (APDT) was licensed in 1981 in Japan. This vaccine contains pertussis toxin (PT), filamentous hemagglutinin (FHA) and agglutinogen (AGG) as the main protective antigens. The new APDT vaccine produced by each company differs slightly in composition. There are two representative types of vaccine. One vaccine (B type) contains PT and FHA in a ratio of 1 to 1 and the other one (T type) contains PT and FHA in a ratio of 4 to 1 or 9 to 1 and also contains different amounts of AGG. We have been comparing the effectiveness of these two types of vaccine. The adverse reactions of APDT were local reactions such as redness and swelling, with a few febrile cases. No central nervous system adverse reactions were observed. The antibody protective level of this vaccine is also being investigated. After we changed from conventional vaccine to APDT, the frequency of serious adverse reactions was reduced and the number of pertussis infections also gradually decreased. This vaccine should be used for the children world-wide. PMID:3273618

  10. Orientation of glycine on silver nanoparticles: SERS studies

    NASA Astrophysics Data System (ADS)

    Parameswari, A.; Benial, A. Milton Franklin

    2016-05-01

    Surface enhanced Raman scattering (SERS) studies of glycine (Gly) adsorbed on silver nanoparticles (AgNPs) was investigated by experimental and density functional theory approach. The AgNPs were prepared and characterized. The molecular structure of the Gly and Gly adsorbed on silver cluster were optimized by the DFT/B3PW91 method with LanL2DZ basis set. The calculated and observed vibrational frequencies were assigned on the basis of potential energy distribution calculation. The perpendicular orientation of Gly on the silver surface was predicted from the enhanced Raman signal correspond to the C=O and C-H stretching vibrational modes. The frontier molecular orbitals analysis and molecular electrostatic potential calculation were carried out. The reduced band gap value was obtained for Gly adsorbed on silver nanoparticles, which paves the way for designing the bio molecular devices. The first order hyperpolarizability value for Ag-Gly is 461 times greater than the urea. Thus, Ag-Gly is a promising candidate for NLO materials.

  11. [Detection of virulence genes of the enteroaggregative pathotype in Escherichia coli strains isolated from groundwater sources in the province of Chaco, Argentina].

    PubMed

    Lösch, Liliana S; Gariboglio Vázquez, María L; Rivas, Marta; Merino, Luis A

    2015-01-01

    Groundwater is an important source of drinking water for many communities in Northern Argentina; particularly, in the province of Chaco, where about 14% of households use this natural resource. Enteroaggregative Escherichia coli is an emerging pathogen whose global importance in public health has increased in recent years. Despite the significant risk of disease linked to contaminated water exposure, the prevalence of E. coli pathotypes in aquatic environments is still not so well defined. The aim of the present study was to detect the presence of typical enteroaggregative E. coli through the recognition of its virulence factors aap, AA probe and aggR by molecular techniques. A total of 93 water samples from different small communities of Chaco were analyzed. E. coli was identified in 36 (38.7%) of the tested samples. Six strains isolated from different samples harbored the studied genes. Of these 6 isolates, 3 carried the aap gene, 2 the AA probe and the last one the combination of aap/aggR genes. The prevalence of E. coli isolates harboring enteroaggregative virulence genes in groundwater sources was 6.4%. This work represents the first contribution to the study of the presence and distribution of virulence genes of EAEC in groundwater sources in this region of Argentina.

  12. Antibiotic resistance genes and virulence factors in Enterococcus faecium and Enterococcus faecalis from diseased farm animals: pigs, cattle and poultry.

    PubMed

    Seputiene, V; Bogdaite, A; Ruzauskas, M; Suziedeliene, E

    2012-01-01

    Eighty enterococcal isolates (E. faecium, n = 38, E. faecalis, n = 42) from diseased farm animals (swine, cattle, poultry) in Lithuania have been studied for the prevalence of antibiotic resistance and for resistance and virulence genetic determinants. 86% of E. faecium and 71% of E. faecalis isolates were multidrug resistant (resistant to three or more unrelated antibiotics). Resistance to aminoglycosides, tetracycline and erythromycin was found most frequently in both species (61%, 69%) and was linked to aph(3')-IIIa, aac(6')-Ie-aph(2")-Ia, ant(6)-Ia (aminoglycoside resistance), tetM, tetL (tetracycline resistance), ermA, ermB (erythromycin resistance) gene combinations, which were supplemented with chloramphenicol resistance genes catA7, catA8 (E. faecalis) and catA9 (E. faecium). All E. faecalis isolates harboured genes coding for virulence factors agg, esp, fsr gelE alone or in combinations with the high prevalence of esp gene in isolates from cattle (63%) and pigs (79%). The origin-dependent incidence of agg gene variants prgB and asp1 was observed. The results indicate the existence of a large pool of potentially virulent and multidrug resistant E. faecalis in diseased farm animals posing risk to humans.

  13. Al-Ti Particulate Composite: Processing and Studies on Particle Twinning, Microstructure, and Thermal Stability

    NASA Astrophysics Data System (ADS)

    Yadav, Devinder; Bauri, Ranjit; Kauffmann, Alexander; Freudenberger, Jens

    2016-08-01

    The present investigation shows that alternate to the ceramic particles, hard metallic particles can be used as reinforcement in an aluminum matrix to achieve a good strength-ductility combination in a composite. Titanium particles were incorporated into aluminum by friction stir processing (FSP) to process an Al-Ti particulate composite. FSP led to uniform distribution of the particles in the stir zone without any particle-matrix reaction, thereby retaining the particles in their elemental state. Fracture and twinning of the Ti particles with different frequency of occurrence on the advancing and retreating sides of the stir zone was observed. Twinning of the particles was studied by focused ion beam-assisted transmission electron microscopy. The processed Al-Ti composite exhibited a significant improvement in strength and also retained appreciable amount of ductility. The thermal stability of the fine-grained structure against abnormal grain growth (AGG) was improved by the Ti particles. The AGG in the Al-Ti composite occurred at 713 K (440 °C) compared to 673 K (400 °C) in the unreinforced aluminum processed under the same conditions. On the other hand, the particle-matrix reaction occurred only at 823 K (550 °C), and hence the Ti particles were thermally more stable compared to the matrix grain structure.

  14. Adhesiveness for extracellular matrices and lysosomal enzyme release from normal and beta 2 integrin-deficient bovine neutrophils.

    PubMed

    Nagahata, H; Higuchi, H; Noda, H; Tamoto, K; Kuwabara, M

    1996-01-01

    The adhesiveness of control and CD18-deficient bovine neutrophils on culture plates precoated with collagen I, collagen IV, fibronectin and laminin was measured to evaluate the possible factors for adherence to extracellular matrices. The release of N-acetyl-beta-D-glucosaminidase (NAGase) from control and CD18-deficient neutrophils stimulated with complement receptor type 3 (CR3) or Fc receptor dependent stimuli was also evaluated. The adhesive activities of CD18-deficient neutrophils to collagen I, collagen IV and fibronectin were significantly diminished (P < 0.05); however, similar adhesion to laminin was observed in CD18-deficient neutrophils and control neutrophils. The adhesive activity of control neutrophils on uncoated plates increased 2.5 times (P < 0.05) with the presence of PMA. The mean activities for NAGase release from CD18-deficient neutrophils stimulated with opsonized zymosan and aggregated bovine immunoglobulin G (Agg-IgG) were 46.7 and 82.7% that of the control neutrophils, respectively. The Agg-IgG-induced NAGase release from control and CD18-deficient neutrophils was eliminated by H7, a protein kinase C inhibitor. These results support that an association between CR3 and Fc receptors on neutrophils appears to play an essential role in neutrophil functions. PMID:8981354

  15. Antibacterial activity and inhibition of protein synthesis in Escherichia coli by antisense DNA analogs.

    PubMed

    Rahman, M A; Summerton, J; Foster, E; Cunningham, K; Stirchak, E; Weller, D; Schaup, H W

    1991-01-01

    Protein synthesis, which takes place within ribosomes, is essential for the survival of any living organism. Ribosomes are composed of both proteins and RNA. Specific interaction between the 3' end CCUCC sequence of prokaryotic 16S rRNA and a partially complementary sequence preceding the initiating codon of mRNA is believed to be a prerequisite for initiation of protein synthesis. Here we report the use of short (three to six nucleotides) synthetic DNA analogs complementary to this sequence to block protein synthesis in vitro and in vivo in Escherichia coli. In the DNA analogs the normal phosphodiester bond in the antisense DNA was replaced by methylcarbamate internucleoside linkages to enhance transport across plasma membranes. Of the analogs tested, those with the sequence AGG and GGA inhibit protein synthesis and colony formation by E. coli strains lacking an outer cell wall. Polyethylene glycol 1000 (PEG 1000) was attached to the 5' end of some of the test methylcarbamate DNAs to enhance solubility. Analogs of AGG and GGAG with PEG 1000 attached inhibited colony formation in normal E. coli. These analogs may be useful food additives to control bacterial spoilage and biomedically as antibiotics. PMID:1821653

  16. [Analysis of FOXO1A and FOXO3A Gene Allele Association with Human Longevity].

    PubMed

    Erdman, V V; Nasibullin, T R; Tuktarova, I A; Somova, R Sh; Mustafina, O E

    2016-04-01

    Seeking human longevity association with gene polymorphisms in transcription factors in the Tatar ethnic group, we conducted an analysis for age-related genotype, frequencies in polymorphic sites of FOXO1A (rs4943794, 72327C>G) and FOXO3A (rs3800231, 35-2764A>G) genes. Genotyping was conducted by using the PCR-RFLP approach. According to the results of logistic regression analysis, during maturity and old age periods, a decrease in the number of FOXO1A*G/*G (OR = 0.984, P = 0.004) genotype carriers occurs and an increase in the number of FOXO1A*C/*G (OR = 1.035, P = 0.014) and FOXO1A*C/*C (OR = 1.024, P = 0.033) genotype carriers occurs in the sample of subjects before gender adjustments. In the sample of long-livers, the number of FOXO1A*C/*C (OR = 0.772, P = 0.028) genotype carriers decreased among women, while the number of FOXO3A*G/*G (OR = 1.008, P = 0.0001) genotype carriers increased among both men and women. Therefore, the FOXO1A gene polymorphic site rs4943794 is associated with an acquisition of old and senescent age in a sample before gender adjustments and with women's longevity. FOXO3A gene polymorphic site rs3800231 is associated with longevity in both women and men. PMID:27529982

  17. Glu-47, which forms a salt bridge between neurophysin-II and arginine vasopressin, is deleted in patients with familial central diabetes insipidus

    SciTech Connect

    Yuasa, Hiromitsu; Ito, Masafumi; Nagasaki, Hiroshi; Oiso, Yutaka; Saito, Hidehiko ); Miyamoto, S.; Sasaki, N. )

    1993-09-01

    The arginine vasopressin (AVP) gene was sequenced in a pedigree with familial central diabetes insipidus (DI). When polymerase chain reaction-amplified DNAs from affected subjects were subjected to polyacrylamide gel electrophoresis, fragments including exon 2 displayed two additional, slower migrating bands. These extra bands represented DNA heteroduplexes, indicating that there was a deletion or insertion mutation in exon 2. As the region with such a mutation was identified by direct sequence analysis, polymerase chain reaction-amplified fragments including the region were subcloned and sequenced. A 3-basepair deletion (AGG) out of two consecutive AGG sequences (nucleotides 1824-1829) was identified in one of two alleles. The cosegregation of the mutation with the DI phenotype in the family was confirmed by restriction enzyme analyses. This mutation should yield an abnormal AVP precursor lacking Glu[sup 47] in its neurophysin-II (NP) moiety. Since Glu[sup 47] is essential for NP molecules to form a salt bridge with AVP, it is very likely that the function of NP as a carrier protein for AVP would be impaired. The authors suggest that AVP would undergo accelerated proteolytic degradation, and this mechanism would be involved in the pathogenesis of DI in this pedigree. 34 refs., 4 figs., 2 tabs.

  18. pic gene of enteroaggregative Escherichia coli and its association with diarrhea in Peruvian children.

    PubMed

    Durand, David; Contreras, Carmen A; Mosquito, Susan; Ruíz, Joaquim; Cleary, Thomas G; Ochoa, Theresa J

    2016-08-01

    Enteroaggregative Escherichia coli (EAEC) causes acute and persistent diarrhea among children, HIV-infected patients, and travelers to developing countries. We have searched for 18 genes-encoding virulence factors associated with aggregative adherence, dispersion, biofilm, toxins, serine protease autotransporters of Enterobacteriaceae (SPATEs) and siderophores, analyzed in 172 well-characterized EAEC strains (aggR(+)) isolated from stool samples of 97 children with diarrhea and 75 healthy controls from a passive surveillance diarrhea cohort study in Peru. Eighty-one different genetic profiles were identified, 37 were found only associated with diarrhea and 25 with control samples. The most frequent genetic profile was aggC(+)aatA(+)aap(+)shf(+)fyuA(+), present in 19 strains, including diarrhea and controls. The profile set1A(+)set1B(+)pic(+) was associated with diarrhea (P < 0.05). Of all genes evaluated, the most frequent were aatA (CVD 342) present in 159 strains (92.4%) and fyuA in 157 (91.3%). When EAEC strains were analyzed as a single pathogen (excluding co-infections), only pic was associated with diarrhea (P < 0.05) and with prolonged diarrhea (diarrhea ≥ 7 days) (P < 0.05). In summary, this is the first report on the prevalence of a large set of EAEC virulence genes and its association with diarrhea in Peruvian children. More studies are needed to elucidate the exact role of each virulence factor.

  19. The reaction of [Fe(pic)3] with hydrogen peroxide: a UV-visible and EPR spectroscopic study (Hpic = picolinic acid).

    PubMed

    Jain, Sneh L; Bhattacharyya, Pravat

    2005-08-21

    The Gif family of catalysts, based on an iron salt and O2 or H2O2 in pyridine, allows the oxygenation of cyclic saturated hydrocarbons to ketones and alcohols under mild conditions. The reaction between [Fe(pic)3] and hydrogen peroxide in pyridine under GoAgg(III)(Fe(III)/Hpic catalyst) conditions was investigated by UV-visible spectrophotometry. Reactions were monitored at 430 and 520 nm over periods ranging from a few minutes to several hours at 20 degrees C. A number of kinetically stable intermediates were detected, and their relevance to the processes involved in the assembly of the active GoAgg(III) catalyst was determined by measuring the kinetics in the presence and absence of cyclohexane. EPR measurements at 110 K using hydrogen peroxide and t-BuOOH as oxidants were used to further probe these intermediates. Our results indicate that in wet pyridine [Fe(pic)3] undergoes reversible dissociation of one picolinate ligand, establishing an equilibrium with [Fe(pic)2(py)(OH)]. Addition of aqueous hydrogen peroxide rapidly generates the high-spin complex [Fe(pic)2(py)(eta1-OOH)] from the labilised hydroxy species. Subsequently the hydroperoxy species undergoes homolysis of the Fe-O bond, generating HOO. and [Fe(pic)2(py)2], the active oxygenation catalyst.

  20. Self-assembly, hydration, and structures in N-decanoyl-N-methylglucamide aqueous solutions: effect of salt addition and temperature.

    PubMed

    Molina-Bolívar, J A; Hierrezuelo, J M; Carnero Ruiz, C

    2007-09-15

    The influence of NaCl addition and temperature on the self-assembly, hydration, and structures of N-decanoyl-N-methylglucamide (MEGA-10) in dilute solution has been investigated by using several experimental techniques, including tensiometry, steady-state fluorescence, density, viscosity, and static and dynamic light scattering. Tensiometry and fluorescence probe studies, by using pyrene as a probe, were used to obtain the critical micelle concentration (cmc) upon the electrolyte addition. The mean micellar aggregation numbers (N(agg)) as a function of the salt addition were obtained by both static light scattering and static quenching methods. The N(agg) values estimated by both methods were found to be in good agreement. It was found that the increase in the micelle size, produced by the addition of NaCl, is due to the increase in the aggregation number and in the amount of water non-specifically associated to the micelle. On the other hand, we have observed that the aggregation number remains invariant in the temperature range studied, whereas the hydrodynamic radius slightly decreases. The effect of electrolyte addition and temperature on the properties of MEGA-10 micelles is much less pronounced than those observed in the traditionally used POE-based surfactants.

  1. Fatigue stress concentration and notch sensitivity in nanocrystalline metals

    DOE PAGES

    Furnish, Timothy A.; Boyce, Brad L.; Sharon, John A.; O’Brien, Christopher J.; Clark, Blythe G.; Arrington, Christian L.; Pillars, Jamin R.

    2016-03-11

    Recent studies have shown the potential for nanocrystalline metals to possess excellent fatigue resistance compared to their coarse-grained counterparts. Although the mechanical properties of nanocrystalline metals are believed to be particularly susceptible to material defects, a systematic study of the effects of geometric discontinuities on their fatigue performance has not yet been performed. In the present work, nanocrystalline Ni–40 wt%Fe containing both intrinsic and extrinsic defects were tested in tension–tension fatigue. The defects were found to dramatically reduce the fatigue resistance, which was attributed to the relatively high notch sensitivity in the nanocrystalline material. Microstructural analysis within the crack-initiation zonesmore » underneath the defects revealed cyclically-induced abnormal grain growth (AGG) as a predominant deformation and crack initiation mechanism during high-cycle fatigue. Furthermore, the onset of AGG and the ensuing fracture is likely accelerated by the stress concentrations, resulting in the reduced fatigue resistance compared to the relatively defect-free counterparts.« less

  2. First isolation of enteroaggregative Escherichia coli O104:H4 from a diarrhea case in Argentina.

    PubMed

    Carbonari, Claudia C; Deza, Natalia; Flores, Mario; Gasparini, Alejandra; Manfredi, Eduardo; Rivas, Marta

    2014-01-01

    We describe the first isolation of an enteroaggregative Escherichia coli (EAEC) O104:H4 strain associated with an acute diarrhea case in Argentina. Two multiplex PCRs (mPCR) were performed as screening of genes mPCR1 (eae, lt, and st) and mPCR2 (IpaH, aggR, stx1 and stx2). A mPCR to detect the rfbO104, fliCH4 and terD genes, and PCR assays for the detection of pCVD432 plasmid, aaiC and lpfO113 genes were included. Biochemical and antimicrobial susceptibility assays as well as serotyping were performed. The identified E. coli strain was susceptible to all antimicrobials tested and harbored the aggR, aaiC, pCVD432 plasmid, lpfO113, rfbO104, fliCH4 and terD genes. Although serotype EAEC O104:H4 rarely spreads and sporadic cases have been reported, global concern increased after the large-scale outbreak in Europe in 2011. The finding of EAEC O104:H4 reinforces the need for improved methodologies for the detection of all E. coli pathotypes.

  3. Microcalorimetric and SAXS determination of PEO-SDS interactions: the effect of cosolutes formed by ions.

    PubMed

    Barbosa, Aparecida Mageste; Santos, Igor José Boggione; Ferreira, Guilherme Max Dias; da Silva, Maria do Carmo Hespanhol; Teixeira, Alvaro Vianna Novaes de Carvalho; da Silva, Luis Henrique Mendes

    2010-09-23

    The effect of different ionic cosolutes (NaCl, Na(2)SO(4), Li(2)SO(4), NaSCN, Na(2)[Fe(CN)(5)NO], and Na(3)[Co(NO)(6)]) on the interaction between sodium dodecyl sulfate (SDS) and poly(ethylene oxide) (PEO) was examined by small-angle X-ray scattering (SAXS) and isothermal titration calorimetric techniques. The critical aggregation concentration values (cac), the saturation concentration (C(2)), the integral enthalpy change for aggregate formation (ΔH(agg)(int)) and the standard free energy change of micelle adsorption on the macromolecule chain (ΔΔG(agg)) were derived from the calorimetric titration curves. In the presence of 1.00 mmol L(-1) cosolute, no changes in the parameters were observed when compared with those obtained for SDS-PEO interactions in pure water. For NaCl, Na(2)SO(4), Li(2)SO(4), and NaSCN at 10.0 and 100 mmol L(-1), the cosolute presence lowered cac, increased C(2), and the PEO-SDS aggregate became more stable. In the presence of Na(2)[Fe(CN)(5)NO], the calorimetric titration curves changed drastically, showing a possible reduction in the PEO-SDS degree of interaction, possibility disrupting the formed nanostructure; however, the SAXS data confirmed, independent of the small energy observed, the presence of aggregates adsorbed on the polymer chain.

  4. Personality as a predictor of depression symptoms in burn patients: a follow-up study.

    PubMed

    Giannoni-Pastor, A; Gomà-i-Freixanet, M; Valero, S; Fidel Kinori, S G; Tasqué-Cebrián, R; Arguello, J M; Casas, M

    2015-02-01

    There is empirical evidence that having some personality characteristics increases the risk of developing depression. This is the first study which analyses the role of personality dimensions, assessed by the Alternative Five Factor Model, in the development of depressive symptoms in adult burn survivors across time. Participants were 109 adult burn survivors admitted to a Burns Unit. Personality was assessed by the Zuckerman-Kuhlman Personality Questionnaire and depression symptoms by the Beck Depression Inventory. After adjusting by age, gender and burn size, results showed that high Neuroticism-Anxiety (N-Anx) and Aggression-Hostility (Agg-Host) were related to higher depression scores when compared with low N-Anx and Agg-Host groups along the six months follow-up. Moreover, Activity and Impulsive-Sensation Seeking factors were involved in statistically significant different depressive symptom development trajectories during the six months after burn. These findings suggest that personality factors could be used to identify the most vulnerable patients, who could develop severe mood symptoms at different points in their recovery.

  5. Direct electrospinning of 3D auricle-shaped scaffolds for tissue engineering applications.

    PubMed

    Walser, Jochen; Stok, Kathryn S; Caversaccio, Marco D; Ferguson, Stephen J

    2016-05-12

    Thirty-two poly(ε)caprolactone (PCL) scaffolds have been produced by electrospinning directly into an auricle-shaped mould and seeded with articular chondrocytes harvested from bovine ankle joints. After seeding, the auricle shaped constructs were cultured in vitro and analysed at days 1, 7, 14 and 21 for regional differences in total DNA, glycosaminoglycan (GAG) and collagen (COL) content as well as the expression of aggrecan (AGG), collagen type I and type II (COL1/2) and matrix metalloproteinase 3 and 13 (MMP3/13). Stress-relaxation indentation testing was performed to investigate regional mechanical properties of the electrospun constructs. Electrospinning into a conductive mould yielded stable 3D constructs both initially and for the whole in vitro culture period, with an equilibrium modulus in the MPa range. Rapid cell proliferation and COL accumulation was observed until week 3. Quantitative real time PCR analysis showed an initial increase in AGG, no change in COL2, a persistent increase in COL1, and only a slight decrease initially for MMP3. Electrospinning of fibrous scaffolds directly into an auricle-shape represents a promising option for auricular tissue engineering, as it can reduce the steps needed to achieve an implantable structure.

  6. Antithrombotic effect of a polysaccharide fraction from Laminaria japonica from the South China Sea.

    PubMed

    Xie, Lu; Chen, Meng-Hua; Li, Jing; Yang, Xiao-Mei; Huang, Qiao-Juan

    2011-09-01

    Some in vitro studies have identified an antithrombotic effect of polysaccharides from Laminaria japonica, but this activity remains to be confirmed in vivo. In this study a polysaccharide fraction termed PLG was extracted from L. japonica in the Beibu Gulf in Guangxi, China, and its antithrombotic effects explored in rat models of carotid and venous thrombosis. Its anticoagulation and antiplatelet properties were assessed by measuring the prothrombin time (PT), activated partial thromboplastin time (APTT) and ADP-induced platelet aggregation rate (Agg(max)). Its effects on bleeding time were measured using the tail transection method. It was found that pretreatment with an intraperitoneal injection of PLG at 2.5 or 5.0 mg/kg significantly prolonged the occlusion time in the carotid thrombosis model, and a dose of 5.0 mg/kg reduced the thrombus weight in the venous thrombosis model. Pretreatment with PLG (5.0 mg/kg) increased the APTT and decreased the ADP-induced platelet Agg(max). Neither dose of PLG significantly prolonged the bleeding time compared with the control group. In an in vitro anticoagulation assay using human plasma, PLG at 57.14, 28.57 and 28.57 μg/mL inhibited APTT and PT in a concentration-dependent manner. The results show that PLG possesses antithrombotic activity in a rat model, and that it may prove to be clinically useful in humans.

  7. Annual laminae as measured using fluorescence in historic stalagmites from Baradla Cave, Aggtelek National Park, Hungary.

    NASA Astrophysics Data System (ADS)

    van Beynen, P.; Ford, D.; Schwarcz, H.

    2012-04-01

    Calcite and aragonite speleothems (stalactites and stalagmites) deposited in caves often display fluorescence. It may take the form of couplets of greater and lesser intensity that have been shown to be annual pairs in some carefully controlled instances such as deposits in 20th Century canal tunnels. The variations of intensity are related to seasonal variations in concentrations of fluorophores (chiefly fulvic acids) in the feed water to the speleothem. To test for the possibility and replicability of couplet formation two small stalagmites likely to be of historic age were collected in Baradla Cave, Aggtelek National Park, Hungary, in 1992. This is a large cave in Triassic limestones and dolomites that have been intensely deformed by Carpathian tectonism to allow ready ground water penetration. As a consequence, it is profusely decorated with speleothems and has been a tourist attraction since the 18th Century. The samples were taken ten metres apart in an abandoned river passage at a depth of 40-60 m beneath the surface, which is mantled with terra rossas, rendzinas and luvisols mostly less than 50 cm in thickness. The vegetation cover is deciduous forest with small patches of grassland, spruce and pine. At a nearby meteorological station 30-year mean January and July temperatures are -3.5o C and 18.5o C respectively. Annual mean precipitation is 560 mm, with a summer maximum and actual evapotranspiration less than 400 mm. Samples AGG-1 and -2 were bright white calcite stalagmites 90 and 70 mm in length respectively and 40-50 mm in width. They were growing on the blackened stumps of larger stalagmites that had been taken as souvenirs. Blackening was caused by smoky torches used in the earliest days of tourism, and replaced by lanterns around 1820 CE. 2 mm thick slices were cut perpendicular to the growth axes of the samples, polished, excited by electronic flash gun and photographed at 1/60th second with Kodak TMAX ISO 3200 film, using multiple exposures to

  8. Efficacy of 11 Brazilian essential oils on lethality of the cattle tick Rhipicephalus (Boophilus) microplus.

    PubMed

    Chagas, Ana Carolina de Souza; Oliveira, Márcia Cristina de Sena; Giglioti, Rodrigo; Santana, Raul Costa Mascarenhas; Bizzo, Humberto Ribeiro; Gama, Paola Ervatti; Chaves, Francisco Celio Maia

    2016-04-01

    Herbal extracts have been investigated as an alternative for parasite control, aiming to slow the development of resistance and to obtain low-cost biodegradable parasiticides. The goal of this study was to evaluate the efficacy, in vitro, of 11 essential oils from Brazil on reproductive efficiency and lethality of the cattle tick Rhipicephalus (Boophilus) microplus. The effects of oils extracted from Curcuma longa, Zingiber officinale, Lippia alba, Lippia gracilis, Lippia origanoides, Lippia sidoides, Mentha arvensis, Mentha piperita, Croton cajucara (white and red), and Croton sacaquinha on ticks were investigated by the Immersion Test with Engorged Females (ITEF) and the modified Larval Packet Test (LPT). Distilled water and 2% Tween 80 were used as control treatments. Chemical analysis of the oils was done with gas chromatography coupled with mass spectrometry. Analysis of the in vitro tests using Probit (SAS program) allowed the calculation of lethal concentrations (LCs). Lower reproductive efficiency indexes and higher efficacy percentages in the ITEF were obtained with the oils extracted from C. longa (24 and 71%, respectively) and M. arvensis oils (27 and 73%, respectively). Lower LC50 was reached with C. longa (10.24 mg/mL), L. alba (10.78 mg/mL), M. arvensis (22.31 mg/mL), L. sidoides (27.67 mg/mL), and C. sacaquinha (29.88 mg/mL) oils. In the LPT, species from Zingiberaceae and Verbenaceae families caused 100% lethality at 25 mg/mL, except for L. sidoides. The most effective oils were from C. longa, L. gracilis, L. origanoides, L. alba, and Z. officinale. The LC50 and LC90 were, respectively: 0.54 and 1.80 mg/mL, 3.21 and 7.03 mg/mL, 3.10 and 8.44 mg/mL, 5.85 and 11.14 mg/mL, and 7.75 and 13.62 mg/mL. The efficacy was directly related to the major components in each essential oil, and the oils derived from Croton genus presented the worst performance, suggesting the absence of synergistic effect among its compounds. Since C. longa, containing 62

  9. Efficacy of 11 Brazilian essential oils on lethality of the cattle tick Rhipicephalus (Boophilus) microplus.

    PubMed

    Chagas, Ana Carolina de Souza; Oliveira, Márcia Cristina de Sena; Giglioti, Rodrigo; Santana, Raul Costa Mascarenhas; Bizzo, Humberto Ribeiro; Gama, Paola Ervatti; Chaves, Francisco Celio Maia

    2016-04-01

    Herbal extracts have been investigated as an alternative for parasite control, aiming to slow the development of resistance and to obtain low-cost biodegradable parasiticides. The goal of this study was to evaluate the efficacy, in vitro, of 11 essential oils from Brazil on reproductive efficiency and lethality of the cattle tick Rhipicephalus (Boophilus) microplus. The effects of oils extracted from Curcuma longa, Zingiber officinale, Lippia alba, Lippia gracilis, Lippia origanoides, Lippia sidoides, Mentha arvensis, Mentha piperita, Croton cajucara (white and red), and Croton sacaquinha on ticks were investigated by the Immersion Test with Engorged Females (ITEF) and the modified Larval Packet Test (LPT). Distilled water and 2% Tween 80 were used as control treatments. Chemical analysis of the oils was done with gas chromatography coupled with mass spectrometry. Analysis of the in vitro tests using Probit (SAS program) allowed the calculation of lethal concentrations (LCs). Lower reproductive efficiency indexes and higher efficacy percentages in the ITEF were obtained with the oils extracted from C. longa (24 and 71%, respectively) and M. arvensis oils (27 and 73%, respectively). Lower LC50 was reached with C. longa (10.24 mg/mL), L. alba (10.78 mg/mL), M. arvensis (22.31 mg/mL), L. sidoides (27.67 mg/mL), and C. sacaquinha (29.88 mg/mL) oils. In the LPT, species from Zingiberaceae and Verbenaceae families caused 100% lethality at 25 mg/mL, except for L. sidoides. The most effective oils were from C. longa, L. gracilis, L. origanoides, L. alba, and Z. officinale. The LC50 and LC90 were, respectively: 0.54 and 1.80 mg/mL, 3.21 and 7.03 mg/mL, 3.10 and 8.44 mg/mL, 5.85 and 11.14 mg/mL, and 7.75 and 13.62 mg/mL. The efficacy was directly related to the major components in each essential oil, and the oils derived from Croton genus presented the worst performance, suggesting the absence of synergistic effect among its compounds. Since C. longa, containing 62

  10. Enhanced expression of Fc receptors on neutrophils from calves with leukocyte adhesion deficiency.

    PubMed

    Nagahata, H; Higuchi, H; Nochi, H; Tamoto, K; Noda, H; Kociba, G J

    1995-01-01

    The expression of Fc receptors for immunoglobulin G(IgG) and concanavalin A (con A)-binding receptors, luminol-dependent chemiluminescent (LDCL) responses, and the effect of anti-bovine IgG on LDCL responses were evaluated in neutrophils from Holstein calves with leukocyte adhesion deficiency (BLAD). Neutrophils from affected calves showed a 2.1- to 2.5-fold increase in Fc receptor expression compared with those of control calves by flow cytometric analysis. Con A-binding activities of neutrophils from affected calves were similar to those of control calves. Neutrophils from a calf with BLAD, when stimulated with zymosan opsonized with bovine serum (OPZ), heat-aggregated bovine IgG (Agg-bovine IgG), sheep red blood cells (SRBC) sensitized with anti-SRBC antibody (SRBC-anti-SRBC Ab), or con A had LDCL responses of 36 (P < 0.05), 77, 126 and 119% of peak LDCL values of controls, respectively. The NBT-reducing value of neutrophils from a calf with BLAD when stimulated with Agg-bovine IgG after pretreatment with anti-bovine IgG was 116.5% of the values of neutrophils from control calves, but the difference was not significant. The LDCL responses of neutrophils from a control calf and a calf with BLAD stimulated with OPZ were inhibited markedly by pre-incubation with anti-bovine IgG antiserum at concentrations ranging from 1.25 to 20 or 40 micrograms/ml. Although an increase in Fc receptor expression on neutrophils from calves with BLAD was observed, the LDCL responses stimulated with SRBC-anti-SRBC Ab and NBT-reducing activity stimulated with Agg-bovine IgG after pretreatment with anti-bovine IgG did not correlate significantly with the increased Fc receptor expression. These results support that neutrophil functions mediated by the Fc receptors are associated synergistically with the presence of the complement receptor type 3 (CR3)(CD11b/CD18). PMID:8577284

  11. The Structure and Electrical Properties of the Ag2Se + Ga2Se3 + GeSe2 Glass System

    NASA Astrophysics Data System (ADS)

    Marple, Maxwell Adam Thomas

    Silver containing homogeneous chalcogenide glasses in the ternary system Ag2Se-Ga2Se3-GeSe2 (AGGS) are synthesized and their atomic structure-property relationships are investigated. Structural studies are carried out using Raman, 77Se, 71Ga, 69Ga, and 109Ag nuclear magnetic resonance (NMR) spectroscopy. The structure of these glasses consists primarily of a network of corner sharing (Ga/Ge)Se4/2 tetrahedra with a small fraction of homopolar Se-Se bonds. Compositional modification of the atomic structure follows the charge compensated network model developed in the literature for aluminosilicate glasses. Ag2Se acts as a network modifier, forming non-bridging Se in glasses with Ag/Ga >1, while Ga 2Se3 plays the role of a network intermediate similar to Al2O3 in oxide glasses. The network favors the formation of homopolar Ge-Ge bonding in glasses with Ag/Ga <1, to accommodate the Se deficiency brought by the incorporation of Ga2Se3 with Ga being tetrahedrally coordinated to Se. This structural model is consistent with the variation in the glass transition temperatures and molar volume. Electrical Impedance Spectroscopy (EIS) reveals the ionic conductivity of the AGGS glasses to be quite high at ambient temperature, reaching up to 10 --4 S/cm for glasses with the highest Ag content. Increasing Se deficiency with respect to stoichiometry can enhance the conductivity further to ˜3x10--4 S/cm . Transference number measurements using the electromotive force (EMF) method as well as variable temperature 109Ag NMR line shape studies indicate that the conductivity is predominantly ionic in nature and results from fast hopping dynamics of Ag ions. The high ionic conductivity can be related to a heavily modified structural network that results in a potential energy landscape with many suitable hopping sites for the Ag ions. These structural characteristics and electrical properties of the glasses in the AGGS system may guide in the development of next generation fast ion

  12. Detection of complement activation by counterimmunoelectrophoresis (CIE).

    PubMed

    Arroyave, C M; Tan, E M

    1976-01-01

    Counterimmunoelectrophoresis (CIE) was used as a method of detecting activation of the third component of the complement system (C3). Highly purified C3, normal human serum (NHS), EDTA-treated plasma and serum activated with aggregated human immunoglobulin (agg-IgG) or inulin were used as sources of C3 and/or C3 split products. Activation of the alternative pathway of complement was assayed in the presence of EGTA (10 mM) and MgCl2 (0.3 mM), conditions which block activation of the classical pathway. When purified native C3, fresh NHS and fresh EDTA-plasma were tested in CIE against either antisera to whole C3 or to C3 split products, only one precipitin line was found, which was identified as native C3. However, when serum activated with agg-IgG or inulin were tested against the same reagents, two precipitin lines were seen. The first, with more cathodal mobility was identical to that of native C3. The second line had a more anodal mobility, was distinctly separated from the first and contained C3c and C3d as shown immunochemically with specific antisera. Native C3 and split products of C3 were identified by this CIE method in patients showing evidence of activated complement by having subnormal total complement (CH50) levels. When C3 split products were identified, the C3c-C3d precipitin line could always be distinguished from native C3 by its different electrophoretic mobility, even when C3 concentrations in serum varied from 0.25 mg/ml to 1.5 mg/ml. The sensitivity of CIE was compared to that of CH50 by asssaying at different time intervals after agg-IgG was added to fresh NHS. C3c-C3d split products were detected by CIE before any fall in CH50 and at all times when a significant decrease in CH50 was present. This study shows that the CIE technique is a highly sensitive, specific and rapid method for detecting activation of the complement system via classical or alternative pathways in human disease.

  13. Chemical composition and biological activities of the essential oils from two Pereskia species grown in Brazil.

    PubMed

    Souza, Lucéia Fatima; De Barros, Ingrid Bergman Inchausti; Mancini, Emilia; De Martino, Laura; Scandolera, Elia; De Feo, Vincenzo

    2014-12-01

    The chemical composition of the essential oils of Pereskia aculeata Mill. and P. grandifolia Haw. (Cactaceae), grown in Brazil, was studied by means of GC and GC-MS. In all, 37 compounds were identified, 30 for P. aculeata and 15 for P. grandifolia. Oxygenated diterpenes are the main constituents, both in the oil ofP. grandifolia (55.5%) and in that ofP. aculeata (29.4%). The essential oils were evaluated for their in vitro phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Sinapis arvensis L., and Phalaris canariensis L. seeds. The essential oil of P. grandifolia, at all doses tested, significantly inhibited the radicle elongation of R. sativus. Moreover, the antimicrobial activity of the essential oils was assayed against ten bacterial strains. The essential oils showed weak inhibitory activity against the Gram-positive pathogens. PMID:25632490

  14. Biological evaluation and determination of the absolute configuration of chloromonilicin, a strong antimicrobial metabolite isolated from Alternaria sonchi.

    PubMed

    Cimmino, Alessio; Pescitelli, Gennaro; Berestetskiy, Alexander; Dalinova, Anna; Krivorotov, Denis; Tuzi, Angela; Evidente, Antonio

    2016-01-01

    Chloromonilicin was isolated for the first time from Alternaria sonchi, a mycoherbicide proposed for the control of the noxious weed Sonchus arvensis. The already known alternethanoxins A and B and the three recently isolated phytotoxic polycyclic ethanones named alternethanoxins C-E were also isolated from the same source. Chloromonilicin was identified by spectroscopic data (essentially one-dimensional NMR, 2-dimensional NMR and high-resolution ESI-MS) and its structure was confirmed by single X-ray analysis, which also allowed the assignment of the absolute configuration. This latter was independently confirmed by electronic CD calculations. When chloromonilicin was tested for its antimicrobial activity, it was active at concentrations 0.5-1 μg per disc against four bacterial species and a yeast fungus. The compound inhibited conidial germination of four plant pathogens at concentration of 1-10 μg ml(-1). No phytotoxic activity of this antibiotic by leaf-disc puncture bioassay was detected.

  15. Carbon Dioxide Compensation Points of Flowering Plants 1

    PubMed Central

    Krenzer, Eugene G.; Moss, Dale N.; Crookston, R. Kent

    1975-01-01

    Carbon dioxide compensation points of several hundred species of monocotyledons and dicotyledons have been measured during the course of various experiments in our laboratory over a period of several years. These have been classified into two groups: high, compensation points of 40 μl/l or greater; and low, compensation points of 10 μl/l or less. They are listed alphabetically both by families and species for monocotyledons and dicotyledons. Only two species did not unequivocally fit into the above established groups. These were Moricandia arvensis (L.) DC., which had an average compensation point of 26 μl/l and Panicum milioides Nees ex Trin., which was variable, but most often equilibrated between 12 to 20 μl/l CO2. PMID:16659272

  16. In Vitro Antimicrobial Activity of Spices and Medicinal Herbs against Selected Microbes Associated with Juices.

    PubMed

    Dhiman, Romika; Aggarwal, Neeraj; Aneja, Kamal Rai; Kaur, Manpreet

    2016-01-01

    In the present investigation, comparison of antimicrobial activities of different spices, Curcuma longa, Zingiber officinale, and Mentha arvensis, and medicinal herbs, such as Withania somnifera, Rauvolfia serpentina, Emblica officinalis, Terminalia arjuna, and Centella asiatica, was evaluated. Different extraction solvents (acetone, methanol, ethanol, and water) were used and extracts were examined against Bacillus cereus, Serratia sp., Rhodotorula mucilaginosa, Aspergillus flavus, and Penicillium citrinum isolated from juices. Extracts from the medicinal herb and spices have significant activity. B. cereus was the most sensitive and R. mucilaginosa was the most resistant among the microorganisms tested. Ethanolic and methanolic extract of C. asiatica displayed maximum diameter of inhibition zone against bacteria and yeast and percentage mycelial inhibition against moulds. This study confirmed the potential of selected extracts of spices as effective natural food preservative in juices. PMID:26880927

  17. Chemical composition and biological activities of the essential oils from two Pereskia species grown in Brazil.

    PubMed

    Souza, Lucéia Fatima; De Barros, Ingrid Bergman Inchausti; Mancini, Emilia; De Martino, Laura; Scandolera, Elia; De Feo, Vincenzo

    2014-12-01

    The chemical composition of the essential oils of Pereskia aculeata Mill. and P. grandifolia Haw. (Cactaceae), grown in Brazil, was studied by means of GC and GC-MS. In all, 37 compounds were identified, 30 for P. aculeata and 15 for P. grandifolia. Oxygenated diterpenes are the main constituents, both in the oil ofP. grandifolia (55.5%) and in that ofP. aculeata (29.4%). The essential oils were evaluated for their in vitro phytotoxic activity against germination and initial radicle growth of Raphanus sativus L., Sinapis arvensis L., and Phalaris canariensis L. seeds. The essential oil of P. grandifolia, at all doses tested, significantly inhibited the radicle elongation of R. sativus. Moreover, the antimicrobial activity of the essential oils was assayed against ten bacterial strains. The essential oils showed weak inhibitory activity against the Gram-positive pathogens.

  18. Radioprotective Potential of Plants and Herbs against the Effects of Ionizing Radiation.

    PubMed

    C Jagetia, Ganesh

    2007-03-01

    Ionizing radiations produce deleterious effects in the living organisms and the rapid technological advancement has increased human exposure to ionizing radiations enormously. There is a need to protect humans against such effects of ionizing radiation. Attempts to protect against the deleterious effects of ionizing radiations by pharmacological intervention were made as early as 1949 and efforts are continued to search radioprotectors, which may be of great help for human application. This review mainly dwells on the radioprotective potential of plant and herbal extracts. The results obtained from in vitro and in vivo studies indicate that several botanicals such as Gingko biloba, Centella asiatica, Hippophae rhamnoides, Ocimum sanctum, Panax ginseng, Podophyllum hexandrum, Amaranthus paniculatus, Emblica officinalis, Phyllanthus amarus, Piper longum, Tinospora cordifoila, Mentha arvensis, Mentha piperita, Syzygium cumini, Zingiber officinale, Ageratum conyzoides, Aegle marmelos and Aphanamixis polystachya protect against radiation-induced lethality, lipid peroxidation and DNA damage. The fractionation-guided evaluation may help to develop new radioprotectors of desired activities. PMID:18188408

  19. In Vitro Antimicrobial Activity of Spices and Medicinal Herbs against Selected Microbes Associated with Juices

    PubMed Central

    Dhiman, Romika; Aggarwal, Neeraj; Aneja, Kamal Rai; Kaur, Manpreet

    2016-01-01

    In the present investigation, comparison of antimicrobial activities of different spices, Curcuma longa, Zingiber officinale, and Mentha arvensis, and medicinal herbs, such as Withania somnifera, Rauvolfia serpentina, Emblica officinalis, Terminalia arjuna, and Centella asiatica, was evaluated. Different extraction solvents (acetone, methanol, ethanol, and water) were used and extracts were examined against Bacillus cereus, Serratia sp., Rhodotorula mucilaginosa, Aspergillus flavus, and Penicillium citrinum isolated from juices. Extracts from the medicinal herb and spices have significant activity. B. cereus was the most sensitive and R. mucilaginosa was the most resistant among the microorganisms tested. Ethanolic and methanolic extract of C. asiatica displayed maximum diameter of inhibition zone against bacteria and yeast and percentage mycelial inhibition against moulds. This study confirmed the potential of selected extracts of spices as effective natural food preservative in juices. PMID:26880927

  20. In vitro anticancer activity of extracts of Mentha Spp. against human cancer cells.

    PubMed

    Sharma, Vikas; Hussain, Shabir; Gupta, Moni; Saxena, Ajit Kumar

    2014-10-01

    In vitro anticancer potential of methanolic and aqueous extracts of whole plants of Mentha arvensis, M. longifolia, M. spicata and M. viridis at concentration of 100 μg/ml was evaluated against eight human cancer cell lines--A-549, COLO-205, HCT-116, MCF-7, NCI-H322, PC-3, THP-1 and U-87MG from six different origins (breast, colon, glioblastoma, lung, leukemia and prostate) using sulphorhodamine blue (SRB) assay. Methanolic extracts of above-mentioned Mentha Spp. displayed anti-proliferative effect in the range of 70-97% against four human cancer cell lines, namely COLO-205, MCF-7, NCI-H322 and THP-1; however, aqueous extracts were found to be active against HCT-116 and PC-3. The results indicate that Mentha Spp. contain certain constituents with cytotoxic properties which may find use in developing anticancer agents.

  1. Free radical scavenging (DPPH) potential in nine Mentha species.

    PubMed

    Ahmad, Nisar; Fazal, Hina; Ahmad, Iftikhar; Abbasi, Bilal Haider

    2012-02-01

    Mentha species are used in every day life in various food items. These species produce valuable secondary metabolites that scavenge toxic free radicals. Toxic free radicals can cause different diseases in the human body. In the present study free radical scavenging potential (1,1-diphenyl-2-picrylhydrazyl scavenging activity) in nine Mentha species were investigated to evaluate and explore new potential sources for natural antioxidants. The activity was performed after different time intervals with incubation period of 30 minutes. The methanolic extracts revealed that significantly higher activity (82%) was observed in Mentha suaveolens, followed by Mentha longifolia (79%), Mentha officinalis (76%) and Mentha piperita, Mentha pulegium, Mentha royleana (75%), respectively. Significantly same activity was observed in Mentha arvensis and Mentha spicata. Lower activity was observed in Mentha citrata (64%). The present study revealed that these species can be used as natural antioxidants.

  2. Simultaneous Photoacoustic and Photopyroelectric Detection of Trace Gas Emissions from Some Plant Parts and Their Related Essential Oils in a Combined Detection Cell

    NASA Astrophysics Data System (ADS)

    Abu-Taha, M. I.; Abu-Teir, M. M.; Al-Jamal, A. J.; Eideh, H.

    The aim of this work was to establish the feasibility of the combined photoacoustic (PA) and photopyroelectric (PPE) detection of the vapours emitted from essential oils and their corresponding uncrushed leaves or flowers. Gas traces of jasmine (Jessamine (Jasminum)), mint (Mentha arvensis L.) and Damask rose (Rosa damascena Miller) and their essential oils were tested using a combined cell fitted with both a photopyroelectric film (PVDF) and a microphone in conjunction with a pulsed wideband infrared source (PWBS) source. Infrared PA and PPE absorbances were obtained simultaneously at room temperatures with excellent reproducibility and high signal-to-noise ratios. Significant similarities found between the PA and PPE spectra of the trace gas emissions of plant parts, i.e., flowers or leaves and their related essential oils show the good correlation of their emissions and that both effects are initiated by the same absorbing molecules.

  3. Characterization of cellobiohydrolase from a newly isolated strain of Agaricus arvencis.

    PubMed

    Lee, Kyung-Min; Moon, Hee-Jung; Kalyani, Dayanand; Kim, Hoon; Kim, In-Won; Jeya, Marimuthu; Lee, Jung-Kul

    2011-07-01

    A highly efficient cellobiohydrolase (CBH)-secreting basidiomycetous fungus, Agaricus arvensis KMJ623, was isolated and identified based on its morphological features and sequence analysis of internal transcribed spacer rDNA. An extracellular CBH was purified to homogeneity from A. arvencis culture supernatant using sequential chromatography. The relative molecular mass of A. arvencis CBH was determined to be 65 kDa by SDSPAGE and 130 kDa by size-exclusion chromatography, indicating that the enzyme is a dimer. A. arvencis CBH showed a catalytic efficiency (kcat/Km) of 31.8 mM⁻¹ s⁻¹ for p-nitrophenyl-beta-D-cellobioside, the highest level seen for CBH-producing microorganisms. Its internal amino acid sequences showed significant homology with CBHs from glycoside hydrolase family 7. Although CBHs have been purified and characterized from other sources, A. arvencis CBH is distinguished from other CBHs by its high catalytic efficiency.

  4. Anti-Candida activity of Brazilian medicinal plants.

    PubMed

    Duarte, Marta Cristina Teixeira; Figueira, Glyn Mara; Sartoratto, Adilson; Rehder, Vera Lúcia Garcia; Delarmelina, Camila

    2005-02-28

    Essential oils and ethanolic extracts from the leaves and/or roots of 35 medicinal plants commonly used in Brazil were screened for anti-Candida albicans activity. The oils were obtained by water-distillation using a Clevenger-type system. Essential oils from 13 plants showed anti-Candida activity, including Aloysia triphylla, Anthemis nobilis, Cymbopogon martini, Cymbopogon winterianus, Cyperus articulatus, Cyperus rotundus, Lippia alba, Mentha arvensis, Mikania glomerata, Mentha piperita, Mentha sp., Stachys byzantina, and Solidago chilensis. The ethanol extract was not effective at any of the concentrations tested. Chemical analyses showed the presence of compounds with known antimicrobial activity, including 1,8-cineole, geranial, germacrene-D, limonene, linalool, and menthol.

  5. Chemical composition and biological activities of the essential oil from Calamintha nepeta plants from the wild in southern Italy.

    PubMed

    Mancini, Emilia; De Martino, Laura; Malova, Hanna; De Feo, Vincenzo

    2013-01-01

    The chemical composition of the essential oil from aerial parts of Calamintha nepeta (L.) Savi, collected in the Campania Region, was obtained by hydrodistillation and analyzed by GC and GC-MS. In all, 42 compounds were identified. The oil was characterized by a prevalence of the sesquiterpenic fraction (80.8%). The main components were 1,10-di-epi-cubenol (18.5%), allo-aromadendrene epoxide (11.4%) and cadalene (5.7%). The essential oil was evaluated for its in vitro potential phytotoxic activity against germination and initial radical growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The essential oil showed no antioxidant activity.

  6. Radioprotective Potential of Plants and Herbs against the Effects of Ionizing Radiation

    PubMed Central

    C. Jagetia, Ganesh

    2007-01-01

    Ionizing radiations produce deleterious effects in the living organisms and the rapid technological advancement has increased human exposure to ionizing radiations enormously. There is a need to protect humans against such effects of ionizing radiation. Attempts to protect against the deleterious effects of ionizing radiations by pharmacological intervention were made as early as 1949 and efforts are continued to search radioprotectors, which may be of great help for human application. This review mainly dwells on the radioprotective potential of plant and herbal extracts. The results obtained from in vitro and in vivo studies indicate that several botanicals such as Gingko biloba, Centella asiatica, Hippophae rhamnoides, Ocimum sanctum, Panax ginseng, Podophyllum hexandrum, Amaranthus paniculatus, Emblica officinalis, Phyllanthus amarus, Piper longum, Tinospora cordifoila, Mentha arvensis, Mentha piperita, Syzygium cumini, Zingiber officinale, Ageratum conyzoides, Aegle marmelos and Aphanamixis polystachya protect against radiation-induced lethality, lipid peroxidation and DNA damage. The fractionation-guided evaluation may help to develop new radioprotectors of desired activities. PMID:18188408

  7. Chemical composition and biological activities of the essential oil from Calamintha nepeta plants from the wild in southern Italy.

    PubMed

    Mancini, Emilia; De Martino, Laura; Malova, Hanna; De Feo, Vincenzo

    2013-01-01

    The chemical composition of the essential oil from aerial parts of Calamintha nepeta (L.) Savi, collected in the Campania Region, was obtained by hydrodistillation and analyzed by GC and GC-MS. In all, 42 compounds were identified. The oil was characterized by a prevalence of the sesquiterpenic fraction (80.8%). The main components were 1,10-di-epi-cubenol (18.5%), allo-aromadendrene epoxide (11.4%) and cadalene (5.7%). The essential oil was evaluated for its in vitro potential phytotoxic activity against germination and initial radical growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The essential oil showed no antioxidant activity. PMID:23472480

  8. Screening the antiangiogenic activity of medicinal plants grown and sold in Jordan.

    PubMed

    Zihlif, Malek; Afifi, Fatma; Muhtaseb, Ruba; Al-Khatib, Sondos; Abaza, Ismail; Naffa, Randa

    2012-02-01

    Angiogenesis is essential for the growth, invasion, and metastasis of most solid tumors and has become a valuable pharmacological target for cancer prevention and treatment. This study was performed to assess the antiangiogenic activity of 31 medicinal plants grown and sold in Jordan. The antiangiogenic activity was assessed using the rat aortic ring assay. Out of 31 extracts, 15 extracts showed more than 50 % inhibition of the blood vessels outgrowth from the primary tissue explants (p = 0.000). Three of these 15 extracts showed a potential cytotoxic effect on normal fibroblast cells. Four extracts shared antiangiogenic and antiproliferative activity towards MCF7 breast cancer cell lines. Eight extracts demonstrated selective antiangiogenic activity. This is the first report demonstrating the potential antiangiogenic activity of Artemisia judaica, Aloysia citriodora, Salvia egyptiaca, and Calendula arvensis. Some extracts with antiangiogenic activity exhibited selectivity against the endothelial cells proliferation, demonstrating a direct inhibitory activity against the key step in tumor angiogenesis. PMID:22174075

  9. Anti-Candida activity of Brazilian medicinal plants.

    PubMed

    Duarte, Marta Cristina Teixeira; Figueira, Glyn Mara; Sartoratto, Adilson; Rehder, Vera Lúcia Garcia; Delarmelina, Camila

    2005-02-28

    Essential oils and ethanolic extracts from the leaves and/or roots of 35 medicinal plants commonly used in Brazil were screened for anti-Candida albicans activity. The oils were obtained by water-distillation using a Clevenger-type system. Essential oils from 13 plants showed anti-Candida activity, including Aloysia triphylla, Anthemis nobilis, Cymbopogon martini, Cymbopogon winterianus, Cyperus articulatus, Cyperus rotundus, Lippia alba, Mentha arvensis, Mikania glomerata, Mentha piperita, Mentha sp., Stachys byzantina, and Solidago chilensis. The ethanol extract was not effective at any of the concentrations tested. Chemical analyses showed the presence of compounds with known antimicrobial activity, including 1,8-cineole, geranial, germacrene-D, limonene, linalool, and menthol. PMID:15707770

  10. (E)-β-farnesene gene reduces Lipaphis erysimi colonization in transgenic Brassica juncea lines

    PubMed Central

    Verma, Shiv Shankar; Sinha, Rakesh Kumar; Jajoo, Anajna

    2015-01-01

    Aphids are the major concern that significantly reduces the yield of crops. (E)-β-farnesene (Eβf) is the principal component of the alarm pheromone of many aphids. The results of current research support the direct defense response of (E)-β-farnesene (Eβf) against aphid Lipaphis erysimi (L.) Kaltenbach in Brassica juncea. Eβf gene was isolated from Mentha arvensis and transformed into B. juncea, showed direct repellent against aphid colonization. The seasonal mean population (SMP) recorded under field condition showed significantly higher aphid colonization in wild type in comparison to most of the transgenic lines, and shows positive correlation with the repellency of transgenic plant expressing (E)-β-farnesene. The current research investigation provides direct evidence for aphid control in B. juncea using Eβf, a non-toxic mode of action. PMID:26251882

  11. Chemical composition and biological activity of the essential oil of Origanum vulgare ssp. hirtum from different areas in the Southern Apennines (Italy).

    PubMed

    Mancini, Emilia; Camele, Ippolito; Elshafie, Hazem S; De Martino, Laura; Pellegrino, Carlo; Grulova, Daniela; De Feo, Vincenzo

    2014-04-01

    The chemical composition of the essential oils of Origanum vulgare ssp. hirtum, growing wild in three different localities in the Southern Apennines, was studied by GC-FID and GC/MS analyses. In total, 103 compounds were identified. The oils were mainly composed of phenolic compounds and all oils belonged to the chemotype carvacrol/thymol. The three essential oils were evaluated for their in vitro phytotoxic activity by determining their influence on the germination and initial radicle elongation of Sinapis arvensis L., Phalaris canariensis L., Lepidium sativum L., and Raphanus sativus L. The seed germination and radicle growth were affected in various degrees. Moreover, the antifungal activity of the three essential oils was assayed against three species causing pre- and postharvest fruit decay (Monilinia laxa, M. fructigena, and M. fructicola). At 1000 ppm, the three oils completely inhibited fungal growth. The hemolytic activity of the oils was assayed and showed no effect on the cell membranes of bovine erythrocytes.

  12. Experimental Transmission of Pospiviroid Populations to Weed Species Characteristic of Potato and Hop Fields▿

    PubMed Central

    Matoušek, J.; Orctová, L.; Ptáček, J.; Patzak, J.; Dědič, P.; Steger, G.; Riesner, D.

    2007-01-01

    Weed plants characteristic for potato and hop fields have not been considered in the past as potential hosts that could transmit and lead to spreading of potato spindle tuber (PSTVd) and hop stunt (HSVd) viroids, respectively. To gain insight into this problem, we biolistically inoculated these weed plants with viroid populations either as RNA or as cDNA. New potential viroid host species, collected in central Europe, were discovered. From 12 weed species characteristic for potato fields, high viroid levels, detectable by molecular hybridization, were maintained after both RNA and DNA transfers in Chamomilla reculita and Anthemis arvensis. Low viroid levels, detectable by reverse transcription-PCR (RT-PCR) only, were maintained after plant inoculations with cDNA in Veronica argensis and Amaranthus retroflexus. In these two species PSTVd concentrations were 105 and 103 times, respectively, lower than in tomato as estimated by real-time PCR. From 14 weeds characteristic for hop fields, high HSVd levels were detected in Galinsoga ciliata after both RNA and DNA transfers. HSVd was found, however, not to be transmissible by seeds of this weed species. Traces of HSVd were detectable by RT-PCR in HSVd-cDNA-inoculated Amaranthus retroflexus. Characteristic monomeric (+)-circular and linear viroid RNAs were present in extracts from weed species propagating viroids to high levels, indicating regular replication, processing, and circularization of viroid RNA in these weed species. Sequence analyses of PSTVd progenies propagated in C. reculita and A. arvensis showed a wide spectrum of variants related to various strains, from mild to lethal variants; the sequence variants isolated from A. retroflexus and V. argensis exhibited similarity or identity to the superlethal AS1 viroid variant. All HSVd clones from G. ciliata corresponded to a HSVdg variant, which is strongly pathogenic for European hops. PMID:17715233

  13. Enhanced rosmarinic acid production in cultured plants of two species of Mentha.

    PubMed

    Roy, Debleena; Mukhopadhyay, Sandip

    2012-11-01

    In the present investigation an attempt has been made to enhance rosmarinic acid level in plants, grown in vitro, of 2 species of Mentha in presence of 2 precursors in the nutrient media during culture. For in vitro culture establishment and shoot bud multiplication, MS basal media were used supplemented with different concentrations and combinations of different growth regulator like NAA (alpha-napthaleneacetic acid), BAP (6-benzylaminopurine). The medium containing NAA (0.25 mg/L) and BAP (2.5 mg/L) gave the highest potentiality of shoot formation (average 58.0 numbers of shoots) per explant for Mentha piperita L. and the medium containing BAP (2.0 mg/L) gave the highest potentiality of shoot (average 19.2 numbers of shoots) formation per explant for Mentha arvensis L. The complete plants were regenerated in above mentioned media after 8 weeks of subculture. For in vitro enhancement of rosmarinic acid production, the 2 precursors tyrosine (Tyr) and phenylalanine (Phe) were added in the nutrient media at different levels (0.5 mg/L to 15.0 mg/L). Tyrosine was found to be very effective for augmenting rosmarinic acid content in Mentha piperita L. It nearly increased the production up to 1.77 times. In case of Mentha arvensis L., phenylalanine significantly affected the production of rosmarinic acid and the production was nearly 2.03 times more than the control. No significant increase in biomass was observed after addition of these precursors indicating that the added amino acids acting as precursors for rosmarinic acid synthesis were readily utilized in producing rosmarinic acid without promoting growth. Total protein profile also revealed the presence of a specific band in polyacrylamide gel electrophoresis.

  14. Osteogenesis imperfecta Type I caused by a novel mutation in the start codon of the COL1A1 gene in a Korean family.

    PubMed

    Cho, Sung Yoon; Lee, Ji-Ho; Ki, Chang-Seok; Chang, Mi Sun; Jin, Dong-Kyu; Han, Heon-Seok

    2015-01-01

    Osteogenesis imperfecta (OI) comprises a heterogeneous group of disorders characterized by susceptibility to bone fractures ranging in severity from perinatal death to a subtle increase in fracture frequency. We report the case of a patient who appeared healthy at birth and did not experience any fractures until 12 months of age. We observed blue sclera, frequent fractures without commensurate trauma, nearly normal stature, the absence of dentinogenesis imperfecta, no bony deformity, and no limitation of mobility in the patient--all characteristics suggestive of OI Type I. The patient's mother also had blue sclera and a history of frequent fracture episodes until the age of 15 years. A novel COL1A1 missense mutation (c.2T>G) disrupting the start codon of the gene (ATG to AGG (Met1Arg)) was found in the patient and his mother.

  15. Determination of high mitochondrial membrane potential in spermatozoa loaded with the mitochondrial probe 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolyl-carbocyanine iodide (JC-1) by using fluorescence-activated flow cytometry.

    PubMed

    Guthrie, H David; Welch, Glenn R

    2008-01-01

    A flow cytometric method was developed to identify viable, energized sperm cells with high mitochondrial inner transmembrane potential (Deltapsi(m)), >80-100 mV using the mitochondrial probe 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolylcarbocyanine iodide (JC-1) and the impermeant nuclear stain propidium iodine (PI). This flow cytometric method is described in detail here. When in contact with membranes possessing a high Deltapsi(m), JC-1 forms aggregates (J(agg)) that are fluorescent at 590 nm in response to 488 nm excitation. We found that the reactive oxygen species generator, menadione reduced sperm motility and reduced Deltapsi(m) in a dose responsive fashion that was closely correlated with the loss of motility. PMID:19082941

  16. Cloaked Gamma-Ray Bursts

    NASA Astrophysics Data System (ADS)

    Eichler, David

    2014-06-01

    It is suggested that many gamma-ray bursts (GRBs) are cloaked by an ultrarelativistic baryonic shell that has high optical depth when the photons are manufactured. Such a shell would not fully block photons reflected or emitted from its inner surface, because the radial velocity of the photons can be less than that of the shell. This avoids the standard problem associated with GRBs that the thermal component should be produced where the flow is still obscured by high optical depth. The radiation that escapes high optical depth obeys the Amati relation. Observational implications may include (1) anomalously high ratios of afterglow to prompt emission, such as may have been the case in the recently discovered PTF 11agg, and (2) ultrahigh-energy neutrino pulses that are non-coincident with detectable GRB. It is suggested that GRB 090510, a short, very hard GRB with very little afterglow, was an exposed GRB, in contrast to those cloaked by baryonic shells.

  17. Computational Analyses of Simple Sequence Repeats on Human Tissue Specific Genes Promoters

    NASA Astrophysics Data System (ADS)

    FeiFei, Zhao; XiuJun, Gong; XinMi, Liu; LiFeng, Dong

    Promoter region of gene closely related with tissue specific expression and SSRs (simple sequence repeats) have been shown to have a variety of effects on an organism. This paper used a heuristic method to find SSRs and compared the most frequently SSRs on promoter region of both human tissues specific genes and human housekeeping genes. We used kidney and testis tissue as examples to show the final results. Especially, we found that (AGG)n is kidney specific SSR and (GCG)n is testis specific SSR. We also analyzed the SSRs frequency density distribution on different promoter regions of both tissue specific genes and housekeeping genes, and we found the density of housekeeping genes on core-promoter region is much higher than on other promoter regions.

  18. Shiga toxin 2a and Enteroaggregative Escherichia coli – a deadly combination

    PubMed Central

    Boisen, Nadia; Melton-Celsa, Angela R; Scheutz, Flemming; O'Brien, Alison D; Nataro, James P

    2015-01-01

    In 2011, a Shiga toxin (Stx) type 2a-producing enteroaggregative E. coli (EAEC) strain of serotype O104:H4 caused a large lethal outbreak in Northern Europe. Until recently, the pathogenic mechanisms explaining the high virulence of the strain have remained unclear. Our laboratories have shown that EAEC genes encoded on the pAA virulence plasmid, particularly the AggR-regulated AAF/I fimbriae, enhance inflammation and enable the outbreak strain to both adhere to epithelial cells and translocate Stx2a across the intestinal epithelium, possibly explaining the high incidence of the life threatening post-diarrheal sequelae of hemolytic uremic syndrome. Epidemiologic evidence supports a model of EAEC pathogenesis comprising the concerted action of multiple virulence factors along with induction of inflammation. Here, we suggest a model for the pathogenesis of the O104:H4 outbreak strain that includes contributions from EAEC alone, but incorporating additional injury induced by Stx2a. PMID:26039753

  19. Effect of Friction Stir Processing on Microstructure and Tensile Properties of an Investment Cast Al-7Si-0.6Mg Alloy

    SciTech Connect

    Jana, Saumyadeep; Mishra, Rajiv S.; Baumann, John B.; Grant, Glenn J.

    2010-10-01

    Friction stir processing (FSP) is emerging as a promising tool for microstructural modification. The present study assesses the effects of FSP on the microstructure and mechanical properties of an investment cast Al-7Si-Mg alloy. FSP eliminates porosity and significantly refines eutectic Si particles. The extent of particle refinement varied with changes in processing conditions. High tool rotation rate and low to intermediate tool traverse speed generated a higher volume fraction of finer particles. Tensile ductility changed significantly as a result of FSP, whereas UTS improved only marginally. Yield strength was similar in both cast and FSPed samples under various heat treated conditions, with the highest value obtained after a T6 heat treatment. Further, FSP caused significant grain refinement in the stir zone, subsequently transforming into very coarse grains as abnormal grain growth (AGG) occurred during solution treatment at high temperature.

  20. Structure of the human glucokinase gene and identification of a missense mutation in a Japanese patient with early-onset non-insulin-dependent diabetes mellitus

    SciTech Connect

    Sakura, Hiroshi; Eto, Kazuhiro; Ueno, Hirohisa; Yazaki, Yoshio; Kadowaki, Takashi ); Kadowaki, Hiroko; Simokawa, Kotaro; Akanuma, Yasuo ); Koda, Naoya; Fukushima, Yoshimitsu )

    1992-12-01

    Glucokinase is thought to play a glucose-sensor role in the pancreas, and abnormalities in its structure, function, and regulation can induce diabetes. The authors isolated the human glucokinase gene, and determined its genomic structure including exon-intron boundaries. Structure of the glucokinase gene in human was very similar to that in rat. Then, by screening Japanese diabetic patients using polymerase chain reaction - single strand conformation polymorphism (PCR-SSCP) and direct-sequencing strategies, they identified a missense mutation substituting ariginine (AGG) for glycine (GGG) at position 261 in exon 7 of the glucokinase gene in a patient with early-onset non-insulin-dependent diabetes (NIDDM). 12 refs., 3 figs., 2 tabs.

  1. CLOAKED GAMMA-RAY BURSTS

    SciTech Connect

    Eichler, David

    2014-06-01

    It is suggested that many gamma-ray bursts (GRBs) are cloaked by an ultrarelativistic baryonic shell that has high optical depth when the photons are manufactured. Such a shell would not fully block photons reflected or emitted from its inner surface, because the radial velocity of the photons can be less than that of the shell. This avoids the standard problem associated with GRBs that the thermal component should be produced where the flow is still obscured by high optical depth. The radiation that escapes high optical depth obeys the Amati relation. Observational implications may include (1) anomalously high ratios of afterglow to prompt emission, such as may have been the case in the recently discovered PTF 11agg, and (2) ultrahigh-energy neutrino pulses that are non-coincident with detectable GRB. It is suggested that GRB 090510, a short, very hard GRB with very little afterglow, was an exposed GRB, in contrast to those cloaked by baryonic shells.

  2. Potential for Chemolithoautotrophy Among Ubiquitous Bacteria Lineages in the Dark Ocean

    NASA Astrophysics Data System (ADS)

    Swan, Brandon K.; Martinez-Garcia, Manuel; Preston, Christina M.; Sczyrba, Alexander; Woyke, Tanja; Lamy, Dominique; Reinthaler, Thomas; Poulton, Nicole J.; Masland, E. Dashiell P.; Gomez, Monica Lluesma; Sieracki, Michael E.; DeLong, Edward F.; Herndl, Gerhard J.; Stepanauskas, Ramunas

    2011-09-01

    Recent studies suggest that unidentified prokaryotes fix inorganic carbon at globally significant rates in the immense dark ocean. Using single-cell sorting and whole-genome amplification of prokaryotes from two subtropical gyres, we obtained genomic DNA from 738 cells representing most cosmopolitan lineages. Multiple cells of Deltaproteobacteria cluster SAR324, Gammaproteobacteria clusters ARCTIC96BD-19 and Agg47, and some Oceanospirillales from the lower mesopelagic contained ribulose-1,5-bisphosphate carboxylase-oxygenase and sulfur oxidation genes. These results corroborated community DNA and RNA profiling from diverse geographic regions. The SAR324 genomes also suggested C1 metabolism and a particle-associated life-style. Microautoradiography and fluorescence in situ hybridization confirmed bicarbonate uptake and particle association of SAR324 cells. Our study suggests potential chemolithoautotrophy in several uncultured Proteobacteria lineages that are ubiquitous in the dark oxygenated ocean and provides new perspective on carbon cycling in the ocean’s largest habitat.

  3. [Molecular detection of tomato yellow leaf curl virus (TYLCV)].

    PubMed

    Li, Chang-Bao; Cui, Yan-Ling; Zhang, Li-Ying; Li, Chuan-You

    2012-03-01

    Tomato yellow leaf curl virus (TYLCV) is currently considered as one of the most devastating viruses in cultivated tomatoes (Solanum lycopersicum) worldwide. We reported here the development of a PCR-based method to quickly detect TYLCV using the primer pairs (TYLCV-F: 5'-ACG CAT GCC TCT AAT CCA GTG TA-3' and TYLCV-R: 5'-CCA ATA AGG CGT AAG CGT GTA GAC-3'), which was designed based on the genome sequence of TYLCV. A TYLCV-specific band of 543 bp was amplified from infected tomato plants. This protocol provides a rapid, reliable, and sensitive tool for molecular detection and identification of TYLCV in the industrial seedling and virus resistance breeding to facilitate safe and sustainable production of tomato.

  4. Study of temperature and pressure dependences of electric properties of amorphous Ag-Ge-As-S chalcogenides containing carbon nanotubes

    NASA Astrophysics Data System (ADS)

    Kurochka, K. V.; Melnikova, N. V.; Zaikova, V. E.; Volkova, Ya Yu

    2015-01-01

    Frequency and temperature dependences of impedance of AgGe1+xAs1-x(S+CNT)3, x = 0.4; 0.5; 0.6 were measured. There are maxima on frequency dependences of tangent of loss, which can be connected with relaxation processes inside the sample (the maximum at high frequencies) and the second maximum can be connected with processes occurring on the sample-electrode border. Activation energy of all synthesized materials was estimated to be near 0.5 eV. The relaxation of electric resistance at fixed pressures within the pressure range of 30 to 50 GPa was observed. It is established that the resistance decreases exponentially with time within this range of pressures.

  5. Slaughterhouse effluent discharges into rivers not responsible for environmental occurrence of enteroaggregative Escherichia coli.

    PubMed

    Bibbal, Delphine; Kérourédan, Monique; Loukiadis, Estelle; Scheutz, Flemming; Oswald, Eric; Brugère, Hubert

    2014-01-31

    Enteroaggregative Shiga-toxin-producing Escherichia coli strains were responsible for a massive outbreak in Europe in 2011, and had been previously isolated from French patients. The objective of this study was to investigate the presence of enteroaggregative E. coli (EAEC) in slaughterhouse effluents (wastewater, slurry, sludge and effluents), and in river waters near these slaughterhouses. A total of 10,618 E. coli isolates were screened by PCR for the presence of EAEC-associated genetic markers (aggR, aap and aatA). None of these markers was detected in E. coli isolated from slaughterhouse samples. A unique enteroaggregative E. coli (EAEC) O126:H8 was detected in river water sampled upstream from slaughterhouse effluent discharge. These results confirmed that animals might not be reservoirs of EAEC, and that further studies are required to evaluate the role of the environment in the transmission of EAEC to humans. PMID:24388632

  6. The Kauring Airborne Gravity Test Site, Western Australia

    NASA Astrophysics Data System (ADS)

    Lane, R. J.; Grujic, M.; Aravanis, T.; Tracey, R.; Dransfield, M.; Howard, D.; Smith, B.

    2009-12-01

    A test site for airborne gravity (AG) systems has been established at Kauring, approximately 100 km east of Perth, Western Australia. The site was chosen using a range of criteria that included being within 200 km of Jandakot Airport in Perth where most of the airborne systems would be based at one time or another when operating in Australia, being free of low level flight restrictions, having minimal human infrastructure in the central 20 by 20 km area, and the presence of gentle to rolling terrain rather than deeply incised topography or an extensive flat plain with very low relief. In anticipation of catering for airborne gravity gradiometer (AGG) systems, the site was required to have a gravity gradient feature with clear response in the wavelength range of 100 m to 2 km in a 5 by 5 km core region. The existence of closely-spaced, high quality ground gravity data would have been a positive factor for selecting a test site, but a search of the national gravity database indicated that there were no such data sets in the search area. Consequently, a ground vertical gravity acquisition program for the chosen site at Kauring was arranged by the Geological Survey of Western Australia (GSWA), Geoscience Australia (GA), and Rio Tinto Exploration. To support AG system tests, a 150 by 150 km area was covered with a maximum station spacing of 2 by 2 km, and the central area of 20 by 20 km was covered with a maximum station spacing of 0.5 by 0.5 km. These data are freely available from GSWA and GA. To support AGG system tests, the core 5 by 5 km area would need to have stations with much closer spacing (e.g., 100 by 100 m). A variety of publicly available digital terrain data sets are available (e.g., SRTM 3-second data (~90 m), ASTER GDEM 1-second data (~30 m), GEODATA 9-second data (~300 m), etc.). Acquisition of a LIDAR-based high-resolution digital terrain model (DTM) for the central 20 by 20 km area is being considered. A DTM of this nature for the core 5 by 5 km area

  7. Mitochondrial genome of the bull shark Carcharhinus leucas (Carcharhiniformes: Carcharhinidae).

    PubMed

    Chen, Xiao; Liu, Min; Peng, Zaiqing; Shi, Xiaofang

    2015-01-01

    The bull shark Carcharhinus leucas is a large elasmobranch species widespread in tropical and warm oceans, rivers and lakes. We first determine the complete mitogenome of C. leucas in this article. It is 16,704 bp in length, consists 37 genes and one control region with the typical gene order in vertebrates. The ND6 gene used the rare AGG as stop codon. The 22 tRNA genes ranged from 67 to 75 bp. The tRNA-Ser2 lacks the dihydrouridine arm and cannot form the typical cloverleaf structure. The control region is 1066 bp in length with high A+T and low G contents. PMID:24409857

  8. [Molecular detection of tomato yellow leaf curl virus (TYLCV)].

    PubMed

    Li, Chang-Bao; Cui, Yan-Ling; Zhang, Li-Ying; Li, Chuan-You

    2012-03-01

    Tomato yellow leaf curl virus (TYLCV) is currently considered as one of the most devastating viruses in cultivated tomatoes (Solanum lycopersicum) worldwide. We reported here the development of a PCR-based method to quickly detect TYLCV using the primer pairs (TYLCV-F: 5'-ACG CAT GCC TCT AAT CCA GTG TA-3' and TYLCV-R: 5'-CCA ATA AGG CGT AAG CGT GTA GAC-3'), which was designed based on the genome sequence of TYLCV. A TYLCV-specific band of 543 bp was amplified from infected tomato plants. This protocol provides a rapid, reliable, and sensitive tool for molecular detection and identification of TYLCV in the industrial seedling and virus resistance breeding to facilitate safe and sustainable production of tomato. PMID:22425956

  9. The Role of Grain Boundary Energy on Grain Boundary Complexion Transitions

    SciTech Connect

    Bojarski, Stephanie A.; Rohrer, Gregory S.

    2014-09-01

    Grain boundary complexions are distinct equilibrium structures and compositions of a grain boundary and complexion transformations are transition from a metastable to an equilibrium complexion at a specific thermodynamic and geometric conditions. Previous work indicates that, in the case of doped alumina, a complexion transition that increased the mobility of transformed boundaries and resulted in abnormal grain growth also caused a decrease in the mean relative grain boundary energy as well as an increase in the anisotropy of the grain boundary character distribution (GBCD). The current work will investigate the hypothesis that the rates of complexion transitions that result in abnormal grain growth (AGG) depend on grain boundary character and energy. Furthermore, the current work expands upon this understanding and tests the hypothesis that it is possible to control when and where a complexion transition occurs by controlling the local grain boundary energy distribution.

  10. Enterococcus in wound infections: virulence and antimicrobial resistance.

    PubMed

    Dworniczek, Ewa; Piwowarczyk, Justyna; Bania, Jacek; Kowalska-Krochmal, Beata; Wałecka, Ewa; Seniuk, Alicja; Dolna, Izabela; Gościniak, Grażyna

    2012-06-01

    Enterococci, a complex group of facultative pathogens have become increasingly isolated in various hospital settings. They are considerable frequently cultured from traumatic and surgical wounds. We investigated 57 strains of the species E. faecalis, E. faecium and E. casseliflavus isolated from infected wounds. Their ability to produce virulence factors and their sensitivity to antibiotics were evaluated using phenotypic and genotyping methods. In the phenotype studies, significant portion of the isolates produced biofilm (66.7%) and gelatinase (36.8%). Nearly 30% of the strains expressed hemolytic properties. Only a few produced DNAse (15.8%) and lipase (7.0%). The genes esp, gelE, cylA, cylB, cylM and agg were detected in most of the isolates (38.6-87.7%). All the isolated enterococci were susceptible to vancomycin and were characterized by their low resistance to antibiotics, except aminoglycosides (HLR).

  11. The complete mitochondrial genome of Lithobates catesbeianus (Anura: Ranidae).

    PubMed

    Lin, Yubo; Tao, Bofang; Fang, Xindong; Wang, Tingting; Zhang, Jiayong

    2014-12-01

    The complete mitochondrial genome of Lithobates catesbeianus (Anura: Ranidae) is sequenced to analyze the gene arrangement. It is a circular molecule of 18,241 bp in length including 37 genes typically found in other frogs. The AT content of the overall base composition of L. catesbeianus is 59.9%. The length of control region is 2783 bp with 66.0% AT content. Protein-coding genes begin with ATG as start codon except except ND1 and ATP6 began with ATA, COI and ND4L with GTG, and ND2 with ATT. COI end with AGG as stop codon, COII and ND6 end with AGA, ND2 end with TAG, ATP8. ND4L. ND5 and Cytb end with TAA, and the other five PCGs end with a incomplete stop codon (a single stop nucleotide T).

  12. Shiga toxin 2a and Enteroaggregative Escherichia coli--a deadly combination.

    PubMed

    Boisen, Nadia; Melton-Celsa, Angela R; Scheutz, Flemming; O'Brien, Alison D; Nataro, James P

    2015-07-01

    In 2011, a Shiga toxin (Stx) type 2a-producing enteroaggregative E. coli (EAEC) strain of serotype O104:H4 caused a large lethal outbreak in Northern Europe. Until recently, the pathogenic mechanisms explaining the high virulence of the strain have remained unclear. Our laboratories have shown that EAEC genes encoded on the pAA virulence plasmid, particularly the AggR-regulated AAF/I fimbriae, enhance inflammation and enable the outbreak strain to both adhere to epithelial cells and translocate Stx2a across the intestinal epithelium, possibly explaining the high incidence of the life threatening post-diarrheal sequelae of hemolytic uremic syndrome. Epidemiologic evidence supports a model of EAEC pathogenesis comprising the concerted action of multiple virulence factors along with induction of inflammation. Here, we suggest a model for the pathogenesis of the O104:H4 outbreak strain that includes contributions from EAEC alone, but incorporating additional injury induced by Stx2a.

  13. Palynological and palaeobotanical investigations in the Miocene of the Yatağan basin, Turkey: High-resolution taxonomy and biostratigraphy

    NASA Astrophysics Data System (ADS)

    Bouchal, Johannes Martin; Güner, Tuncay H.; Denk, Thomas

    2015-04-01

    The subject of this study is the palynology (biostratigraphic and taxonomic) and the plant remains of the lignite strip mines of Eskihisar, Salihpasalar, and Tinaz (Muğla province, western Turkey). In the Yatağan basin two Miocene to Pliocene formations are present, the Eskihisar Formation (early to middle Miocene) and the Yatağan Formation (late Miocene to early Pliocene). Both formations represent river and lake deposits consisting mainly of conglomerate, sandstone, claystone, limestone, tuffite, and intercalated lignite; the thickest, actively mined lignite seams occur in the Sekköy member of the Eskihisar Formation. Previous palynological studies of the palynoflora of the Yatağan basin mainly focussed on its biostratigraphic and palaeoclimatic significance, using conventional morphological nomenclature and light microscopy (LM). In this study the "single grain method" is applied. Using this method, the same individual pollen grains are investigated by using both LM and scanning electron microscopy (SEM). The resulting high-resolution pictographs enable a much higher taxonomic resolution. The studied palynoflora is very rich and taxonomically diverse. Cryptogams are represented by more than ten spore morphotypes of at least three families (Osmundaceae, Pteridaceae, Polypodiaceae). Gymnosperm pollen is dominated by Cupressaceae, Gnetales (Ephedra), and Pinaceae (Cathaya, Keteleeria, Pinus). Angiosperm pollen can be assigned to 57 different genera belonging to Poaceae, Typhaceae, Altingiaceae, Amaranthaceae (Chenopodieae), Anacardiaceae, Apiaceae (three types), Asteraceae (Asteroideae, Cichoriodeae), Betulaceae (Alnus, Betula, Carpinus, Ostrya) Buxaceae, Campanulaceae, Caprifoliaceae (Lonicera), Caryophyllaceae, Dipsacaceae, Eucommiaceae, Euphorbiaceae, Fabaceae, Fagaceae (Fagus, Quercus, Trigonobalanopsis) Geraniaceae, Juglandaceae, Linaceae, Malvaceae (Tilia), Myricaceae, Oleaceae (four different types), Plumbaginaceae, Polygonaceae (Rumex), Rosaceae

  14. Late Miocene (Pannonian) Vegetation from the Northern Part of Central Paratethys

    NASA Astrophysics Data System (ADS)

    Kováčová, M.; Doláková, N.

    2009-04-01

    . Accumulations of the Chenopodiaceae in the interfluve areas probably indicate local saline swampy environments during sea level fall. The increasing amounts of herbs indicate the existence of wet prairie areas (Thalictrum, Rumex, Valeriana, Dipsacaceae, Lamiaceae, Galium) or steppes (Artemisia - up to 17%, Asteraceae, Campanula, Fabaceae, Daucaceae, Caryophyllaceae, Plantago). This is the contribution to the projects ESF -EC-009-07, APVT 51-011305, APVV-0280-07 (Slovakia) and MSM0021622427 (Czech republic).

  15. Evaluation of the MeltPro TB/STR assay for rapid detection of streptomycin resistance in Mycobacterium tuberculosis.

    PubMed

    Zhang, Ting; Hu, Siyu; Li, Guoli; Li, Hui; Liu, Xiaoli; Niu, Jianjun; Wang, Feng; Wen, Huixin; Xu, Ye; Li, Qingge

    2015-03-01

    Rapid and comprehensive detection of drug-resistance is essential for the control of tuberculosis, which has facilitated the development of molecular assays for the detection of drug-resistant mutations in Mycobacterium tuberculosis. We hereby assessed the analytical and clinical performance of an assay for streptomycin-resistant mutations. MeltPro TB/STR is a closed-tube, dual-color, melting curve analysis-based, real-time PCR test designed to detect 15 streptomycin-resistant mutations in rpsL 43, rpsL 88, rrs 513, rrs 514, rrs 517, and rrs 905-908 of M. tuberculosis. Analytical studies showed that the accuracy was 100%, the limit of detection was 50-500 bacilli per reaction, the reproducibility in the form of Tm variation was within 1.0 °C, and we could detect 20% STR resistance in mixed bacterial samples. The cross-platform study demonstrated that the assay could be performed on six models of real-time PCR instruments. A multicenter clinical study was conducted using 1056 clinical isolates, which were collected from three geographically different healthcare units, including 709 STR-susceptible and 347 STR-resistant isolates characterized on Löwenstein-Jensen solid medium by traditional drug susceptibility testing. The results showed that the clinical sensitivity and specificity of the MeltPro TB/STR was 88.8% and 95.8%, respectively. Sequencing analysis confirmed the accuracy of the mutation types. Among all the 8 mutation types detected, rpsL K43R (AAG → AGG), rpsL K88R (AAG → AGG) and rrs 514 A → C accounted for more than 90%. We concluded that MeltPro TB/STR represents a rapid and reliable assay for the detection of STR resistance in clinical isolates.

  16. Expression of Tight Junction Molecule In The Human Serum-Induced Aggregation of Human Abdominal Adipose-Derived Stem Cells In Vitro

    PubMed Central

    Yoon, A Young; Yun, Sujin; Yang, HyeJin; Lim, Yoon Hwa; Kim, Haekwon

    2014-01-01

    Previously we have shown that human abdominal adipose derived-stem cells (ADSCs) could aggregate during the high-density culture in the presence of human serum (HS). In the present study, we observed that human cord blood serum (CBS) and follicular fluid (HFF) also induced aggregation. Similarly, porcine serum could induce aggregation whereas bovine and sheep sera induced little aggregation. qRT-PCR analyses demonstrated that, compared to FBS-cultured ADSCs, HScultured cells exhibited higher level of mRNA expression of CLDN3, -6, -7, -15, and -16 genes among the tight junction proteins. ADSCs examined at the time of aggregation by culture with HS, BSA, HFF, CBS, or porcine serum showed significantly higher level of mRNA expression of JAM2 among JAM family members. In contrast, cells cultured in FBS, bovine serum or sheep serum, showed lower level of JAM2 expression. Immunocytochemical analyses demonstrated that the aggregates of HS-cultured cells (HS-Agg) showed intense staining against the anti-JAM2 antibody whereas neither non-aggregated cells (HS-Ex) nor FBS-cultured cells exhibited weak staining. Western blot results showed that HS-Agg expressed JAM2 protein more prominently than HS-Ex and FBS-cultured cells, both of latter reveled weaker intensity. These results suggest that the aggregation property of ADSCs during high-density culture would be dependent on the specific components of serum, and that JAM2 molecule could play a role in the animal sera-induced aggregation in vitro. PMID:25949191

  17. Phylogenetic Analysis of Enteroaggregative Escherichia coli (EAEC) Isolates from Japan Reveals Emergence of CTX-M-14-Producing EAEC O25:H4 Clones Related to Sequence Type 131.

    PubMed

    Imuta, Naoko; Ooka, Tadasuke; Seto, Kazuko; Kawahara, Ryuji; Koriyama, Toyoyasu; Kojyo, Tsuyoshi; Iguchi, Atsushi; Tokuda, Koichi; Kawamura, Hideki; Yoshiie, Kiyotaka; Ogura, Yoshitoshi; Hayashi, Tetsuya; Nishi, Junichiro

    2016-08-01

    Enteroaggregative Escherichia coli (EAEC) causes acute or persistent diarrhea. The aggR gene is widely used as a marker for typical EAEC. The heterogeneity of EAEC is well known; however, there are few reports on the phylogenetic relationships of EAEC. Recently, CTX-M extended-spectrum β-lactamase (ESBL)-producing EAEC strains have been reported worldwide. To characterize EAEC strains in Japan, we investigated the population structure of EAEC. A total of 167 aggR-positive strains isolated from stool specimens from diarrheal patients in Kagoshima (139 strains) and Osaka (28 strains), Japan, between 1992 and 2010 were examined for the prevalence of EAEC virulence markers, the blaCTX-M gene, and the capacity to form biofilms. Multilocus sequence typing was also conducted. EAEC strains were widely distributed across four major E. coli phylogroups. Strains of O111:H21/clonal group 40 (CG40) (30 strains), O126:H27/CG200 (13 strains), and O86a:H27/CG3570 (11 strains) in phylogroup B1 are the historical EAEC clones in Japan, and they exhibited strong biofilm formation. Twenty-nine strains of EAEC O25:H4/CG131 were identified in phylogroup B2, 79% of which produced CTX-M-14. This clone has emerged since 2003. The clone harbored plasmid-encoded EAEC virulence genes but not chromosomal virulence genes and had lower biofilm-forming capacity than historical EAEC strains. This clone most likely emerged from a pandemic uropathogenic O25:H4/sequence type 131 clone by acquiring an EAEC virulence plasmid from canonical EAEC. Surveillance of the horizontal transfer of both virulence and ESBL genes among E. coli strains is important for preventing a worldwide increase in antimicrobial drug resistance. PMID:27252465

  18. Serotyping and virulence genes detection in Escherichia coli isolated from fertile and infertile eggs, dead-in-shell embryos, and chickens with yolk sac infection.

    PubMed

    Rosario, C C; López, A C C; Téllez, I G; Navarro, O A; Anderson, R C; Eslava, C C

    2004-12-01

    Escherichia coli is a common avian pathogen mainly associated with extraintestinal infections such as yolk sac infection (YSI). The aim of this study was to determine the serotypes and the presence of some virulence genes of E. coli strains isolated from different samples in a vertically integrated poultry operation in Mexico. Two hundred sixty-seven E. coli isolates from different samples were serotyped using rabbit serum against the 175 somatic (O) and 56 flagellar (H) antigens of the typing schema. Virulence genes were determined by colony blot hybridization, using DNA probes for st, eae, agg1, agg2, bfp, lt, cdt, slt, and ipaH diarrhea-associated virulence factors. The serogroup of 85% of the strains was determined; O19 (12%), 084 (9%), 08 (6%), and 078 (5%) were the most common. Using the complete antigenic formula (O and H), O19:NM (n = 31) was the serotype most frequently isolated from dead-in-shell embryos and in broilers that had died on the fourth, fifth, sixth, and seventh days after hatch. One hundred ten strains (41.2%) hybridized with one or more of the used probes. Of these, ipaH (72%), eae (30%), and cdt (27%) were the most common. Considering the origin of the respective isolates, 40% of the broiler farm strains were positive for at least one probe. Results show that some avian E. coli strains isolated in Mexico are included in avian pathogenic E. coli serotypes not previously reported, suggesting that they could be specific for this geographic area. The wide distribution of the ipaH gene among nonmotile strains suggests that this invasiveness trait could be important in YSI pathogenesis. On the other hand, some other genes could contribute to E. coli virulence during YSI. PMID:15666860

  19. Complement fixation by rheumatoid factor.

    PubMed Central

    Tanimoto, K; Cooper, N R; Johnson, J S; Vaughan, J H

    1975-01-01

    The capacity for fixation and activation of hemolytic complement by polyclonal IgM rheumatoid factors (RF) isolated from sera of patients with rheumatoid arthritis and monoclonal IgM-RF isolated from the cryoprecipitates of patients with IgM-IgG mixed cryoglobulinemia was examined. RF mixed with aggregated, reduced, and alkylated human IgG (Agg-R/A-IgG) in the fluid phase failed to significantly reduce the level of total hemolytic complement, CH50, or of individual complement components, C1, C2, C3, and C5. However, sheep erythrocytes (SRC) coated with Agg-R/A-IgG or with reduced and alkylated rabbit IgG anti-SRC antibody were hemolyzed by complement in the presence of polyclonal IgM-RF. Human and guinea pig complement worked equally well. The degree of hemolysis was in direct proportion to the hemagglutination titer of the RF against the same coated cells. Monoclonal IgM-RF, normal human IgM, and purified Waldenström macroglobulins without antiglobulin activity were all inert. Hemolysis of coated SRC by RF and complement was inhibited by prior treatment of the complement source with chelating agents, hydrazine, cobra venom factor, specific antisera to C1q, CR, C5, C6, or C8, or by heating at 56 degrees C for 30 min. Purified radiolabeled C4, C3, and C8 included in the complement source were bound to hemolysed SRC in direct proportion to the degree of hemolysis. These data indicate that polyclonal IgM-RF fix and activate complement via the classic pathway. The system described for assessing complement fixation by isolated RF is readily adaptable to use with whole human serum. PMID:1078825

  20. The effect of GlycoPEGylation on the physical stability of human rFVIIa with increasing calcium chloride concentration.

    PubMed

    Plesner, Bitten; Westh, Peter; Nielsen, Anders D

    2011-06-01

    The effects of calcium chloride on the structural, kinetic and thermal stability of recombinant human factor VIIa (rFVIIa) were investigated using rFVIIa and two GlycoPEGylated recombinant human FVIIa derivatives, a linear 10 kDa PEG and a branched 40 kDa PEG, respectively. Three different CaCl(2) concentrations were used: 10mM, 35 mM and 100mM. The secondary structure and tertiary structure of rFVIIa at 25°C, measured by circular dichroism (CD), were maintained upon GlycoPEGylation as well as CaCl(2) content. In contrast, the thermal stability of the three rFVIIa compounds, measured by differential scanning calorimetry (DSC) and circular dichroism (CD), and aggregation behaviour, measured by light scattering (LS), were affected by the increasing calcium concentration. Increasing the CaCl(2) concentration from 10mM to 35 mM resulted in a decrease in the apparent unfolding temperature, T(m), of rFVIIa, whereas the concentration of CaCl(2) has to be raised to 100mM in order to see the same effect on the GlycoPEGylated rFVIIa compounds. The temperature of aggregation of rFVIIa, T(agg), increased as the CaCl(2) concentration increased from 35 mM to 100 mM, while T(agg) for the GlycoPEGylated rFVIIa compounds was practically independent of the CaCl(2) concentration. From the obtained results, it is concluded that GlycoPEGylation postpones the calcium induced thermal destabilisation of rFVIIa, and a much higher calcium concentration also postpones the thermally induced aggregation of rFVIIa. The thermally induced aggregation of the GlycoPEGylated rFVIIa compounds is unaffected by an increasing calcium chloride concentration.

  1. Heterochromatin banding patterns in Rutaceae-Aurantioideae--a case of parallel chromosomal evolution.

    PubMed

    Guerra, M; Dos Santos, K G; Barros E Silva, A E; Ehrendorfer, F

    2000-05-01

    The heterochromatin banding patterns in the karyotypes of 17 species belonging to 15 genera of Rutaceae subfamily Aurantioideae (= Citroideae) were analyzed with the fluorochromes chromomycin (CMA) and 4'-6-diamidino-2-phenylindole-2HCl (DAPI). All species were diploids, except one tetraploid (Clausena excavata) and two hexaploids [Glycosmis parviflora agg. (aggregate) and G. pentaphylla agg.]. There are only CMA/DAPI bands, including those associated with the nucleolus. Using recent cpDNA (chloroplast DNA) sequence data as a phylogenetic background, it becomes evident that generally more basal genera with rather plesiomorphic traits in their morphology, anatomy, and phytochemistry exhibit very small amounts of heterochromatin (e.g., Glycosmis, Severinia, Swinglea), whereas relatively advanced genera from different clades with more apomorphic characters display numerous large CMA bands (e.g., Merrillia, Feroniella, Fortunella). Heterochromatin increase (from 0.7 to 13.7%) is interpreted as apomorphic. The bands are mostly located in the larger chromosomes and at telomeric regions of larger arms. However, one of the largest chromosome pair has been conserved throughout the subfamily with only very little heterochromatin. The heterochromatin-rich patterns observed in different clades of Aurantioideae appear quite similar, suggesting a kind of parallel chromosomal evolution. In respect to the current classification of the subfamily, it is proposed to divide Murraya s.l. (sensu lato) into Bergera and Murraya s.s. (sensu stricto) and to place the former near Clausena into Clauseneae s.s. and the latter together with Merrillia into Citreae s.l. The subtribes recognized within Clauseneae s.s. and Citreae s.l. appear heterogeneous and should be abandoned. On the other hand, the monophyletic nature of the core group of Citrinae, i.e., the Citrus clade with Eremocitrus, Microcitrus, Clymenia, Poncirus, Fortunella, and Citrus, is well supported.

  2. Aggregate structure, morphology and the effect of aggregation mechanisms on viscosity at elevated protein concentrations.

    PubMed

    Barnett, Gregory V; Qi, Wei; Amin, Samiul; Neil Lewis, E; Roberts, Christopher J

    2015-12-01

    Non-native aggregation is a common issue in a number of degenerative diseases and during manufacturing of protein-based therapeutics. There is a growing interest to monitor protein stability at intermediate to high protein concentrations, which are required for therapeutic dosing of subcutaneous injections. An understanding of the impact of protein structural changes and interactions on the protein aggregation mechanisms and resulting aggregate size and morphology may lead to improved strategies to reduce aggregation and solution viscosity. This report investigates non-native aggregation of a model protein, α-chymotrypsinogen, under accelerated conditions at elevated protein concentrations. Far-UV circular dichroism and Raman scattering show structural changes during aggregation. Size exclusion chromatography and laser light scattering are used to monitor the progression of aggregate growth and monomer loss. Monomer loss is concomitant with increased β-sheet structures as monomers are added to aggregates, which illustrate a transition from a native monomeric state to an aggregate state. Aggregates grow predominantly through monomer-addition, resulting in a semi-flexible polymer morphology. Analysis of aggregation growth kinetics shows that pH strongly affects the characteristic timescales for nucleation (τn) and growth (τg), while the initial protein concentration has only minor effects on τn or τg. Low-shear viscosity measurements follow a common scaling relationship between average aggregate molecular weight (Mw(agg)) and concentration (σ), which is consistent with semi-dilute polymer-solution theory. The results establish a link between aggregate growth mechanisms, which couple Mw(agg) and σ, to increases in solution viscosity even at these intermediate protein concentrations (less than 3w/v %).

  3. Specificity of the ModA11, ModA12 and ModD1 epigenetic regulator N6-adenine DNA methyltransferases of Neisseria meningitidis

    PubMed Central

    Seib, Kate L.; Jen, Freda E.-C.; Tan, Aimee; Scott, Adeana L.; Kumar, Ritesh; Power, Peter M.; Chen, Li-Tzu; Wu, Hsing-Ju; Wang, Andrew H.-J.; Hill, Dorothea M. C.; Luyten, Yvette A.; Morgan, Richard D.; Roberts, Richard J.; Maiden, Martin C. J.; Boitano, Matthew; Clark, Tyson A.; Korlach, Jonas; Rao, Desirazu N.; Jennings, Michael P.

    2015-01-01

    Phase variation (random ON/OFF switching) of gene expression is a common feature of host-adapted pathogenic bacteria. Phase variably expressed N6-adenine DNA methyltransferases (Mod) alter global methylation patterns resulting in changes in gene expression. These systems constitute phase variable regulons called phasevarions. Neisseria meningitidis phasevarions regulate genes including virulence factors and vaccine candidates, and alter phenotypes including antibiotic resistance. The target site recognized by these Type III N6-adenine DNA methyltransferases is not known. Single molecule, real-time (SMRT) methylome analysis was used to identify the recognition site for three key N. meningitidis methyltransferases: ModA11 (exemplified by M.NmeMC58I) (5′-CGYm6AG-3′), ModA12 (exemplified by M.Nme77I, M.Nme18I and M.Nme579II) (5′-ACm6ACC-3′) and ModD1 (exemplified by M.Nme579I) (5′-CCm6AGC-3′). Restriction inhibition assays and mutagenesis confirmed the SMRT methylome analysis. The ModA11 site is complex and atypical and is dependent on the type of pyrimidine at the central position, in combination with the bases flanking the core recognition sequence 5′-CGYm6AG-3′. The observed efficiency of methylation in the modA11 strain (MC58) genome ranged from 4.6% at 5′-GCGCm6AGG-3′ sites, to 100% at 5′-ACGTm6AGG-3′ sites. Analysis of the distribution of modified sites in the respective genomes shows many cases of association with intergenic regions of genes with altered expression due to phasevarion switching. PMID:25845594

  4. An Investigation of the Diversity of Strains of Enteroaggregative Escherichia coli Isolated from Cases Associated with a Large Multi-Pathogen Foodborne Outbreak in the UK

    PubMed Central

    Dallman, Timothy J.; Chattaway, Marie A.; Cowley, Lauren A.; Doumith, Michel; Tewolde, Rediat; Wooldridge, David J.; Underwood, Anthony; Ready, Derren; Wain, John; Foster, Kirsty; Grant, Kathie A.; Jenkins, Claire

    2014-01-01

    Following a large outbreak of foodborne gastrointestinal (GI) disease, a multiplex PCR approach was used retrospectively to investigate faecal specimens from 88 of the 413 reported cases. Gene targets from a range of bacterial GI pathogens were detected, including Salmonella species, Shigella species and Shiga toxin-producing Escherichia coli, with the majority (75%) of faecal specimens being PCR positive for aggR associated with the Enteroaggregative E. coli (EAEC) group. The 20 isolates of EAEC recovered from the outbreak specimens exhibited a range of serotypes, the most frequent being O104:H4 and O131:H27. None of the EAEC isolates had the Shiga toxin (stx) genes. Multilocus sequence typing and single nucleotide polymorphism analysis of the core genome confirmed the diverse phylogeny of the strains. The analysis also revealed a close phylogenetic relationship between the EAEC O104:H4 strains in this outbreak and the strain of E. coli O104:H4 associated with a large outbreak of haemolytic ureamic syndrome in Germany in 2011. Further analysis of the EAEC plasmids, encoding the key enteroaggregative virulence genes, showed diversity with respect to FIB/FII type, gene content and genomic architecture. Known EAEC virulence genes, such as aggR, aat and aap, were present in all but one of the strains. A variety of fimbrial genes were observed, including genes encoding all five known fimbrial types, AAF/1 to AAF/V. The AAI operon was present in its entirety in 15 of the EAEC strains, absent in three and present, but incomplete, in two isolates. EAEC is known to be a diverse pathotype and this study demonstrates that a high level of diversity in strains recovered from cases associated with a single outbreak. Although the EAEC in this study did not carry the stx genes, this outbreak provides further evidence of the pathogenic potential of the EAEC O104:H4 serotype. PMID:24844597

  5. High platelet reactivity after P2Y12-inhibition in patients with atrial fibrillation and coronary stenting.

    PubMed

    Rilinger, Jonathan; Meyer, Melanie; Schnabel, Katharina; Weik, Patrick; Charlet, Anne; Esser, Jennifer S; Zhou, Qian; Bode, Christoph; Moser, Martin; Diehl, Philipp; Olivier, Christoph B

    2016-11-01

    High platelet reactivity (HPR) after P2Y12-inhibition in patients undergoing coronary stenting is associated with an increased risk for thromboembolic events and coronary death. So far it is not known how HPR affects the clinical outcome of different treatment strategies in patients with atrial fibrillation (AF) undergoing coronary stenting. In this single centre, observational study the antiplatelet effect of P2Y12-inhibitors in AF patients undergoing coronary stenting was investigated using impedance aggregometry. Patients received either dual antiplatelet therapy (DAPT) or triple therapy (TT). HPR was defined as the ratio of ADP-to TRAP-induced aggregation (r-ADP-agg) ≥50 %. Thromboembolic and bleeding events were assessed within the first 30 days after stenting. Out of 910 screened patients 167 patients were available for the present analysis. HPR was found in 5 of 43 (12 %) patients treated with DAPT and in 18 of 124 (15 %) patients treated with TT. In patients receiving TT, HPR was not a risk factor for thromboembolic events compared to patients with adequate response to P2Y12-inhibitors (6 vs. 8 %, p = 0.712). There was a trend for less bleeding events in patients with HPR compared to r-ADP-agg <50 % in the TT group (0 vs. 16 %, p = 0.077). Our data suggest that HPR after P2Y12-antagonism in patients receiving TT due to AF and coronary stenting might protect from bleeding without increasing thromboembolic risk. Future studies will need to investigate if patients with AF receiving coronary stenting benefit from a reduction of antithrombotic therapy.

  6. Biosynthesis of B2-integrin, intracellular calcium signalling and functional responses of normal and CD18-deficient bovine neutrophils.

    PubMed

    Nagahata, H; Higuchi, H; Nochi, H; Tamoto, K; Araiso, T; Noda, H; Kociba, G J

    1996-09-01

    1Biosynthesis of CD11/CD18 in bovine leucocytes, intracellular Ca2+ ([Ca2+]i) signalling, chemiluminescent responses and membrane fluidity of neutrophils and the effects of D-mannose on neutrophils from control heifers and a heifer with bovine leucocyte adhesion deficiency (BLAD) were measured. The synthesis of CD11/CD18 complex was clearly detected in leucocytes from a normal heifer, but not in a BLAD-affected heifer. The transient phase of increased [Ca2+]i was clearly detected in neutrophils from a heifer with BLAD stimulated with opsonised zymosan, aggregated bovine immunoglobulin G or concanavalin A, whereas the sustained phase was deficient or significantly decreased compared with control heifers. [Ca2+]i signalling of neutrophils from control heifers and a heifer with BLAD stimulated with phorbol myristate acetate via an 11b/CD18-independent pathway showed no transient phase, and the subsequent increase in [Ca2+]i was almost identical in neutrophils from affected and control heifers. [Ca2+]i concentration and chemiluminescent responses of neutrophils from a control heifer were clearly decreased by treatment with anti-CD18 and anti-IgG antibodies. No differences in membrane fluidity were detected between neutrophils derived from control and CD18-deficient cattle. D-mannose binds mainly to Fc rather than CD18 receptors, and decreased Agg-IgG induced [Ca2+]i and the chemiluminescent response of neutrophils. The [Ca2+]i responses and Agg-IgG induced chemiluminescent responses of neutrophils from control heifers and a BLAD-affected heifer were inhibited by D-mannose. The characteristic changes of [Ca2+]i signalling and functional responses of B2-integrin-deficient neutrophils were demonstrated. PMID:8880976

  7. An investigation of the diversity of strains of enteroaggregative Escherichia coli isolated from cases associated with a large multi-pathogen foodborne outbreak in the UK.

    PubMed

    Dallman, Timothy J; Chattaway, Marie A; Cowley, Lauren A; Doumith, Michel; Tewolde, Rediat; Wooldridge, David J; Underwood, Anthony; Ready, Derren; Wain, John; Foster, Kirsty; Grant, Kathie A; Jenkins, Claire

    2014-01-01

    Following a large outbreak of foodborne gastrointestinal (GI) disease, a multiplex PCR approach was used retrospectively to investigate faecal specimens from 88 of the 413 reported cases. Gene targets from a range of bacterial GI pathogens were detected, including Salmonella species, Shigella species and Shiga toxin-producing Escherichia coli, with the majority (75%) of faecal specimens being PCR positive for aggR associated with the Enteroaggregative E. coli (EAEC) group. The 20 isolates of EAEC recovered from the outbreak specimens exhibited a range of serotypes, the most frequent being O104:H4 and O131:H27. None of the EAEC isolates had the Shiga toxin (stx) genes. Multilocus sequence typing and single nucleotide polymorphism analysis of the core genome confirmed the diverse phylogeny of the strains. The analysis also revealed a close phylogenetic relationship between the EAEC O104:H4 strains in this outbreak and the strain of E. coli O104:H4 associated with a large outbreak of haemolytic ureamic syndrome in Germany in 2011. Further analysis of the EAEC plasmids, encoding the key enteroaggregative virulence genes, showed diversity with respect to FIB/FII type, gene content and genomic architecture. Known EAEC virulence genes, such as aggR, aat and aap, were present in all but one of the strains. A variety of fimbrial genes were observed, including genes encoding all five known fimbrial types, AAF/1 to AAF/V. The AAI operon was present in its entirety in 15 of the EAEC strains, absent in three and present, but incomplete, in two isolates. EAEC is known to be a diverse pathotype and this study demonstrates that a high level of diversity in strains recovered from cases associated with a single outbreak. Although the EAEC in this study did not carry the stx genes, this outbreak provides further evidence of the pathogenic potential of the EAEC O104:H4 serotype.

  8. The Dysregulation Profile in middle childhood and adolescence across reporters: factor structure, measurement invariance, and links with self-harm and suicidal ideation.

    PubMed

    Deutz, Marike H F; Geeraerts, Sanne B; van Baar, Anneloes L; Deković, Maja; Prinzie, Peter

    2016-04-01

    Recently, a phenotype of severe dysregulation, the Dysregulation Profile (DP), has been identified. DP consists of elevated scores on the Anxious/Depressed (AD), Aggressive Behavior (AGG) and Attention Problems (AP) scales of the Child Behavior Checklist (CBCL), Teacher Report Form (TRF), or Youth Self Report (YSR). A drawback in current research is that DP has been conceptualized and operationalized in different manners and research on the factor structure of DP is lacking. Therefore, we examined the factor structure of DP across multiple reporters, measurement invariance across gender, parents, and time, as well as links between DP and self-harm and suicidal ideation. Data from a large community sample were used (N = 697), covering middle childhood (Mage = 7.90, (SD = 1.16) and adolescence (Mage = 13.93, SD = 1.14). Mothers, fathers, teachers, and youth themselves reported on children's emotional and behavioral problems using the CBCL, TRF, and YSR. Results indicated that in middle childhood and in adolescence, a bifactor model with a general factor of Dysregulation alongside three specific factors of AD, AGG, and AP fitted best, compared to a second-order or one-factor model. The model showed good fit for mother, father, teacher, and youth reports and showed invariance across gender, parents and time. Youth, mother, and father reported Dysregulation was uniquely and positively related to adolescent-reported self-harm and suicidal ideation. The DP is best conceptualized as a broad dysregulation syndrome, which exists over and above anxiety/depression, aggression, and attention problems as specific problems. The bifactor model of DP explains the uniqueness and interrelatedness of these behavioral problems and can help explaining shared and non-shared etiology factors. The exclusive link between the general dysregulation factor and adolescents' self-harm and suicidal ideation further established the clinical relevance of the bifactor model.

  9. Enteroaggregative Escherichia coli O78:H10, the Cause of an Outbreak of Urinary Tract Infection

    PubMed Central

    Scheutz, Flemming; Andersen, Rebecca L.; Menard, Megan; Boisen, Nadia; Johnston, Brian; Hansen, Dennis S.; Krogfelt, Karen A.; Nataro, James P.; Johnson, James R.

    2012-01-01

    In 1991, multiresistant Escherichia coli O78:H10 strains caused an outbreak of urinary tract infections in Copenhagen, Denmark. The phylogenetic origin, clonal background, and virulence characteristics of the outbreak isolates, and their relationship to nonoutbreak O78:H10 strains according to these traits and resistance profiles, are unknown. Accordingly, we extensively characterized 51 archived E. coli O78:H10 isolates (48 human isolates from seven countries, including 19 Copenhagen outbreak isolates, and 1 each of calf, avian, and unknown-source isolates), collected from 1956 through 2000. E. coli O78:H10 was clonally heterogeneous, comprising one dominant clonal group (61% of isolates, including all 19 outbreak isolates) from ST10 (phylogenetic group A) plus several minor clonal groups (phylogenetic groups A and D). All ST10 isolates, versus 25% of non-ST10 isolates, were identified by molecular methods as enteroaggregative E. coli (EAEC) (P < 0.001). Genes present in >90% of outbreak isolates included fimH (type 1 fimbriae; ubiquitous in E. coli); fyuA, traT, and iutA (associated with extraintestinal pathogenic E. coli [ExPEC]); and sat, pic, aatA, aggR, aggA, ORF61, aaiC, aap, and ORF3 (associated with EAEC). An outbreak isolate was lethal in a murine subcutaneous sepsis model and exhibited characteristic EAEC “stacked brick” adherence to cultured epithelial cells. Thus, the 1991 Copenhagen outbreak was caused by a tight, non-animal-associated subset within a broadly disseminated O78:H10 clonal group (ST10; phylogenetic group A), members of which exhibit both ExPEC and EAEC characteristics, whereas O78:H10 isolates overall are phylogenetically diverse. Whether ST10 O78:H10 EAEC strains are both uropathogenic and diarrheagenic warrants further investigation. PMID:22972830

  10. Site-specific integration of bacteriophage VWB genome into Streptomyces venezuelae and construction of a VWB-based integrative vector.

    PubMed

    Van Mellaert, L; Mei, L; Lammertyn, E; Schacht, S; Anné, J

    1998-12-01

    The temperate bacteriophage VWB integrates into the chromosome of Streptomyces venezuelae ETH14630 via site-specific integration. Following recombination of the VWB attP region with the chromosomal attB sequence, the host-phage junctions attL and attR are formed. Nucleotide sequence analysis of attP, attB, attL and attR revealed a 45 bp common core sequence. In attB this 45 bp sequence consists of the 3' end of a putative tRNA Arg(AGG) gene with a 3'-terminal CCA sequence which is typical for prokaryotic tRNAs. Phage DNA integration restores the putative tRNA Arg(AGG) gene in attL. However, following recombination the CCA sequence is missing as is the case for most Streptomyces tRNA genes described so far. Adjacent to VWB attP, an ORF encoding a 427 aa protein was detected. The C-terminal region of this protein shows high similarity to the conserved C-terminal domain of site-specific recombinases belonging to the integrase family. To prove the functionality of this putative integrase gene (int), an integrative vector pKT02 was constructed. This vector consists of a 2.3 kb HindIII-SphI restriction fragment of VWB DNA containing attP and int cloned in a non-replicative Escherichia coli vector carrying a thiostrepton-resistance (tsr) gene. Integration of pKT02 was obtained after transformation of Streptomyces venezuelae ETH14630 and Streptomyces lividans TK24 protoplasts. This vector will thus be useful for a number of additional Streptomyces species in which a suitable tRNA gene can be functional as integration site.

  11. SISGR: Linking Ion Solvation and Lithium Battery Electrolyte Properties

    SciTech Connect

    Trulove, Paul C.; Foley, Matthew P.

    2012-09-30

    The solvation and phase behavior of the model battery electrolyte salt lithium trifluoromethanesulfonate (LiCF3SO3) in commonly used organic solvents; ethylene carbonate (EC), gamma-butyrolactone (GBL), and propylene carbonate (PC) was explored. Data from differential scanning calorimetry (DSC), Raman spectroscopy, and X-ray diffraction were correlated to provide insight into the solvation states present within a sample mixture. Data from DSC analyses allowed the construction of phase diagrams for each solvent system. Raman spectroscopy enabled the determination of specific solvation states present within a solvent-salt mixture, and X-ray diffraction data provided exact information concerning the structure of a solvates that could be isolated Thermal analysis of the various solvent-salt mixtures revealed the phase behavior of the model electrolytes was strongly dependent on solvent symmetry. The point groups of the solvents were (in order from high to low symmetry): C2V for EC, CS for GBL, and C1 for PC(R). The low symmetry solvents exhibited a crystallinity gap that increased as solvent symmetry decreased; no gap was observed for EC-LiTf, while a crystallinity gap was observed spanning 0.15 to 0.3 mole fraction for GBL-LiTf, and 0.1 to 0.33 mole fraction for PC(R)-LiTf mixtures. Raman analysis demonstrated the dominance of aggregated species in almost all solvent compositions. The AGG and CIP solvates represent the majority of the species in solutions for the more concentrated mixtures, and only in very dilute compositions does the SSIP solvate exist in significant amounts. Thus, the poor charge transport characteristics of CIP and AGG account for the low conductivity and transport properties of LiTf and explain why is a poor choice as a source of Li+ ions in a Li-ion battery.

  12. An investigation of the diversity of strains of enteroaggregative Escherichia coli isolated from cases associated with a large multi-pathogen foodborne outbreak in the UK.

    PubMed

    Dallman, Timothy J; Chattaway, Marie A; Cowley, Lauren A; Doumith, Michel; Tewolde, Rediat; Wooldridge, David J; Underwood, Anthony; Ready, Derren; Wain, John; Foster, Kirsty; Grant, Kathie A; Jenkins, Claire

    2014-01-01

    Following a large outbreak of foodborne gastrointestinal (GI) disease, a multiplex PCR approach was used retrospectively to investigate faecal specimens from 88 of the 413 reported cases. Gene targets from a range of bacterial GI pathogens were detected, including Salmonella species, Shigella species and Shiga toxin-producing Escherichia coli, with the majority (75%) of faecal specimens being PCR positive for aggR associated with the Enteroaggregative E. coli (EAEC) group. The 20 isolates of EAEC recovered from the outbreak specimens exhibited a range of serotypes, the most frequent being O104:H4 and O131:H27. None of the EAEC isolates had the Shiga toxin (stx) genes. Multilocus sequence typing and single nucleotide polymorphism analysis of the core genome confirmed the diverse phylogeny of the strains. The analysis also revealed a close phylogenetic relationship between the EAEC O104:H4 strains in this outbreak and the strain of E. coli O104:H4 associated with a large outbreak of haemolytic ureamic syndrome in Germany in 2011. Further analysis of the EAEC plasmids, encoding the key enteroaggregative virulence genes, showed diversity with respect to FIB/FII type, gene content and genomic architecture. Known EAEC virulence genes, such as aggR, aat and aap, were present in all but one of the strains. A variety of fimbrial genes were observed, including genes encoding all five known fimbrial types, AAF/1 to AAF/V. The AAI operon was present in its entirety in 15 of the EAEC strains, absent in three and present, but incomplete, in two isolates. EAEC is known to be a diverse pathotype and this study demonstrates that a high level of diversity in strains recovered from cases associated with a single outbreak. Although the EAEC in this study did not carry the stx genes, this outbreak provides further evidence of the pathogenic potential of the EAEC O104:H4 serotype. PMID:24844597

  13. Wide variation in virulence and genetic diversity of binucleate Rhizoctonia isolates associated with root rot of strawberry in Western Australia.

    PubMed

    Fang, Xiangling; Finnegan, Patrick M; Barbetti, Martin J

    2013-01-01

    Strawberry (Fragaria×ananassa) is one of the most important berry crops in the world. Root rot of strawberry caused by Rhizoctonia spp. is a serious threat to commercial strawberry production worldwide. However, there is no information on the genetic diversity and phylogenetic status of Rhizoctonia spp. associated with root rot of strawberry in Australia. To address this, a total of 96 Rhizoctonia spp. isolates recovered from diseased strawberry plants in Western Australia were characterized for their nuclear condition, virulence, genetic diversity and phylogenetic status. All the isolates were found to be binucleate Rhizoctonia (BNR). Sixty-five of the 96 BNR isolates were pathogenic on strawberry, but with wide variation in virulence, with 25 isolates having high virulence. Sequence analysis of the internal transcribed spacers of the ribosomal DNA separated the 65 pathogenic BNR isolates into six distinct clades. The sequence analysis also separated reference BNR isolates from strawberry or other crops across the world into clades that correspond to their respective anastomosis group (AG). Some of the pathogenic BNR isolates from this study were embedded in the clades for AG-A, AG-K and AG-I, while other isolates formed clades that were sister to the clades specific for AG-G, AG-B, AG-I and AG-C. There was no significant association between genetic diversity and virulence of these BNR isolates. This study demonstrates that pathogenic BNR isolates associated with root rot of strawberry in Western Australia have wide genetic diversity, and highlights new genetic groups not previously found to be associated with root rot of strawberry in the world (e.g., AG-B) or in Australia (e.g., AG-G). The wide variation in virulence and genetic diversity identified in this study will be of high value for strawberry breeding programs in selecting, developing and deploying new cultivars with resistance to these multi-genetic groups of BNR. PMID:23405226

  14. EHEC/EAEC O104:H4 strain linked with the 2011 German outbreak of haemolytic uremic syndrome enters into the viable but non-culturable state in response to various stresses and resuscitates upon stress relief.

    PubMed

    Aurass, Philipp; Prager, Rita; Flieger, Antje

    2011-12-01

    Various non-spore forming bacteria, including Escherichia coli, enter a dormant-like state, the viable but non-culturable (VBNC) state, characterized by the presence of viable cells but the inability to grow on routine laboratory media. Upon resuscitation, these VBNC cells recover both culturability and pathogenicity. In 2011, a large outbreak involving more than 3000 cases of bloody diarrhoea and haemolytic uremic syndrome was caused by an E. coli O104:H4 strain expressing genes characteristic of both enterohaemorrhagic (EHEC) and enteroaggregative E. coli (EAEC). The ability of the outbreak strain to enter the VBNC state may have complicated its detection in the suspected sources. In this paper, we investigated the ability of the outbreak strain to enter and subsequently recover from the VBNC state. We found that in a nutrient-poor micro-environment, various stresses such as toxic concentrations of copper ions or certain types of tap water are able to render the bacteria unculturable within a few days. Without copper ion stress, the majority of cells remained culturable for at least 40 days. Incubation with the stressors at 23°C compared with 4°C hastened this observed loss of culturability. The integrity of a considerable fraction of copper ion- and tap water 1-stressed bacteria was demonstrated by live/dead staining and microscopy. Relieving stress by copper-ion chelation facilitated resuscitation of these bacteria while preserving their fitness, major virulence gene markers (stx2, aggR, aggA genes) and specific phenotypes (ESBL resistance, autoaggregation typical for EAEC strains). PMID:21951606

  15. Wide variation in virulence and genetic diversity of binucleate Rhizoctonia isolates associated with root rot of strawberry in Western Australia.

    PubMed

    Fang, Xiangling; Finnegan, Patrick M; Barbetti, Martin J

    2013-01-01

    Strawberry (Fragaria×ananassa) is one of the most important berry crops in the world. Root rot of strawberry caused by Rhizoctonia spp. is a serious threat to commercial strawberry production worldwide. However, there is no information on the genetic diversity and phylogenetic status of Rhizoctonia spp. associated with root rot of strawberry in Australia. To address this, a total of 96 Rhizoctonia spp. isolates recovered from diseased strawberry plants in Western Australia were characterized for their nuclear condition, virulence, genetic diversity and phylogenetic status. All the isolates were found to be binucleate Rhizoctonia (BNR). Sixty-five of the 96 BNR isolates were pathogenic on strawberry, but with wide variation in virulence, with 25 isolates having high virulence. Sequence analysis of the internal transcribed spacers of the ribosomal DNA separated the 65 pathogenic BNR isolates into six distinct clades. The sequence analysis also separated reference BNR isolates from strawberry or other crops across the world into clades that correspond to their respective anastomosis group (AG). Some of the pathogenic BNR isolates from this study were embedded in the clades for AG-A, AG-K and AG-I, while other isolates formed clades that were sister to the clades specific for AG-G, AG-B, AG-I and AG-C. There was no significant association between genetic diversity and virulence of these BNR isolates. This study demonstrates that pathogenic BNR isolates associated with root rot of strawberry in Western Australia have wide genetic diversity, and highlights new genetic groups not previously found to be associated with root rot of strawberry in the world (e.g., AG-B) or in Australia (e.g., AG-G). The wide variation in virulence and genetic diversity identified in this study will be of high value for strawberry breeding programs in selecting, developing and deploying new cultivars with resistance to these multi-genetic groups of BNR.

  16. Characterizing New Fast Optical Transients with HST: Astrometry, Geometry, and Host Galaxies

    NASA Astrophysics Data System (ADS)

    Cenko, Stephen

    2014-10-01

    The Palomar Transient Factory (PTF) is a wide-field, high-cadence optical survey designed with two primary objectives: (1) to perform a systematic study of known classes of transient and/or variable sources (e.g., Type Ia supernovae, RR Lyrae stars, etc.); and (2) to enable the discovery of new classes of transient phenomena by exploring new regimes of sensitivity and variability. PTF recently transitioned to a new observing strategy (dubbed "iPTF"), in large part due to a desire to investigate even shorter time scales (tau < 1 day). The systematic exploration of this new phase should enable the discovery of new astrophysical phenomenon, including both those predicted but not yet observationally confirmed (e.g., orphan gamma-ray burst afterglows) and those entirely unknown.Here we request HST ToO observations of a newly discovered "fast" optical transient, typified by our previous discovery of PTF11agg. We argue that PTF11agg may represent a new class of distant, relativistic outbursts lacking in high-energy emission altogether (i.e., "dirty" fireballs), and that these sources may be at least as common as normal, on-axis gamma-ray bursts. Our transient detection pipeline now enables us to identify and confirm these sources in real-time, as demonstrated by our recent discovery of iPTF14yb (the first gamma-ray burst identified via its long-wavelength afterglow emission). HST can provide three vital diagnostics that cannot be achieved with any other facility: (1) resolved host imaging; (2) sub-galactic localizations; and (3) sensitive late-time photometry when the transient emission is comparable to or fainter than the underlying host.

  17. Molecular investigation and cultivation of camelpox virus in Iran.

    PubMed

    Mosadeghhesari, M; Oryan, A; Zibaee, S; Varshovi, H R

    2014-11-01

    Camelpox virus (genus Orthopoxvirus, family Poxviridae) is the etiologic agent of camel pox. The clinical manifestations of this virus range from inapparent infection to mild, moderate and, less commonly, severe systemic infection and death. Following an outbreak of camelpox, samples that were collected from camel flocks suspected to have camelpox in Qom Province in central Iran and Khash city, Sistan and Baluchestan Province and South Khorasan Province in eastern Iran were sent to Razi Vaccine and Serum Research Institute in Mashhad. DNA extraction was performed primarily by the phenol-chloroform method, and PCR was carried out using a Bioneer kit. Using the primer pair 5'-AAT-ACA-AGG-AGG-ATC-T-3' and 5'-CTT-AAC-TTT-TTC-TTT-CTC-3', the gene sequence encoding the A-type inclusion protein (ATIP) was amplified. The size of the PCR product, specific for camelpox virus, was 881 bp. The PCR product was purified, and to confirm its sequence, it was sent to the reference laboratory. The sequence was subjected to a BLAST search and then phylogenetically analyzed using CLC software. The results showed that all samples were nearly 100 % identical to each other and to strains CMS and M-96. These isolates also had 99 % and 95 % similarity to the CP-1 strain and isolate FIN/T2000, respectively. In Vero cell culture, inoculation with this virus caused a cytopathic effect (CPE), which appeared 2-5 days post-inoculation. Characteristic CPE showing foci of rounded cells, ballooning, giant-cell formation and syncytia with degenerative changes appeared.

  18. Prevalence and characteristics of verotoxigenic Escherichia coli strains isolated from pigs and pork products in Umbria and Marche regions of Italy.

    PubMed

    Ercoli, Laura; Farneti, Silvana; Zicavo, Alessia; Mencaroni, Guerriero; Blasi, Giuliana; Striano, Gianluca; Scuota, Stefania

    2016-09-01

    In total 1095 samples from 675 pork products, 210 swine colon contents, and 210 swine carcass sponge swabs were collected in Umbria and Marche regions of Italy and examined for the presence of Shiga toxin-producing Escherichia coli (STEC), also known as Verotoxin-producing E. coli (VTEC). After an enrichment step, each sample was analysed by real-time PCR to detect the stx1, stx2, and eae genes. stx-Positive samples were further tested for the "top five" serogroup markers (O157, O26, O103, O111, O145) and cultured onto selective media. The isolates were assigned to stx subtypes and tested for the presence of aaiC and aggR genes. Out of 420 swine samples, 38.6% faecal samples and 13.8% carcass sponge swabs were stx-positive. In total, 33 E. coli STEC isolates were obtained from 30 samples (4 carcasses and 26 colon contents) indicating a culture-positive rate of 7.1%. A higher culture-positive rate was observed in faecal samples (12.4%) than in carcass sponge swabs (1.9%). Out of 675 pork samples, 19 (2.8%) were stx-positive. No STEC strains were isolated from stx-positive pork products. We concluded that STEC isolation from foodstuffs remains difficult, despite the application of ISO/TS 13136:2012. Furthermore, in accordance with the results of studies conducted in other countries, we observed that most of swine STEC strains carried stx2e gene and lacked of virulence genes, such as eae, aaiC and aggR, indicative of potential pathogenic characteristics for humans. Although the majority of STEC isolates did not express virulence factors correlating with severe human diseases, the association between swine STEC strains and human illness requires further investigations. PMID:27236076

  19. Codon 972 polymorphism in the insulin receptor substrate-1 gene, obesity, and risk of noninsulin-dependent diabetes mellitus

    SciTech Connect

    Sigal, R.J.; Doria, A.; Warram, J.H.; Krolewski, A.S.

    1996-04-01

    Because of the role of insulin receptor substrate-1 in insulin action, the insulin receptor substrate-1 gene is a candidate gene for noninsulin-dependent diabetes mellitus (NIDDM). Modest associations between NIDDM and a GGG-AGG single base substitution (corresponding to a glycine-arginine amino acid substitution) in codon 972 of the gene have been found, but none reached statistical significance. To examine further how large a proportion of NIDDM cases could be caused by the mutation, we performed a stratified analysis combining the results from the 6 earlier studies and those from our panel of 192 unrelated NIDDM subjects and 104 healthy controls. In addition, we looked for a possibility that the codon 972 mutation plays a role only in the presence of certain conditions. Genomic DNA samples obtained from NIDDM cases and healthy controls were genotyped using a PCR-restriction fragment length polymorphism protocol modified for genomic DNA. The GGG{r_arrow}AGG substitution was found in 5.7% of the diabetic subjects (11 of 192) and 6.9% of the controls (7 of 104). The difference between groups was not statistically significant, and it was not different from the results of other studies. The Mantel-Haenszel summary odds ratio across all studies was 1.49 (P < 0.05; 95% confidence intervals, 1.01-2.2). This summary odds ratio is consistent with a small proportion of NIDDM cases ({approximately}3%) being caused by the mutation. Exploratory subgroup analyses on our panel suggested a clustering of NIDDM, the codon 972 mutation, and overweight, raising the hypothesis that the mutation may predispose to NIDDM only in the presence of excess body weight. 9 refs., 2 tabs.

  20. Nectar-carbohydrate production and composition vary in relation to nectary anatomy and location within individual flowers of several species of Brassicaceae.

    PubMed

    Davis, A R; Pylatuik, J D; Paradis, J C; Low, N H

    1998-06-01

    Nectar-carbohydrate production and composition were investigated by high-performance liquid chromatography and enzymology in nine species from five tribes of the Brassicaceae. In six species (Arabidopsis thaliana (L.) Heynh., Brassica napus L., B. rapa L., Lobularia maritima (L.) Desv., Raphanus sativus L., Sinapis arvensis L.) that produced nectar from both lateral nectaries (associated with the short stamens) and median nectaries (outside the long stamens), on average 95% of the total nectar carbohydrate was collected from the lateral ones. Nectar from these glands possessed a higher glucose/fructose ratio (usually 1.0-1.2) than that from the median nectaries (0.2-0.9) within the same flower. Comparatively little sucrose was detected in any nectar samples except from Matthiola bicornus (Sibth. et Sm.) DC., which possessed lateral nectaries only and produced a sucrose-dominant exudate. The anatomy of the nectarial tissue in nectar-secreting flowers of six species, Hesperis matronalis L., L. maritima, M. bicornus, R. sativus, S. arvensis, and Sisymbrium loeselii L., was studied by light and scanning-electron microscopy. Phloem alone supplied the nectaries. However, in accordance with their overall nectar-carbohydrate production, the lateral glands received relatively rich quantities of phloem that penetrated far into the glandular tissue, whereas median glands were supplied with phloem that often barely innervated them. All nectarial tissue possessed modified stomata (with the exception of the median glands of S. loeselii, which did not produce nectar); further evidence was gathered to indicate that these structures do not regulate nectar flow by guard-cell movements. The numbers of modified stomata per gland showed no relation to nectar-carbohydrate production. Taken together, the data on nectar biochemistry and nectary anatomy indicate the existence of two distinct nectary types in those Brassicacean species that possess both lateral and median nectaries

  1. Molecular systematics of Brassica and allied genera (Subtribe Brassicinae, Brassiceae) -chloroplast genome and cytodeme congruence.

    PubMed

    Warwick, S I; Black, L D

    1991-07-01

    Chloroplast DNA restriction sites for 20 endonucleases were mapped using cpDNA probes from Brassica juncea and site variation was surveyed in 33 diploid taxa of the Subtribe Brassicinae. A total of 419 mutations was observed, including both site (i.e., gain/ loss) and fragment length (i.e., insertions or deletions); 221 (53%) mutations showed variation at the interspecific level. Phylogenetic analysis indicated a clear division of the subtribe into two ancient evolutionary lineages. These were (I) the "Nigra" lineage: Brassica nigra, B. fruticulosa, B. tournefortii, Sinapis pubescens, S. alba, S. flexuosa, S. arvensis, Coincya cheiranthos, Erucastrum canariense, and Hirschfeldia incana, and (II) the "Rapa/ Oleracea" lineage: Brassica rapa, B. oleracea ssp. oleracea and ssp. alboglabra, B. rupestris-villosa complex (B. rupestris, B. drepanensis, B. macrocarpa, B. villosa), B. barrelieri, B. deflexa, B. oxyrrhina, B. gravinae, Diplotaxis erucoides, D. tenuifolia, Eruca sativa, Raphanus raphanistrum, R. sativus, and Sinapis aucheri. In the "Nigra" lineage, Brassica nigra was most closely related to the annual Sinapis species, S. arvensis and S. alba. In the "Rapa/Oleracea" lineage, the Brassica rapa and B. oleracea genomes formed a distinct group whose closest relatives were the wild species of the B. oleracea (n=9) complex (i.e., B. rupestris-villosa complex). Species with n=7 chromosomes exist in both lineages. Hirschfeldia incana (n=7), in the "Nigra" lineage, was most closely related to Sinapis pubescens. In the "Rapa/Oleracea" lineage three taxa with n=7 - B. deflexa, D. erucoides, and S. aucheri - were closely related, advanced in the lineage, and were the closest apparent relatives (particularly D. erucoides) to B. rapa, B. oleracea, and its wild relatives. Levels of genetic divergence suggested by the cpDNA data were consistent with cytodeme recognition in the subtribe, but provided evidence for inconsistencies in the current generic delimitations based on

  2. Disentangling relationships among the diploid members of the intricate genus Knautia (Caprifoliaceae, Dipsacoideae).

    PubMed

    Rešetnik, Ivana; Frajman, Božo; Bogdanović, Sandro; Ehrendorfer, Friedrich; Schönswetter, Peter

    2014-05-01

    The genus Knautia (Caprifoliaceae, Dipsacoideae) encompasses 40-60 species mainly distributed in western Eurasia, with highest species diversity in the Alps and the Balkan Peninsula. It is traditionally regarded as one of the taxonomically most challenging European genera due to the widespread occurrence of polyploidy, the high incidence of hybridisation and the maintenance of morphologically intermediate forms. A prerequisite for assessing the complex spatiotemporal diversification of a polyploid group is a comprehensive hypothesis of the phylogenetic relationships among its diploid members. To this end, DNA sequence data (nrDNA ITS and plastid petN(ycf6)-psbM) combined with AFLP fingerprinting were performed on 148 diploid populations belonging to 35 taxa. Phylogenies obtained by maximum parsimony and Bayesian analyses were used to test the monophyly of the genus and its three sections Trichera, Tricheroides and Knautia, to provide insights into its evolutionary history and to test previous hypotheses of inter- and intrasectional classification. Both nuclear and chloroplast datasets support the monophyly of Knautia and its three sections, with ambiguous placement of K. cf. degenii. The majority of species belong to the nearly exclusively perennial section Trichera (x=10). Within section Trichera all markers revealed largely unresolved phylogenetic relationships suggesting rapid radiation and recent range expansion. In addition, extensive sharing of plastid haplotypes across taxa and wide geographic ranges of plastid haplotypes and ribotype groups were observed. The molecular data are partly at odds with the traditional informal grouping of taxa within section Trichera. Whereas the traditional groups of K. dinarica, K. drymeia and K. montana can be maintained, the new, smaller and well supported Midzorensis and Pancicii Groups as well as the SW European Group are separated from the heterogeneous traditional K. longifolia group. The former groups of K. arvensis, K

  3. Transcriptome profile analysis of young floral buds of fertile and sterile plants from the self-pollinated offspring of the hybrid between novel restorer line NR1 and Nsa CMS line in Brassica napus

    PubMed Central

    2013-01-01

    Background The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. Results In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste) and 253,507 (Fer) distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs). In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE) data. Conclusions A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in Nsa line, fertility

  4. The Rhone-Aggregation Land Surface Scheme Intercomparison Project

    NASA Astrophysics Data System (ADS)

    Boone, A. A.; Habets, F.; Noilhan and Working Group, J.

    2002-05-01

    The Rhone-AGGregation (Rhone-AGG) Land Surface Scheme intercomparison project is an initiative within the Global Energy and Water Cycle Experiment (GEWEX) Global Land-Atmosphere System Study (GLASS)/Global Soil Wetness Project (GSWP) panel of the World Climate Research Programme (WCRP). This project makes use of the Rhone modeling system, which was developed in recent years by the French research community in order to study the continental water cycle on a regional scale. Three distinct components comprise this system: an analysis system to determine the near-surface atmospheric forcing, a Land Surface Scheme (LSS) interface and a distributed hydrological model. The coupling between the three components of the system is 1-way. It was created in an attempt to ensure a consistent dialogue between the atmosphere (precipitation, radiative fluxes, state variables) and the hydrological variables (evaporation, soil moisture, runoff, ground water and river flow). The atmospheric data, which have been mapped to an 8 km grid, consist of standard screen level observations at approximately 60 Météo-France weather network sites within the domain, European Centre for Medium-Range Weather Forecasts (ECMWF) analysis, climatological data and total daily precipitation data from over 1500 gauges. The system utilizes high spatial resolution European soil and vegetation databases, but it has been designed such that it is transferable to other regions. The size of the entire Rhone basin (86,996 km 2) is comparable to the area of a typical coarse-resolution Global atmospheric Climate Model (GCM) grid element, so that it is of interest to examine how the simulations from a wide range of LSSs, which are used in GCMs, numerical weather prediction models, mesoscale atmospheric models or hydrological models, are impacted by changing the spatial resolution over the domain from 8 km to approximately 69 km (1 degree). The main issues addressed by the Rhone-AGG project are how various state of

  5. Structural organization of cetyltrimethylammonium sulfate in aqueous solution: The effect of Na2SO4.

    PubMed

    Feitosa, Eloi; Brazolin, Marcelo Rodrigo Savério; Naal, Rose Mary Zumstein Georgetto; Del Lama, Maria Perpétua Freire de Morais; Lopes, Josias R; Loh, Watson; Vasilescu, Marilena

    2006-07-15

    We used dynamic light scattering (DLS), steady-state fluorescence, time resolved fluorescence quenching (TRFQ), tensiometry, conductimetry, and isothermal titration calorimetry (ITC) to investigate the self-assembly of the cationic surfactant cetyltrimethylammonium sulfate (CTAS) in aqueous solution, which has SO(2-)4 as divalent counterion. We obtained the critical micelle concentration (cmc), aggregation number (N(agg)), area per monomer (a0), hydrodynamic radius (R(H)), and degree of counterion dissociation (alpha) of CTAS micelles in the absence and presence of up to 1 M Na2SO4 and at temperatures of 25 and 40 degrees C. Between 0.01 and 0.3 M salt the hydrodynamic radius of CTAS micelle R(H) approximately 16 A is roughly independent on Na2SO4 concentration; below and above this concentration range R(H) increases steeply with the salt concentration, indicating micelle structure transition, from spherical to rod-like structures. R(H) increases only slightly as temperature increases from 25 to 40 degrees C, and the cmc decreases initially very steeply with Na2SO4 concentration up to about 10 mM, and thereafter it is constant. The area per surfactant at the water/air interface, a0, initially increases steeply with Na2SO4 concentration, and then decreases above ca. 10 mM. Conductimetry gives alpha = 0.18 for the degree of counterion dissociation, and N(agg) obtained by fluorescence methods increases with surfactant concentration but it is roughly independent of up to 80 mM salt. The ITC data yield cmc of 0.22 mM in water, and the calculated enthalpy change of micelle formation, Delta H(mic) = 3.8 kJ mol(-1), Gibbs free energy of micellization of surfactant molecules, Delta G(mic) = -38.0 kJ mol(-1) and entropy TDelta S(mic) = 41.7 kJ mol(-1) indicate that the formation of CTAS micelles is entropy-driven.

  6. Prevalence of Escherichia coli Virulence Genes in Patients with Diarrhea and a Subpopulation of Healthy Volunteers in Madrid, Spain.

    PubMed

    Cabal, Adriana; García-Castillo, María; Cantón, Rafael; Gortázar, Christian; Domínguez, Lucas; Álvarez, Julio

    2016-01-01

    Etiological diagnosis of diarrheal diseases may be complicated by their multi-factorial nature. In addition, Escherichia coli strains present in the gut can occasionally harbor virulence genes (VGs) without causing disease, which complicates the assessment of their clinical significance in particular. The aim of this study was to detect and quantify nine VGs (stx1, stx2, eae, aggR, ehxA, invA, est, elt and bfpA) typically present in five E. coli enteric pathotypes [enterohaemorrhagic E. coli (EHEC), enterotoxigenic E. coli (ETEC), enteropathogenic E. coli (EPEC), enteroaggregative E. coli (EAEC), and enteroinvasive E. coli (EIEC)] in fecal samples collected from 49 patients with acute diarrhea and 32 healthy controls from Madrid, Spain. In addition, the presence of four serotype-related genes (wzx O104 and fliCH4, rfb O157, and fliCH7) was also determined. Presence of target genes was assessed using a quantitative real-time PCR assay previously developed, and the association of presence and burden of VGs with clinical disease and/or other risk factors was explored. Prevalence of ehxA [typically associated with Shigatoxin producing E. coli (STEC) and (EPEC), invA (EIEC), and the rfb O157+fliCH7 (STEC)] combination were significantly (p < 0.02) higher in the diarrheic group, while the wzx O104+fliCH4 combination was significantly (p = 0.014) more prevalent in the control group. On the other hand, eae was detected in more than 90% of the individuals in both patient and control populations, and it was not associated with bfpA, suggesting the absence of typical EPEC. No significant differences in the quantitative values were detected for any VG among study groups, but the difference in the load of aggR (EAEC) and invA in the patients with respect to the controls was close to the significance, suggesting a potential role of these VGs in the clinical signs observed when they are present at high levels.

  7. Prevalence of Escherichia coli Virulence Genes in Patients with Diarrhea and a Subpopulation of Healthy Volunteers in Madrid, Spain

    PubMed Central

    Cabal, Adriana; García-Castillo, María; Cantón, Rafael; Gortázar, Christian; Domínguez, Lucas; Álvarez, Julio

    2016-01-01

    Etiological diagnosis of diarrheal diseases may be complicated by their multi-factorial nature. In addition, Escherichia coli strains present in the gut can occasionally harbor virulence genes (VGs) without causing disease, which complicates the assessment of their clinical significance in particular. The aim of this study was to detect and quantify nine VGs (stx1, stx2, eae, aggR, ehxA, invA, est, elt and bfpA) typically present in five E. coli enteric pathotypes [enterohaemorrhagic E. coli (EHEC), enterotoxigenic E. coli (ETEC), enteropathogenic E. coli (EPEC), enteroaggregative E. coli (EAEC), and enteroinvasive E. coli (EIEC)] in fecal samples collected from 49 patients with acute diarrhea and 32 healthy controls from Madrid, Spain. In addition, the presence of four serotype-related genes (wzxO104 and fliCH4, rfbO157, and fliCH7) was also determined. Presence of target genes was assessed using a quantitative real-time PCR assay previously developed, and the association of presence and burden of VGs with clinical disease and/or other risk factors was explored. Prevalence of ehxA [typically associated with Shigatoxin producing E. coli (STEC) and (EPEC), invA (EIEC), and the rfbO157+fliCH7 (STEC)] combination were significantly (p < 0.02) higher in the diarrheic group, while the wzxO104+fliCH4 combination was significantly (p = 0.014) more prevalent in the control group. On the other hand, eae was detected in more than 90% of the individuals in both patient and control populations, and it was not associated with bfpA, suggesting the absence of typical EPEC. No significant differences in the quantitative values were detected for any VG among study groups, but the difference in the load of aggR (EAEC) and invA in the patients with respect to the controls was close to the significance, suggesting a potential role of these VGs in the clinical signs observed when they are present at high levels. PMID:27199966

  8. Assessment of safety of enterococci isolated throughout traditional Terrincho cheesemaking: virulence factors and antibiotic susceptibility.

    PubMed

    Pimentel, Lígia L; Semedo, Teresa; Tenreiro, Rogério; Crespo, M Teresa B; Pintado, M Manuela E; Malcata, F Xavier

    2007-09-01

    Enterococci account for an important fraction of the adventitious microflora of traditional cheeses manufactured in Mediterranean countries from small ruminants' raw milk and play an important role in the development of suitable organoleptic characteristics of the final product. It has been suggested that animals used for food or animals that supply edible products are a reservoir of antibiotic-resistant enterococci. The main purpose of this research effort was thus to identify, to the species level, a total of 73 enterococci with high tolerance to acidic pH and bile salts (as prevailing environmental conditions in the first portion of the gastrointestinal tract), which were previously isolated from the milk feedstock to the final product of Terrincho cheesemaking, and to determine their profiles of antibiotic susceptibility, coupled with the occurrence of specific virulence factors (especially in those that might eventually be claimed to exhibit suitable probiotic and technological performances). Isolates, identified by both API 20 STREP and PCR methods, were found to belong to the following Enterococcus species: E. casseliflavus, E. durans, E. faecalis, E. faecium, and E. gallinarum. Susceptibility of those isolates was observed to most antibiotics tested, whereas none harbored aminoglycoside resistance genes. PCR screenings for cytolysin genes (cylL(L), cylL(s), cylM, cylB, and cylA), surface adhesin genes (efaA(fs), efaA(fm), and esp), the aggregation protein gene (agg), and the extracellular metalloendopeptidase gene (gelE) were performed. All isolates proved negative for cylL(L), cylM, cylB, and agg genes. Both E. faecalis strains were positive for the cell wall-associated protein Esp and the cell wall adhesin efaA(fs), whereas the cell wall adhesin efaA(fm) was detected in 11 of the 12 E. faecium strains. Only one strain possessed the cylL(s) determinant, and another possessed the cylA gene. Incidence of virulence determinants was thus very low; hence, the

  9. Molecular Epidemiologic Analysis of Enterococcus faecalis Isolates in Cuba by Multilocus Sequence Typing

    PubMed Central

    Kobayashi, Nobumichi; Nagashima, Shigeo

    2009-01-01

    We carried out the first study of Enterococcus faecalis clinical isolates in Cuba by multilocus sequence typing linking the molecular typing data with the presence of virulence determinants and the antibiotic resistance genes. A total of 23 E. faecalis isolates recovered from several clinic sources and geographic areas of Cuba during a period between 2000 and 2005 were typed by multilocus sequence typing. Thirteen sequence types (STs) including five novel STs were identified, and the ST 64 (clonal complex [CC] 8), ST 6 (CC2), ST 21(CC21), and ST 16 (CC58) were found in more than one strain. Sixty-seven percent of STs corresponded to STs reported previously in Spain, Poland, and The Netherlands, and other STs (ST115, ST64, ST6, and ST40) were genetically close to those detected in the United States. Prevalence of both antimicrobial resistance genes [aac(6′)-aph(2″), aph(3′), ant(6), ant(3″)(9), aph(2″)-Id, aph(2″)-Ic, erm(B), erm(A), erm(C), mef(A), tet(M), and tet(L)] and virulence genes (agg, gelE, cylA, esp, ccf, and efaAfs) were examined by polymerase chain reaction. Aminoglycoside resistance genes aac(6′)-Ie-aph(2″)-Ia, aph(3′), ant(6), ant(3″)(9) were more frequently detected in ST6, ST16, ST23, ST64, and ST115. The multidrug resistance was distributed to all STs detected, except for ST117 and singleton ST225. The presence of cyl gene was specifically linked to the ST64 and ST16. Presence of the esp, gel, and agg genes was not specific to any particular ST. This research provided the first insight into the population structure of E. faecalis in Cuba, that is, most Cuban strains were related to European strains, whereas others to U.S. strains. The CC2, CC21, and CC8, three of the biggest CCs in the world, were evidently circulating in Cuba, associated with multidrug resistance and virulence traits. PMID:19857135

  10. Pathotypic and Phylogenetic Study of Diarrheagenic Escherichia coli and Uropathogenic E. coli Using Multiplex Polymerase Chain Reaction

    PubMed Central

    Salmani, Hamzeh; Azarnezhad, Asaad; Fayazi, Mohammad Reza; Hosseini, Arshad

    2016-01-01

    Background: Acute diarrheal disease and urinary tract infection are leading causes of childhood morbidity and mortality in the developing world. Diarrheagenic Escherichia coli (DEC) has been identified as a major etiologic agent of diarrhea worldwide, and urinary tract infection (UTI) caused by uropathogenic Escherichia coli (UPEC) is one of the most common bacterial infections among human beings. Quick and precise detection of these bacteria help provide more effective intervention and management of infection. Objectives: In this study we present a precise and sensitive typing and phylogenetic study of UPEC and DEC using multiplex PCR in order to simplify and improve the intervention and management of diarrheal and UT infections. Materials and Methods: In total, 100 urinary tract infection samples (UTI) and 200 specimens from children with diarrhea, which had been diagnosed with E. coli as the underlying agent by differential diagnosis using MacConkey’s agar and biochemical study, were submitted for molecular detection. Pathotyping of E. coli pathotypes causing urinary tract infection and diarrhea were examined using a two set multiplex PCR, targeting six specific genes. Phylogenetic typing was done by targeting three genes, including ChuA, YjaA and TspE4C2. Results: Overall, 88% of DEC and 54% of UTI isolates were positive for one or more of the six genes encoding virulence factors. Prevalence of the genes encoding virulence factors for DEC were 62%, 25%, 24%, 13%, 7% and 5% for ST (ETEC), LT (ETEC), aggR (EAggEC), daaD (DAEC), invE (EIEC) and eae (EPEC), respectively; whereas, the prevalence rates for the UTI samples were 23%, 14%, 6%, 6% and 4% for aggR (EAggEC), LT (ETEC), daaD (DAEC), invE (EIEC) and ST (ETEC), respectively. No coding virulence factors were detected for eae (EPEC). Group B2 was the most prevalent phylogroup and ST was the most frequently detected pathotype in all phylogroups. Conclusions: ETEC and EAggEC were the most detected E. coli among

  11. The past, present and future tasks of Hungarian dendrological research.

    PubMed

    Bartha, D

    2010-01-01

    species classified into aggregate species (e.g. Quercus petraea agg., Qu. pubescens agg.); v) take intraspecific taxa according to various ecological demands, area, morphological differences into consideration; vi) culture variations cannot be treat as an equal with the species (e.g. Populus spp., Salix spp.); vii) natural ↔ artificial area have to be separated; viii) lend a helping hand in getting taxonomical knowledge of hardly known dendrotaxa.

  12. Ecology and behavior of Pezothrips kellyanus (Thysanoptera: Thripidae) on citrus.

    PubMed

    Vassiliou, V A

    2010-02-01

    The most common thrips species found in Cyprus citrus orchards between 2003 and 2008 were Pezothrips kellyanus (Bagnall) (Thysanoptera: Thripidae), Frankliniella occidentalis (Pergande) (Thysanoptera: Thripidae), and Thrips tabaci (Lindeman) (Thysanoptera: Thripidae). Only Pezothrips kellyanus, Kelly's citrus thrips (KCT) causes feeding damage on citrus fruits in Cyprus. KCT adults prefer to concentrate mostly in the northern and eastern sides of both lemon and grapefruit canopies. The attractiveness of white, sky blue, marine blue, and yellow color to KCT was evaluated. White was found to be the most attractive color to adults of KCT, F. occidentalis, and T. tabaci. A range of incidental and breeding host plants grown within and outside citrus orchards in Cyprus were identified. KCT adults were found on flowers of all citrus varieties, and various other flowering plants including Malva nicaeensis, Malva silvestris, Sinapis alba, Oxalis pes-caprae, Calendula arvensis, Urospermum picroides, Jasminum officinale, Gardenia jasminoides, Jasminum sambac, Prunus dulcis, Mangifera indica, Persea americana, and Eriobotrya japonica. KCT larvae were found only on lemon, grapefruit, Jasmine spp., and Gardenia flowers. PMID:20214367

  13. Ethnobotanical survey of the medicinal flora used by the Caribs of Guatemala.

    PubMed

    Girón, L M; Freire, V; Alonzo, A; Cáceres, A

    1991-09-01

    An ethnobotanical survey was conducted among the Carib population of Guatemala in 1988-1989. In general terms, the sample surveyed possessed a relatively good standard of living. Results indicated that health services were utilized by the population, and that domestic medicine, mainly plants (96.9%) was used by 15% of the population. One hundred and nineteen plants used for medicinal purposes were collected, of which 102 (85.7%) could be identified; a list of these together with the information provided for each plant is presented. The most frequently reported plants used as medicine are: Acalypha arvensis, Cassia alata, Cymbopogon citratus, Melampodium divaricatum. Momordica charantia, Neurolaena lobata, Ocimum basilicum, Petiveria alliacea and Solanum nigrescens. Most of these plants are found in the region, but some are brought from the Highlands or outside of the country, such as Malva parviflora, Matricaria chamomilla, Peumus boldus, Pimpinella anisum, Rosmarinus officinalis and Tagetes lucida. This survey demonstrated that the Carib population of Guatemala has survived in a transcultural environment of African and native Amerindian beliefs. PMID:1795521

  14. Dark/Light Modulation of Ribulose Bisphosphate Carboxylase Activity in Plants from Different Photosynthetic Categories 1

    PubMed Central

    Vu, J. Cu V.; Allen, Leon H.; Bowes, George

    1984-01-01

    Ribulose bisphosphate carboxylase/oxygenase (RuBPCase) from several plants had substantially greater activity in extracts from lightexposed leaves than dark leaves, even when the extracts were incubated in vitro with saturating HCO3− and Mg2+ concentrations. This occurred in Glycine max, Lycopersicon esculentum, Nicotiana tabacum, Panicum bisulcatum, and P. hylaeicum (C3); P. maximum (C4 phosphoenolpyruvate carboxykinase); P. milioides (C3/C4); and Bromelia pinguin and Ananas comosus (Crassulacean acid metabolism). Little or no difference between light and dark leaf extracts of RuBPCase was observed in Triticum aestivum (C3); P. miliaceum (C4 NAD malic enzyme); Zea mays and Sorghum bicolor (C4 NADP malic enzyme); Moricandia arvensis (C3/C4); and Hydrilla verticillata (submersed aquatic macrophyte). It is concluded that, in many plants, especially Crassulacean acid metabolism and C3 species, a large fraction of ribulose-1,5-bisphosphate carboxylase/oxygenase in the dark is in an inactivatable state that cannot respond to CO2 and Mg2+ activation, but which can be converted to an activatable state upon exposure of the leaf to light. PMID:16663937

  15. Dark/Light modulation of ribulose bisphosphate carboxylase activity in plants from different photosynthetic categories.

    PubMed

    Vu, J C; Allen, L H; Bowes, G

    1984-11-01

    Ribulose bisphosphate carboxylase/oxygenase (RuBPCase) from several plants had substantially greater activity in extracts from lightexposed leaves than dark leaves, even when the extracts were incubated in vitro with saturating HCO(3) (-) and Mg(2+) concentrations. This occurred in Glycine max, Lycopersicon esculentum, Nicotiana tabacum, Panicum bisulcatum, and P. hylaeicum (C(3)); P. maximum (C(4) phosphoenolpyruvate carboxykinase); P. milioides (C(3)/C(4)); and Bromelia pinguin and Ananas comosus (Crassulacean acid metabolism). Little or no difference between light and dark leaf extracts of RuBPCase was observed in Triticum aestivum (C(3)); P. miliaceum (C(4) NAD malic enzyme); Zea mays and Sorghum bicolor (C(4) NADP malic enzyme); Moricandia arvensis (C(3)/C(4)); and Hydrilla verticillata (submersed aquatic macrophyte). It is concluded that, in many plants, especially Crassulacean acid metabolism and C(3) species, a large fraction of ribulose-1,5-bisphosphate carboxylase/oxygenase in the dark is in an inactivatable state that cannot respond to CO(2) and Mg(2+) activation, but which can be converted to an activatable state upon exposure of the leaf to light.

  16. Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.

    PubMed

    Gonçalves, Ana Z; Oliveira, Rafael S; Oliveira, Paulo S; Romero, Gustavo Q

    2016-01-01

    Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N) and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites) on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri) improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth). On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments.

  17. Molecular investigations of the soil, rhizosphere and transgenic glufosinate-resistant rape and maize plants in combination with herbicide (Basta) application under field conditions.

    PubMed

    Ernst, Dieter; Rosenbrock-Krestel, Hilkea; Kirchhof, Gudrun; Bieber, Evi; Giunaschwili, Nathela; Müller, Rüdiger; Fischbeck, Gerhard; Wagner, Tobias; Sandermann, Heinrich; Hartmann, Anton

    2008-01-01

    A field study was conducted during 1994 to 1998 on the Experimental Farm Roggenstein, near Fürstenfeldbruck, Bavaria, Germany to determine the effect of transgenic glufosinate-resistant rape in combination with the herbicide Basta [glufosinate-ammonium, phosphinothricin, ammonium (2RS)-2-amino-4-(methylphosphinato) butyric acid] application on soil microorganisms and the behaviour of the synthetic transgenic DNA in response to normal agricultural practice. No influence of Basta on microbial biomass could be detected. The phospholipid fatty acid analysis of soil extracts showed no difference between Basta application and mechanical weed control, whereas conventional herbicide application revealed a different pattern. Basta application resulted in a changed population of weeds with a selective effect for Viola arvensis. During senescence, transgenic rape DNA was degraded similar to endogenous control DNA. After ploughing the chopped plant material in the soil, transgenic as well as endogenous control DNA sequences could be detected for up to 4 weeks for rape and up to 7 months for maize, whereas PCR analysis of composted transgenic maize revealed the presence of the transgene over a period of 22 months.

  18. Evolution of SINE S1 retroposons in Cruciferae plant species.

    PubMed

    Lenoir, A; Cournoyer, B; Warwick, S; Picard, G; Deragon, J M

    1997-09-01

    The S1 element is a plant short interspersed element (SINE) that was first described and studied in Brassica napus. In this work, we investigated the distribution and the molecular phylogeny of the S1 element within the Cruciferae (= Brassicaceae). S1 elements were found to be widely distributed within the Cruciferae, especially in species of the tribe Brassiceae. The molecular phylogeny of S1 elements in eight Cruciferae species (Brassica oleracea, Brassica rapa, Brassica napus, Brassica nigra, Sinapis, arvensis, Sinapis pubescens, Coincya monensis, and Vella spinosa) was inferred using 14-36 elements per species. Significant neighbor-joining and maximum-parsimony phylogenetic clusters, supported by high bootstrap P values and/or represented in 100% of the most-parsimonious trees, were observed for each species. Most of these clusters probably correspond to recent species-specific bursts of S1 amplification. Since these species diverged recently, S1 amplification in Cruciferae plants is proposed to be a highly dynamic process that could contribute to genome rearrangements and eventually lead to reproductive isolation. S1 sequence analysis also revealed putative gene conversion events that occurred between different S1 elements of a given species. These events suggest that gene conversion is a minor but significant component of the molecular drive governing S1 concerted evolution.

  19. Integrating Insect Life History and Food Plant Phenology: Flexible Maternal Choice Is Adaptive.

    PubMed

    Fei, Minghui; Harvey, Jeffrey A; Weldegergis, Berhane T; Huang, Tzeyi; Reijngoudt, Kimmy; Vet, Louise M; Gols, Rieta

    2016-01-01

    Experience of insect herbivores and their natural enemies in the natal habitat is considered to affect their likelihood of accepting a similar habitat or plant/host during dispersal. Growing phenology of food plants and the number of generations in the insects further determines lability of insect behavioural responses at eclosion. We studied the effect of rearing history on oviposition preference in a multivoltine herbivore (Pieris brassicae), and foraging behaviour in the endoparasitoid wasp (Cotesia glomerata) a specialist enemy of P. brassicae. Different generations of the insects are obligatorily associated with different plants in the Brassicaceae, e.g., Brassica rapa, Brassica nigra and Sinapis arvensis, exhibiting different seasonal phenologies in The Netherlands. Food plant preference of adults was examined when the insects had been reared on each of the three plant species for one generation. Rearing history only marginally affected oviposition preference of P. brassicae butterflies, but they never preferred the plant on which they had been reared. C. glomerata had a clear preference for host-infested B. rapa plants, irrespective of rearing history. Higher levels of the glucosinolate breakdown product 3-butenyl isothiocyanate in the headspace of B. rapa plants could explain enhanced attractiveness. Our results reveal the potential importance of flexible plant choice for female multivoltine insects in nature.

  20. Evolution of mustard (Brassica juncea Coss) subspecies in China: evidence from the chalcone synthase gene.

    PubMed

    Chen, F B; Liu, H F; Yao, Q L; Fang, P

    2016-01-01

    To explore the phylogenetic relationship, genome donor, and evolutionary history of the polyploid mustard (Brassica juncea) from China, eighty-one sequences of the chalcone synthase gene (Chs) were analyzed in 43 individuals, including 34 B. juncea, 2 B. rapa, 1 B. nigra, 2 B. oleracea, 1 B. napus, 1 B. carinata, and 2 Raphanus sativus. A maximum likelihood analysis showed that sequences from B. juncea were separated into two well-supported groups in accordance with the A and B genomes, whereas the traditional phenotypic classification of B. juncea was not wholly supported by the molecular results. The SplitsTree analysis recognized four distinct groups of Brassicaceae, and the median-joining network analysis recognized four distinct haplotypes of Chs. The estimates of Tajima's D, Fu and Li's D, and Fu and Li's F statistic for the Chs gene in the B genome were negative, while those in the A genome were significant. The results indicated that 1) the Chs sequences revealed a high level of sequence variation in Chinese mustard, 2) both tree and reticulate evolutions existed, and artificial selection played an important role in the evolution of Chinese mustard, 3) the original parental species of Chinese mustard are B. rapa var. sinapis arvensis and B. nigra (derived from China), 4) nucleotide variation in the B genome was higher than that in the A genome, and 5) cultivated mustard evolved from wild mustard, and China is one of the primary origins of B. juncea.

  1. Phylogenetic analysis of Brassiceae based on the nucleotide sequences of the S-locus related gene, SLR1.

    PubMed

    Inaba, Ryuichi; Nishio, Takeshi

    2002-12-01

    Nucleotide sequences of orthologs of the S-locus related gene, SLR1, in 20 species of Brassicaceae were determined and compared with the previously reported SLR1 sequences of six species. Identities of deduced amino-acid sequences with Brassica oleracea SLR1 ranged from 66.0% to 97.6%, and those with B. oleracea SRK and SLR2 were less than 62% and 55%, respectively. In multiple alignment of deduced amino-acid sequences, the 180-190th amino-acid residues from the initial methionine were highly variable, this variable region corresponding to hypervariable region I of SLG and SRK. A phylogenetic tree based on the deduced amino-acid sequences showed a close relationship of SLR1 orthologs of species in the Brassicinae and Raphaninae. Brassica nigra SLR1 was found to belong to the same clade as Sinapis arvensis and Diplotaxis siifolia, while the sequences of the other Brassica species belonged to another clade together with B. oleracea and Brassica rapa. The phylogenetic tree was similar to previously reported trees constructed using the data of electrophoretic band patterns of chloroplast DNA, though minor differences were found. Based on synonymous substitution rates in SLR1, the diversification time of SLR1 orthologs between species in the Brassicinae was estimated. The evolution and function of SLR1 and the phylogenetic relationship of Brassiceae plants are discussed.

  2. Proteolytic removal of the C-terminal transmembrane region of cytochrome f during extraction from turnip and charlock leaves generates a water-soluble monomeric form of the protein.

    PubMed

    Gray, J C; Rochford, R J; Packman, L C

    1994-07-15

    Water-soluble, monomeric cytochrome f purified from leaves of turnip (Brassica rapa) and charlock (Sinapis arvensis) is approximately 3 kDa smaller than the protein in chloroplast thylakoid membranes determined by SDS/PAGE. Sequencing the N-terminal and C-terminal regions of the monomeric protein, by automated Edman degradation and carboxypeptidase P digestion, suggested the loss of 33 amino acid residues at the C-terminus by comparison to sequences of cytochrome f from other higher plants. This was confirmed by the isolation and nucleotide sequencing of the turnip petA gene and by determination of the molecular mass of the monomeric turnip protein by electrospray mass spectrometry. The turnip petA gene encodes a protein of 320 amino acid residues consisting of a presequence of 35 amino acid residues and a mature protein of 285 amino acid residues. The molecular mass of the monomeric turnip protein was 28,160.2 +/- 5.4 Da, indicating cleavage after Gln252 of the mature protein. Electrospray mass spectrometry of the monomeric charlock protein indicated the presence of two main forms with molecular masses of 28,135.1 +/- 5.5 Da and 27,750.7 +/- 4.3 Da corresponding to cleavage after Gln252 and Leu249, respectively. Cleavage in this region of the cytochrome f polypeptide during extraction with butanone removes the single transmembrane span of the protein and liberates the water-soluble globular domain of cytochrome f.

  3. Inheritance and expression patterns of BN28, a low temperature induced gene in Brassica napus, throughout the Brassicaceae.

    PubMed

    Hawkins, G P; Nykiforuk, C L; Johnson-Flanagan, A M; Boothe, J G

    1996-08-01

    Molecular genetics is becoming an important tool in the breeding and selection of agronomically important traits. BN28 is a low temperature induced gene in Brassicaceae species. PCR and Southern blot analysis indicate that BN28 is polymorphic in the three diploid genomes: Brassica rapa (AA), Brassica nigra (BB), and Brassica oleracea (CC). Of the allotetraploids, Brassica napus (AACC) is the only species to have inherited homologous genes from both parental genomes. Brassica juncea (AABB) and Brassica carinata (BBCC) have inherited homologues from the AA and CC genomes, respectively, while Sinapsis arvensis (SS) contains a single homologue from the BB genome and Sinapsis alba (dd) appears to be different from all the diploid parents. All species show message induction when exposed to low temperature. However, differences in expression were noticed at the protein level, with silencing occurring in the BB genome at the level of translation. Results suggest that silencing is occurring in diploid species where duplication may not have occurred. Molecular characterization and inheritance of BN28 homologues in the Brassicaceae may play an important role in determining their quantitative function during exposure to low temperature. Key words : Brassicaceae, BN28, inheritance, polymorphism.

  4. Cell Wall Regeneration around Protoplasts Isolated from Convolvulus Tissue Culture 1

    PubMed Central

    Horine, Randall K.; Ruesink, Albert W.

    1972-01-01

    Protoplasts of Convolvulus arvensis L. tissue culture regenerated a wall-like structure within 3 days in culture. Although unusually electron dense and atypically amorphous in the electron microscope, this structure could be digested with Myrothecium cellulase but was resistant to protease, a Rohm and Haas pectinase, and a β-1, 3-exoglucanase just like the original wall. A cytochemical test for callose was negative. Wall regeneration required a readily metabolized external carbon source and was not inhibited by a high concentration of cycloheximide, puromycin, or actinomycin D. Protoplast budding was correlated with the wall regeneration, and the latter was related quantitatively to the sucrose concentration in the medium. Although a concentration of 1 μm 2,4-dichlorophenoxy acetic acid is used normally for both general culture of the tissue and for wall regeneration, concentrations of 0 and 0.1 mm, which are highly deleterious to growth, have no appreciable effect on the incidence of the wall-like structure regenerated around protoplasts. The ability of protoplasts to undergo cell wall regeneration was decreased when they were cultured in the presence of proteolytic enzymes. Images PMID:16658192

  5. Chemopreventive effect of a mixture of Chinese Herbs (antitumor B) on chemically induced oral carcinogenesis.

    PubMed

    Wang, Yian; Yao, Ruisheng; Gao, Song; Wen, Weidong; Du, Yinqiu; Szabo, Eva; Hu, Ming; Lubet, Ronald A; You, Ming

    2013-01-01

    In this study, we evaluated chemopreventive efficacy of Antitumor B, a Chinese herbal mixture of six plants (Sophora tonkinensis, Polygonum bistorta, Prunella vulgaris, Sonchus arvensis L., Dictamnus dasycarpus, and Dioscorea bulbifera) on the development of 4-nitroquinoline-1-oxide (4NQO) induced oral squamous cell carcinomas in A/J mice. Antitumor B, delivered through diet, inhibited 4NQO-induced oral cancer development by 59.19%. The reduction of cell proliferation appears to be associated with efficacy of Antitumor B against 4NQO-induced oral cancer in A/J mice. The expression of epidermal growth factor receptor (EGFR) and phosphorylated EGFR (Tyr1173) were down-regulated by Antitumor B. Tissue distribution of Antitumor B was determined using obacunone, matrine, and maackiain as marker chemicals. We found significant amounts of obacunone, matrine, and maackiain in the blood after 1-wk treatment. The concentrations of these three compounds did not increase further at 18  wk, suggesting that plasma concentrations had reached a steady-state level at 1  wk. There was no significant body weight loss and there was no other obvious sign of toxicity in Antitumor B-treated mice. These results suggest that Antitumor B is a promising agent for human oral cancer chemoprevention. PMID:22086836

  6. The clinical differentiation of nervous and muscular locomotor disorders of sheep in Australia.

    PubMed

    Bourke, C A

    1995-06-01

    Many of the nervous and muscular locomotor disorders that affect sheep throughout Australia are commonly referred to as "staggers" syndromes. The range of clinical signs displayed by sheep suffering these disorders is sufficiently diverse to enable each syndrome to be graded into one of 5 progressive clinical groups. The first group, the limb paresis syndromes, includes the primary myopathies associated with the ingestion of Ixiolaena brevicompta, Malva parviflora, and Trachymene ochracea, as well as selenium and Vitamin E disorders, Paroo virus staggers, congenital progressive muscular dystrophy, humpy back, hypocalcaemic muscle weakness, Tribulus terrestris staggers and tetanus. The second group is characterised by limb paresis with knuckling of the fetlocks, and includes the plant-associated toxicities of Romulea rosea, Stachys arvensis, Trachyandra divaricata, and Tribulus micrococcus, together with haloxon toxicity, enzootic ataxia (copper deficiency), and the probably genetic disorders of segmental axonopathy, neuroaxonal dystrophy, and degenerative thoracic myelopathy. Other locomotor disorders that fit more loosely into this group are listerial myelitis (post-dipping staggers), vitamin A deficiency, cervico-thoracic vertebral subluxation Stypandra glauca toxicity, Ipomoea spp toxicity, ivermectin toxicity, and botulism. The third group, the falling syndromes, includes the probably genetic disorders of thalamic cerebellar neuropathy, cerebellar abiotrophy, and globoid cell leucodystrophy, together with Swainsona spp toxicity. The fourth group, the falling syndromes, includes the plant associated toxicities of phalaris staggers, perennial rye grass staggers and nervous ergotism (Claviceps paspali).(ABSTRACT TRUNCATED AT 250 WORDS)

  7. Evaluation of native plant flower characteristics for conservation biological control of Prays oleae.

    PubMed

    Nave, A; Gonçalves, F; Crespí, A L; Campos, M; Torres, L

    2016-04-01

    Several studies have shown that manipulating flowering weeds within an agroecosystem can have an important role in pest control by natural enemies, by providing them nectar and pollen, which are significant sources of nutrition for adults. The aim of this study was to assess if the olive moth, Prays oleae (Bernard, 1788) (Lepidoptera: Praydidae), and five of its main natural enemies, the parasitoid species Chelonus elaeaphilus Silvestri (Hymenoptera: Braconidae), Apanteles xanthostigma (Haliday) (Hymenoptera: Braconidae), Ageniaspis fuscicollis (Dalman) (Hymenoptera: Encyrtidae) and Elasmus flabellatus (Fonscolombe) (Hymenoptera: Eulophidae), as well as the predator Chrysoperla carnea (Stephens) (Neuroptera: Chrysopidae), can theoretically access the nectar from 21 flowering weeds that naturally occur in olive groves. Thus, the architecture of the flowers as well as the mouthpart structure and/or the head and thorax width of the pest and its enemies were analyzed. The results suggested that all beneficial insects were able to reach nectar of the plant species from Apiaceae family, i.e. Conopodium majus (Gouan) Loret, Daucus carota L. and Foeniculum vulgare Mill., as well as Asparagus acutifolius L., Echium plantagineum L., Capsella bursa-pastoris (L.) Medik., Raphanus raphanistrum L., Lonicera hispanica Boiss. et Reut., Silene gallica L., Spergula arvensis L., Hypericum perforatum L., Calamintha baetica Boiss. et Reut, Malva neglecta Wallr. and Linaria saxatilis (L.) Chaz. P. oleae was not able to access nectar from five plant species, namely: Andryala integrifolia L., Chondrilla juncea L., Dittrichia viscosa (L.) Greuter, Sonchus asper (L.) Hill and Lavandula stoechas L. PMID:26780918

  8. Formulation Design and Development of a Unani Transdermal Patch for Antiemetic Therapy and Its Pharmaceutical Evaluation

    PubMed Central

    Idris, Mohammad

    2016-01-01

    The Transdermal Drug Delivery System (TDDS) is one of the novel routes for systemic delivery of drugs through intact skin. A transdermal patch (TP) is a medicated patch that is placed on skin for delivery of medication through skin into the blood stream. The aim of present study was to formulate and evaluate a Unani transdermal patch that could be used for antiemetic therapy. The incorporation of Unani ingredients, namely, Khardal (Brassica nigra), Zanjabeel (Zingiber officinale), Podina (Mentha arvensis), and Sirka (Vinegar) were envisaged. The TP was prepared by solvent evaporation technique and was evaluated for organoleptic characteristics and other physicochemical properties, such as thickness, weight uniformity, folding endurance, moisture content, drug content, and tolerability and acceptability of patch. The in vitro permeation study of the patch was carried out through Franz diffusion cell using egg shell membrane as barrier membrane. Phosphate buffer pH 7.4 was used as dissolution medium and the temperature was maintained at 37 ± 1°C. The in vitro permeation study of the prepared TP indicated a time dependent increase in drug release throughout the study. The percentage of cumulative drug release was found to be 77.38% in 24 hours. The study shows a new approach to work in Unani pharmaceutics. PMID:27403377

  9. Assessment of the Food Habits of the Moroccan Dorcas Gazelle in M’Sabih Talaa, West Central Morocco, Using the trnL Approach

    PubMed Central

    Ait Baamrane, Moulay Abdeljalil; Shehzad, Wasim; Ouhammou, Ahmed; Abbad, Abdelaziz; Naimi, Mohamed; Coissac, Eric; Taberlet, Pierre; Znari, Mohammed

    2012-01-01

    Food habits of the Moroccan dorcas gazelle, Gazella dorcas massaesyla, previously investigated in the 1980s using microhistological fecal analysis, in the M’Sabih Talaa Reserve, west central Morocco, were re-evaluated over three seasons (spring, summer and autumn 2009) using the trnL approach to determine the diet composition and its seasonal variation from fecal samples. Taxonomic identification was carried out using the identification originating from the database built from EMBL and the list of plant species within the reserve. The total taxonomic richness in the reserve was 130 instead of 171 species in the 1980s. The diet composition revealed to be much more diversified (71 plant taxa belonging to 57 genus and 29 families) than it was 22 years ago (29 identified taxa). Thirty-four taxa were newly identified in the diet while 13 reported in 1986–87 were not found. Moroccan dorcas gazelle showed a high preference to Acacia gummifera, Anagallis arvensis, Glebionis coronaria, Cladanthus arabicus, Diplotaxis tenuisiliqua, Erodium salzmannii, Limonium thouini, Lotus arenarius and Zizyphus lotus. Seasonal variations occurred in both number (40–41 taxa in spring-summer and 49 taxa in autumn vs. respectively 23–22 and 26 in 1986–1987) and taxonomic type of eaten plant taxa. This dietary diversification could be attributed either to the difference in methods of analysis, trnL approach having a higher taxonomic resolution, or a potential change in nutritional quality of plants over time. PMID:22558187

  10. Chemical composition and biological activity of the essential oil of Origanum vulgare ssp. hirtum from different areas in the Southern Apennines (Italy).

    PubMed

    Mancini, Emilia; Camele, Ippolito; Elshafie, Hazem S; De Martino, Laura; Pellegrino, Carlo; Grulova, Daniela; De Feo, Vincenzo

    2014-04-01

    The chemical composition of the essential oils of Origanum vulgare ssp. hirtum, growing wild in three different localities in the Southern Apennines, was studied by GC-FID and GC/MS analyses. In total, 103 compounds were identified. The oils were mainly composed of phenolic compounds and all oils belonged to the chemotype carvacrol/thymol. The three essential oils were evaluated for their in vitro phytotoxic activity by determining their influence on the germination and initial radicle elongation of Sinapis arvensis L., Phalaris canariensis L., Lepidium sativum L., and Raphanus sativus L. The seed germination and radicle growth were affected in various degrees. Moreover, the antifungal activity of the three essential oils was assayed against three species causing pre- and postharvest fruit decay (Monilinia laxa, M. fructigena, and M. fructicola). At 1000 ppm, the three oils completely inhibited fungal growth. The hemolytic activity of the oils was assayed and showed no effect on the cell membranes of bovine erythrocytes. PMID:24706631

  11. Integrating Insect Life History and Food Plant Phenology: Flexible Maternal Choice Is Adaptive

    PubMed Central

    Fei, Minghui; Harvey, Jeffrey A.; Weldegergis, Berhane T.; Huang, Tzeyi; Reijngoudt, Kimmy; Vet, Louise M.; Gols, Rieta

    2016-01-01

    Experience of insect herbivores and their natural enemies in the natal habitat is considered to affect their likelihood of accepting a similar habitat or plant/host during dispersal. Growing phenology of food plants and the number of generations in the insects further determines lability of insect behavioural responses at eclosion. We studied the effect of rearing history on oviposition preference in a multivoltine herbivore (Pieris brassicae), and foraging behaviour in the endoparasitoid wasp (Cotesia glomerata) a specialist enemy of P. brassicae. Different generations of the insects are obligatorily associated with different plants in the Brassicaceae, e.g., Brassica rapa, Brassica nigra and Sinapis arvensis, exhibiting different seasonal phenologies in The Netherlands. Food plant preference of adults was examined when the insects had been reared on each of the three plant species for one generation. Rearing history only marginally affected oviposition preference of P. brassicae butterflies, but they never preferred the plant on which they had been reared. C. glomerata had a clear preference for host-infested B. rapa plants, irrespective of rearing history. Higher levels of the glucosinolate breakdown product 3-butenyl isothiocyanate in the headspace of B. rapa plants could explain enhanced attractiveness. Our results reveal the potential importance of flexible plant choice for female multivoltine insects in nature. PMID:27527153

  12. A role for ethylene in the metabolism of cyanide by higher plants.

    PubMed

    Goudey, J S; Tittle, F L; Spencer, M S

    1989-04-01

    The action of ethylene on the capacity of plant tissues to metabolize cyanide to beta-cyanoalanine was examined. Beta-cyanoalanine synthase (EC 4.4.1.9) catalyzes the reaction between cyanide and cysteine to form beta-cyanoalanine and hydrogen sulfide. Levels of beta-cyanoalanine synthase activity in tissues of 6 day old etiolated pea (Pisum sativum) seedlings were enhanced severalfold by 1 microliter per liter ethylene. The promotive effect of ethylene increased with increasing ethylene concentrations from 0.01 to 100 microliters per liter and with the period of exposure from 3 to 24 hours. Ethylene enhanced beta-cyanoalanine synthase activity in all regions of the seedling (shoots and roots, internodal regions, cotyledons). The promotive effect was eliminated by norbornadiene, a competitive inhibitor of ethylene action. Levels of beta-cyanoalanine synthase in seedlings of four other dicots (Phaseolus aureas, Glycine max, Lactuca sativa, Sinapis arvensis) and two monocots (Hordeum vulgares, Triticum aestivum) were also increased in response to ethylene. Our results suggest an important regulatory role for ethylene in the metabolism of cyanide by higher plants.

  13. A Role for Ethylene in the Metabolism of Cyanide by Higher Plants 1

    PubMed Central

    Goudey, J. Stephen; Tittle, Forrest L.; Spencer, Mary S.

    1989-01-01

    The action of ethylene on the capacity of plant tissues to metabolize cyanide to β-cyanoalanine was examined. Beta-cyanoalanine synthase (EC 4.4.1.9) catalyzes the reaction between cyanide and cysteine to form β-cyanoalanine and hydrogen sulfide. Levels of β-cyanoalanine synthase activity in tissues of 6 day old etiolated pea (Pisum sativum) seedlings were enhanced severalfold by 1 microliter per liter ethylene. The promotive effect of ethylene increased with increasing ethylene concentrations from 0.01 to 100 microliters per liter and with the period of exposure from 3 to 24 hours. Ethylene enhanced β-cyanoalanine synthase activity in all regions of the seedling (shoots and roots, internodal regions, cotyledons). The promotive effect was eliminated by norbornadiene, a competitive inhibitor of ethylene action. Levels of β-cyanoalanine synthase in seedlings of four other dicots (Phaseolus aureas, Glycine max, Lactuca sativa, Sinapis arvensis) and two monocots (Hordeum vulgares, Triticum aestivum) were also increased in response to ethylene. Our results suggest an important regulatory role for ethylene in the metabolism of cyanide by higher plants. PMID:16666701

  14. Performance of Spodoptera litura Fabricius on different host plants: influence of nitrogen and total phenolics of plants and mid-gut esterase activity of the insect.

    PubMed

    Ghumare, S S; Mukherjee, S N

    2003-08-01

    Five host plants [castor, Ricinus communis (Carolus Linnaeus); cotton, Gossypium hirsutm (Carolus Linnaeus); tomato, Lycopersicum esculentum (Philip Miller); mint, Mentha arvensis (Carolus Linnaeus) and cabbage, Brassica oleracea (Carolus Linnaeus)] belonging to different families were used to study the performance of the Asian armyworm, Spodoptera litura larvae. Highest consumption of food and dry weight gain was observed in larvae fed on castor. Mint did not support optimum larval growth because of low digestibility and low efficiency of conversion of digested food to body matter. Dry weight gain ranged from 26.64 mg on mint to 86.80 mg in castor. These differences tend to be related to nitrogen and total phenolics content of the leaf tissues; however, the most clear-cut correlation is an inverse one between the host plant preference and the ratio of total phenolics to nitrogen in the leaf tissues. Mid-gut esterase activity in larvae showed an increasing trend with the increase in total phenolics: nitrogen ratio in the test plants and the order of mid-gut esterase activity in larvae was mint > cabbage > cotton > tomato > castor.

  15. Formulation Design and Development of a Unani Transdermal Patch for Antiemetic Therapy and Its Pharmaceutical Evaluation.

    PubMed

    Saleem, Mohd Nauman; Idris, Mohammad

    2016-01-01

    The Transdermal Drug Delivery System (TDDS) is one of the novel routes for systemic delivery of drugs through intact skin. A transdermal patch (TP) is a medicated patch that is placed on skin for delivery of medication through skin into the blood stream. The aim of present study was to formulate and evaluate a Unani transdermal patch that could be used for antiemetic therapy. The incorporation of Unani ingredients, namely, Khardal (Brassica nigra), Zanjabeel (Zingiber officinale), Podina (Mentha arvensis), and Sirka (Vinegar) were envisaged. The TP was prepared by solvent evaporation technique and was evaluated for organoleptic characteristics and other physicochemical properties, such as thickness, weight uniformity, folding endurance, moisture content, drug content, and tolerability and acceptability of patch. The in vitro permeation study of the patch was carried out through Franz diffusion cell using egg shell membrane as barrier membrane. Phosphate buffer pH 7.4 was used as dissolution medium and the temperature was maintained at 37 ± 1°C. The in vitro permeation study of the prepared TP indicated a time dependent increase in drug release throughout the study. The percentage of cumulative drug release was found to be 77.38% in 24 hours. The study shows a new approach to work in Unani pharmaceutics. PMID:27403377

  16. Chemical composition and biological activities of the essential oil from Artemisia herba-alba growing wild in Tunisia.

    PubMed

    Amri, Ismail; De Martino, Laura; Marandino, Aurelio; Lamia, Hamrouni; Mohsen, Hanana; Scandolera, Elia; De Feo, Vincenzo; Mancini, Emilia

    2013-03-01

    Aromatic plants can interfere in the Mediterranean ecosystem, mainly by the introduction in the environment of volatile compounds. For this reason, we studied the chemical composition and the possible phytotoxic and antimicrobial activities of the essential oil extracted from leaves of Tunisian Artemisia herba-alba Asso. The chemical composition of the essential oil, obtained by hydrodistillation, was analyzed by GC and GC-MS. In all, 24 compounds were identified. The main components were camphor (39.1%), chrysanthenone (15.0%) and cis-thujone (7.8%). The essential oil was evaluated for its in vitro phytotoxic activity against germination and initial radical growth of Raphanus sativus L., Lepidium sativum L., Sinapis arvensis L., Triticum durum L. and Phalaris canariensis L. seeds. The radicle elongation of the five seeds was affected to different extents by the oil, while germination was not affected. The oil, when tested against eight selected bacterial strains, showed low antimicrobial activity. The chemical composition of the oil of A. herba-alba can help in the chemosystematics of this complex genus. However, the recorded biological activities seem to be neither ecologically nor medicinally significant.

  17. Crop-noncrop spillover: arable fields affect trophic interactions on wild plants in surrounding habitats.

    PubMed

    Gladbach, David J; Holzschuh, Andrea; Scherber, Christoph; Thies, Carsten; Dormann, Carsten F; Tscharntke, Teja

    2011-06-01

    Ecosystem processes in agricultural landscapes are often triggered by resource availability in crop and noncrop habitats. We investigated how oilseed rape (OSR; Brassica napus, Brassicaceae) affects noncrop plants in managed systems and semi-natural habitat, using trophic interactions among wild mustard (Sinapis arvensis, Brassicaceae), rape pollen beetles (Meligethes aeneus, Nitidulidae) and their parasitoids (Tersilochus heterocerus, Ichneumonidae). We exposed wild mustard as phytometer plants in two cropland habitat types (wheat field, field margin) and three noncrop habitat types (fallow, grassland, wood margin) across eight landscapes along a gradient from simple to complex (quantified as % arable land). Both landscape and local factors affected the abundance of rape pollen beetles and parasitoids. Rape pollen beetle infestation and parasitism rates on these plants were lower in noncrop habitats and higher in wheat fields and field margins, whereas beetles and parasitoids responded differently to landscape scale parameters. We found the hypothesized spillover from OSR crop onto wild plants in surrounding habitats only for parasitoids, but not for pollen beetles. Parasitism rates were not related to landscape simplification, but benefited from increasing proportions of OSR. In contrast, rape pollen beetles benefited from simple landscape structures, presumably due to multi-annual population build-ups resulting from long-term OSR planting (as part of the crop rotation). In conclusion, we showed that spillover from cropland affects parasitism rates on related wild plants outside cropland, which has not been shown so far, but can be expected to be a widespread effect shaping noncrop food webs.

  18. A betasatellite-dependent begomovirus infects ornamental rose: characterization of begomovirus infecting rose in Pakistan.

    PubMed

    Khatri, Sandeep; Nahid, Nazia; Fauquet, Claude M; Mubin, Muhammad; Nawaz-ul-Rehman, Muhammad Shah

    2014-08-01

    The Begomovirus genus of the family Geminiviridae comprises the largest group of geminiviruses. The list of begomoviruses is continuously increasing as a result of improvement in the methods for identification. Ornamental rose plants (Rosa chinensis) with highly stunted growth and leaf curling were found in Faisalabad, Pakistan. Plants were analyzed for begomovirus infection, through rolling circle amplification and PCR methods. Based on complete genome sequence homologies with other begomoviruses, a new begomovirus species infecting the rose plants was discovered. In this paper, we propose a new species name, Rose leaf curl virus (RoLCuV), for the virus. RoLCuV showed close identity (83 %) with Tomato leaf curl Pakistan virus, while associated betasatellite showed 96 % identity with Digera arvensis yellow vein betasatellite (DiAYVB), justifying a new isolate for the betasatellite. Recombination analysis of newly identified begomovirus revealed it as a recombinant of tomato leaf curl Pakistan virus from its coat protein region. The infectious molecules for virus/satellite were prepared and inoculated through Agrobacterium tumefaciens to N. benthamiana plants. RoLCuV alone was unable to induce any level of symptoms on N. benthamiana plants, but co-inoculation with cognate betasatellite produced infection symptoms. Further investigation to understand the trans-replication ability of betasatellites revealed their flexibility to interact with Rose leaf curl virus.

  19. Expression of Viola cyclotides by liquid chromatography-mass spectrometry and tandem mass spectrometry sequencing of intercysteine loops after introduction of charges and cleavage sites by aminoethylation.

    PubMed

    Göransson, Ulf; Broussalis, Adriana M; Claeson, Per

    2003-07-01

    The expression of cyclotides-macrocyclic plant peptides-was profiled in six violets, Viola cotyledon, V. biflora, V. arvensis, V. tricolor, V. riviniana, and V. odorata, by LC-MS. All were found to express notably complex mixtures, with single species containing >50 cyclotides. To facilitate their sequencing by MS-MS, an analytical strategy is presented involving aminoethylation of cysteines. This overcomes a number of problems intimately associated with the cyclotide core structure-that is, their joined N and C termini, disulfide knot, and low or clustered content of positively charged amino acids and enzymatic cleavage sites. As a result, charges as well as cleavage sites are introduced at the most conserved part of their sequence, the cysteines. Combined with tryptic digestion, all intercysteine loops are then of suitable size and charge for MS-MS sequencing. The utility of this strategy is shown by the sequencing of two novel cyclotides isolated from V. cotyledon; vico A (cyclo-(AESCVYIPCFTGIAGCSCKNKVCYYNGSIPC)) and vico B (cyclo-(AESCVYIPCITGIAGCSCKNKVCYYNGSIPC)); their complete sequence could be determined by nanospray MS-MS. The strategy for converting conserved cysteines to enzymatic cleavage sites might also benefit the study of other peptides and proteins displaying similar structural problems for MS analysis.

  20. Integrating Insect Life History and Food Plant Phenology: Flexible Maternal Choice Is Adaptive.

    PubMed

    Fei, Minghui; Harvey, Jeffrey A; Weldegergis, Berhane T; Huang, Tzeyi; Reijngoudt, Kimmy; Vet, Louise M; Gols, Rieta

    2016-01-01

    Experience of insect herbivores and their natural enemies in the natal habitat is considered to affect their likelihood of accepting a similar habitat or plant/host during dispersal. Growing phenology of food plants and the number of generations in the insects further determines lability of insect behavioural responses at eclosion. We studied the effect of rearing history on oviposition preference in a multivoltine herbivore (Pieris brassicae), and foraging behaviour in the endoparasitoid wasp (Cotesia glomerata) a specialist enemy of P. brassicae. Different generations of the insects are obligatorily associated with different plants in the Brassicaceae, e.g., Brassica rapa, Brassica nigra and Sinapis arvensis, exhibiting different seasonal phenologies in The Netherlands. Food plant preference of adults was examined when the insects had been reared on each of the three plant species for one generation. Rearing history only marginally affected oviposition preference of P. brassicae butterflies, but they never preferred the plant on which they had been reared. C. glomerata had a clear preference for host-infested B. rapa plants, irrespective of rearing history. Higher levels of the glucosinolate breakdown product 3-butenyl isothiocyanate in the headspace of B. rapa plants could explain enhanced attractiveness. Our results reveal the potential importance of flexible plant choice for female multivoltine insects in nature. PMID:27527153

  1. Linarin Inhibits the Acetylcholinesterase Activity In-vitro and Ex-vivo.

    PubMed

    Feng, Xinchi; Wang, Xin; Liu, Youping; Di, Xin

    2015-01-01

    Linarin is a flavone glycoside in the plants Flos chrysanthemi indici, Buddleja officinalis, Cirsium setosum, Mentha arvensis and Buddleja davidii, and has been reported to possess analgesic, antipyretic, anti-inflammatory and neuroprotective activities. In this paper, linarin was investigated for its AChE inhibitory potential both in-vitro and ex-vivo. Ellman's colorimetric method was used for the determination of AChE inhibitory activity in mouse brain. In-vitro assays revealed that linarin inhibited AChE activity with an IC50 of 3.801 ± 1.149 μM. Ex-vivo study showed that the AChE activity was significantly reduced in both the cortex and hippocampus of mice treated intraperitoneally with various doses of linarin (35, 70 and 140 mg/Kg). The inhibition effects produced by high dose of linarin were the same as that obtained after huperzine A treatment (0.5 mg/Kg). Molecular docking study revealed that both 4'-methoxyl group and 7-O-sugar moiety of linarin played important roles in ligand-receptor binding and thus they are mainly responsible for AChE inhibitory activity. In view of its potent AChE inhibitory activity, linarin may be a promising therapeutic agent for the treatment of some diseases associated with AChE, such as glaucoma, myasthenia gravis, gastric motility and Alzheimer's disease.

  2. Linarin Inhibits the Acetylcholinesterase Activity In-vitro and Ex-vivo

    PubMed Central

    Feng, Xinchi; Wang, Xin; Liu, Youping; Di, Xin

    2015-01-01

    Linarin is a flavone glycoside in the plants Flos chrysanthemi indici, Buddleja officinalis, Cirsium setosum, Mentha arvensis and Buddleja davidii, and has been reported to possess analgesic, antipyretic, anti-inflammatory and neuroprotective activities. In this paper, linarin was investigated for its AChE inhibitory potential both in-vitro and ex-vivo. Ellman’s colorimetric method was used for the determination of AChE inhibitory activity in mouse brain. In-vitro assays revealed that linarin inhibited AChE activity with an IC50 of 3.801 ± 1.149 μM. Ex-vivo study showed that the AChE activity was significantly reduced in both the cortex and hippocampus of mice treated intraperitoneally with various doses of linarin (35, 70 and 140 mg/Kg). The inhibition effects produced by high dose of linarin were the same as that obtained after huperzine A treatment (0.5 mg/Kg). Molecular docking study revealed that both 4’-methoxyl group and 7-O-sugar moiety of linarin played important roles in ligand-receptor binding and thus they are mainly responsible for AChE inhibitory activity. In view of its potent AChE inhibitory activity, linarin may be a promising therapeutic agent for the treatment of some diseases associated with AChE, such as glaucoma, myasthenia gravis, gastric motility and Alzheimer’s disease. PMID:26330885

  3. Effect of fertilization on the weediness of maize in a long-term field experiment.

    PubMed

    Kismányoky, A; Lehoczky, E; Kismányoky, T

    2006-01-01

    We carried our examination in a long-term fertilization field experiment in 2005. In the experiment we had opportunity to compare the weediness in NPK and NPK + FYM1 treatments, and we could study the effect of increasing N dosis on the weeds and maize. The bi-factorial trial was arranged in split plot design with three replications. The weed survey was made 25 days after seeding in the 27th of may. For the weed survey the Balázs-Ujvárosi method was applied. After the weed survey we collected all the weed species from the plots per 1-1 m2. We counted, mesured the fresh and dry matter weight of aerial shoots. We collected maize too, five pieces per plots. In the experiment were found 12 weed species, 9 annual: Abutilon theophrasti, Amaranthus chlorostachys, Ambrosia artemisiifolia, Chenopodium album, Chenopodium hybridum, Echinochloa crus-galli, Polygonum lapathifolium, Xantium strumarium, Veronica hederi-folia, and 3 perennial: Cirsium arvense, Convolvulus arvensis, Lathyrus tuberosus. On the NPK plots the Ch. album, on NPK + FYM treatments the A. theophrasti was the first in order of the dominance. The biomass production of weeds in the NPK + FYM treatments were 3 times higher than in the only NPK treatments. PMID:17390821

  4. Survey of microfungi in the Landschaftspark Duisburg-Nord (Germany).

    PubMed

    Jensen, M; Nerat, N; Ale-Agha, N

    2011-01-01

    During an excursion in the Landschaftspark Duisburg-Nord in 2009 and 2010 we were able to collect and identify more than 100 specimens of microfungi on different parts of cultivated and wild plant species. We found parasitic and saprophytic microfungi on trees, bushes and herbaceous plants. Some of them have been observed only rarely until now. Most of the collected microfungi species belong to the classes of Ascomycetes, Basidiomycetes and Deuteromycetes - for example Leptosphaeria modesta (Desm.) Rabenh. on Knautia cf. arvensis (L.) Coult., Ramularia urticae Ces. on Urtica dioica L., Stigmina glomerulosa (Sacc.) S. Hughes on Juniperus communis L., Pseudomassaria corni (Sowerby) Arx on Cornus alba L., Mollisia discolor (Mont.) W. Phillips on Cornus alba L., Botryosphaeria quercuum (Schwein.) Sacc. on Quercus robur L., Peronospora cytisi Rostr. on Laburnum anagyroides Med., Microsphaera guarinonii Briosi and Cavara on Laburnum anagyroides Med., Brachysporium dingleyae S. Hughes on Fraxinus angustifolia Vahl and Rhododendron spec., Mamiania fimbriata (Pers.) Ces. and De Not. on Carpinus betulus L., Atopospora betulina (Fr.) Petr. on Betula pendula Roth, Septoria robiniae (Lib.) Desm. (=Phloeospora robiniae (Lib.) Höhn.) on Robinia pseudoacacia L., Chalara hughesii Nag Raj and W.B. Kendr. on Quercus robur L.. All specimens are located in the Herbarium ESS, Mycotheca Parva collection G.B. Feige and N. Ale-Agha.

  5. Plants known as té in Spain: an ethno-pharmaco-botanical review.

    PubMed

    Pardo de Santayana, Manuel; Blanco, Emilio; Morales, Ramón

    2005-04-01

    Although the word té (tea) in Spanish is derived from the Chinese tscha and refers to the oriental plant Camellia sinensis, it is popularly used throughout Spain to refer to at least 70 different plant species. These are usually collected in the countryside, boiled dry or fresh, and drunk after meals. The drinking of té is a social habit that encourages conversation in a relaxed atmosphere. Tés are also commonly used as digestifs and stomachics, and in some cases as laxatives, antidiarrhoeics, and to reduce the blood pressure. They are not used as stimulants. It appears that the habit of drinking Camellia sinensis afforded the cognitive context for drinking other infusions with no specific medicinal purpose. Some té species are very common in Spain (and their use is quite extended), others are endemic, and others still are allochthonous that now live in the wild. The majority of these species belong to the families Asteraceae and Lamiaceae. The most important and widely distributed are Jasonia glutinosa, Sideritis hyssopifolia, Lithospermum officinale, Chenopodium ambrosioides and Bidens aurea. Other remarkable but more locally used tés include Cruciata glabra (only in the Pyrenees), Inula salicina and Mentha arvensis (in the Central Mountain Range of Madrid), and Potentilla caulescens (in Tarragona).

  6. Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition

    PubMed Central

    Gonçalves, Ana Z.; Oliveira, Rafael S.; Oliveira, Paulo S.; Romero, Gustavo Q.

    2016-01-01

    Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N) and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites) on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri) improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth). On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments. PMID:27002980

  7. Degradation of fuel oil in salt marsh soils affected by the Prestige oil spill.

    PubMed

    Vega, Flora A; Covelo, Emma F; Reigosa, Manuel J; Andrade, María Luisa

    2009-07-30

    We assessed natural degradation of fuel oil in three marshes from Galicia (Spain) affected by the Prestige oil spill (Baldaio, Barizo, and Muxía). Soil samples collected from polluted and unpolluted areas on four different dates were used to determine total petroleum hydrocarbon content and fuel-oil components. Natural degradation was monitored by analysing changes in the proportion of saturated hydrocarbons, aromatics, asphaltenes and resins in the soils, and also by evaluating the degree of depletion of saturated hydrocarbons on each sampling date. We additionally assessed the phytoremediation potential of Lolium perenne, L., Convolvulus arvensis L. and Raphanus raphanistrum L. All marsh soils exhibited natural degradation of saturated and aromatic hydrocarbons to between 85 and 95% in most cases. In contrast, asphaltenes and resins were degraded to a lesser extent (viz. 64-76% in Barizo 1, Muxía and Traba; 39-44% in Baldaio; and only 12% in Barizo 2, where flooding by the river continues to introduce balls of fuel oil into the soil). Monitoring analyses revealed natural degradation to be dependent on the thickness of the pollutant layer. Field plots sown with L. perenne L. exhibited no significant differences in fuel-oil degradation from untreated plots.

  8. Molecular investigations of the soil, rhizosphere and transgenic glufosinate-resistant rape and maize plants in combination with herbicide (Basta) application under field conditions.

    PubMed

    Ernst, Dieter; Rosenbrock-Krestel, Hilkea; Kirchhof, Gudrun; Bieber, Evi; Giunaschwili, Nathela; Müller, Rüdiger; Fischbeck, Gerhard; Wagner, Tobias; Sandermann, Heinrich; Hartmann, Anton

    2008-01-01

    A field study was conducted during 1994 to 1998 on the Experimental Farm Roggenstein, near Fürstenfeldbruck, Bavaria, Germany to determine the effect of transgenic glufosinate-resistant rape in combination with the herbicide Basta [glufosinate-ammonium, phosphinothricin, ammonium (2RS)-2-amino-4-(methylphosphinato) butyric acid] application on soil microorganisms and the behaviour of the synthetic transgenic DNA in response to normal agricultural practice. No influence of Basta on microbial biomass could be detected. The phospholipid fatty acid analysis of soil extracts showed no difference between Basta application and mechanical weed control, whereas conventional herbicide application revealed a different pattern. Basta application resulted in a changed population of weeds with a selective effect for Viola arvensis. During senescence, transgenic rape DNA was degraded similar to endogenous control DNA. After ploughing the chopped plant material in the soil, transgenic as well as endogenous control DNA sequences could be detected for up to 4 weeks for rape and up to 7 months for maize, whereas PCR analysis of composted transgenic maize revealed the presence of the transgene over a period of 22 months. PMID:19227836

  9. Sexuality and Genetic Identity in the Agaricus Section Arvenses

    PubMed Central

    Calvo-Bado, Leo; Noble, Ralph; Challen, Mike; Dobrovin-Pennington, Andreja; Elliott, Tim

    2000-01-01

    Twelve wild collections and one commercial strain were used to characterize breeding systems and to develop molecular identities in the Arvenses section of the genus Agaricus, which includes the “horse mushroom” A. arvensis. Two morphotypes were identified based on macro- and micromorphological features. However, not all collections could be delimited by conventional taxonomic characters. Sequencing of the small subunit intergenic spacer (ITS) region (368 to 370 bp) of the rRNA genes clearly resolved the 13 collections into two clusters consistent with the identified morphotypes. Single-spore progenies and mating type testers were established and used to test intra- and interstock compatibility. The two compatibility groups identified were consistent with ITS clusters. Compatibility group I stocks readily interbred within the constraints of a unifactorial heterothallic system with a multiallelic mating type factor. Compatibility group II had a more restricted breeding pattern, and interactions were difficult to predict on the basis of mating type. Morphological data, ITS sequences, and the ability to interbreed suggest that these collections are part of a complex of interrelated species. Single-spore, homokaryotic isolates from both compatibility groups were able to fruit in compost culture, and two of the collections may represent natural homokaryotic fruiting. We conclude that species from the section Arvenses have versatile unifactorial heterothallic life cycles that permit both interbreeding and homokaryotic fruiting. PMID:10653743

  10. Contact and fumigant toxicity of oriental medicinal plant extracts against Dermanyssus gallinae (Acari: Dermanyssidae).

    PubMed

    Kim, Soon-Il; Na, Young-Eun; Yi, Ji-Hwan; Kim, Byung-Seok; Ahn, Young-Joon

    2007-04-30

    The acaricidal activity of methanolic extracts from 40 oriental medicinal plant species and a steam distillate of Cinnamomum camphora towards poultry house-collected adult Dermanyssus gallinae De Geer was examined using direct contact and vapour phase toxicity bioassays. Results were compared with those of 15 acaricides currently used. In filter paper contact toxicity bioassays using adult D. gallinae, C. camphora steam distillate (0.0051 mgcm(-2)) was the most toxic material, followed by extracts from Asarum sieboldii var. seoulens whole plant, Eugenia caryophyllata flower bud and Mentha arvensis var. piperascens whole plant (0.0063-0.0072 mgcm(-2)), based upon 24h LD(50) values. The acaricidal activity of these four plant preparations was almost comparable to that of profenofos (LD(50), 0.003 mgcm(-2)) but less effective than dichlorvos (LD(50), 0.0004 mgcm(-2)). The toxicity of Illicium verum fruit and Lysimachia davurica leaf extracts (0.09 mgcm(-2)) was almost comparable to that of benfuracarb, prothiofos, propoxur and fenthion (0.053-0.070mgcm(-2)). In vapour phase toxicity tests, these plant preparations were more effective in closed containers than in open ones, indicating that the mode of delivery of these plant extracts was largely a result of action in the vapour phase. Plants described herein merit further study as potential D. gallinae control agents.

  11. Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.

    PubMed

    Gonçalves, Ana Z; Oliveira, Rafael S; Oliveira, Paulo S; Romero, Gustavo Q

    2016-01-01

    Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N) and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites) on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri) improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth). On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments. PMID:27002980

  12. Chewing lice of genus Ricinus (Phthiraptera, Ricinidae) deposited at the Zoological Institute of the Russian Academy of Sciences, Saint Petersburg, Russia, with description of a new species

    PubMed Central

    2016-01-01

    We revised a collection of chewing lice deposited at the Zoological Institute of the Russian Academy of Sciences, Saint Petersburg, Russia. We studied 60 slides with 107 specimens of 10 species of the genus Ricinus (De Geer, 1778). The collection includes lectotype specimens of Ricinus ivanovi Blagoveshtchensky, 1951 and of Ricinus tugarinovi Blagoveshtchensky, 1951. We registered Ricinus elongatus Olfers, 1816 ex Turdus ruficollis, R. ivanovi ex Leucosticte tephrocotis and Ricinus serratus (Durrant, 1906) ex Calandrella acutirostris and Calandrella cheleensis which were not included in Price’s world checklist. New records for Russia are R. elongatus ex Turdus ruficollis; Ricinus fringillae De Geer, 1778 ex Emberiza aureola, Emberiza leucocephalos, Emberiza rustica, Passer montanus and Prunella modularis; Ricinus rubeculae De Geer, 1778 ex Erithacus rubecula and Luscinia svecica; Ricinus serratus (Durrant, 1906) ex Alauda arvensis. New records for Kyrgyzstan are R. fringillae ex E. leucocephalos and ex Fringilla coelebs. A new record for Tajikistan is R. serratus ex Calandrella acutirostris. The new species Ricinus vaderi Valan n. sp. is described with Calandra lark, Melanocorypha calandra; from Azerbaijan, as a type host. PMID:26902646

  13. Ethnobotanical survey of the medicinal flora used by the Caribs of Guatemala.

    PubMed

    Girón, L M; Freire, V; Alonzo, A; Cáceres, A

    1991-09-01

    An ethnobotanical survey was conducted among the Carib population of Guatemala in 1988-1989. In general terms, the sample surveyed possessed a relatively good standard of living. Results indicated that health services were utilized by the population, and that domestic medicine, mainly plants (96.9%) was used by 15% of the population. One hundred and nineteen plants used for medicinal purposes were collected, of which 102 (85.7%) could be identified; a list of these together with the information provided for each plant is presented. The most frequently reported plants used as medicine are: Acalypha arvensis, Cassia alata, Cymbopogon citratus, Melampodium divaricatum. Momordica charantia, Neurolaena lobata, Ocimum basilicum, Petiveria alliacea and Solanum nigrescens. Most of these plants are found in the region, but some are brought from the Highlands or outside of the country, such as Malva parviflora, Matricaria chamomilla, Peumus boldus, Pimpinella anisum, Rosmarinus officinalis and Tagetes lucida. This survey demonstrated that the Carib population of Guatemala has survived in a transcultural environment of African and native Amerindian beliefs.

  14. Causes and Consequences of Partial Migration in a Passerine Bird.

    PubMed

    Hegemann, Arne; Marra, Peter P; Tieleman, B Irene

    2015-10-01

    Many animal species have populations in which some individuals migrate and others remain on the breeding grounds. This phenomenon is called partial migration. Despite substantial theoretical work, empirical data on causes and consequences of partial migration remain scarce, mainly because of difficulties associated with tracking individuals over large spatial scales. We used stable hydrogen isotopes in claw material to determine whether skylarks Alauda arvensis from a single breeding population in the Netherlands had migrated or remained resident in the previous winter and investigated whether there were causes or consequences of either strategy. Age and sex had no influence on the propensity to migrate, but larger individuals were more likely to be residents. The wintering strategy was not fixed within individuals. Up to 45% of individuals measured in multiple years switched strategies. Reproductive parameters were not related to the wintering strategy, but individuals that wintered locally experienced lower future return rates, and this was directly correlated with two independent measures of immune function. Our results suggest that partial migration in skylarks is based neither on genetic dimorphism nor on an age- and sex-dependent condition. Instead, the wintering strategy is related to structural size and immune function. These new insights on causes and consequences of partial migration advance our understanding of the ecology, evolution, and coexistence of different life-history strategies.

  15. Evolution of mustard (Brassica juncea Coss) subspecies in China: evidence from the chalcone synthase gene.

    PubMed

    Chen, F B; Liu, H F; Yao, Q L; Fang, P

    2016-01-01

    To explore the phylogenetic relationship, genome donor, and evolutionary history of the polyploid mustard (Brassica juncea) from China, eighty-one sequences of the chalcone synthase gene (Chs) were analyzed in 43 individuals, including 34 B. juncea, 2 B. rapa, 1 B. nigra, 2 B. oleracea, 1 B. napus, 1 B. carinata, and 2 Raphanus sativus. A maximum likelihood analysis showed that sequences from B. juncea were separated into two well-supported groups in accordance with the A and B genomes, whereas the traditional phenotypic classification of B. juncea was not wholly supported by the molecular results. The SplitsTree analysis recognized four distinct groups of Brassicaceae, and the median-joining network analysis recognized four distinct haplotypes of Chs. The estimates of Tajima's D, Fu and Li's D, and Fu and Li's F statistic for the Chs gene in the B genome were negative, while those in the A genome were significant. The results indicated that 1) the Chs sequences revealed a high level of sequence variation in Chinese mustard, 2) both tree and reticulate evolutions existed, and artificial selection played an important role in the evolution of Chinese mustard, 3) the original parental species of Chinese mustard are B. rapa var. sinapis arvensis and B. nigra (derived from China), 4) nucleotide variation in the B genome was higher than that in the A genome, and 5) cultivated mustard evolved from wild mustard, and China is one of the primary origins of B. juncea. PMID:27173323

  16. The park-view effect: Residential development is higher at the boundaries of protected areas.

    PubMed

    Brambilla, Mattia; Ronchi, Silvia

    2016-11-01

    Land-use changes in the surrounding of protected areas might compromise their conservation efficacy, and thus the potential attractive effect that protected areas may exert on urban development is particularly concerning. We investigated whether the proximity to protected areas in a region (Lombardy, Italy) with a high density of urban areas and parks may increase the likelihood of residential development. The main change around protected areas was the loss of open areas (mostly due to development processes at the expense of arable land), which was higher in proximity of parks. Changes in residential discontinuous development were significantly and negatively related to proximity to parks, whereas changes in productive developments were unrelated to park proximity. The higher likelihood of residential development in proximity to parks is likely due to the attraction exerted by parks. The severe loss of open areas and increase of residential development around parks heavily impacted on habitat availability for a declining bird species (Alauda arvensis). Conservation policies considering also what happens around protected areas are urgently needed.

  17. Influences of major nutrient elements on Pb accumulation of two crops from a Pb-contaminated soil.

    PubMed

    Lin, Changcun; Zhu, Tingcheng; Liu, Li; Wang, Deli

    2010-02-15

    To know about the effect of major nutrient elements on various forms of Pb and metal extraction, a greenhouse experiment was conducted to assess the effects of various major nutrient elements on Pb accumulation in two crops (Spinacia oleracea, SO and Sonchus arvensis, SA) in Changchun, China. Results indicated that, for SO, the Pb concentrations in both shoots and roots had no difference with increasing nutrients except for low nutrient treatment (1/2H). For SA, high nutrient treatments (2H and 3H) resulted in higher Pb concentrations in roots than low and standard nutrient treatments (1/2H and C), but high Pb concentration in shoot appeared in low and highest nutrient treatments (1/2H and 3H). The nitrogenous nutrient treatment (2N) had the most effect of increasing Pb concentrations in roots of SO and SA. The potassic and phosphorus nutrient treatments (2K and 2P) had little effect on the Pb concentrations in plant tissues for SO. Pb concentration in SO was lower than SA. Because of the higher total biomass in SO than SA, the ability to Pb accumulation in SO was better than SA. Sequential extraction results indicated that the addition of soil amendments transform soil Pb from bioavailable fractions to non-bioavailable fraction substantially. The results suggest that nitrogen fertilizer for SO and phosphorus fertilizer for SA are the most effective materials for the remediation of Pb-contaminated soils, and increase the tolerance of crops to Pb contamination.

  18. Chewing lice of genus Ricinus (Phthiraptera, Ricinidae) deposited at the Zoological Institute of the Russian Academy of Sciences, Saint Petersburg, Russia, with description of a new species.

    PubMed

    Valan, Miroslav; Sychra, Oldrich; Literak, Ivan

    2016-01-01

    We revised a collection of chewing lice deposited at the Zoological Institute of the Russian Academy of Sciences, Saint Petersburg, Russia. We studied 60 slides with 107 specimens of 10 species of the genus Ricinus (De Geer, 1778). The collection includes lectotype specimens of Ricinus ivanovi Blagoveshtchensky, 1951 and of Ricinus tugarinovi Blagoveshtchensky, 1951. We registered Ricinus elongatus Olfers, 1816 ex Turdus ruficollis, R. ivanovi ex Leucosticte tephrocotis and Ricinus serratus (Durrant, 1906) ex Calandrella acutirostris and Calandrella cheleensis which were not included in Price's world checklist. New records for Russia are R. elongatus ex Turdus ruficollis; Ricinus fringillae De Geer, 1778 ex Emberiza aureola, Emberiza leucocephalos, Emberiza rustica, Passer montanus and Prunella modularis; Ricinus rubeculae De Geer, 1778 ex Erithacus rubecula and Luscinia svecica; Ricinus serratus (Durrant, 1906) ex Alauda arvensis. New records for Kyrgyzstan are R. fringillae ex E. leucocephalos and ex Fringilla coelebs. A new record for Tajikistan is R. serratus ex Calandrella acutirostris. The new species Ricinus vaderi Valan n. sp. is described with Calandra lark, Melanocorypha calandra; from Azerbaijan, as a type host.

  19. Chemical control of perennial and annual weeds in herbicide resistant soybean crops.

    PubMed

    Sarpe, N; Roibu, C; Negrila, E; Bodescu, F; Fuia, S; Popa, C; Beraru, C

    2001-01-01

    In Romania, the first tests with Roundup Ready on soybean crops were performed in 1998, on 2 soil types: a) at Teleorman Station on chernozem containing 3.5% humus, 4.5% clay b) at Brăila Station placed in Danube Meadow on alluvial soil containing 3.90% humus and 46% clay. In every locality cultivated soybean cultivar S.2254 was resistant to glyphosate. During the three years of experiments (1998-2000) the crop of soybean was infested with various species of weeds (both annual and perennial) of which the most important are: Sorghum halepense (60-80%), Echinochloa crus-galli, Setaria glauca, Amaranthus retroflexus, Solarium nigrum, Yanthium italicum, Abutilon theoprasthi, Sinapis arvensis, Datum stramonium, Polygonum persicaria, Calystegia sepium, Cirsium arvense. In 3 years of experience the best weed control and the highest soybean production were obtained in the variants treated 2 times postemergent with Roundup Ready at a dose of 3 + 3 l/ha. Similar results were also obtained in the farms of the Academy of Agricultural Forestry Sciences, where GMO soybean was cultivated on 1500 hectares.

  20. Reproduction of Pratylenchus penetrans on 24 Common Weeds in Potato Fields in Québec

    PubMed Central

    Bélair, G.; Dauphinais, N.; Benoit, D. L.; Fournier, Y.

    2007-01-01

    Twenty-four weeds commonly found in commercial potato fields in Quebec were evaluated for their host suitability to the root-lesion nematode, Pratylenchus penetrans, under greenhouse conditions. Brown mustard (Brassica juncea) and rye (Secale cereale) were included as susceptible controls and forage pearl millet hyb. CFPM 101 (Pennisetum glaucum) as a poor host. Pratylenchus penetrans multiplied well on 22 of the 24 weed species tested (Pf/Pi ≥ rye or brown mustard). Cirsium arvense, Leucanthemum vulgare and Matricaria discoida were classified as very good hosts with a Pf/Pi ranging from 1.60 to 2.54, while Ambrosia artemisiifolia and Cyperus esculentus were classified as poor hosts with a Pf/Pi from 0.01 to 0.15. Amaranthus powellii, A. retrqflexus, Raphanus raphanistrum, Rorippa palustris, Cerastium fontanum, Spergula arvensis, Stellaria media, Chenopodium album, Vicia cracca, Elytrigia repens, Digitaria ischaemum, Echinochloa crusgalli, Panicum capillare, Setaria faberii, S. pumila, S. viridis, Polygonum convolvulus, P. scabrum and P. persicaria were intermediate hosts with Pf/Pi values ranging from 0.33 to 2.01. The plant species and the botanical family had a significant impact on nematode reproduction. The Brassicaceae family resulted in the greatest reproduction of P. penetrans, and the Cyperaceae resulted in the least. The plant life-cycle (annual vs. perennial) had no impact on nematode population. PMID:19259506

  1. Reproduction of Pratylenchus penetrans on 24 Common Weeds in Potato Fields in Québec.

    PubMed

    Bélair, G; Dauphinais, N; Benoit, D L; Fournier, Y

    2007-12-01

    Twenty-four weeds commonly found in commercial potato fields in Quebec were evaluated for their host suitability to the root-lesion nematode, Pratylenchus penetrans, under greenhouse conditions. Brown mustard (Brassica juncea) and rye (Secale cereale) were included as susceptible controls and forage pearl millet hyb. CFPM 101 (Pennisetum glaucum) as a poor host. Pratylenchus penetrans multiplied well on 22 of the 24 weed species tested (Pf/Pi >/= rye or brown mustard). Cirsium arvense, Leucanthemum vulgare and Matricaria discoida were classified as very good hosts with a Pf/Pi ranging from 1.60 to 2.54, while Ambrosia artemisiifolia and Cyperus esculentus were classified as poor hosts with a Pf/Pi from 0.01 to 0.15. Amaranthus powellii, A. retrqflexus, Raphanus raphanistrum, Rorippa palustris, Cerastium fontanum, Spergula arvensis, Stellaria media, Chenopodium album, Vicia cracca, Elytrigia repens, Digitaria ischaemum, Echinochloa crusgalli, Panicum capillare, Setaria faberii, S. pumila, S. viridis, Polygonum convolvulus, P. scabrum and P. persicaria were intermediate hosts with Pf/Pi values ranging from 0.33 to 2.01. The plant species and the botanical family had a significant impact on nematode reproduction. The Brassicaceae family resulted in the greatest reproduction of P. penetrans, and the Cyperaceae resulted in the least. The plant life-cycle (annual vs. perennial) had no impact on nematode population. PMID:19259506

  2. Phytochrome Intermediates and Action Spectra for Light Perception by Dry Seeds 1

    PubMed Central

    Bartley, Michael R.; Frankland, Barry

    1984-01-01

    It has previously been demonstrated that far-red irradiation of dry Lactuca sativa L. seeds results in inhibition of subsequent germination. Although red has no effect on dry seeds, a red irradiation following a farred irradiation reverses the effect of far-red. This phenomenon is most noticeable in seeds with artificially raised levels of phytochrome in the far-red absorbing form. Qualitatively similar results have been found for the seeds of Plantago major L., Sinapis arvensis L., and Bromus sterilis L. Action spectra studies on Plantago seeds show that the action peaks for promotion and inhibition of germination of hydrated seeds are at 660 and 730 nanometers, respectively. The action spectrum for inhibition of subsequent germination following irradiation of dry seeds is qualitatively and quantitatively similar to that for hydrated seeds, with an action peak at 730 nanometers, indicating absorption by phytochrome in the far-red absorbing form. However, the action spectrum for the reversal of this far-red effect on dry seeds has a broad peak at 680 nanometers and subsidiary peaks at 650 and 600 nanometers. It is proposed that this effect is due to light absorption by the phytochrome intermediate complex meta-Fa, and that the action spectrum reflects the in vivo absorption properties of this intermediate. PMID:16663467

  3. Analysis of the sugar-binding specificity of mannose-binding-type Jacalin-related lectins by frontal affinity chromatography--an approach to functional classification.

    PubMed

    Nakamura-Tsuruta, Sachiko; Uchiyama, Noboru; Peumans, Willy J; Van Damme, Els J M; Totani, Kiichiro; Ito, Yukishige; Hirabayashi, Jun

    2008-03-01

    The Jacalin-related lectin (JRL) family comprises galactose-binding-type (gJRLs) and mannose-binding-type (mJRLs) lectins. Although the documented occurrence of gJRLs is confined to the family Moraceae, mJRLs are widespread in the plant kingdom. A detailed comparison of sugar-binding specificity was made by frontal affinity chromatography to corroborate the structure-function relationships of the extended mJRL subfamily. Eight mJRLs covering a broad taxonomic range were used: Artocarpin from Artocarpus integrifolia (jackfruit, Moraceae), BanLec from Musa acuminata (banana, Musaceae), Calsepa from Calystegia sepium (hedge bindweed, Convolvulaceae), CCA from Castanea crenata (Japanese chestnut, Fagaceae), Conarva from Convolvulus arvensis (bindweed, Convolvulaceae), CRLL from Cycas revoluta (King Sago palm tree, Cycadaceae), Heltuba from Helianthus tuberosus (Jerusalem artichoke, Asteraceae) and MornigaM from Morus nigra (black mulberry, Moraceae). The result using 103 pyridylaminated glycans clearly divided the mJRLs into two major groups, each of which was further divided into two subgroups based on the preference for high-mannose-type N-glycans. This criterion also applied to the binding preference for complex-type N-glycans. Notably, the result of cluster analysis of the amino acid sequences clearly corresponded to the above specificity classification. Thus, marked correlation between the sugar-binding specificity of mJRLs and their phylogeny should shed light on the functional significance of JRLs.

  4. Long-term phyto-, ornitho- and ichthyophenological time-series analyses in Estonia

    NASA Astrophysics Data System (ADS)

    Ahas, Rein

    This study analyzes a long-term phenological time series for the impact assessment of climate changes on Estonian nature and for the methodological study of the possible limitations of using phenological time series for climate trend analyses. These limiting factors can influence the results of studies more than the real impact of climate changes, which may have a much smaller numeric value. The 132-year series of the arrival of the skylark (Alauda arvensis) and the white wagtail (Motacilla alba), the 78-year series of the blossoming of the wood anemone (Anemone nemorosa), the bird cherry (Padus racemosa), apple trees (Malus domestica) and lilacs (Syringa vulgaris), and the 44-year series of the spawning of pike (Esox lucius) and bream (Abramis brama) were studied at three selected observation points in Estonia. The study of the phenological time series shows that Estonian springs have, on the basis of the database, advanced 8 days on average over the last 80-year period; the last 40-year period has warmed even faster.

  5. Isomenthone protects human dermal fibroblasts from TNF-α-induced death possibly by preventing activation of JNK and p38 MAPK.

    PubMed

    Jung, Eunsun; Byun, Sangyo; Kim, Seungbeom; Kim, Moohan; Park, Deokhoon; Lee, Jongsung

    2012-10-01

    Cell death evoked by tumor necrosis factor-α (TNF-α) is regulated by the TNF-α receptor-associated death domain containing protein, which interacts with and activates apoptotic proteases triggering cell death. c-Jun N-terminal kinase (JNK) and p38 MAPK, induce the apoptotic program and are indispensible early elements in stress-induced apoptosis that control the release of cytochrome c. Isomenthone is a constituent of the essential oil of Mentha arvensis L. and is used as a fragrance and flavor in the cosmetic, drug, and food industries. In this study, we investigated the protective effects of isomenthone against TNF-α-induced cell death and its mechanism in human dermal fibroblasts. To understand the cytoprotective role of isomenthone, MTT and terminal deoxynucleotidyl transferase dUTP nick end labeling assays for cell viability and enzyme-linked immunosorbent assay analysis for the mechanistic study were performed. We found that isomenthone inhibited the TNF-α-mediated reduction in cell viability and inhibited the increase in apoptosis under a serum-free condition. Isomenthone also blocked the JNK and p38 MAPK pathways and downstream apoptotic events. These results indicate that isomenthone has the potential to protect fibroblasts against TNF-α-induced cell death under a serum-deprived condition by blocking activation of the JNK and p38 MAPK pathways and downstream apoptotic events.

  6. Anti-Adipogenic Effects of Ethanol Extracts Prepared from Selected Medicinal Herbs in 3T3-L1 Cells

    PubMed Central

    Park, Min-Jun; Song, Ji-Hye; Shon, Myung-Soo; Kim, Hae Ok; Kwon, O Jun; Roh, Seong-Soo; Kim, Choon Young; Kim, Gyo-Nam

    2016-01-01

    Obesity is a major risk factor for various metabolic diseases such as cardiovascular disease, hypertension, and type 2 diabetes mellitus. In this study, we prepared ethanol extracts from Agastache rugosa (ARE), Chrysanthemum zawadskii (CZE), Mentha arvensis (MAE), Perilla frutescens (PFE), Leonurus sibiricus (LSE), Gardenia jasminoides (GJE), and Lycopus coreanus (LCE). The anti-oxidant and anti-adipogenic effects were evaluated. The IC50 values for ascorbic acid and LCE against 2,2-diphenyl-1-picrylhydrazyl radicals were 246.2 μg/mL and 166.2 μg/mL, respectively, followed by ARE (186.6 μg/mL), CZE (198.6 μg/mL), MAE (337.1 μg/mL), PFE (415.3 μg/mL), LSE (548.2 μg/mL), and GJE (626.3 μg/mL). In non-toxic concentration ranges, CZE had a strong inhibitory effect against 3T3-L1 adipogenes (84.5%) than those of the other extracts. Furthermore, the anti-adipogenic effect of CZE is largely limited in the early stage of adipogenesis, and we revealed that the inhibitory role of CZE in adipogenesis is required for the activation of Wnt signaling. Our results provide scientific evidence that the anti-adipogenic effect of CZE can be applied as an ingredient for the development of functional foods and nutri-cosmetics for obesity prevention. PMID:27752499

  7. Weed vegetation ecology of arable land in Salalah, Southern Oman

    PubMed Central

    El-Sheikh, Mohamed A.

    2013-01-01

    This paper applies multivariate statistical methods to a data set of weed relevés from arable fields in two different habitat types of coastal and mountainous escarpments in Southern Oman. The objectives were to test the effect of environmental gradients, crop plants and time on weed species composition, to rank the importance of these particular factors, and to describe the patterns of species composition and diversity associated with these factors. Through the application of TWINSPAN, DCA and CCA programs on data relating to 102 species recorded in 28 plots and farms distributed in the study area, six plant communities were identified: I- Dichanthium micranthum, II- Cynodon dactylon–D. micranthum, III- Convolvulus arvensis, IV- C. dactylon–Sonchus oleraceus, V- Amaranthus viridis and VI- Suaeda aegyptiaca–Achyranthes aspera. The ordination process (CCA) provided a sequence of plant communities and species diversity that correlated with some anthropogenic factors, physiographic variables and crop types. Therefore, length of time since farm construction, disturbance levels and altitude are the most important factors related to the occurrence of the species. The perennial species correlated with the more degraded mountain areas of new farm stands, whereas most of the annuals correlated with old lowland and less disturbed farms. PMID:23961246

  8. Host Preferences of Arbuscular Mycorrhizal Fungi Colonizing Annual Herbaceous Plant Species in Semiarid Mediterranean Prairies

    PubMed Central

    Torrecillas, E.; Roldán, A.

    2012-01-01

    In this study, we have analyzed and compared the diversities of the arbuscular mycorrhizal fungi (AMF) colonizing the roots of five annual herbaceous species (Hieracium vulgare, Stipa capensis, Anagallis arvensis, Carduus tenuiflorus, and Avena barbata) and a perennial herbaceous species (Brachypodium retusum). Our goal was to determine the differences in the communities of the AMF among these six plant species belonging to different families, using B. retusum as a reference. The AMF small-subunit rRNA genes (SSU) were subjected to nested PCR, cloning, sequencing, and phylogenetic analysis. Thirty-six AMF phylotypes, belonging to Glomus group A, Glomus group B, Diversispora, Paraglomus, and Ambispora, were identified. Five sequence groups identified in this study clustered to known glomalean species or isolates: group Glomus G27 to Glomus intraradices, group Glomus G19 to Glomus iranicum, group Glomus G10 to Glomus mosseae, group Glomus G1 to Glomus lamellosum/etunicatum/luteum, and group Ambispora 1 to Ambispora fennica. The six plant species studied hosted different AMF communities. A certain trend of AMF specificity was observed when grouping plant species by taxonomic families, highlighting the importance of protecting and even promoting the native annual vegetation in order to maintain the biodiversity and productivity of these extreme ecosystems. PMID:22752164

  9. Characterization of Bois noir isolates by restriction fragment length polymorphism of a Stolbur-specific putative membrane protein gene.

    PubMed

    Pacifico, D; Alma, A; Bagnoli, B; Foissac, X; Pasquini, G; Tessitori, M; Marzachì, C

    2009-06-01

    Bois noir phytoplasma (BNp), widespread in wine-producing areas of Europe and endemic in France and Italy, is classified in the 16SrXII-A subgroup, whose members are referred to as Stolbur phytoplasmas. The 16S rDNA gene of Stolbur phytoplasma shows low variability, and few non-ribosomal genes are available as markers to assess variation among isolates. We used the Stolbur-specific stol-1H10 gene, encoding a putative membrane-exposed protein, to investigate genetic diversity of French and Italian BNp isolates from plants and insects. Amplification of stol-1H10 from infected grapevines, weeds, and Hyalesthes obsoletus produced fragments of three sizes, and restriction fragment length polymorphism analysis divided these amplicons further into 12 profiles (V1 to V12). French BNp isolates were more variable than Italian ones, and different profiles were present in infected grapevines from France and Italy. Isolate V3, most abundant among Italian affected grapes but present among French ones, was found in one Urtica dioica sample and in all H. obsoletus collected on this species. Four Italian-specific profiles were represented among infected Convolvulus arvensis, the most frequent of which (V12) was also detected in H. obsoletus collected on this species. Most of the variability in the stol-1H10 sequence was associated with type II on the tuf gene. PMID:19453230

  10. Vegetation pattern and heavy metal accumulation at a mine tailing at Gyöngyösoroszi, hungary.

    PubMed

    Tamás, János; Kovács, Alza

    2005-01-01

    Vegetation at an abandoned heavy metal bearing mine tailing may have multifunctional roles such as modification of water balance, erosion control and landscape rehabilitation. Research on the vegetation of mine tailings can provide useful information on tolerance, accumulation and translocation properties of species potentially applicable at moderately contaminated sites. Analyses of the relationship between heavy metal content (Pb, Zn and Cu) and vegetation in a mine tailing were carried out. These analyses included: (1) spatial analysis of relationship among heavy metal distribution, pH and vegetation patterns, and (2) analysis of heavy metal accumulation and translocation in some plant species. Presence of vegetation was found to be significantly dependent on pH value, which confirms that phytotoxicity is a function of element concentration in solution, which is primarily controlled by pH value in mine tailings. Among the most abundant plant species, dewberry (Rubus caesius), vipersbugloss (Echium vulgare), scarlet pimpernel (Anagallis arvensis) and narrowleaf plantain (Plantago lanceolata) accumulate significant amounts of Pb, Cu and Zn, while in the case of annual bluegrass (Poa annua) only Pb can be measured in elevated contents. Considering the translocation features, scarlet pimpernel, narrowleaf plantain, and dewberry accumulate heavy metals primarily in their roots, while heavy metal concentration in vipersbugloss and annual bluegrass is higher in the shoots.

  11. Contrasting arbuscular mycorrhizal communities colonizing different host plants show a similar response to a soil phosphorus concentration gradient

    PubMed Central

    Gosling, Paul; Mead, Andrew; Proctor, Maude; Hammond, John P; Bending, Gary D

    2013-01-01

    High soil phosphorus (P) concentration is frequently shown to reduce root colonization by arbuscular mycorrhizal (AM) fungi, but the influence of P on the diversity of colonizing AM fungi is uncertain. We used terminal restriction fragment length polymorphism (T-RFLP) of 18S rDNA and cloning to assess diversity of AM fungi colonizing maize (Zea mays), soybean (Glycene max) and field violet (Viola arvensis) at three time points in one season along a P gradient of 10–280 mg l−1 in the field. Percentage AM colonization changed between sampling time points but was not reduced by high soil P except in maize. There was no significant difference in AM diversity between sampling time points. Diversity was reduced at concentrations of P > 25 mg l−1, particularly in maize and soybean. Both cloning and T-RFLP indicated differences between AM communities in the different host species. Host species was more important than soil P in determining the AM community, except at the highest P concentration. Our results show that the impact of soil P on the diversity of AM fungi colonizing plants was broadly similar, despite the fact that different plants contained different communities. However, subtle differences in the response of the AM community in each host were evident. PMID:23421495

  12. Evaluation of native plant flower characteristics for conservation biological control of Prays oleae.

    PubMed

    Nave, A; Gonçalves, F; Crespí, A L; Campos, M; Torres, L

    2016-04-01

    Several studies have shown that manipulating flowering weeds within an agroecosystem can have an important role in pest control by natural enemies, by providing them nectar and pollen, which are significant sources of nutrition for adults. The aim of this study was to assess if the olive moth, Prays oleae (Bernard, 1788) (Lepidoptera: Praydidae), and five of its main natural enemies, the parasitoid species Chelonus elaeaphilus Silvestri (Hymenoptera: Braconidae), Apanteles xanthostigma (Haliday) (Hymenoptera: Braconidae), Ageniaspis fuscicollis (Dalman) (Hymenoptera: Encyrtidae) and Elasmus flabellatus (Fonscolombe) (Hymenoptera: Eulophidae), as well as the predator Chrysoperla carnea (Stephens) (Neuroptera: Chrysopidae), can theoretically access the nectar from 21 flowering weeds that naturally occur in olive groves. Thus, the architecture of the flowers as well as the mouthpart structure and/or the head and thorax width of the pest and its enemies were analyzed. The results suggested that all beneficial insects were able to reach nectar of the plant species from Apiaceae family, i.e. Conopodium majus (Gouan) Loret, Daucus carota L. and Foeniculum vulgare Mill., as well as Asparagus acutifolius L., Echium plantagineum L., Capsella bursa-pastoris (L.) Medik., Raphanus raphanistrum L., Lonicera hispanica Boiss. et Reut., Silene gallica L., Spergula arvensis L., Hypericum perforatum L., Calamintha baetica Boiss. et Reut, Malva neglecta Wallr. and Linaria saxatilis (L.) Chaz. P. oleae was not able to access nectar from five plant species, namely: Andryala integrifolia L., Chondrilla juncea L., Dittrichia viscosa (L.) Greuter, Sonchus asper (L.) Hill and Lavandula stoechas L.

  13. Phytochrome intermediates and action spectra for light perception by dry seeds.

    PubMed

    Bartley, M R; Frankland, B

    1984-03-01

    It has previously been demonstrated that far-red irradiation of dry Lactuca sativa L. seeds results in inhibition of subsequent germination. Although red has no effect on dry seeds, a red irradiation following a farred irradiation reverses the effect of far-red. This phenomenon is most noticeable in seeds with artificially raised levels of phytochrome in the far-red absorbing form. Qualitatively similar results have been found for the seeds of Plantago major L., Sinapis arvensis L., and Bromus sterilis L. Action spectra studies on Plantago seeds show that the action peaks for promotion and inhibition of germination of hydrated seeds are at 660 and 730 nanometers, respectively. The action spectrum for inhibition of subsequent germination following irradiation of dry seeds is qualitatively and quantitatively similar to that for hydrated seeds, with an action peak at 730 nanometers, indicating absorption by phytochrome in the far-red absorbing form. However, the action spectrum for the reversal of this far-red effect on dry seeds has a broad peak at 680 nanometers and subsidiary peaks at 650 and 600 nanometers. It is proposed that this effect is due to light absorption by the phytochrome intermediate complex meta-Fa, and that the action spectrum reflects the in vivo absorption properties of this intermediate.

  14. A plasmid of Rhizobium meliloti 41 encodes catabolism of two compounds from root exudate of Calystegium sepium.

    PubMed Central

    Tepfer, D; Goldmann, A; Pamboukdjian, N; Maille, M; Lepingle, A; Chevalier, D; Dénarié, J; Rosenberg, C

    1988-01-01

    Our objectives were to identify substances produced by plant roots that might act as nutritional mediators of specific plant-bacterium relationships and to delineate the bacterial genes responsible for catabolizing these substances. We discovered new compounds, which we call calystegins, that have the characteristics of nutritional mediators. They were detected in only 3 of 105 species of higher plants examined: Calystegia sepium, Convolvulus arvensis (both of the Convolvulaceae family), and Atropa belladonna. Calystegins are abundant in organs in contact with the rhizosphere and are not found, or are observed only in small quantities, in aerial plant parts. Just as the synthesis of calystegins is infrequent in the plant kingdom, their catabolism is rare among rhizosphere bacteria that associate with plants and influence their growth. Of 42 such bacteria tested, only one (Rhizobium meliloti 41) was able to catabolize calystegins and use them as a sole source of carbon and nitrogen. The calystegin catabolism gene(s) (cac) in this strain is located on a self-transmissible plasmid (pRme41a), which is not essential to nitrogen-fixing symbiosis with legumes. We suggest that under natural conditions calystegins provide an exclusive carbon and nitrogen source to rhizosphere bacteria which are able to catabolize these compounds. Calystegins (and the corresponding microbial catabolic genes) might be used to analyze and possibly modify rhizosphere ecology. Images PMID:2981046

  15. Effect of fertilization on the weediness of maize in a long-term field experiment.

    PubMed

    Kismányoky, A; Lehoczky, E; Kismányoky, T

    2006-01-01

    We carried our examination in a long-term fertilization field experiment in 2005. In the experiment we had opportunity to compare the weediness in NPK and NPK + FYM1 treatments, and we could study the effect of increasing N dosis on the weeds and maize. The bi-factorial trial was arranged in split plot design with three replications. The weed survey was made 25 days after seeding in the 27th of may. For the weed survey the Balázs-Ujvárosi method was applied. After the weed survey we collected all the weed species from the plots per 1-1 m2. We counted, mesured the fresh and dry matter weight of aerial shoots. We collected maize too, five pieces per plots. In the experiment were found 12 weed species, 9 annual: Abutilon theophrasti, Amaranthus chlorostachys, Ambrosia artemisiifolia, Chenopodium album, Chenopodium hybridum, Echinochloa crus-galli, Polygonum lapathifolium, Xantium strumarium, Veronica hederi-folia, and 3 perennial: Cirsium arvense, Convolvulus arvensis, Lathyrus tuberosus. On the NPK plots the Ch. album, on NPK + FYM treatments the A. theophrasti was the first in order of the dominance. The biomass production of weeds in the NPK + FYM treatments were 3 times higher than in the only NPK treatments.

  16. A role for ethylene in the metabolism of cyanide by higher plants

    SciTech Connect

    Goudey, J.S.; Tittle, F.L.; Spencer, M.S. )

    1989-04-01

    The action of ethylene on the capacity of plant tissues to metabolize cyanice to {beta}-cyanoalanine was examined. Beta-cyanoalanine synthase catalyzes the reaction between cyanide and cysteine to form {beta}-cyanoalanine and hydrogen sulfide. Levels of {beta}-cyanoalanine synthase activity in tissues of 6 day old etiolated pea (Pisum sativum) seedlings were enhanced severalfold by 1 microliter per liter ethylene. The promotive effect of ethylene increased with increasing ethylene concentrations from 0.01 to 100 microliters per liter and with the period of exposure from 3 to 24 hours. Ethylene enhanced {beta}-cyanoalanine synthase activity in all regions of the seedling (shoots and roots, internodal regions, cotyledons). The promotive effect was eliminated by norbornadiene, a competitive inhibitor of ethylene action. Levels of {beta}-cyanoalanine synthase in seedlings of four other dicots (Phaseolus aureas, Glycine max, Lactuca sativa, Sinapis arvensis) and two monocots (Hordeum vulgares, Triticum aestivum) were also increased in response to ethylene. Our results suggest an important regulatory role for ethylene in the metabolism of cyanide by higher plants.

  17. Performance of Spodoptera litura Fabricius on different host plants: influence of nitrogen and total phenolics of plants and mid-gut esterase activity of the insect.

    PubMed

    Ghumare, S S; Mukherjee, S N

    2003-08-01

    Five host plants [castor, Ricinus communis (Carolus Linnaeus); cotton, Gossypium hirsutm (Carolus Linnaeus); tomato, Lycopersicum esculentum (Philip Miller); mint, Mentha arvensis (Carolus Linnaeus) and cabbage, Brassica oleracea (Carolus Linnaeus)] belonging to different families were used to study the performance of the Asian armyworm, Spodoptera litura larvae. Highest consumption of food and dry weight gain was observed in larvae fed on castor. Mint did not support optimum larval growth because of low digestibility and low efficiency of conversion of digested food to body matter. Dry weight gain ranged from 26.64 mg on mint to 86.80 mg in castor. These differences tend to be related to nitrogen and total phenolics content of the leaf tissues; however, the most clear-cut correlation is an inverse one between the host plant preference and the ratio of total phenolics to nitrogen in the leaf tissues. Mid-gut esterase activity in larvae showed an increasing trend with the increase in total phenolics: nitrogen ratio in the test plants and the order of mid-gut esterase activity in larvae was mint > cabbage > cotton > tomato > castor. PMID:15248492

  18. Complete DNA sequence of the mitochondrial genome of the ascidian Halocynthia roretzi (Chordata, Urochordata).

    PubMed

    Yokobori, S i; Ueda, T; Feldmaier-Fuchs, G; Pääbo, S; Ueshima, R; Kondow, A; Nishikawa, K; Watanabe, K

    1999-12-01

    The complete nucleotide sequence of the 14,771-bp-long mitochondrial (mt) DNA of a urochordate (Chordata)-the ascidian Halocynthia roretzi-was determined. All the Halocynthia mt-genes were found to be located on a single strand, which is rich in T and G rather than in A and C. Like nematode and Mytilus edulis mtDNAs, that of Halocynthia encodes no ATP synthetase subunit 8 gene. However, it does encode an additional tRNA gene for glycine (anticodon TCT) that enables Halocynthia mitochondria to use AGA and AGG codons for glycine. The mtDNA carries an unusual tRNA(Met) gene with a TAT anticodon instead of the usual tRNA(Met)(CAT) gene. As in other metazoan mtDNAs, there is not any long noncoding region. The gene order of Halocynthia mtDNA is completely different from that of vertebrate mtDNAs except for tRNA(His)-tRNA(Ser)(GCU), suggesting that evolutionary change in the mt-gene structure is much accelerated in the urochordate line compared with that in vertebrates. The amino acid sequences of Halocynthia mt-proteins deduced from their gene sequences are quite different from those in other metazoans, indicating that the substitution rate in Halocynthia mt-protein genes is also accelerated.

  19. Effect of Temperature on Fimbrial Gene Expression and Adherence of Enteroaggregative Escherichia coli.

    PubMed

    Hinthong, Woranich; Indrawattana, Nitaya; Pitaksajjakul, Pannamthip; Pipattanaboon, Chonlatip; Kongngoen, Thida; Tharnpoophasiam, Prapin; Worakhunpiset, Suwalee

    2015-08-01

    The influence of temperature on bacterial virulence has been studied worldwide from the viewpoint of climate change and global warming. The bacterium enteroaggregative Escherichia coli (EAEC) is the causative agent of watery diarrhea and shows an increasing incidence worldwide. Its pathogenicity is associated with the virulence factors aggregative adherence fimbria type I and II (AAFI and AAFII), encoded by aggA and aafA in EAEC strains 17-2 and 042, respectively. This study focused on the effect of temperature increases from 29 °C to 40 °C on fimbrial gene expression using real-time PCR, and on its virulence using an aggregative adherence assay and biofilm formation assay. Incubation at 32 °C caused an up-regulation in both EAEC strains 17-2 and strain 042 virulence gene expression. EAEC strain 042 cultured at temperature above 32 °C showed down-regulation of aafA expression except at 38 °C. Interestingly, EAEC cultured at a high temperature showed a reduced adherence to cells and an uneven biofilm formation. These results provide evidence that increases in temperature potentially affect the virulence of pathogenic EAEC, although the response varies in each strain. PMID:26213951

  20. The complete mitochondrial genome of jade perch, Scortum barcoo (Perciformes: Terapontidae: Scortum).

    PubMed

    Liu, Chun; Li, Kaibin; Wang, Qing; Wang, Fang; Zeng, Weiwei; Mai, Xiaomei; Wu, Shuqin

    2016-09-01

    This is the first documentation of the complete mitochondrial genome sequence of the jade perch, Scortum barcoo. The 16,843 bp mitogenome containes 37 genes (13 protein-coding genes, 22 transfer RNA genes, and 2 ribosomal RNA genes) and two main non-coding regions (the control region and the origin of the light strand replication) as do other vertebrate mitogenomes. The overall base composition of S. barcoo is 27.39% for A, 24.74% for T, 31.14% for C and 16.73% for G, with a slight A + T bias of 52.13%. All protein-coding genes are initiated with ATG except for COX1, which begin with GTG instead. Meanwhile, the termination codons of 13 protein-coding genes are varied with TAA, TAG, TA, T or AGG. The measure of complete mitogenome sequence of S. barcoo will provide fundamental data for the phylogenetic and biogeographic studies of the Terapontidae.

  1. New LIC Vectors For Production of Proteins from Genes Containing Rare Codons

    PubMed Central

    Eschenfeldt, William H.; Makowska-Grzyska, Magdalena; Stols, Lucy; Donnelly, Mark; Jedrzejczak, Robert; Joachimiak, Andrzej

    2014-01-01

    In the effort to produce proteins coded by diverse genomes, structural genomics projects often must express genes containing codons that are rare in the production strain. To address this problem, genes expressing tRNAs corresponding to those codons are typically coexpressed from a second plasmid in the host strain, or from genes incorporated into production plasmids. Here we describe the modification of a series of LIC pMCSG vectors currently used in the high-throughput production of proteins to include crucial tRNA genes covering rare codons for Arg (AGG/AGA) and Ile (AUA). We also present variants of these new vectors that allow analysis of ligand binding or co-expression of multiple proteins introduced through two independent LIC steps. Additionally, to accommodate the cloning of multiple large proteins, the size of the plasmids was reduced by approximately one kilobase through the removal of non-essential DNA from the base vector. Production of proteins from core vectors of this series validated the desired enhanced capabilities: higher yields of proteins expressed from genes with rare codons occurred in most cases, biotinylated derivatives enabled detailed automated ligand binding analysis, and multiple proteins introduced by dual LIC cloning were expressed successfully and in near balanced stoichiometry, allowing tandem purification of interacting proteins. PMID:24057978

  2. A comparative study of interaction of ibuprofen with biocompatible polymers.

    PubMed

    Khan, Iqrar A; Anjum, Kahkashan; Ali, Mohd Sajid; Kabir-ud Din

    2011-11-01

    In this paper we are reporting the interaction of a non-steroidal anti-inflammatory drug ibuprofen (IBF) with various biocompatible polymers. Being amphiphilic, the drug interacts with the polymers similar to the interaction of surfactants and polymers. Therefore, we have considered the polymer-amphiphile interaction approach using conductimetry. The polymers of different charges (cationic, anionic, and nonionic) have been taken for the study. It was found that the critical aggregation concentration (cac) decreases on increasing the polymer concentrations of cationic as well as nonionic polymers whereas it increases for anionic polymers. The results imply that anionic IBF interacts with cationic and nonionic polymers more strongly as compared to the anionic polymers. A possible anionic-anionic repulsion is responsible for the weak interaction of IBF with anionic polymers. On the other side, the critical micelle concentration (cmc) increases for all polymers which is a usual indication of the interaction between amphiphiles and polymers. Free energies of aggregation (ΔG(agg)) and micellization (ΔG(mic)) were also computed with the help of degrees of micelle ionization obtained from the specific conductivity - [IBF] isotherms.

  3. The Involvement of Protease Nexin-1 (PN1) in the Pathogenesis of Intervertebral Disc (IVD) Degeneration

    PubMed Central

    Wu, Xinghuo; Liu, Wei; Duan, Zhenfeng; Gao, Yong; Li, Shuai; Wang, Kun; Song, Yu; Shao, Zengwu; Yang, Shuhua; Yang, Cao

    2016-01-01

    Protease nexin-1 (PN-1) is a serine protease inhibitor belonging to the serpin superfamily. This study was undertaken to investigate the regulatory role of PN-1 in the pathogenesis of intervertebral disk (IVD) degeneration. Expression of PN-1 was detected in human IVD tissue of varying grades. Expression of both PN-1 mRNA and protein was significantly decreased in degenerated IVD, and the expression levels of PN-1 were correlated with the grade of disc degeneration. Moreover, a decrease in PN-1 expression in primary NP cells was confirmed. On induction by IL-1β, the expression of PN-1 in NP cells was decreased at day 7, 14, and 21, as shown by western blot analysis and immunofluorescence staining. PN-1 administration decreased IL-1β-induced MMPs and ADAMTS production and the loss of Agg and Col II in NP cell cultures through the ERK1/2/NF-kB signaling pathway. The changes in PN-1 expression are involved in the pathogenesis of IVD degeneration. Our findings indicate that PN-1 administration could antagonize IL-1β-induced MMPs and ADAMTS, potentially preventing degeneration of IVD tissue. This study also revealed new insights into the regulation of PN-1 expression via the ERK1/2/NF-kB signaling pathway and the role of PN-1 in the pathogenesis of IVD degeneration. PMID:27460424

  4. Molecular Correlates and Recent Advancements in the Diagnosis and Screening of FMR1-Related Disorders

    PubMed Central

    Rajan-Babu, Indhu-Shree; Chong, Samuel S.

    2016-01-01

    Fragile X syndrome (FXS) is the most common monogenic cause of intellectual disability and autism. Molecular diagnostic testing of FXS and related disorders (fragile X-associated primary ovarian insufficiency (FXPOI) and fragile X-associated tremor/ataxia syndrome (FXTAS)) relies on a combination of polymerase chain reaction (PCR) and Southern blot (SB) for the fragile X mental retardation 1 (FMR1) CGG-repeat expansion and methylation analyses. Recent advancements in PCR-based technologies have enabled the characterization of the complete spectrum of CGG-repeat mutation, with or without methylation assessment, and, as a result, have reduced our reliance on the labor- and time-intensive SB, which is the gold standard FXS diagnostic test. The newer and more robust triplet-primed PCR or TP-PCR assays allow the mapping of AGG interruptions and enable the predictive analysis of the risks of unstable CGG expansion during mother-to-child transmission. In this review, we have summarized the correlation between several molecular elements, including CGG-repeat size, methylation, mosaicism and skewed X-chromosome inactivation, and the extent of clinical involvement in patients with FMR1-related disorders, and reviewed key developments in PCR-based methodologies for the molecular diagnosis of FXS, FXTAS and FXPOI, and large-scale (CGG)n expansion screening in newborns, women of reproductive age and high-risk populations. PMID:27754417

  5. A model of interaction: aflatoxins and hepatitis viruses in liver cancer aetiology and prevention.

    PubMed

    Wild, Christopher P; Montesano, Ruggero

    2009-12-01

    Hepatocellular carcinoma (HCC) is one of the most common cancers worldwide and has an extremely poor prognosis. The majority of cases occur in south-east Asia and sub-Saharan Africa where the major risk factors are chronic infection with hepatitis B and C viruses (HBV and HCV) as well as dietary exposure to aflatoxins. Aflatoxin B1, the most commonly occurring and potent of the aflatoxins is associated with a specific AGG to AGT transversion mutation at codon 249 of the p53 gene in human HCC, providing mechanistic support to a causal link between exposure and disease. Prospective epidemiological studies have shown a more than multiplicative interaction between HBV and aflatoxins in terms of HCC risk. However, the biology underlying this statistical interaction is not fully understood. There are a number of potential mechanisms including, among others: the fixation of AFB1-induced mutations in the presence of liver regeneration and hyperplasia induced by chronic HBV infection; the predisposition of HBV-infected hepatocytes to aflatoxin-induced DNA damage; an increase in susceptibility to chronic HBV infection in aflatoxin-exposed individuals; and oxidative stress exacerbated by co-exposure to aflatoxins and chronic hepatitis infection. Priorities for prevention are global HBV vaccination, primary and secondary prevention strategies against aflatoxin and the avoidance of transmission of HCV through good hygiene practices.

  6. Structure of poly(styrene-b-ethylene-alt-propylene) diblock copolymer micelles in squalane.

    PubMed

    Choi, Soo-Hyung; Bates, Frank S; Lodge, Timothy P

    2009-10-22

    The temperature dependence of the micellar structures formed by poly(styrene-b-ethylene-alt-propylene) (SEP) diblock copolymers in squalane, a highly selective solvent for the PEP blocks, has been studied using dynamic light scattering (DLS) and small-angle X-ray scattering (SAXS). Four SEP diblock copolymers were prepared by sequential anionic polymerization of styrene and isoprene, followed by hydrogenation of the isoprene blocks, to yield SEP(17-73), SEP(26-66), SEP(36-69), and SEP(42-60), where the numbers indicate block molecular weights in kDa. All four polymers formed well-defined spherical micelles. In dilute solution, DLS provided the temperature-dependent mean hydrodynamic radius, R(h), and its distribution, while detailed fitting of the SAXS profiles gave the core radius, R(c), the equivalent hard sphere radius, R(hs), and an estimate of the aggregation number, N(agg). In general, the micelles became smaller as the critical micelle temperature (CMT) was approached, which was well above the glass transition of the core block. As concentration increased the micelles packed onto body centered cubic lattices for all four copolymers, which underwent order-disorder transitions upon heating near the dilute solution CMTs. The results are discussed in terms of current understanding of block copolymer solution self-assembly, and particular attention is paid to the issue of equilibration, given the high glass transition temperature of the core block.

  7. Effects of PEG size on structure, function and stability of PEGylated BSA.

    PubMed

    Plesner, Bitten; Fee, Conan J; Westh, Peter; Nielsen, Anders D

    2011-10-01

    The effects of PEGylation on the structural, thermal and functional stability of bovine serum albumin (BSA) were investigated using BSA and 6 linear mono-PEGylated BSA compounds. The secondary and tertiary structure of BSA measured by circular dichroism (CD) was independent of PEGylation. In contrast, the thermal stability of BSA was affected by PEGylation. The apparent unfolding temperature T(max) measured by differential scanning calorimetry (DSC) decreased with PEGylation, whereas the temperature of aggregation, T(agg), measured by dynamic light scattering (DLS) increased with PEGylation. The unfolding temperature and the temperature of aggregation were both independent of the molecular weight of the PEG chain. Possible functional changes of BSA after PEGylation were measured by Isothermal Titration Calorimetry (ITC), where the binding of sodium dodecyl sulphate (SDS) to BSA and PEGylated BSA was analysed. At 25°C, two distinct classes of binding sites (high affinity and low affinity) for BSA and one class of binding site (low affinity) for PEGylated BSA were identified. The binding isotherm was modelled assuming independence and thermodynamic equivalence of the sites within each class. From the present biophysical characterisation, it is concluded that after PEGylation BSA appears to be unaffected structurally (secondary and tertiary structure), slightly destabilised thermally (unfolding temperature), stabilised kinetically (temperature of aggregation) and has an altered functionality (binding profile). These biophysical characteristics are all independent of the molecular weight of the attached polymer chain.

  8. Surveys of microfungi in a former industrial area in Duisburg-Nord.

    PubMed

    Feige, G B; Ale-Agha, N; Dachowski, M; Kricke, R

    2002-01-01

    One hundred and forty microfungi (Ascomycetes and Deuteromycetes) were collected in the "Landschaftspark Duisburg-Nord" located in North Rhine-Westphalia. New hosts for rarely found fungi are recorded for the first time. New for Germany are Massaria inquinans (Tode) De Not. and Nitschkia grevillei (Rhem) Nannf. on Acer pseudoplatanus L., Pirottaea nigrostriata Graddon on Artemisia vulgaris L., Ceratopycnis clematidis Höhn. on Clematis vitalba L., Dasyscyphus aff. humuli (W. Phillips) Dennis on Humulus lupulus L. and Leptosphaeria derasa (Berk. & Br.) Auersw. on Senecio inaequidens DC. New for North Rhine-Westphalia are Chaetosphaerella phaeostroma (Durieu & Mont.) E. Müller & Booth and Phomopsis platanoides (Cooke) Died. on Acer pseudoplatanus L., Microsphaeropsis pseudaspera Sutton, Mycosphaerella osborniae D. Hawksw. & Sivan. and Phomopsis oblita Sacc. on Artemisia vulgaris L., Leptosphaeria acuta (Fr.) P. Karst. and Leptosphaeria doliolum (Pers.) Ces. & De Not. on Bryonia dioica Jacq., Ophiobolus erythrosporus (Riess) G. Winter and Pleospora herbarum (Pers.) Rabenh. ex Ces. & De Not. on Dipsacus sylvestris (Huds), Keissleriella ocellata (Niessl) Bose on Hypericum perforatum L., Dactylaria aff. graminicola on Lolium perenne L., Siroplacodium aff. atrum on Oenothera beinnis L., Diatrypella favacea (Fr.) Sacc. on Prunus spec., Hapalosphaeria deformans (Syd.) Syd. and Microdiscula rubicola (Bres.) Höhn. on Rubus fructicosus agg. L., Cryptodiaporthe salicina (Pers.) Wehm. on Salix alba L. and Pleurophoma pleurospora (Sacc.) Höhn. on Salix caprea L.

  9. Diarrheagenic Escherichia coli detected by 16-plex PCR in raw meat and beef intestines sold at local markets in Ouagadougou, Burkina Faso.

    PubMed

    Kagambèga, Assèta; Martikainen, Outi; Lienemann, Taru; Siitonen, Anja; Traoré, Alfred S; Barro, Nicolas; Haukka, Kaisa

    2012-02-01

    The study investigated the prevalence of five major Escherichia coli pathogroups in raw meats and beef intestines sold at the local markets in Ouagadougou, Burkina Faso. One hundred and twenty samples (36 beef, 36 beef intestine, 24 mutton and 24 chicken samples) were purchased from four markets between October 2008 and February 2009. Fifteen virulence genes specific for Shiga toxin-producing E. coli (STEC), enteropathogenic E. coli (EPEC), enterotoxigenic E. coli (ETEC), enteroinvasive E. coli (EIEC) and enteroaggregative E. coli (EAEC) were examined using 16-plex PCR for mixed bacterial cultures derived from the samples. One or more diarrheagenic E. coli pathogroup was detected in 51 (43%) of all the 120 samples: in 16 (44%) beef, 19 (53%) beef intestine, 9 (38%) mutton and in 7 (29%) chicken samples. Thirty three (28%) samples were positive for stx(1) and/or stx(2) indicating presence of STEC. EPEC virulence markers (eae, escV and/or ent and/or bfp and/or EHEC-hlyA) were detected in 14 (12%) stx-negative samples. ETEC virulence markers (elt and/or estIb and/or estIa) were detected in 10 (8%) samples and EAEC virulence markers (pic or aggR) in 5 (4%) samples. No EIEC was detected. The results show that in Burkina Faso the microbiological quality of retail meat is alarmingly poor due to the common occurrence of diarrheagenic E. coli bacteria.

  10. Prevalence of Virulence Genes Associated with Pathogenic Escherichia coli Strains Isolated from Domestically Harvested Rainwater during Low- and High-Rainfall Periods

    PubMed Central

    Dobrowsky, P. H.; van Deventer, A.; De Kwaadsteniet, M.; Ndlovu, T.; Khan, S.; Cloete, T. E.

    2014-01-01

    The possible health risks associated with the consumption of harvested rainwater remains one of the major obstacles hampering its large-scale implementation in water limited countries such as South Africa. Rainwater tank samples collected on eight occasions during the low- and high-rainfall periods (March to August 2012) in Kleinmond, South Africa, were monitored for the presence of virulence genes associated with Escherichia coli. The identity of presumptive E. coli isolates in rainwater samples collected from 10 domestic rainwater harvesting (DRWH) tanks throughout the sampling period was confirmed through universal 16S rRNA PCR with subsequent sequencing and phylogenetic analysis. Species-specific primers were also used to routinely screen for the virulent genes, aggR, stx, eae, and ipaH found in enteroaggregative E. coli (EAEC), enterohemorrhagic E. coli (EHEC), enteropathogenic E. coli (EPEC), and enteroinvasive E. coli, respectively, in the rainwater samples. Of the 92 E. coli strains isolated from the rainwater using culture based techniques, 6% were presumptively positively identified as E. coli O157:H7 using 16S rRNA. Furthermore, virulent pathogenic E. coli genes were detected in 3% (EPEC and EHEC) and 16% (EAEC) of the 80 rainwater samples collected during the sampling period from the 10 DRWH tanks. This study thus contributes valuable information to the limited data available regarding the ongoing prevalence of virulent pathotypes of E. coli in harvested rainwater during a longitudinal study in a high-population-density, periurban setting. PMID:24375127

  11. Decoding mechanism of non-universal genetic codes in Loligo bleekeri mitochondria.

    PubMed

    Ohira, Takayuki; Suzuki, Takeo; Miyauchi, Kenjyo; Suzuki, Tsutomu; Yokobori, Shin-ichi; Yamagishi, Akihiko; Watanabe, Kimitsuna

    2013-03-15

    Non-universal genetic codes are frequently found in animal mitochondrial decoding systems. In squid mitochondria, four codons deviate from the universal genetic code, namely AUA, UGA, and AGA/AGG (AGR) for Met, Trp, and Ser, respectively. To understand the molecular basis for establishing the non-universal genetic code, we isolated and analyzed five mitochondrial tRNAs from a squid, Loligo bleekeri. Primary structures of the isolated tRNAs, including their post-transcriptional modifications, were analyzed by mass spectrometry. tRNA(Met)(AUR) possessed an unmodified cytidine at the first position of the anticodon, suggesting that the AUA codon is deciphered by CAU anticodon via non-canonical A-C pairing. We identified 5-taurinomethyluridine (τm(5)U) at the first position of the anticodon in tRNA(Trp)(UGR). τm(5)U enables tRNA(Trp) to decipher UGR codons as Trp. In addition, 5-taurinomethyl-2-thiouridine (τm(5)s(2)U) was found in mitochondrial tRNAs for Leu(UUR) and Lys in L. bleekeri. This is the first discovery of τm(5)U and τm(5)s(2)U in molluscan mitochondrial tRNAs.

  12. Combined Genotype Analyses of Precursor miRNA196a2 and 499a Variants with Hepatic and Renal Cancer Susceptibility a Preliminary Study.

    PubMed

    Toraih, Eman A; Fawz, Manal S; Elgazzaz, Mona G; Hussein, Mohammad H; Shehata, Rasha H; Daoud, Hisham G

    2016-01-01

    MicroRNAs, a novel class of small noncoding RNAs, are key players in many cellular processes, including cell proliferation, differentiation, invasion and regeneration. Tissue and circulatory microRNAs could serve as useful clinical biomarkers and deregulated expression levels have been observed in various cancers. Gene variants may alter microRNA processing and maturation. Thus, we aimed to investigate the association of MIR196a2 rs11614913 (C/T), MIR499a rs3746444 (A/G) polymorphisms and their combination with cancer susceptibility in an Egyptian population. Sixty five renal cell carcinoma (RCC) and 60 hepatocellular carcinoma (HCC) patients and 150 controls were enrolled in the study. They were genotyped using realtime polymerase chain reaction technology. Both miR196a2*T and miR499a*G were associated with RCC risk, but only miR196a*T was associated with HCC development. Carriage of the homozygote combinations (MIR196a2*TT + MIR499a*AA) and (MIR196a2*CC + MIR499a*GG) was associated with 25 and 48 fold elevation of likelhood to develop RCC, respectively. The miR196a2 SNP was also linked with larger tumor size in RCC and advanced tumor stage in HCC. miR196a2 and miR499a combined genotypes were associated with RCC and HCC. Further functional analysis of SNPs is required to confirm relationships between genotypes and phenotypes. PMID:27509977

  13. Mimicked cartilage scaffolds of silk fibroin/hyaluronic acid with stem cells for osteoarthritis surgery: Morphological, mechanical, and physical clues.

    PubMed

    Jaipaew, Jirayut; Wangkulangkul, Piyanun; Meesane, Jirut; Raungrut, Pritsana; Puttawibul, Puttisak

    2016-07-01

    Osteoarthritis is a critical disease that comes from degeneration of cartilage tissue. In severe cases surgery is generally required. Tissue engineering using scaffolds with stem cell transplantation is an attractive approach and a challenge for orthopedic surgery. For sample preparation, silk fibroin (SF)/hyaluronic acid (HA) scaffolds in different ratios of SF/HA (w/w) (i.e., 100:0, 90:10, 80:20, and 70:30) were formed by freeze-drying. The morphological, mechanical, and physical clues were considered in this research. The morphological structure of the scaffolds was observed by scanning electron microscope. The mechanical and physical properties of the scaffolds were analyzed by compressive and swelling ratio testing, respectively. For the cell experiments, scaffolds were seeded and cultured with human umbilical cord-derived mesenchymal stem cells (HUMSCs). The cultured scaffolds were tested for cell viability, histochemistry, immunohistochemistry, and gene expression. The SF with HA scaffolds showed regular porous structures. Those scaffolds had a soft and elastic characteristic with a high swelling ratio and water uptake. The SF/HA scaffolds showed a spheroid structure of the cells in the porous structure particularly in the SF80 and SF70 scaffolds. Cells could express Col2a, Agg, and Sox9 which are markers for chondrogenesis. It could be deduced that SF/HA scaffolds showed significant clues for suitability in cartilage tissue engineering and in surgery for osteoarthritis. PMID:27127042

  14. The primary transcriptome of the Escherichia coli O104:H4 pAA plasmid and novel insights into its virulence gene expression and regulation

    PubMed Central

    Berger, Petya; Knödler, Michael; Förstner, Konrad U.; Berger, Michael; Bertling, Christian; Sharma, Cynthia M.; Vogel, Jörg; Karch, Helge; Dobrindt, Ulrich; Mellmann, Alexander

    2016-01-01

    Escherichia coli O104:H4 (E. coli O104:H4), which caused a massive outbreak of acute gastroenteritis and hemolytic uremic syndrome in 2011, carries an aggregative adherence fimbriae I (AAF/I) encoding virulence plasmid, pAA. The importance of pAA in host-pathogen interaction and disease severity has been demonstrated, however, not much is known about its transcriptional organization and gene regulation. Here, we analyzed the pAA primary transcriptome using differential RNA sequencing, which allows for the high-throughput mapping of transcription start site (TSS) and non-coding RNA candidates. We identified 248 TSS candidates in the 74-kb pAA and only 21% of them could be assigned as TSS of annotated genes. We detected TSS for the majority of pAA-encoded virulence factors. Interestingly, we mapped TSS, which could allow for the transcriptional uncoupling of the AAF/I operon, and potentially regulatory antisense RNA candidates against the genes encoding dispersin and the serine protease SepA. Moreover, a computational search for transcription factor binding sites suggested for AggR-mediated activation of SepA expression, which was additionally experimentally validated. This work advances our understanding of the molecular basis of E. coli O104:H4 pathogenicity and provides a valuable resource for further characterization of pAA virulence gene regulation. PMID:27748404

  15. Rapid identification and differentiation of non-O157 Shiga toxin-producing Escherichia coli using polymerase chain reaction coupled to electrospray ionization mass spectrometry.

    PubMed

    Shen, Jinling; Wang, Fei; Li, Feng; Housley, Roberta; Carolan, Heather; Yasuda, Irene; Burrows, Erik; Binet, Rachel; Sampath, Rangarajan; Zhang, Jianmin; Allard, Marc W; Meng, Jianghong

    2013-08-01

    A polymerase chain reaction (PCR)-mass spectroscopy assay was developed to identify non-O157 Shiga toxin-producing Escherichia coli (STEC) with Plex-ID biosensor system, a platform identifying short PCR amplicons by specific base compositions. This assay simultaneously amplifies five fragments of two housekeeping genes, two subunits of stx2 gene, and four other virulence genes of STEC. A total of 164 well-characterized STEC isolates were examined with the assay to build a DNA base composition database. Another panel of 108 diverse STEC isolates was tested with the established database to evaluate the assay's identification capability. Among the 108 isolates, the assay specificity was 100% for three (stx1, eae, and aggA) out of five tested virulence genes, but 99% for stx2 and 96% for hlyA, respectively. Main stx1/stx2 subtypes and multiple alleles of stx1/stx2 could be differentiated. The assay successfully identified several clinically significant serotypes, including O91:H14, O103:H25, O145:H28/NM, O113:H21, and O104:H4. Meanwhile, it was able to group isolates with different levels of pathogenic potential. The results suggest that this high-throughput method may be useful in clinical and regulatory laboratories for STEC identification, particularly strains with increased pathogenic potential.

  16. Enterobacteria identification and detection of diarrheagenic Escherichia coli in a Port Complex

    PubMed Central

    Costa, Clarissa Frota Macatrão; Neto, Valério Monteiro; Santos, Bruno Rafael de Carvalho; Costa, Bruno Rafael Rabelo; Azevedo, Alexandre; Serra, Josilene Lima; Mendes, Hermínio Benítez Rabello; Nascimento, Adenilde Ribeiro; Mendes, Mariana Bonfim Pinto; Kuppinger, Oliver

    2014-01-01

    The Port Complex of Maranhão (PCM) is the second largest port complex in Brazil, receiving ships with large volumes of ballast water. To evaluate the microbiological quality of its waters, physicochemical parameters (pH and salinity), the number of coliforms (thermotolerants and totals), and the presence of enterobacterias and diarrheagenic Escherichia coli strains were analyzed. In order to identify the presence of E. coli virulence genes target regions of the stx, elt, est, aggR, CVD432, ipaH and eae nucleotide sequences were studied. The presence of totals and thermotolerants coliforms were positive. Analyzing the salinity parameter, a significant increase in total coliforms was observed during the rainy season. We identified the species Escherichia coli, Proteus mirabilis, Citrobacter freundii, Proteus vulgaris, Klebsiella pneumoniae, Klebsiella ozaenae, Morganella morganii, Enterobacter cloacae and Edwardsiella tarda. Out of the 51 E. coli isolated, two were positive for the elt gene and one was positive for the CVD432 sequence, features of enterotoxigenic and enteroaggregative strains, respectively. This study reveals that the PCM is contaminated by enterobacteria and diarrheagenic E.coli thus providing evidence regarding the risk of these bacteria being carried by ships to other countries, and draws attention to the input of fecal bacteria brought by ships in the port waters of Maranhão. PMID:25477930

  17. Use of molecular beacons to probe for messenger RNA release from ribosomes during 5'-translational blockage by consecutive low-usage codons in Escherichia coli

    NASA Astrophysics Data System (ADS)

    Gao, Wenwu; Tyagi, Sanjay; Kramer, Fred R.; Goldman, Emanuel

    2000-03-01

    In `5'-translational blockage,' significantly reduced yields of proteins are synthesized in Escherichia coli when consecutive low-usage codons are inserted near translation starts of messages (with reduced or no effect when these same codons are inserted downstream). We tested the hypothesis that ribosomes encountering these low-usage codons prematurely release the mRNA. RNA from polysome gradients was fractionated into pools of polysomes, monosomes and ribosomes-free. New hybridization probes, called `molecular beacons,' and standard slot-blots, were used to detect test messages containing either consecutive low-usage AGG (arginine) or synonymous high-usage CGU insertions near the 5' end. The results show an approximately twofold increase in the ratio of free to bound mRNA when the low-usage codons were present compared to high-usage codons. In contrast, there was no difference in the ratio of free to bound mRNA when consecutive low-usage CUA or high-usage CUG (leucine) codons were inserted, or when the arginine codons were inserted near the 3' end. These data indicate that at least some mRNA is released from ribosomes during 5'-translational blockage by arginine but not leucine codons, and they support proposals that premature termination of translation can occur in some conditions in vivo in the absence of a stop codon.

  18. Carriage of One or Two FMR1 Premutation Alleles Seems to Have No Effect on Illness Severity in a FXTAS Female with an Autozygous FMR1 Premutation Allele.

    PubMed

    Rodriguez-Revenga, Laia; Pagonabarraga, Javier; Gómez-Anson, Beatriz; López-Mourelo, Olga; Izquierdo, Silvia; Alvarez-Mora, Maria Isabel; Granell, Esther; Madrigal, Irene; Milà, Montserrat

    2016-10-01

    Fragile X-associated tremor/ataxia syndrome (FXTAS) is a late-onset neurodegenerative disorder that occurs in FMR1 premutation carriers. The prevalence of FMR1 premutation carriers in the general population is relatively high, and although rare, a premutation in both X chromosomes may occur in females inheriting a premutation allele from each of both parent carriers. Here, we report the first female with an autozygous (homozygous by descendent) FMR1 premutation allele, who fulfills neurological and radiological FXTAS findings/criteria. Molecular characterization included CGG repeat length, AGG interruption pattern, FMR1 messenger RNA (mRNA), fragile X mental retardation protein (FMRP) level quantification, and single-nucleotide polymorphism (SNP) microarray. Neuroradiological assessment of 3-T magnetic resonance imaging and neurological and cognitive/neuropsychological evaluations were performed. Neurological and neuroradiological examination of the female with the same FMR1 allele in the premutation range (77 CGGs) demonstrated FXTAS features. Further familial evaluation showed a similar neuropsychiatric profile, with impairments in cognitive flexibility and visuospatial function, mainly. A unique family with an autozygous FMR1 premutation female is presented. Neurological/cognitive and neuroradiological examinations revealed FXTAS-specific findings in the female with the autozygous FMR1 premutation allele. The consistent molecular and cognitive/psychiatric phenotype in family members suggests that carrying one or two FMR1 premutation alleles has no effect on illness severity.

  19. Genetic association of cyclooxygenase-2 gene polymorphisms with Parkinson’s disease susceptibility in Chinese Han population

    PubMed Central

    Dai, Yi; Wu, Yuquan; Li, Yansheng

    2015-01-01

    Objective: The aim of this study was to explore the genetic association of cyclooxygenase-2 (COX2) gene promoter region polymorphisms with Parkinson’s disease (PD) susceptibility in Chinese Han population. Methods: The genotyping of COX2 gene polymorphisms was conducted by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) in 122 patients with PD and 120 healthy persons. The association strength of gene polymorphism with disease was measured by odds ratio (OR) and 95% confidence interval (95% CI) calculated using χ2 test which also evaluated the Hardy-Weinberg equilibrium (HWE) of gene polymorphism in controls. The linkage disequilibrium and haplotype were also analyzed as evidence in the analysis of association. Results: On condition that the genotypes distributions of COX2 -1290A>G, -1195G>A, -765G>C in the control group all conformed to HWE, however, only the homozygous genotype AA of -1195G>A polymorphism showed an association with PD (OR=0.432, 95% CI=0.196-0.950). In addition, in haplotype analysis, G-A-C haplotype frequency in cases was significantly lower than the controls, compared with the common haplotype A-G-G (P=0.031, OR=0.375, 95% CI=0.149-0.940). Conclusions: COX2 -1195G>A polymorphism might play a protective role in the onset of PD and G-A-C haplotype in this three promoter region polymorphisms also showed a negative association. PMID:26722563

  20. Defining pathogenic verocytotoxin-producing Escherichia coli (VTEC) from cases of human infection in the European Union, 2007-2010.

    PubMed

    Messens, W; Bolton, D; Frankel, G; Liebana, E; McLAUCHLIN, J; Morabito, S; Oswald, E; Threlfall, E J

    2015-06-01

    During 2007-2010, 13 545 confirmed human verocytotoxin (VT)-producing Escherichia coli (VTEC) infections were reported in the European Union, including 777 haemolytic uraemic syndrome (HUS) cases. Clinical manifestations were reported for 53% of cases, 64% of which presented with diarrhoea alone and 10% with HUS. Isolates from 85% of cases were not fully serotyped and could not be classified on the basis of the Karmali seropathotype concept. There is no single or combination of phenotypic or genetic marker(s) that fully define 'pathogenic' VTEC. Isolates which contain the vtx2 (verocytotoxin 2) gene in combination with the eae (intimin-encoding) gene or aaiC (secreted protein of enteroaggregative E. coli) and aggR (plasmid-encoded regulator) genes have been associated with a higher risk of more severe illness. A molecular approach targeting genes encoding VT and other virulence determinants is thus proposed to allow an assessment of the potential severity of disease that may be associated with a given VTEC isolate. PMID:25921781

  1. Enterobacteria identification and detection of diarrheagenic Escherichia coli in a Port Complex.

    PubMed

    Costa, Clarissa Frota Macatrão; Monteiro Neto, Valério; Santos, Bruno Rafael de Carvalho; Costa, Bruno Rafael Rabelo; Azevedo, Alexandre; Serra, Josilene Lima; Mendes, Hermínio Benítez Rabello; Nascimento, Adenilde Ribeiro; Mendes, Mariana Bonfim Pinto; Kuppinger, Oliver

    2014-01-01

    The Port Complex of Maranhão (PCM) is the second largest port complex in Brazil, receiving ships with large volumes of ballast water. To evaluate the microbiological quality of its waters, physicochemical parameters (pH and salinity), the number of coliforms (thermotolerants and totals), and the presence of enterobacterias and diarrheagenic Escherichia coli strains were analyzed. In order to identify the presence of E. coli virulence genes target regions of the stx, elt, est, aggR, CVD432, ipaH and eae nucleotide sequences were studied. The presence of totals and thermotolerants coliforms were positive. Analyzing the salinity parameter, a significant increase in total coliforms was observed during the rainy season. We identified the species Escherichia coli, Proteus mirabilis, Citrobacter freundii, Proteus vulgaris, Klebsiella pneumoniae, Klebsiella ozaenae, Morganella morganii, Enterobacter cloacae and Edwardsiella tarda. Out of the 51 E. coli isolated, two were positive for the elt gene and one was positive for the CVD432 sequence, features of enterotoxigenic and enteroaggregative strains, respectively. This study reveals that the PCM is contaminated by enterobacteria and diarrheagenic E.coli thus providing evidence regarding the risk of these bacteria being carried by ships to other countries, and draws attention to the input of fecal bacteria brought by ships in the port waters of Maranhão.

  2. Screening of catalytic oxygen reduction reaction activity of metal-doped graphene by density functional theory

    NASA Astrophysics Data System (ADS)

    Chen, Xin; Chen, Shuangjing; Wang, Jinyu

    2016-08-01

    Graphene doping is a promising direction for developing effective oxygen reduction reaction (ORR) catalysts. In this paper, we computationally investigated the ORR performance of 10 kinds of metal-doped graphene (M-G) catalysts, namely, Al-, Si-, Mn-, Fe-, Co-, Ni-, Pd-, Ag-, Pt-, and Au-G. The results shown that the binding energies of the metal atoms incorporated into the graphene vacancy are higher than their bulk cohesive energies, indicating the formed M-G catalysts are even more stable than the corresponding bulk metal surfaces, and thus avoid the metals dissolution in the reaction environment. We demonstrated that the linear relation among the binding energies of the ORR intermediates that found on metal-based materials does not hold for the M-G catalysts, therefore a single binding energy of intermediate alone is not sufficient to evaluate the ORR activity of an arbitrary catalyst. By analysis of the detailed ORR processes, we predicted that the Au-, Co-, and Ag-G materials can be used as the ORR catalysts.

  3. Different VanA Elements in E. faecalis and in E. faecium Suggest at Least Two Origins of Tn1546 Among VRE in a Brazilian Hospital.

    PubMed

    Merlo, Thaís Panhan; Dabul, Andrei Nicoli Gebieluca; Camargo, Ilana Lopes Baratella Cunha

    2015-06-01

    In 2009 during surveillance in a Brazilian hospital, many patients were confirmed to be colonized by vancomycin-resistant enterococci (VRE) and a few infection cases occurred. Among 14 isolates of Enterococcus faecalis, most had the same pulsotype, virulence profile (agg(+)elrA(+)gelE(+)), and were sequence type (ST)103, indicating dissemination of a clone. The 47 Enterococcus faecium were separated into four pulsotypes, the predominant virulence profile being esp(+)acm(+). All of them harbored the hospital marker IS16, and three randomly chosen isolates were ST412, belonging to the Clonal Complex 17. E. faecalis were all susceptible to penicillin and ampicillin, while all E. faecium were resistant to them. All isolates were susceptible to daptomycin and tigecycline. There were no rep-family genes common to all VRE. The VanA element of all E. faecium lost its left-side inverted repeat (IRL) region and had a specific IS insertion. On the other hand, all E. faecalis presented intact Tn1546. The size of plasmids containing the vanA gene as well as its rep-families varied between and within species. The lack of a vanA plasmid common to all VRE, together with the differences among VanA elements, despite the fact that some patients were colonized by both species during their hospitalization, leads us to suggest at least two different Tn1546 origins.

  4. The role of Ag buffer layer in Fe islands growth on Ge (111) surfaces

    SciTech Connect

    Fu, Tsu-Yi Wu, Jia-Yuan; Jhou, Ming-Kuan; Hsu, Hung-Chan

    2015-05-07

    Sub-monolayer iron atoms were deposited at room temperature on Ge (111)-c(2 × 8) substrates with and without Ag buffer layers. The behavior of Fe islands growth was investigated by using scanning tunneling microscope (STM) after different annealing temperatures. STM images show that iron atoms will cause defects and holes on substrates at room temperature. As the annealing temperature rises, iron atoms pull out germanium to form various kinds of alloyed islands. However, the silver layer can protect the Ag/Ge(111)-(√3×√3) reconstruction from forming defects. The phase diagram shows that ring, dot, and triangular defects were only found on Ge (111)-c(2 × 8) substrates. The kinds of islands found in Fe/Ge system are similar to Fe/Ag/Ge system. It indicates that Ge atoms were pulled out to form islands at high annealing temperatures whether there was a Ag layer or not. But a few differences in big pyramidal or strip islands show that the silver layer affects the development of islands by changing the surface symmetry and diffusion coefficient. The structure characters of various islands are also discussed.

  5. Complex organic molecules in comets C/2012 F6 (Lemmon) and C/2013 R1 (Lovejoy): detection of ethylene glycol and formamide

    NASA Astrophysics Data System (ADS)

    Biver, N.; Bockelée-Morvan, D.; Debout, V.; Crovisier, J.; Boissier, J.; Lis, D. C.; Dello Russo, N.; Moreno, R.; Colom, P.; Paubert, G.; Vervack, R.; Weaver, H. A.

    2014-06-01

    A spectral survey in the 1 mm wavelength range was undertaken in the long-period comets C/2012 F6 (Lemmon) and C/2013 R1 (Lovejoy) using the 30 m telescope of the Institut de radioastronomie millimétrique (IRAM) in April and November-December 2013. We report the detection of ethylene glycol (CH2OH)2 (aGg' conformer) and formamide (NH2CHO) in the two comets. The abundances relative to water of ethylene glycol and formamide are 0.2-0.3% and 0.02% in the two comets, similar to the values measured in comet C/1995 O1 (Hale-Bopp). We also report the detection of HCOOH and CH3CHO in comet C/2013 R1 (Lovejoy), and a search for other complex species (methyl formate, glycolaldehyde). Based on observations carried out with the IRAM 30 m telescope. IRAM is supported by INSU/CNRS (France), MPG (Germany) and IGN (Spain).Tables 4 and 5 are available in electronic form at http://www.aanda.orgThe IRAM dataset is available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/566/L5

  6. Determination of lead, cadmium, indium, thallium and silver in ancient ices from Antarctica by isotope dilution-thermal ionization mass spectrometry

    USGS Publications Warehouse

    Matsumoto, A.; Hinkley, T.K.

    1997-01-01

    The concentrations of five chalcophile elements (Pb, Cd, In, Tl and Ag) and the lead isotope rarios in ancient ices from the Taylor Dome near coastal Antarctica, have been determined by the isotope dilutionthermal ionization mass spectrometry (ID-TIMS), with ultra-clean laboratory techniques. The samples were selected from segments of cores, one of which included a visible ash layer. Electric conductivity measurement (ECM) or dielectric properties (DEP) gave distinctive sharp peaks for some of the samples c hosen. Exterior portions of the sample segments were trimmed away by methods described here. Samples w ere evaporated to dryness and later separated into fractions for the five elements using an HBr-HNO3 a nion exchange column method. The concentrations are in the range 2.62-36.7 pg Pb/g of ice, 0.413-2.83 pg Cd/g, 0.081-0.34 pg In/g, 0.096-2.8 pg Tl/g and 0.15-0.84 pg Ag/g. respectively. The dispersions in duplicate analyses are about ??1% for lead and cadmium, ??2% for indium. ??4% for thallium and ??6% for silver, respectively. The concentrations of lead obtained are commonly higher than those in the present-day Antarctic surface snows, but the isotope ratios are distinctively higher than those of the present-day snows and close to those of the other ancient ice collected from a different Antarctic area.

  7. Genetic structure of Pilosocereus gounellei (Cactaceae) as revealed by AFLP marker to guide proposals for improvement and restoration of degraded areas in Caatinga biome.

    PubMed

    Monteiro, E R; Strioto, D K; Meirelles, A C S; Mangolin, C A; Machado, M F P S

    2015-12-15

    Amplified fragment length polymorphism (AFLP) analysis was used to evaluate DNA polymorphism in Pilosocereus gounellei with the aim of differentiating samples grown in different Brazilian semiarid regions. Seven primer pairs were used to amplify 703 AFLP markers, of which 700 (99.21%) markers were polymorphic. The percentage of polymorphic markers ranged from 95.3% for the primer combination E-AAG/M-CTT to 100% for E-ACC/M-CAT, E-ACC/M-CAA, E-AGC/M-CAG, E-ACT/M-CTA, and E-AGG/M-CTG. The largest number of informative markers (126) was detected using the primer combination E-AAC/M-CTA. Polymorphism of the amplified DNA fragments ranged from 72.55% (in sample from Piauí State) to 82.79% (in samples from Rio Grande Norte State), with an average of 75.39%. Despite the high genetic diversity of AFLP markers in xiquexique, analysis using the STRUCTURE software identified relatively homogeneous clusters of xiquexique from the same location, indicating a differentiation at the molecular level, among the plant samples from different regions of the Caatinga biome. The AFLP methodology identified genetically homogeneous and contrasting plants, as well as plants from different regions with common DNA markers. Seeds from such plants can be used for further propagation of plants for establishment of biodiversity conservation units and restoration of degraded areas of the Caatinga biome.

  8. Superhydrophilic molecularly imprinted polymers based on a water-soluble functional monomer for the recognition of gastrodin in water media.

    PubMed

    Ji, Wenhua; Zhang, Mingming; Wang, Daijie; Wang, Xiao; Liu, Jianhua; Huang, Luqi

    2015-12-18

    In this study, the first successfully developed superhydrophilic molecularly imprinted polymers (MIPs) for gastrodin recognition have been described. MIPs were prepared via the bulk polymerization process in an aqueous solution using alkenyl glycosides glucose (AGG) as the water-soluble functional monomer. The non-imprinted polymers (NIPs) were also synthesized using the same method without the use of the template. The dynamic water contact angles and photographs of the dispersion properties confirmed that the molecularly imprinted polymers displayed excellent superhydrophilicity. The results demonstrated that the MIPs exhibited high selectivity and an excellent imprinting effect. A molecularly imprinted solid phase extraction (MISPE) method was established. Optimization of various parameters affecting MISPE was investigated. Under the optimized conditions, a wide linear range (0.001-100.0μgmL(-1)) and low limits of detection (LOD) and quantification (LOQ) (0.03 and 0.09ngmL(-1), respectively) were achieved. When compared with the NIPs, higher recoveries (90.5% to 97.6%) of gastrodin with lower relative standard deviations values (below 6.4%) using high performance liquid chromatography were obtained at three spiked levels in three blank samples. These results demonstrated one efficient, highly selective and environmentally-friendly MISPE technique with excellent reproducibility for the purification and pre-concentration of gastrodin from an aqueous extract of Gastrodia elata roots.

  9. Decreased apoptosis of beta 2- integrin-deficient bovine neutrophils.

    PubMed

    Nagahata, Hajime; Higuchi, Hidetoshi; Teraoka, Hiroki; Takahashi, Kenji; Takahashi, Kensi; Kuwabara, Mikinori; Inanami, Osamu; Kuwabara, Mikwori

    2004-02-01

    Stimulant-induced viability of neutrophils, nuclear-fragmentation, increase in intracellular calcium ([Ca2+]i), expression of annexin V on neutrophils and proteolysis of a fluorogenic peptide substrate Ac-DEVD-MCA (acetyl Asp-Glu-Val-Asp alpha-[4-methyl-coumaryl-7-amide]) by neutrophil lysates from five normal calves and three calves with leucocyte adhesion deficiency were determined to evaluate the apoptosis of normal and CD18-deficient neutrophils. Viability was markedly decreased in control neutrophils stimulated with opsonized zymosan (OPZ), compared to CD18-deficient neutrophils at 37 degrees C after incubation periods of 6 and 24 hours. The rate of apoptosis of control neutrophils stimulated with OPZ increased significantly depending on the incubation time, whereas no apparent increase in apoptosis was found in CD18-deficient neutrophils under the same conditions. Aggregated bovine (Agg) IgG-induced apoptosis of control neutrophils was not significantly different from that of CD18-deficient neutrophils. The expression of annexin V on OPZ-stimulated control neutrophils was greater than that of unstimulated ones 6 h after stimulation. No apparent increase in annexin V expression on CD18-deficient neutrophils was found with OPZ stimulation. A delay in apoptosis was demonstrated in CD18-deficient bovine neutrophils and this appeared to be closely associated with lowered signalling via [Ca2+]i, diminished annexin V expression on the cell surface, and decreased caspase 3 activity in lysates. PMID:14984592

  10. Codon-reading specificities of mitochondrial release factors and translation termination at non-standard stop codons

    NASA Astrophysics Data System (ADS)

    Lind, Christoffer; Sund, Johan; Åqvist, Johan

    2013-12-01

    A key feature of mitochondrial translation is the reduced number of transfer RNAs and reassignment of codons. For human mitochondria, a major unresolved problem is how the set of stop codons are decoded by the release factors mtRF1a and mtRF1. Here we present three-dimensional structural models of human mtRF1a and mtRF1 based on their homology to bacterial RF1 in the codon recognition domain, and the strong conservation between mitochondrial and bacterial ribosomal RNA in the decoding region. Sequence changes in the less homologous mtRF1 appear to be correlated with specific features of the mitochondrial rRNA. Extensive computer simulations of the complexes with the ribosomal decoding site show that both mitochondrial factors have similar specificities and that neither reads the putative vertebrate stop codons AGA and AGG. Instead, we present a structural model for a mechanism by which the ICT1 protein causes termination by sensing the presence of these codons in the A-site of stalled ribosomes.

  11. Complete mitochondrial genome of Cinereous vulture Aegypius monachus (Falconiformes: Accipitridae).

    PubMed

    Li, Bo; Liu, Gang; Zhou, Lizhi; Gu, Changming

    2015-01-01

    In this study we report the complete mitochondrial (mt) DNA sequence from Cinereous vulture Aegypius monachus, a large raptorial bird species of Falconiformes. The mtDNA is a 17,811-bp circular molecule with a total A+T content of 54.03%. The mitochondrial genome contains 37 genes and an extra pseudo-control region. The gene arrangement pattern is identical to Buteo and Falco, which has remnant CR2 gene order. All protein-coding genes use the standard mitochondrial initiation codon ATN, except for COI start with GTG. Of the 13 protein coding genes, 11 stop with TAN, the COI and ND1 stop with AGG. All tRNAs possess the classic clover-leaf secondary structure except for tRNASer (AGN) and tRNALys (CUN), which lacks the "DHU" stem, only forming a simple loop. The non-coding region contains some intergenic spacers, a control region and an extra pseudo-control region.

  12. Detection of Glucose with Atomic Absorption Spectroscopy by Using Oligonucleotide Functionalized Gold Nanoparticle.

    PubMed

    Zhang, Hong; Yan, Honglian; Ling, Liansheng

    2016-06-01

    A novel method for the detection of glucose was established with atomic absorption spectroscopy by using the label of gold nanoparticle (AuNP). Silver-coated glass assembled with oligonucleotide 5'-SH-T12-AGA CAA GAG AGG-3' (Oligo 1) was acted as separation probe, oligonucleotide 5'-CAA CAG AGA ACG-T12-SH-3' modified gold nanoparticle (AuNP-Oligo 2) was acted as signal-reporting probe. Oligonucleotide 5'-CGT TCT CTG TTG CCT CTC TTG TCT-3' (Oligo 3) could hybridize with Oligo 1 on the surface of silver-coated glass and AuNP-Oligo 2, and free AuNP-Oligo 2 could be removed by rinsing with buffer. Hence the concentration of Oligo 3 was transformed into the concentration of gold element. In addition, Oligo 3 could be cleaved into DNA fragments by glucose, glucose oxidase and Fe(2+)-EDTA through Fenton reaction. Thereby the concentration of glucose could be transformed to the absorbance of gold element. Under the optimum conditions, the integrated absorbance decreased proportionally to the concentration of glucose over the range from 50.0 μM to 1.0 mM with a detection limit of 40.0 μM. Moreover, satisfactory result was obtained when the assay was used to determinate glucose in human serum. PMID:27427698

  13. Genetic structure of Pilosocereus gounellei (Cactaceae) as revealed by AFLP marker to guide proposals for improvement and restoration of degraded areas in Caatinga biome.

    PubMed

    Monteiro, E R; Strioto, D K; Meirelles, A C S; Mangolin, C A; Machado, M F P S

    2015-01-01

    Amplified fragment length polymorphism (AFLP) analysis was used to evaluate DNA polymorphism in Pilosocereus gounellei with the aim of differentiating samples grown in different Brazilian semiarid regions. Seven primer pairs were used to amplify 703 AFLP markers, of which 700 (99.21%) markers were polymorphic. The percentage of polymorphic markers ranged from 95.3% for the primer combination E-AAG/M-CTT to 100% for E-ACC/M-CAT, E-ACC/M-CAA, E-AGC/M-CAG, E-ACT/M-CTA, and E-AGG/M-CTG. The largest number of informative markers (126) was detected using the primer combination E-AAC/M-CTA. Polymorphism of the amplified DNA fragments ranged from 72.55% (in sample from Piauí State) to 82.79% (in samples from Rio Grande Norte State), with an average of 75.39%. Despite the high genetic diversity of AFLP markers in xiquexique, analysis using the STRUCTURE software identified relatively homogeneous clusters of xiquexique from the same location, indicating a differentiation at the molecular level, among the plant samples from different regions of the Caatinga biome. The AFLP methodology identified genetically homogeneous and contrasting plants, as well as plants from different regions with common DNA markers. Seeds from such plants can be used for further propagation of plants for establishment of biodiversity conservation units and restoration of degraded areas of the Caatinga biome. PMID:26681043

  14. Detection of Glucose with Atomic Absorption Spectroscopy by Using Oligonucleotide Functionalized Gold Nanoparticle.

    PubMed

    Zhang, Hong; Yan, Honglian; Ling, Liansheng

    2016-06-01

    A novel method for the detection of glucose was established with atomic absorption spectroscopy by using the label of gold nanoparticle (AuNP). Silver-coated glass assembled with oligonucleotide 5'-SH-T12-AGA CAA GAG AGG-3' (Oligo 1) was acted as separation probe, oligonucleotide 5'-CAA CAG AGA ACG-T12-SH-3' modified gold nanoparticle (AuNP-Oligo 2) was acted as signal-reporting probe. Oligonucleotide 5'-CGT TCT CTG TTG CCT CTC TTG TCT-3' (Oligo 3) could hybridize with Oligo 1 on the surface of silver-coated glass and AuNP-Oligo 2, and free AuNP-Oligo 2 could be removed by rinsing with buffer. Hence the concentration of Oligo 3 was transformed into the concentration of gold element. In addition, Oligo 3 could be cleaved into DNA fragments by glucose, glucose oxidase and Fe(2+)-EDTA through Fenton reaction. Thereby the concentration of glucose could be transformed to the absorbance of gold element. Under the optimum conditions, the integrated absorbance decreased proportionally to the concentration of glucose over the range from 50.0 μM to 1.0 mM with a detection limit of 40.0 μM. Moreover, satisfactory result was obtained when the assay was used to determinate glucose in human serum.

  15. Structure of Poly(styrene-b-ethylene-alt-propylene) Diblock Copolymer Micelles in Squalane

    SciTech Connect

    Choi, Soo-Hyung; Bates, Frank S.; Lodge, Timothy P.

    2009-11-04

    The temperature dependence of the micellar structures formed by poly(styrene-b-ethylene-alt-propylene) (SEP) diblock copolymers in squalane, a highly selective solvent for the PEP blocks, has been studied using dynamic light scattering (DLS) and small-angle X-ray scattering (SAXS). Four SEP diblock copolymers were prepared by sequential anionic polymerization of styrene and isoprene, followed by hydrogenation of the isoprene blocks, to yield SEP(17-73), SEP(26-66), SEP(36-69), and SEP(42-60), where the numbers indicate block molecular weights in kDa. All four polymers formed well-defined spherical micelles. In dilute solution, DLS provided the temperature-dependent mean hydrodynamic radius, R{sub h}, and its distribution, while detailed fitting of the SAXS profiles gave the core radius, R{sub c}, the equivalent hard sphere radius, R{sub hs}, and an estimate of the aggregation number, N{sub agg}. In general, the micelles became smaller as the critical micelle temperature (CMT) was approached, which was well above the glass transition of the core block. As concentration increased the micelles packed onto body centered cubic lattices for all four copolymers, which underwent order-disorder transitions upon heating near the dilute solution CMTs. The results are discussed in terms of current understanding of block copolymer solution self-assembly, and particular attention is paid to the issue of equilibration, given the high glass transition temperature of the core block.

  16. Hepatocellular carcinoma and liver cirrhosis TP53 mutation analysis reflects a moderate dietary exposure to aflatoxins in Espírito Santo State, Brazil.

    PubMed

    de Carvalho, Fernanda Magri; de Almeida Pereira, Thiago; Gonçalves, Patrícia Lofego; Jarske, Robson Dettmann; Pereira, Fausto Edmundo Lima; Louro, Iuri Drumond

    2013-08-01

    The close relationship between aflatoxins and 249ser TP53 gene mutation (AGG to AGT, Arg to Ser) in hepatocellular carcinoma (HCC) makes this mutation an indirect indicator of dietary contamination with this toxin. We have examined the prevalence of codon 249 TP53 mutation in 41 HCC and 74 liver cirrhosis (without HCC) cases diagnosed at the HUCAM University Hospital in Vitoria, Espírito Santo State, Brazil. DNA was extracted from paraffin sections and from plasma. The mutation was detected by DNA amplification, followed by restriction endonuclease digestion and confirmed by direct sequencing. DNA restriction showed 249ser mutation in 16 HCC and 13 liver cirrhosis, but sequencing confirmed mutations in only 6 HCC and 1 liver cirrhosis. In addition, sequencing revealed 4 patients with mutations at codon 250 (250ser and 250leu) in HCC cases. The prevalence of TP53 mutation was 10/41 (24.3%) in HCC and 1/74 (1.4%) in liver cirrhosis. No relationship between the presence of mutations and the etiology of HCC was observed. TP53 exon 7 mutations, which are related to aflatoxins exposure, were found at 14.6% (249ser), 7.3% (250leu) and 2.4% (250ser) in 41 cases of HCC and 1.4% in 74 liver cirrhosis (without HCC) cases, suggesting a moderate dietary exposure to aflatoxins in the Espírito Santo State, Brazil.

  17. Complete mitochondrial genome of the hardnose shark Carcharhinus macloti (Carcharhiniformes: Carcharhinidae).

    PubMed

    Chen, Xiao; Liu, Min; Xiao, Jiamei; Yang, Weidi; Peng, Zaiqing

    2016-01-01

    The complete mitochondrial genome of Carcharhinus macloti was determined in this study. It is 16,701 bp in length and contains 37 genes with the typical gene order and transcriptional orientation in vertebrates. A total of 29 bp overlaps and 29 bp short intergenic spaces located in 22 gene junctions. The overall base composition is 31.6% A, 26.2% C, 13.0% G and 29.2% T. Two start codons (ATG and GTG) and three stop codons (AGG, TAG and TAA/T) were found in 13 protein-coding genes. The length of 22 tRNA genes ranged from 66 bp (tRNA-Ser2) to 75 bp (tRNA-Leu1). The tRNA-Ser2 (GCU) lacks the dihydrouridine arm by a simple loop and can not be folded into the typical cloverleaf structure. The control region is 1066 bp in length with high A+T content (68.2%). PMID:24983148

  18. The complete mitochondrial genome of the spinner shark Carcharhinus brevipinna.

    PubMed

    Chen, Xiao; Xiang, Dan; Peng, Xin; Ai, Weiming; Chen, Hao

    2016-05-01

    The mitochondrial genome of the spinner shark (Carcharhinus brevipinna) was determined in this study. It was 16,706 bp in length with the typical genomic organization and gene order as most vertebrates. Whole nucleotide base composition was 31.3% A, 25.3% C, 13.2% G and 30.1% T. Among the protein-coding genes, there are three overlapping reading-frames on the same strand, while one of it on the opposite strand. Two start codons (ATG and GTG) and three stop codons (AGG, TAG and TAA/T) were used in 13 protein-coding genes. The 22 tRNA ranged from 67 (tRNA-Cys and tRNA-Ser2) to 75 bp (tRNA-Leu1) in length. Only the tRNA-Ser2 could not fold into the typical clover-leaf structure, which lost the dihydrouridine (DHU) arm and replaced by a simple loop. The control region was 1064 bp in length and showed a higher AT content (66.8%) than the average value of whole mitogenome (61.4%). PMID:25268999

  19. Complexation behavior of gelatin with amphiphilic drug imipramine hydrochloride as studied by conductimetry, surface tensiometry and circular dichroism studies.

    PubMed

    Ali, Mohd Sajid; Anjum, Kahkashan; Khan, Javed M; Khan, Rizwan H; Kabir-ud-Din

    2011-01-01

    Herein we report our studies carried out on the interaction between IMP and gelatin in aqueous medium at 25°C using conductimetry, surface tensiometry and circular dichroism (CD) techniques. Both surface tensiometry and conductimetry results indicate that the drug interacts with the gelatin in a surfactant-like manner, i.e., both critical aggregation (cac) and polymer saturation points (psp) were observed. The interaction starts with the formation of a highly surface-active complex as revealed by the lowering of surface tension on the addition of drug to the macromolecule. The decrease in cac on increasing gelatin concentration is an indication of the strong interaction between gelatin and IMP. However, at low concentration of gelatin the interaction was not much strong as exposed by surface tension study, i.e., the cac was not very clear (as with higher gelatin concentrations). As usual, the psp increased on increasing the gelatin concentration and was always higher than the critical micelle concentration of the drug in pure aqueous medium. Using CD measurements the influence of IMP on the secondary structure of gelatin in aqueous solutions was also investigated. CD studies (performed at very low drug concentrations) illustrated that the random coil content of gelatin increases with increasing drug concentration. Free energies of aggregation (ΔG(agg)) and micellization (ΔG(mic)) were computed with the help of degrees of micelle ionization obtained from the specific conductivity - [IMP] plots.

  20. [Development and application of EST-derived SSR markers for bananas (Musa nana Lour.)].

    PubMed

    Wang, Jing-Yi; Chen, Ye-Yuan; Liu, Wei-Liang; Wu, Yao-Ting

    2008-07-01

    A total of 2,284 banana unigene sequences were mined, resulting in the identification of 122 SSRs in 110 sequences. Among them, there were 37 motifs the overall average length of SSRs was 20 bp. The trinucleotide repeats appeared to be the most abundant SSRs (47.6%), followed by dinucleotide repeats (33.1%), whereas the tetranucleotide repeats were less abundant. The rich repeats AG and AGG were predominant, accounting for 75.7% and 36% in dri- and tri-nucleotide repeats respectively. A total of 63 primer pairs were designed and tested against genomic DNA of Brazil. Forty-one primers could be validated as usable markers. Nineteen of these primers revealed moderate to high polymorphism information content (PIC) across 49 accessions. The polymorphic bands were ranged from 4 to 12, averagely 7.58. The mean PIC value was 0.7324, ranging from 0.3572 to 0.8744. Forty-nine banana varieties were separated into two major clusters closely corresponding with the genome composition by UPGMA analysis. The results showed that the EST-SSR markers were of great value in evaluation of banana germplasms.

  1. Nucleotide sequence of a human tRNA gene heterocluster

    SciTech Connect

    Chang, Y.N.; Pirtle, I.L.; Pirtle, R.M.

    1986-05-01

    Leucine tRNA from bovine liver was used as a hybridization probe to screen a human gene library harbored in Charon-4A of bacteriophage lambda. The human DNA inserts from plaque-pure clones were characterized by restriction endonuclease mapping and Southern hybridization techniques, using both (3'-/sup 32/P)-labeled bovine liver leucine tRNA and total tRNA as hybridization probes. An 8-kb Hind III fragment of one of these ..gamma..-clones was subcloned into the Hind III site of pBR322. Subsequent fine restriction mapping and DNA sequence analysis of this plasmid DNA indicated the presence of four tRNA genes within the 8-kb DNA fragment. A leucine tRNA gene with an anticodon of AAG and a proline tRNA gene with an anticodon of AGG are in a 1.6-kb subfragment. A threonine tRNA gene with an anticodon of UGU and an as yet unidentified tRNA gene are located in a 1.1-kb subfragment. These two different subfragments are separated by 2.8 kb. The coding regions of the three sequenced genes contain characteristic internal split promoter sequences and do not have intervening sequences. The 3'-flanking region of these three genes have typical RNA polymerase III termination sites of at least four consecutive T residues.

  2. Carriage of One or Two FMR1 Premutation Alleles Seems to Have No Effect on Illness Severity in a FXTAS Female with an Autozygous FMR1 Premutation Allele.

    PubMed

    Rodriguez-Revenga, Laia; Pagonabarraga, Javier; Gómez-Anson, Beatriz; López-Mourelo, Olga; Izquierdo, Silvia; Alvarez-Mora, Maria Isabel; Granell, Esther; Madrigal, Irene; Milà, Montserrat

    2016-10-01

    Fragile X-associated tremor/ataxia syndrome (FXTAS) is a late-onset neurodegenerative disorder that occurs in FMR1 premutation carriers. The prevalence of FMR1 premutation carriers in the general population is relatively high, and although rare, a premutation in both X chromosomes may occur in females inheriting a premutation allele from each of both parent carriers. Here, we report the first female with an autozygous (homozygous by descendent) FMR1 premutation allele, who fulfills neurological and radiological FXTAS findings/criteria. Molecular characterization included CGG repeat length, AGG interruption pattern, FMR1 messenger RNA (mRNA), fragile X mental retardation protein (FMRP) level quantification, and single-nucleotide polymorphism (SNP) microarray. Neuroradiological assessment of 3-T magnetic resonance imaging and neurological and cognitive/neuropsychological evaluations were performed. Neurological and neuroradiological examination of the female with the same FMR1 allele in the premutation range (77 CGGs) demonstrated FXTAS features. Further familial evaluation showed a similar neuropsychiatric profile, with impairments in cognitive flexibility and visuospatial function, mainly. A unique family with an autozygous FMR1 premutation female is presented. Neurological/cognitive and neuroradiological examinations revealed FXTAS-specific findings in the female with the autozygous FMR1 premutation allele. The consistent molecular and cognitive/psychiatric phenotype in family members suggests that carrying one or two FMR1 premutation alleles has no effect on illness severity. PMID:27315125

  3. Fragile X founder chromosomes in Italy: A few initial events and possible explanation for their heterogeneity

    SciTech Connect

    Chiurazzi, P.; Genuardi, M.; Kozak, L.; Neri, G.

    1996-07-12

    A total of 137 fragile X and 235 control chromosomes from various regions of Italy were haplotyped by analyzing two neighbouring marker microsatellites, FRAXAC1 and DXS548. The number of CGG repeats at the 5{prime} end of the FMR1 gene was also assessed in 141 control chromosomes and correlated with their haplotypes. Significant linkage disequilibrium between some {open_quotes}major{close_quotes} haplotypes and fragile X was observed, while other {open_quotes}minor{close_quotes} haplotypes may have originated by subsequent mutation at the marker microsatellite loci and/or recombination between them. Recent evidence suggests that the initial mechanism leading to CGG instability might consist of rare (10{sup -6/-7}) CGG repeat slippage events and/or loss of a stabilizing AGG via A-to-C transversion. Also, the apparently high variety of fragile X chromosomes may be partly due to the relatively high mutation rate (10{sup -4/-5}) of the microsatellite markers used in haplotyping. Our fragile X sample also showed a higher than expected heterozygosity when compared to the control sample and we suggest that this might be explained by the chance occurrence of the few founding events on different chromosomes, irrespective of their actual frequency in the population. Alternatively, a local mechanism could enhance the microsatellite mutation rate only on fragile X chromosomes, or fragile X mutations might occur more frequently on certain background haplotypes. 59 refs., 4 figs.

  4. REVERSE SHOCK EMISSION AND IONIZATION BREAKOUT POWERED BY POST-MERGER MILLISECOND MAGNETARS

    SciTech Connect

    Wang, Ling-Jun; Dai, Zi-Gao; Yu, Yun-Wei E-mail: yuyw@mail.ccnu.edu.cn

    2015-02-20

    There is accumulating evidence that at least a fraction of binary neutron star (BNS) mergers result in rapidly spinning magnetars, with subrelativistic neutron-rich ejecta as massive as a small fraction of a solar mass. The ejecta could be heated continuously by the Poynting flux emanated from the central magnetars. Such a Poynting flux could become lepton dominated so that a reverse shock develops. It was demonstrated that such a picture is capable of accounting for the optical transient PTF11agg. In this paper we investigate the X-ray and ultraviolet (UV) radiation, as well as the optical and radio radiation studied by Wang and Dai. UV emission is particularly important because it has the right energy to ionize the hot ejecta at times t ≲ 600 s. It is thought that the ejecta of BNS mergers are a remarkably pure sample of r-process material, about which our understanding is still incomplete. In this paper we evaluate the possibility of observationally determining the bound-bound and bound-free opacities of the r-process material by timing the X-ray, UV, and optical radiation. It is found that these timings depend on the opacities weakly, and therefore only loose constraints on the opacities can be obtained.

  5. Restriction enzyme digestion analysis of PCR-amplified DNA of Blastocystis hominis isolates.

    PubMed

    Init, I; Foead, A L; Fong, M Y; Yamazaki, H; Rohela, M; Yong, H S; Mak, J W

    2007-11-01

    Genomic DNA of Blastocystis isolates released into 0.1% Triton X-100 was suitable for amplification and yielded similar results as the genomic DNA extracted with standard kit. The specific B. hominis primers (BH1: GCT TAT CTG GTT GAT CCT GCC AGT and BH2: TGA TCC TTC CGC AGG TTC ACC TAC A) successfully produced the PCR product of about 1,770 bp with all the 7 Blastocystis isolates tested. The restriction fragment length polymorphism (RFLP) patterns yielded by 13 out of 25 restriction endonucleases showed that the 7 isolates could be grouped into 4 subgroups: subgroup-1 consisted of isolate C; subgroup-2 of isolates H4 and H7; subgroup-3 of isolates KP1, Y51 and M12; and subgroup-4 of isolate 27805. The differences between subgroups manifested as clear-cut RFLP patterns. A common band of 230 bp was revealed by Eco R1 in all the Blastocystis isolates tested. The band of about 180 bp was revealed by Alu I, differentiated symptomatic from asymptomatic isolates of this parasite, and might indicate the pathogenicity of this parasite. PMID:18613539

  6. Label-free detection of kanamycin based on a G-quadruplex DNA aptamer-based fluorescent intercalator displacement assay.

    PubMed

    Xing, Yun-Peng; Liu, Chun; Zhou, Xiao-Hong; Shi, Han-Chang

    2015-01-01

    This work was the first to report that the kanamycin-binding DNA aptamer (5'-TGG GGG TTG AGG CTA AGC CGA-3') can form stable parallel G-quadruplex DNA (G4-DNA) structures by themselves and that this phenomenon can be verified by nondenaturing polyacrylamide gel electrophoresis and circular dichroism spectroscopy. Based on these findings, we developed a novel label-free strategy for kanamycin detection based on the G4-DNA aptamer-based fluorescent intercalator displacement assay with thiazole orange (TO) as the fluorescence probe. In the proposed strategy, TO became strongly fluorescent upon binding to kanamycin-binding G4-DNA. However, the addition of kanamycin caused the displacement of TO from the G4-DNA-TO conjugate, thereby resulting in decreased fluorescent signal, which was inversely related to the kanamycin concentration. The detection limit of the proposed assay decreased to 59 nM with a linear working range of 0.1 μM to 20 μM for kanamycin. The cross-reactivity against six other antibiotics was negligible compared with the response to kanamycin. A satisfactory recovery of kanamycin in milk samples ranged from 80.1% to 98.0%, confirming the potential of this bioassay in the measurement of kanamycin in various applications. Our results also served as a good reference for developing similar fluorescent G4-DNA-based bioassays in the future. PMID:25634469

  7. Identification of the Plant Compound Geraniin as a Novel Hsp90 Inhibitor

    PubMed Central

    Vassallo, Antonio; Vaccaro, Maria Carmela; De Tommasi, Nunziatina; Dal Piaz, Fabrizio; Leone, Antonella

    2013-01-01

    Besides its function in normal cellular growth, the molecular chaperone heat shock protein 90 (Hsp90) binds to a large number of client proteins required for promoting cancer cell growth and/or survival. In an effort to discover new small molecules able to inhibit the Hsp90 ATPase and chaperoning activities, we screened, by a surface plasmon resonance assay, a small library including different plant polyphenols. The ellagitannin geraniin, was identified as the most promising molecule, showing a binding affinity to Hsp90α similar to that of 17-(allylamino)-17-demethoxygeldanamycin (17AGG). Geraniin was able to inhibit in vitro the Hsp90α ATPase activity in a dose−dependent manner, with an inhibitory efficiency comparable to that measured for 17-AAG. In addition, this compound compromised the chaperone activity of Hsp90α, monitored by the citrate synthase thermal induced aggregation assay. Geraniin decreased the viability of HeLa and Jurkat cell lines and caused an arrest in G2/M phase. We also proved that following exposure to different concentrations of geraniin, the level of expression of the client proteins c-Raf, pAkt, and EGFR was strongly down−regulated in both the cell lines. These results, along with the finding that geraniin did not exert any appreciable cytotoxicity on normal cells, encourage further studies on this compound as a promising chemical scaffold for the design of new Hsp90 inhibitors. PMID:24066128

  8. Shiga toxin-producing Escherichia coli O100:H⁻: stx2e in drinking water contaminated by waste water in Finland.

    PubMed

    Lienemann, Taru; Pitkänen, Tarja; Antikainen, Jenni; Mölsä, Elina; Miettinen, Ilkka; Haukka, Kaisa; Vaara, Martti; Siitonen, Anja

    2011-04-01

    In November 2007, 450 m(3) of treated wastewater leaked into the drinking water distribution system contaminating the drinking water of over 10,000 inhabitants of Nokia, Southern Finland. Nearly 1,000 people visited the health centre because of gastroenteritis during the following 5 weeks. A wide range of enteric pathogens was found in the patients. The authors used the 16-plex PCR to investigate whether the five major diarrheagenic Escherichia coli pathotypes (EPEC, ETEC, STEC, EIEC or EAEC) were present in the contaminated drinking water and in the patients' stool samples. The contaminated drinking water was positive for genes characteristic of various E. coli pathotypes: pic, invE, hlyA, ent, escV, eae, aggR, stx(2) , estIa and astA. These genes, except stx(2), hlyA and invE, were also detected in the stool samples of the patients linked to this outbreak. A sorbitol positive, streptomycin resistant STEC strain was isolated from the drinking water, and belonged to the serotype O100:H(-), produced Stx2 toxin (titre 1:8 by reversed-passive latex agglutination method), and carried the genes stx(2e), estIa and irp2.

  9. Label-free detection of kanamycin based on a G-quadruplex DNA aptamer-based fluorescent intercalator displacement assay

    NASA Astrophysics Data System (ADS)

    Xing, Yun-Peng; Liu, Chun; Zhou, Xiao-Hong; Shi, Han-Chang

    2015-01-01

    This work was the first to report that the kanamycin-binding DNA aptamer (5'-TGG GGG TTG AGG CTA AGC CGA-3') can form stable parallel G-quadruplex DNA (G4-DNA) structures by themselves and that this phenomenon can be verified by nondenaturing polyacrylamide gel electrophoresis and circular dichroism spectroscopy. Based on these findings, we developed a novel label-free strategy for kanamycin detection based on the G4-DNA aptamer-based fluorescent intercalator displacement assay with thiazole orange (TO) as the fluorescence probe. In the proposed strategy, TO became strongly fluorescent upon binding to kanamycin-binding G4-DNA. However, the addition of kanamycin caused the displacement of TO from the G4-DNA-TO conjugate, thereby resulting in decreased fluorescent signal, which was inversely related to the kanamycin concentration. The detection limit of the proposed assay decreased to 59 nM with a linear working range of 0.1 μM to 20 μM for kanamycin. The cross-reactivity against six other antibiotics was negligible compared with the response to kanamycin. A satisfactory recovery of kanamycin in milk samples ranged from 80.1% to 98.0%, confirming the potential of this bioassay in the measurement of kanamycin in various applications. Our results also served as a good reference for developing similar fluorescent G4-DNA-based bioassays in the future.

  10. Label-free detection of kanamycin based on a G-quadruplex DNA aptamer-based fluorescent intercalator displacement assay

    PubMed Central

    Xing, Yun-Peng; Liu, Chun; Zhou, Xiao-Hong; Shi, Han-Chang

    2015-01-01

    This work was the first to report that the kanamycin-binding DNA aptamer (5′-TGG GGG TTG AGG CTA AGC CGA-3′) can form stable parallel G-quadruplex DNA (G4-DNA) structures by themselves and that this phenomenon can be verified by nondenaturing polyacrylamide gel electrophoresis and circular dichroism spectroscopy. Based on these findings, we developed a novel label-free strategy for kanamycin detection based on the G4-DNA aptamer-based fluorescent intercalator displacement assay with thiazole orange (TO) as the fluorescence probe. In the proposed strategy, TO became strongly fluorescent upon binding to kanamycin-binding G4-DNA. However, the addition of kanamycin caused the displacement of TO from the G4-DNA–TO conjugate, thereby resulting in decreased fluorescent signal, which was inversely related to the kanamycin concentration. The detection limit of the proposed assay decreased to 59 nM with a linear working range of 0.1 μM to 20 μM for kanamycin. The cross-reactivity against six other antibiotics was negligible compared with the response to kanamycin. A satisfactory recovery of kanamycin in milk samples ranged from 80.1% to 98.0%, confirming the potential of this bioassay in the measurement of kanamycin in various applications. Our results also served as a good reference for developing similar fluorescent G4-DNA-based bioassays in the future. PMID:25634469

  11. Characterization of Enterococci from Food and Food-Related Settings.

    PubMed

    Soares-Santos, Verónica; Barreto, António Salvador; Semedo-Lemsaddek, Teresa

    2015-07-01

    Enterococcus species are ubiquitous in nature, exist at high levels in food, and can cause severe diseases in humans. Thus, surveillance of enterococci harboring antibiotic resistance and virulence factors in food and food-related environments is needed. In the present study, 89 samples from food and food processing surfaces were collected in a cheese factory, a swine slaughterhouse, and a supermarket, and 132 Enterococcus isolates were recovered. Most isolates were identified as E. faecalis, which is considered the most pathogenic member of this genus. Safety analysis covering antibiotic resistance revealed that all isolates were resistant to sulfamethoxazole-trimethoprim and sensitive to amoxicillin-clavulanate, ampicillin, ciprofloxacin, gentamicin, levofloxacin, linezolid, nitrofurantoin, or teicoplanin. More than half of the isolates were resistant to quinupristin-dalfopristin, tetracycline, and bacitracin, and less than half were resistant to the other antibiotics evaluated. Regarding virulence factors, 52% the isolates were beta-hemolytic, 39% were gelatinase producers, and 45% contained the gelE gene. For the remaining genes evaluated, efaAfs was detected in more than half of the isolates, and agg, esp, and efaAfm were found in less than half of the isolates. The present investigation revealed that food-related enterococci obtained from very different settings have multidrug resistance and virulence factors, highlighting the importance of effective surveillance networks to avoid the spread of putative pathogenic enterococci.

  12. Using instability of nanometric liquid Cu films on SiO2 substrates to determine the underlying van der Waals potential

    NASA Astrophysics Data System (ADS)

    González, Alejandro G.; Diez, Javier A.; Wu, Yueying; Fowlkes, Jason D.; Rack, Philip D.; Kondic, Lou

    2013-11-01

    We study the instability of nanometric Cu thin films on a SiO2 substrate. The metal is melted by means of laser pulses for some tens of nanoseconds. The free surface destabilizes during the liquid lifetime, leading to the formation of holes at first and to metal drops on the substrate in later stages. By analyzing the Fourier transforms of the SEM images obtained during the metal film evolution, we determine the emerging length scales for both early and late stages of the instability development. The results are analyzed within the framework of a long-wave hydrodynamic model, which introduces van der Waals forces by means of disjoining and conjoining pressures. These forces are characterized by a pair of exponents for the ratio h / h * , where h is the liquid thickness and h* is a residual one. We find that the pair (3 , 2) provides a good agreement for the relationship of the wavelength with maximum growth rate, λm, while other typical pairs, such as (4 , 3) and (9 , 3) do not provide accurate description of the experimental data. Supported by CONICET-Argentina grant PIP 844/2011 (AGG, JAD), and by NSF grants CBET-1235651 (PDR) and CBET-1235710 (LK).

  13. Haplotypes of tumor necrosis factor gene and tracheal aspirate fluid levels of tumor necrosis factor-alpha in preterm infants.

    PubMed

    Kazzi, S Nadya J; Tromp, Gerard; Quasney, Michael W; Buhimschi, Irina A

    2008-08-01

    Individual variability in the production of tumor necrosis factor-alpha (TNF-alpha) has been attributed to genetic factors. We examined whether alleles of TNF gene (lymphotoxin-alpha+250, TNF-alpha-308, and TNF-alpha-238) affect tracheal aspirate fluid (TAF) levels of TNF-alpha among preterm infants at risk of bronchopulmonary dysplasia. TAF samples were collected within 48 h of birth and 7, 14, 21, and 28 d later. Haplotypes [designated using the nucleotide bases in the chromosome order (lymphotoxin-alpha+250, TNF-alpha-308, TNF-alpha-238)] of TNF were correlated with levels of TNF-alpha. Diplotypes of TNF (genotypes of haplotypes) classified as high, intermediate, or low based on their relation to TAF TNF-alpha levels were also correlated with TNF-alpha levels. The most frequent (and reference haplotype) was AGG. The GGG haplotype was associated with the lowest TAF TNF-alpha levels on day 7 among African American infants (p < 0.008). Sequential changes in levels of TNF-alpha correlated with infants' diplotype status [high (HH), intermediate (HL), low (LL)]. Fetal chorioamnionitis but not bronchopulmonary dysplasia was associated with infants' diplotypes (p < 0.005). Haplotypes of the TNF gene influence TAF levels of TNF-alpha. Diplotypes of TNF are associated with fetal chorioamnionitis.

  14. Virulence determinants in enteroaggregative Escherichia coli from North India and their interaction in in vitro organ culture system.

    PubMed

    Gupta, Deepika; Sharma, Monica; Sarkar, Subendu; Thapa, B R; Chakraborti, Anuradha

    2016-09-01

    Enteroaggregative Escherichia coli (EAEC) is an important diarrhoeal pathogen causing diseases in multiple epidemiological and clinical settings. In developing countries like India, diarrhoeal diseases are one of the major killers among paediatric population and oddly, few studies are available from Indian paediatric population on the variability of EAEC virulence genes. In this study, we examined the distribution of plasmid and chromosomal-encoded virulence determinants in EAEC isolates, and analysed cytokines response generated against EAEC with specific aggregative adherence fimbriae (AAF) type in duodenal biopsies using in vitro organ culture (IVOC) mimicking in vivo conditions. Different virulence marker combinations among strains were reflected as a function of specific adhesins signifying EAEC heterogeneity. fis gene emerged as an important genetic marker apart from aggA and aap Further, EAEC infection in IVOC showed upregulation of IL-8, IL-1β, IL-6, TNF-α and TLR-5 expression. EAEC with AAFII induced significant TLR-5 and IL-8 response, conceivably owing to more pathogenicity markers. This study sheds light on the pattern of EAEC pathotypes prevalent in North Indian paediatric population and highlights the presence of unique virulence combinations in pathogenic strains. Thus, evident diversity in EAEC virulence and multifaceted bacteria-host crosstalk can provide useful insights for the strategic management of diarrhoeal diseases in India, where diarrhoeal outbreaks are more frequent. PMID:27493010

  15. Transfer and accumulation of organochlorines from black-crowned night-heron eggs to chicks

    USGS Publications Warehouse

    Custer, T.W.; Custer, Christine M.

    1995-01-01

    Eggs and sibling 1-, 3-, and 5-d-old chicks from seven black-crowned night-heron (Nycticorax nycticorax) broods were collected from Green Bay, Wisconsin, and analyzed for organochlorines. The concentration (A?g/g) of nine organochlo-rines either decreased (n = 7) or remained the same (n = 2) as the chicks grew older. In contrast, the total mass (A?g) of these nine organochlorines increased (n = 7) or remained the same (n = 2) as the chicks grew older. Accumulation rates of mass (A?g/d) between egg and 5-d-old chicks for each of the nine organochlorines were positive and varied from 0.2 A?g/d (p,pa??-DDT) to 42 A?g/d (PCBs). These results suggest that the loss of contaminant mass from eggs to chicks reported in some earlier studies was because the entire carcass was not analyzed (i.e., not including skin, gastrointestinal tract, etc.). These results also support the use of contaminant accumulation rates as an indicator of local contamination.

  16. Safety assessment and probiotic evaluation of Enterococcus faecium YF5 isolated from sourdough.

    PubMed

    Tan, Qianglai; Xu, Hengyi; Aguilar, Zoraida P; Peng, Shanshan; Dong, Suqin; Wang, Baogui; Li, Ping; Chen, Tingtao; Xu, Feng; Wei, Hua

    2013-04-01

    Enterococcus faecium YF5, a strain previously isolated from sourdough, was assessed for safety and probiotic potential. Its virulence and antibiotic resistant phenotypes (cytolysin and gelatinase production, antibiotic susceptibility) and genes (cylA, gelE, ace, agg, esp, and vanA) were surveyed. Results indicated that the tested virulence determinants were nontoxic. In addition, E. faecium YF5 was sensitive to 3 antibiotics such as amoxicillin, vancomycin, and chloramphenicol. Furthermore, results of in vivo animal acute oral toxicity of E. faecium YF5 studies were similar to the control group that indicated no abnormalities. In addition, E. faecium YF5 stably survived in low pH, bile salts, gastric, and intestinal fluids in vitro. Moreover, E. faecium YF5 was found to adhere to human colon cancer cell line HT-29 at 3.39 (±0.67) × 10(5) CFU/mL. When cocultured with pathogenic organisms (Enterobacter sakazakii CMCC45402, Escherichia coli CMCC44102, enterohemorrhage Escherichia coli O157: H7 CMCC44828, Salmonella Typhimurium CMCC50071, Shigella flexneri 301, and Shigella sonnei ATCC 29930) and 2 gram-positive strains (Listeria monocytogenes CMCC54001 and Staphylococcus aureus CMCC 26003), it inhibited these foodborne pathogens with exception of S. aureus. Therefore, E. faecium YF5 can be regarded as a safe strain and it may be used as a probiotic preparation or for microecologics. PMID:23488799

  17. Effect of Temperature on Fimbrial Gene Expression and Adherence of Enteroaggregative Escherichia coli.

    PubMed

    Hinthong, Woranich; Indrawattana, Nitaya; Pitaksajjakul, Pannamthip; Pipattanaboon, Chonlatip; Kongngoen, Thida; Tharnpoophasiam, Prapin; Worakhunpiset, Suwalee

    2015-08-01

    The influence of temperature on bacterial virulence has been studied worldwide from the viewpoint of climate change and global warming. The bacterium enteroaggregative Escherichia coli (EAEC) is the causative agent of watery diarrhea and shows an increasing incidence worldwide. Its pathogenicity is associated with the virulence factors aggregative adherence fimbria type I and II (AAFI and AAFII), encoded by aggA and aafA in EAEC strains 17-2 and 042, respectively. This study focused on the effect of temperature increases from 29 °C to 40 °C on fimbrial gene expression using real-time PCR, and on its virulence using an aggregative adherence assay and biofilm formation assay. Incubation at 32 °C caused an up-regulation in both EAEC strains 17-2 and strain 042 virulence gene expression. EAEC strain 042 cultured at temperature above 32 °C showed down-regulation of aafA expression except at 38 °C. Interestingly, EAEC cultured at a high temperature showed a reduced adherence to cells and an uneven biofilm formation. These results provide evidence that increases in temperature potentially affect the virulence of pathogenic EAEC, although the response varies in each strain.

  18. What an Intron May Tell: Several Sexual Biospecies Coexist in Meriderma spp. (Myxomycetes).

    PubMed

    Feng, Yun; Klahr, Anja; Janik, Paulina; Ronikier, Anna; Hoppe, Thomas; Novozhilov, Yuri K; Schnittler, Martin

    2016-06-01

    Specimens of the snowbank myxomycete Meriderma atrosporum agg. from five European mountain ranges were sequenced for parts of the nuclear small subunit ribosomal RNA gene (SSU) and the protein elongation factor 1 alpha gene (EF1A). A phylogeny of the EF1A gene, including a very variable spliceosomal intron, resulted in seven phylogroups, and this topology was confirmed by SSU sequences. Two thirds of all specimens were heterozygous for the EF1A gene, and the two haplotypes of these specimens occurred always in the same phylogroup. Except for two cases in closely related phylogroups all ribotypes were as well limited to one phylogroup. This pattern is consistent with the assumption of reproductively isolated sexual biospecies. Numbers of EF1A-haplotypes shared between mountain ranges correlate with geographical distance, suggesting relative isolation but occasional long-distance dispersal by spores. Most subpopulations (divided by putative biospecies and mountain ranges) were in Hardy-Weinberg equilibrium. A simulation assuming panmixis within but not in between subpopulations suggested that similar numbers of shared genotypes can be created by chance through sexual reproduction alone. Our results support the biospecies concept, derived from experiments with cultivable members of the Physarales. We discuss the results on the background of possible reproductive options in myxomycetes. PMID:27128786

  19. An Engineered Rare Codon Device for Optimization of Metabolic Pathways

    PubMed Central

    Wang, You; Li, Chunying; Khan, Md. Rezaul Islam; Wang, Yushu; Ruan, Yunfeng; Zhao, Bin; Zhang, Bo; Ma, Xiaopan; Zhang, Kaisi; Zhao, Xiwen; Ye, Guanhao; Guo, Xizhi; Feng, Guoyin; He, Lin; Ma, Gang

    2016-01-01

    Rare codons generally arrest translation due to rarity of their cognate tRNAs. This property of rare codons can be utilized to regulate protein expression. In this study, a linear relationship was found between expression levels of genes and copy numbers of rare codons inserted within them. Based on this discovery, we constructed a molecular device in Escherichia coli using the rare codon AGG, its cognate tRNA (tRNAArg (CCU)), modified tRNAAsp (GUC → CCU), and truncated aspartyl-tRNA synthetase (TDRS) to switch the expression of reporter genes on or off as well as to precisely regulate their expression to various intermediate levels. To underscore the applicability of our work, we used the rare codon device to alter the expression levels of four genes of the fatty acid synthesis II (FASII) pathway (i.e. fabZ, fabG, fabI, and tesA’) in E. coli to optimize steady-state kinetics, which produced nearly two-fold increase in fatty acid yield. Thus, the proposed method has potential applications in regulating target protein expression at desired levels and optimizing metabolic pathways by precisely tuning in vivo molar ratio of relevant enzymes. PMID:26852704

  20. Accumulation and effects of sediment-associated silver nanoparticles to sediment-dwelling invertebrates.

    PubMed

    Ramskov, Tina; Forbes, Valery E; Gilliland, Douglas; Selck, Henriette

    2015-09-01

    Sediment is increasingly recognized as the major sink for contaminants including nanoparticles (NPs). Thus, sediment-living organisms are especially susceptible to NP exposure. Studies of the fate and effects of NPs in the sediment matrix are still in their infancy, and data from such studies are in high demand. Here, we examine the effects of exposure to sediment mixed with either aqueous Ag (administered as AgNO3) or Ag NPs (13nm, citrate-capped) at a nominal exposure concentration of 100μg Ag/g dry weight sediment on four benthic invertebrates: two clones of the gastropod Potamopyrgus antipodarum (clones A and B) and two polychaete species (Capitella teleta, Capitella sp. S). Our results show that both species sensitivity and Ag form (aqueous Ag, Ag NPs) play a role in bioaccumulation and effects. Following two weeks of exposure, both clones of P. antipodarum were found to be insensitive towards both Ag forms (generally low Ag accumulation, no toxicity). In contrast, the two Capitella species varied widely with respect to Ag uptake and observed toxicity. Capitella sp. S was adversely affected by both aqueous Ag (mortality) and Ag NPs (growth), whereas C. teleta was not affected by either Ag form. For neither polychaete species was the observed toxicity directly related to bioaccumulation. Therefore, future nano-ecotoxicological research should focus on understanding differences in uptake and handling mechanisms among species and the relationship between bioaccumulation and toxicity. PMID:26256765

  1. Prevalence of virulence genes associated with pathogenic Escherichia coli strains isolated from domestically harvested rainwater during low- and high-rainfall periods.

    PubMed

    Dobrowsky, P H; van Deventer, A; De Kwaadsteniet, M; Ndlovu, T; Khan, S; Cloete, T E; Khan, W

    2014-03-01

    The possible health risks associated with the consumption of harvested rainwater remains one of the major obstacles hampering its large-scale implementation in water limited countries such as South Africa. Rainwater tank samples collected on eight occasions during the low- and high-rainfall periods (March to August 2012) in Kleinmond, South Africa, were monitored for the presence of virulence genes associated with Escherichia coli. The identity of presumptive E. coli isolates in rainwater samples collected from 10 domestic rainwater harvesting (DRWH) tanks throughout the sampling period was confirmed through universal 16S rRNA PCR with subsequent sequencing and phylogenetic analysis. Species-specific primers were also used to routinely screen for the virulent genes, aggR, stx, eae, and ipaH found in enteroaggregative E. coli (EAEC), enterohemorrhagic E. coli (EHEC), enteropathogenic E. coli (EPEC), and enteroinvasive E. coli, respectively, in the rainwater samples. Of the 92 E. coli strains isolated from the rainwater using culture based techniques, 6% were presumptively positively identified as E. coli O157:H7 using 16S rRNA. Furthermore, virulent pathogenic E. coli genes were detected in 3% (EPEC and EHEC) and 16% (EAEC) of the 80 rainwater samples collected during the sampling period from the 10 DRWH tanks. This study thus contributes valuable information to the limited data available regarding the ongoing prevalence of virulent pathotypes of E. coli in harvested rainwater during a longitudinal study in a high-population-density, periurban setting.

  2. Comparative genetic characterization of Enteroaggregative Escherichia coli strains recovered from clinical and non-clinical settings

    PubMed Central

    Zhang, Rong; Gu, Dan-xia; Huang, Yong-lu; Chan, Edward Wai-Chi; Chen, Gong-Xiang; Chen, Sheng

    2016-01-01

    The origin of pathogenic Enteroaggregative Escherichia coli (EAEC), a major causative agent of childhood diarrhea worldwide, remains ill-defined. The objective of this study was to determine the relative prevalence of EAEC in clinical and non-clinical sources and compare their genetic characteristics in order to identify strains that rarely and commonly cause human diarrhea. The virulence gene astA was commonly detectable in both clinical and non-clinical EAEC, while clinical isolates, but not the non-clinical strains, were consistently found to harbor other virulence factors such as aap (32%), aatA (18%) and aggR (11%). MLST analysis revealed the extremely high diversity of EAEC ST types, which can be grouped into three categories including: (i) non-clinical EAEC that rarely cause human infections; (ii) virulent strains recoverable in diarrhea patients that are also commonly found in the non-clinical sources; (iii) organisms causing human infections but rarely recoverable in the non-clinical setting. In addition, the high resistance in these EAEC isolates in particular resistance to fluoroquinolones and cephalosporins raised a huge concern for clinical EAEC infection control. The data from this study suggests that EAEC strains were diversely distributed in non-clinical and clinical setting and some of the clinical isolates may originate from the non-clinical setting. PMID:27062991

  3. Defining pathogenic verocytotoxin-producing Escherichia coli (VTEC) from cases of human infection in the European Union, 2007-2010.

    PubMed

    Messens, W; Bolton, D; Frankel, G; Liebana, E; McLAUCHLIN, J; Morabito, S; Oswald, E; Threlfall, E J

    2015-06-01

    During 2007-2010, 13 545 confirmed human verocytotoxin (VT)-producing Escherichia coli (VTEC) infections were reported in the European Union, including 777 haemolytic uraemic syndrome (HUS) cases. Clinical manifestations were reported for 53% of cases, 64% of which presented with diarrhoea alone and 10% with HUS. Isolates from 85% of cases were not fully serotyped and could not be classified on the basis of the Karmali seropathotype concept. There is no single or combination of phenotypic or genetic marker(s) that fully define 'pathogenic' VTEC. Isolates which contain the vtx2 (verocytotoxin 2) gene in combination with the eae (intimin-encoding) gene or aaiC (secreted protein of enteroaggregative E. coli) and aggR (plasmid-encoded regulator) genes have been associated with a higher risk of more severe illness. A molecular approach targeting genes encoding VT and other virulence determinants is thus proposed to allow an assessment of the potential severity of disease that may be associated with a given VTEC isolate.

  4. Synonymous codon usage and its potential link with optimal growth temperature in prokaryotes.

    PubMed

    Lobry, J R; Necşulea, A

    2006-12-30

    The relationship between codon usage in prokaryotes and their ability to grow at extreme temperatures has been given much attention over the past years. Previous studies have suggested that the difference in synonymous codon usage between (hyper)thermophiles and mesophiles is a consequence of a selective pressure linked to growth temperature. Here, we performed an updated analysis of the variation in synonymous codon usage with growth temperature; our study includes a large number of species from a wide taxonomic and growth temperature range. The presence of psychrophilic species in our study allowed us to test whether the same selective pressure acts on synonymous codon usage at very low growth temperature. Our results show that the synonymous codon usage for Arg (through the AGG, AGA and CGT codons) is the most discriminating factor between (hyper)thermophilic and non-thermophilic species, thus confirming previous studies. We report the unusual clustering of an Archaeal psychrophile with the thermophilic and hyperthermophilic species on the synonymous codon usage factorial map; the other psychrophiles in our study cluster with the mesophilic species. Our conclusion is that the difference in synonymous codon usage between (hyper)thermophilic and non-thermophilic species cannot be clearly attributed to a selective pressure linked to growth at high temperatures.

  5. Superhydrophilic molecularly imprinted polymers based on a water-soluble functional monomer for the recognition of gastrodin in water media.

    PubMed

    Ji, Wenhua; Zhang, Mingming; Wang, Daijie; Wang, Xiao; Liu, Jianhua; Huang, Luqi

    2015-12-18

    In this study, the first successfully developed superhydrophilic molecularly imprinted polymers (MIPs) for gastrodin recognition have been described. MIPs were prepared via the bulk polymerization process in an aqueous solution using alkenyl glycosides glucose (AGG) as the water-soluble functional monomer. The non-imprinted polymers (NIPs) were also synthesized using the same method without the use of the template. The dynamic water contact angles and photographs of the dispersion properties confirmed that the molecularly imprinted polymers displayed excellent superhydrophilicity. The results demonstrated that the MIPs exhibited high selectivity and an excellent imprinting effect. A molecularly imprinted solid phase extraction (MISPE) method was established. Optimization of various parameters affecting MISPE was investigated. Under the optimized conditions, a wide linear range (0.001-100.0μgmL(-1)) and low limits of detection (LOD) and quantification (LOQ) (0.03 and 0.09ngmL(-1), respectively) were achieved. When compared with the NIPs, higher recoveries (90.5% to 97.6%) of gastrodin with lower relative standard deviations values (below 6.4%) using high performance liquid chromatography were obtained at three spiked levels in three blank samples. These results demonstrated one efficient, highly selective and environmentally-friendly MISPE technique with excellent reproducibility for the purification and pre-concentration of gastrodin from an aqueous extract of Gastrodia elata roots. PMID:26627582

  6. An Observational Study of Honey Bee Colony Winter Losses and Their Association with Varroa destructor, Neonicotinoids and Other Risk Factors.

    PubMed

    van der Zee, Romée; Gray, Alison; Pisa, Lennard; de Rijk, Theo

    2015-01-01

    This article presents results of an analysis of honey bee losses over the winter of 2011-2012 in the Netherlands, from a sample of 86 colonies, located at 43 apiaries. The apiaries were selected using spatially stratified random sampling. Colony winter loss data were collected and related to various measures of colony strength recorded in summer, as well as data from laboratory analysis of sample material taken from two selected colonies in each of the 43 apiaries. The logistic regression model which best explained the risk of winter loss included, in order of statistical importance, the variables (1) Varroa destructor mite infestation rate in October 2011, (2) presence of the cyano-substituted neonicotinoids acetamiprid or thiacloprid in the first 2 weeks of August 2011 in at least one of the honey bee matrices honey, bees or bee bread (pollen), (3) presence of Brassica napus (oilseed rape) or Sinapis arvensis (wild mustard) pollen in bee bread in early August 2011, and (4) a measure of the unexplained winter losses for the postal code area where the colonies were located, obtained from a different dataset. We consider in the discussion that reduced opportunities for foraging in July and August because of bad weather may have added substantially to the adverse effects of acetamiprid and thiacloprid. A novel feature of this work is its use of postal code random effects from two other independent datasets collected in the annual national monitoring by questionnaires of winter losses of honey bees in the Netherlands. These were used to plan the sample selection and also in the model fitting of the data in this study. It should however be noted that the results of the present pilot study are based on limited data, which may consequently reveal strong factors but fail to demonstrate possible interaction effects. PMID:26154346

  7. Quantifying the introgressive hybridisation propensity between transgenic oilseed rape and its wild/weedy relatives.

    PubMed

    Devos, Yann; De Schrijver, Adinda; Reheul, Dirk

    2009-02-01

    In order to estimate the introgressive hybridisation propensity (IHP) between genetically modified (GM) oilseed rape (Brassica napus) and certain of its cross-compatible wild/weedy relatives at the landscape level, a conceptual approach was developed. A gene flow index was established enclosing the successive steps to successfully achieve introgressive hybridisation: wild/weedy relatives and oilseed rape should co-occur, have overlapping flowering periods, be compatible, produce viable and fertile progeny, and the transgenes should persist in natural/weedy populations. Each step was described and scored, resulting in an IHP value for each cross-compatible oilseed rape wild/weedy relative. The gene flow index revealed that Brassica rapa has the highest introgressive hybridisation propensity (IHP value = 11.5), followed by Hirschfeldia incana and Raphanus raphanistrum (IHP = 6.7), Brassica juncea (IHP = 5.1), Diplotaxis tenuifolia and Sinapis arvensis (IHP = 4.5) in Flanders. Based on the IHP values, monitoring priorities can be defined within the pool of cross-compatible wild/weedy oilseed rape relatives. Moreover, the developed approach enables to select areas where case-specific monitoring of GM oilseed rape could be done in order to detect potential adverse effects on cross-compatible wild/weedy relatives resulting from vertical gene flow. The implementation of the proposed oilseed rape-wild relative gene flow index revealed that the survey design of existing botanical survey networks does not suit general surveillance needs of GM crops in Belgium. The encountered hurdles to implement the gene flow index and proposals to acquire the missing data are discussed.

  8. Efficacy of plant essential oils on postharvest control of rots caused by fungi on different stone fruits in vivo.

    PubMed

    Lopez-Reyes, Jorge Giovanny; Spadaro, Davide; Prelle, Ambra; Garibaldi, Angelo; Gullino, Maria Lodovica

    2013-04-01

    The antifungal activity of plant essential oils was evaluated as postharvest treatment on stone fruit against brown rot and grey mold rot of stone fruit caused by Monilinia laxa and Botrytis cinerea, respectively. The essential oils from basil (Ocimum basilicum), fennel (Foeniculum sativum), lavender (Lavandula officinalis), marjoram (Origanum majorana), oregano (Origanum vulgare), peppermint (Mentha piperita), rosemary (Rosmarinus officinalis), sage (Salvia officinalis), savory (Satureja montana), thyme (Thymus vulgaris), and wild mint (Mentha arvensis) were tested at two different concentrations on apricots (cv. Kyoto and cv. Tonda di Costigliole), nectarines (cv. Big Top and cv. Nectaross) and plums (cv. Italia and cv. TC Sun). The volatile composition of the essential oils tested was determined by gas chromatography-mass spectrometry analysis. The treatments containing essential oils from oregano, savory, and thyme at 1% (vol/vol) controlled both B. cinerea and M. laxa growing on apricots cv. Tonda di Costigliole and plums cv. Italia and cv. TC Sun; however, the same treatments were phytotoxic for the carposphere of nectarines cv. Big Top and cv. Nectaross. Treatments with 10% (vol/vol) essential oils were highly phytotoxic, notwithstanding their efficacy against the pathogens tested. The essential oils containing as major components α-pinene, p-cymene, carvacrol, and thymol showed similar results on stone fruit, so their antimicrobial activity and the phytotoxicity produced could be based on the concentration of their principal compounds and their synergistic activity. The efficacy of the essential oil treatments on control of fungal pathogens in postharvest depended on the fruit cultivar, the composition and concentration of the essential oil applied, and the length of storage. PMID:23575125

  9. The quest for a herbal contraceptive.

    PubMed

    Chaudhury, R R

    1993-01-01

    An oral herbal contraceptive would allow couples control their fertility without consulting a health worker, which in turn would likely markedly increase the number of couples practicing family planning. Other advantages of such a contraceptive would include the familiarity rural people have with herbal medicines, the fewer side effects associated with herbal preparations, their ready availability from local sources, and protection of privacy. There are many references to plants in India with antifertility properties. Since 1966, the Indian Council of Medical Research (ICMR) has been conducting research to identify a herbal contraceptive, as have other organizations. Plants that have exhibited antifertility activity in clinical trials include Hibiscus rosasinensis (benzene extract of the flower petals suppresses implantation); Rudrapushpaka (extract of the flower petals prevents pregnancy); Embelia ribes (pregnancy prevention); Davcus carota, Butea monosperma, and Sapindus trifoliatis (seeds have an anti-implantation effect); and Mentha arvensis (leaves have anti-implantation effect). The Central Drug Research Institute in Lucknow, India, in collaboration with the US National Institutes of Health, the World Health Organization, and the ICMR confirm anti-implantation activity in Ferula jaeschkeana, Bupleurum marginatum, Lepidium capitatum, Caesalpinia sepiaria, Lonicera japonica, Juniperus communis, Lotus corniculatus, Lamium allum, and Acacia farnesiana. In China, scientists have evaluated the cotton-seed extract gossypol as a male contraceptive. They are now studying the possible antifertility effect on men of the plant Tripterygium wilfordii. From all the aforementioned plants as well as others under investigation, three possible types of contraceptives could be developed: an anti-ovulatory contraceptive; a postcoital contraceptive; and a male contraceptive. Some obstacles to their development include difficulties in obtaining adequate quantities of the herbs, a

  10. Field evaluation of traditionally used plant-based insect repellents and fumigants against the malaria vector Anopheles darlingi in Riberalta, Bolivian Amazon.

    PubMed

    Moore, Sarah J; Hill, Nigel; Ruiz, Carmen; Cameron, Mary M

    2007-07-01

    Inexpensive insect repellents may be needed to supplement the use of impregnated bed-nets in the Amazon region, where the primary malaria vector, Anopheles darlingi (Root), is exophilic and feeds in the early evening. Three plants that are traditionally used to repel mosquitoes in Riberalta, Bolivian Amazon, were identified by focus group, and then they were tested against An. darlingi as well as Mansonia indubitans (Dyar & Shannon)/Mansonia titillans (Walker). Cymbopogon citratus (Staph), Guatemalan lemongrass, essential oil at 25% was used as a skin repellent, and it provided 74% protection for 2.5 h against predominantly An. darlingi and 95% protection for 2.5 h against Mansonia spp. Attalea princeps (name not verified) husks, burned on charcoal in the traditional way provided 35 and 51% protection against An. darlingi and Mansonia spp., respectively. Kerosene lamps, often used to light rural homes, were used as a heat source to volatilize 100% Mentha arvensis (Malinv ex. Bailey) essential oil, and they reduced biting by 41% inside traditional homes against Mansonia spp., although they were ineffective outdoors against An. darlingi. All three plant-based repellents provided significant protection compared with controls. Plant-based repellents, although less effective than synthetic alternatives, were shown by focus groups to be more culturally acceptable in this setting, in particular para-menthane-3, 8, idol derived from lemon eucalyptus, Corymbia citriodora (Hook). Plant-based repellents have the potential to be produced locally and therefore sold more cheaply than synthetic commercial repellents. Importantly, their low cost may encourage user compliance among indigenous and marginalized populations. PMID:17695017

  11. The cupric ion reducing antioxidant capacity and polyphenolic content of some herbal teas.

    PubMed

    Apak, Reşat; Güçlü, Kubilay; Ozyürek, Mustafa; Esin Karademir, Saliha; Erçağ, Erol

    2006-01-01

    The total antioxidant capacity of the aqueous extracts of some endemic herbs-prepared as infusions by steeping these herbs in hot water--was assayed with bis(neocuproine)copper(II) chloride, also known as the cupric ion reducing antioxidant capacity (CUPRAC) reagent, which was easily accessible, rapid, stable and responsive to both hydrophilic and lipophilic antioxidants. The highest antioxidant capacities of some herbal teas available in the Turkish market were observed for scarlet pimpernel (Anagallis arvensis), sweet basil (Ocimum basilicum), green tea (Camellia sinensis) and lemon balm (Melissa officinalis), in this order (1.63, 1.18, 1.07, and 0.99 mmol trolox equivalent (TR)/g, respectively). For infusions prepared from ready-to-use tea bags, the CUPRAC values were highest for Ceylon blended ordinary tea (4.41), green tea with lemon (1.61), English breakfast ordinary tea (1.26) and green tea (0.94), all of which were manufactured types of C. sinensis. Following the strongest antioxidant herbs with capacities close to or slightly exceeding 1.0 mmol TR/g, sage, thyme, coriander, coltsfoot, blackberry and immortelle (Helichrysum) exhibited capacities around 0.5 mmol TR/g. The correlation of the Folin total phenolic content of herbal teas with their CUPRAC and ABTS (2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt) total antioxidant capacities gave linear curves with correlation coefficients of 0.966 and 0.936, respectively, showing that the CUPRAC assay results better correlated with total phenolic content of herbal teas. Absorbance versus concentration data at different dilutions and upon standard additions of model antioxidant compounds (trolox and quercetin) to herbal tea infusions showed that the absorbances (at 450 nm of the CUPRAC method) due to different antioxidant compounds in herbal tea infusions were additive; that is, the tested antioxidants did not chemically interact to cause apparent deviations from Beer's law.

  12. Phenotypic flexibility in cutaneous water loss and lipids of the stratum corneum.

    PubMed

    Haugen, Michael J; Tieleman, B Irene; Williams, Joseph B

    2003-10-01

    When vertebrates invaded land during the Carboniferous period, they were exposed not only to new ecological opportunities but also to a desiccating environment. To maintain cellular water homeostasis, natural selection modified the integument of pioneering terrestrial animals, enabling them to reduce water loss through the skin. In desert environments, where ambient temperatures (T(a)) can reach 50 degrees C, relative humidities are low and drinking water is scarce, integumentary modifications that reduce cutaneous water loss (CWL) could be fundamental to survival. Previous research has shown that hoopoe larks (Alaemon alaudipes) from the Arabian desert reduced CWL when acclimated to 35 degrees C compared with individuals at 15 degrees C, but skylarks (Alauda arvensis) and woodlarks (Lullula arborea), from The Netherlands, and Dunn's larks (Eremalauda dunni), also from the Arabian desert, did not. Here, we test the idea that hoopoe larks acclimated to 35 degrees C would alter the lipid composition of their stratum corneum (SC), resulting in a decrease in CWL, but that skylarks, woodlarks and Dunn's larks would not. Specifically, we hypothesized that hoopoe larks, acclimated to 35 degrees C, would increase the proportions of polar ceramide content and decrease the proportions of free fatty acids in their SC compared with individuals acclimated to 15 degrees C. Results showed that hoopoe larks at 35 degrees C had lower CWL and higher proportions of total ceramides but lower proportions of free fatty acids and sterols in their SC. We demonstrate that adjustments in ratios of lipid classes in the SC are associated with changes in CWL in hoopoe larks.

  13. Uptake and distribution of minerals and heavy metals in commonly grown leafy vegetable species irrigated with sewage water.

    PubMed

    Anwar, Sumera; Nawaz, Muhammad Farrakh; Gul, Sadaf; Rizwan, Muhammad; Ali, Shafaqat; Kareem, Arshaad

    2016-09-01

    Heavy metal uptake and accumulation behavior in dietary vegetables irrigated with sewage waters is an important issue worldwide. The main objective of this study was to examine and compare the physiological and growth responses of leafy vegetables irrigated with sewage water. A pot experiment was conducted in a wire house with three leafy vegetables, coriander (Coriandrum sativum), mint (Mentha arvensis), and fenugreek (Trigonella foenum), grown under ambient conditions. Plants were irrigated with different concentrations, 0, 50 (T 1), and 100 % (T 2), of sewage water. After harvesting, morphological and physiological parameters of plants were measured. Heavy metal (Cd, Cu, Pb, and Zn) concentrations in the sewage water were found much higher than safer limits. The results revealed that the highest plant biomass and lowest metal contents were observed in control treatments in all studied vegetables. The biomass of all the vegetables were negatively affected when irrigated with sewage water. In T 2, coriander accumulated maximum Cd (μg g(-1) DW) in shoots (4.97) as compared to other vegetables. The maximum Pb and Cu concentrations were accumulated in mint roots (44 and 3.9, respectively) as compared to coriander and fenugreek. Zinc was accumulated in the sequence of leaves > roots > shoots under polluted water irrigation. The concentrations of potassium increased in leaves, shoots, and roots in all vegetables, while phosphorous concentrations varied with species and plant parts with increasing sewage water concentration. It was found that the leafy vegetables grown with sewage water irrigation may cause severe human health problems. PMID:27581008

  14. Wild Skylarks Seasonally Modulate Energy Budgets but Maintain Energetically Costly Inflammatory Immune Responses throughout the Annual Cycle

    PubMed Central

    Hegemann, Arne; Matson, Kevin D.; Versteegh, Maaike A.; Tieleman, B. Irene

    2012-01-01

    A central hypothesis of ecological immunology is that immune defences are traded off against competing physiological and behavioural processes. During energetically demanding periods, birds are predicted to switch from expensive inflammatory responses to less costly immune responses. Acute phase responses (APRs) are a particularly costly form of immune defence, and, hence, seasonal modulations in APRs are expected. Yet, hypotheses about APR modulation remain untested in free-living organisms throughout a complete annual cycle. We studied seasonal modulations in the APRs and in the energy budgets of skylarks Alauda arvensis, a partial migrant bird from temperate zones that experiences substantial ecological changes during its annual cycle. We characterized throughout the annual cycle changes in their energy budgets by measuring basal metabolic rate (BMR) and body mass. We quantified APRs by measuring the effects of a lipopolysaccharide injection on metabolic rate, body mass, body temperature, and concentrations of glucose and ketone. Body mass and BMR were lowest during breeding, highest during winter and intermediate during spring migration, moult and autumn migration. Despite this variation in energy budgets, the magnitude of the APR, as measured by all variables, was similar in all annual cycle stages. Thus, while we find evidence that some annual cycle stages are relatively more energetically constrained, we find no support for the hypothesis that during these annual cycle stages birds compromise an immune defence that is itself energetically costly. We suggest that the ability to mount an APR may be so essential to survival in every annual cycle stage that skylarks do not trade off this costly form of defence with other annual cycle demands. PMID:22570706

  15. An Observational Study of Honey Bee Colony Winter Losses and Their Association with Varroa destructor, Neonicotinoids and Other Risk Factors.

    PubMed

    van der Zee, Romée; Gray, Alison; Pisa, Lennard; de Rijk, Theo

    2015-01-01

    This article presents results of an analysis of honey bee losses over the winter of 2011-2012 in the Netherlands, from a sample of 86 colonies, located at 43 apiaries. The apiaries were selected using spatially stratified random sampling. Colony winter loss data were collected and related to various measures of colony strength recorded in summer, as well as data from laboratory analysis of sample material taken from two selected colonies in each of the 43 apiaries. The logistic regression model which best explained the risk of winter loss included, in order of statistical importance, the variables (1) Varroa destructor mite infestation rate in October 2011, (2) presence of the cyano-substituted neonicotinoids acetamiprid or thiacloprid in the first 2 weeks of August 2011 in at least one of the honey bee matrices honey, bees or bee bread (pollen), (3) presence of Brassica napus (oilseed rape) or Sinapis arvensis (wild mustard) pollen in bee bread in early August 2011, and (4) a measure of the unexplained winter losses for the postal code area where the colonies were located, obtained from a different dataset. We consider in the discussion that reduced opportunities for foraging in July and August because of bad weather may have added substantially to the adverse effects of acetamiprid and thiacloprid. A novel feature of this work is its use of postal code random effects from two other independent datasets collected in the annual national monitoring by questionnaires of winter losses of honey bees in the Netherlands. These were used to plan the sample selection and also in the model fitting of the data in this study. It should however be noted that the results of the present pilot study are based on limited data, which may consequently reveal strong factors but fail to demonstrate possible interaction effects.

  16. Antioxidant activity of herbaceous plant extracts protect against hydrogen peroxide-induced DNA damage in human lymphocytes

    PubMed Central

    2013-01-01

    Background Herbaceous plants containing antioxidants can protect against DNA damage. The purpose of this study was to evaluate the antioxidant substances, antioxidant activity, and protection of DNA from oxidative damage in human lymphocytes induced by hydrogen peroxide (H2O2). Our methods used acidic methanol and water extractions from six herbaceous plants, including Bidens alba (BA), Lycium chinense (LC), Mentha arvensis (MA), Plantago asiatica (PA), Houttuynia cordata (HC), and Centella asiatica (CA). Methods Antioxidant compounds such as flavonol and polyphenol were analyzed. Antioxidant activity was determined by the inhibition percentage of conjugated diene formation in a linoleic acid emulsion system and by trolox-equivalent antioxidant capacity (TEAC) assay. Their antioxidative capacities for protecting human lymphocyte DNA from H2O2-induced strand breaks was evaluated by comet assay. Results The studied plants were found to be rich in flavonols, especially myricetin in BA, morin in MA, quercetin in HC, and kaemperol in CA. In addition, polyphenol abounded in BA and CA. The best conjugated diene formation inhibition percentage was found in the acidic methanolic extract of PA. Regarding TEAC, the best antioxidant activity was generated from the acidic methanolic extract of HC. Water and acidic methanolic extracts of MA and HC both had better inhibition percentages of tail DNA% and tail moment as compared to the rest of the tested extracts, and significantly suppressed oxidative damage to lymphocyte DNA. Conclusion Quercetin and morin are important for preventing peroxidation and oxidative damage to DNA, and the leaves of MA and HC extracts may have excellent potential as functional ingredients representing potential sources of natural antioxidants. PMID:24279749

  17. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections.

    PubMed

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J

    2016-01-01

    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P < 0.05), as well as higher total polyphenol and flavonoid contents than other plant extracts. Minimum inhibitory concentrations on MRSA isolates ranged from 388.4 ± 0.2 mg/L, in D. sanguinalis, to 5.5 ± 0.1 mg/L, in L. aphaca. The methanolic extracts of L. aphaca (Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings. PMID:27585260

  18. Efficacy of plant essential oils on postharvest control of rots caused by fungi on different stone fruits in vivo.

    PubMed

    Lopez-Reyes, Jorge Giovanny; Spadaro, Davide; Prelle, Ambra; Garibaldi, Angelo; Gullino, Maria Lodovica

    2013-04-01

    The antifungal activity of plant essential oils was evaluated as postharvest treatment on stone fruit against brown rot and grey mold rot of stone fruit caused by Monilinia laxa and Botrytis cinerea, respectively. The essential oils from basil (Ocimum basilicum), fennel (Foeniculum sativum), lavender (Lavandula officinalis), marjoram (Origanum majorana), oregano (Origanum vulgare), peppermint (Mentha piperita), rosemary (Rosmarinus officinalis), sage (Salvia officinalis), savory (Satureja montana), thyme (Thymus vulgaris), and wild mint (Mentha arvensis) were tested at two different concentrations on apricots (cv. Kyoto and cv. Tonda di Costigliole), nectarines (cv. Big Top and cv. Nectaross) and plums (cv. Italia and cv. TC Sun). The volatile composition of the essential oils tested was determined by gas chromatography-mass spectrometry analysis. The treatments containing essential oils from oregano, savory, and thyme at 1% (vol/vol) controlled both B. cinerea and M. laxa growing on apricots cv. Tonda di Costigliole and plums cv. Italia and cv. TC Sun; however, the same treatments were phytotoxic for the carposphere of nectarines cv. Big Top and cv. Nectaross. Treatments with 10% (vol/vol) essential oils were highly phytotoxic, notwithstanding their efficacy against the pathogens tested. The essential oils containing as major components α-pinene, p-cymene, carvacrol, and thymol showed similar results on stone fruit, so their antimicrobial activity and the phytotoxicity produced could be based on the concentration of their principal compounds and their synergistic activity. The efficacy of the essential oil treatments on control of fungal pathogens in postharvest depended on the fruit cultivar, the composition and concentration of the essential oil applied, and the length of storage.

  19. Plant speciation in continental island floras as exemplified by Nigella in the Aegean Archipelago.

    PubMed

    Comes, Hans Peter; Tribsch, Andreas; Bittkau, Christiane

    2008-09-27

    Continental shelf island systems, created by rising sea levels, provide a premier setting for studying the effects of geographical isolation on non-adaptive radiation and allopatric speciation brought about by genetic drift. The Aegean Archipelago forms a highly fragmented complex of mostly continental shelf islands that have become disconnected from each other and the mainland in relatively recent geological times (ca <5.2 Ma). These ecologically fairly homogenous islands thus provide a suitable biogeographic context for assessing the relative influences of past range fragmentation, colonization, gene flow and drift on taxon diversification. Indeed, recent molecular biogeographic studies on the Aegean Nigella arvensis complex, combining phylogenetic, phylogeographic and population level approaches, exemplify the importance of allopatry and genetic drift coupled with restricted gene flow in driving plant speciation in this continental archipelago at different temporal and spatial scales. While the recent (Late Pleistocene) radiation of Aegean Nigella, as well as possible instances of incipient speciation (in the Cyclades), is shown to be strongly conditioned by (palaeo)geographic factors (including changes in sea level), shifts in breeding system (selfing) and associated isolating mechanisms have also contributed to this radiation. By contrast, founder event speciation has probably played only a minor role, perhaps reflecting a migratory situation typical for continental archipelagos characterized by niche pre-emption because of a long established resident flora. Overall, surveys of neutral molecular markers in Aegean Nigella have so far revealed population genetic processes that conform remarkably well to predictions raised by genetic drift theory. The challenge is now to gain more direct insights into the relative importance of the role of genetic drift, as opposed to natural selection, in the phenotypic and reproductive divergence among these Aegean plant

  20. [Morphogenesis and ultrastructure of basidiomycetes Agaricus and Pleurotus mitochondria].

    PubMed

    Matrosova, E V; Mazheĭka, I S; Kudriavtseva, O A; Kamzolkina, O V

    2009-01-01

    Mitochondrial morphogenesis in 31 strains of 9 species of Agaricus--A. arvensis Schaeff., A. bisporus (Lange) Imbach, A. bitorquis (Quel.) Sacc., A. campestris L., A. excellens (F. H. Moller) F. H. Moller, A. macrocarpus (F. H. Möller) F. H. Möller, A. silvaticus Schaeff., A. silvicola (Vittad.) Peck, A. xanthodermus Genev--and 2 strains of Pleurotus--P. ostreatus (Jacg.) P. Kumm., P. pulmonarius (Fr.) Quel.--has many common features in mitochondria distribution under favorable growth conditions (type 1) and in reconstruction of chondriom (fission or fragmentation) under unfavorable growth conditions and aging (type 2). The first type of mitochondria distribution was observed in heterokaryotic mycelium of some Agaricus strains and Pleurotus grown in agar medium during 7-14 days, and also in submerged mycelium of some Agaricus strains and Pleurotus. The second type of mitochondria distribution was observed in homokaryotic Agaricus strains under condition of starvation, in aging mycelium (28 days of growth), and in submerged mycelium of most of Agaricus strains. The first type of chondriom consists of small granular mitochondria in the apical cells and long snake-like network in subapical cells, and restores almost completely the mitochondrial network in the aging mycelium cells. The second type of chondriom consists of small granular mitochondria in all cells of mycelium. The surface of chondriom type 2 mitochondrial membrane was usually closely associated with ribosomes and changed crists. Such mycelium cells in A. bisporus strain Bs94 were TUNEL positive. So, the types of mitochondria morphogenesis in the Agaricus and Pleurotus mycelium cells are similar at different time and growth conditions and depend on complex of physiological and biochemical process in the mycelium cells.

  1. An Observational Study of Honey Bee Colony Winter Losses and Their Association with Varroa destructor, Neonicotinoids and Other Risk Factors

    PubMed Central

    van der Zee, Romée; Gray, Alison; Pisa, Lennard; de Rijk, Theo

    2015-01-01

    This article presents results of an analysis of honey bee losses over the winter of 2011-2012 in the Netherlands, from a sample of 86 colonies, located at 43 apiaries. The apiaries were selected using spatially stratified random sampling. Colony winter loss data were collected and related to various measures of colony strength recorded in summer, as well as data from laboratory analysis of sample material taken from two selected colonies in each of the 43 apiaries. The logistic regression model which best explained the risk of winter loss included, in order of statistical importance, the variables (1) Varroa destructor mite infestation rate in October 2011, (2) presence of the cyano-substituted neonicotinoids acetamiprid or thiacloprid in the first 2 weeks of August 2011 in at least one of the honey bee matrices honey, bees or bee bread (pollen), (3) presence of Brassica napus (oilseed rape) or Sinapis arvensis (wild mustard) pollen in bee bread in early August 2011, and (4) a measure of the unexplained winter losses for the postal code area where the colonies were located, obtained from a different dataset. We consider in the discussion that reduced opportunities for foraging in July and August because of bad weather may have added substantially to the adverse effects of acetamiprid and thiacloprid. A novel feature of this work is its use of postal code random effects from two other independent datasets collected in the annual national monitoring by questionnaires of winter losses of honey bees in the Netherlands. These were used to plan the sample selection and also in the model fitting of the data in this study. It should however be noted that the results of the present pilot study are based on limited data, which may consequently reveal strong factors but fail to demonstrate possible interaction effects. PMID:26154346

  2. Ethnopharmacological survey among migrants living in the Southeast Atlantic Forest of Diadema, São Paulo, Brazil

    PubMed Central

    2010-01-01

    Background Understanding how people of diverse cultural backgrounds have traditionally used plants and animals as medicinal substances during displacements is one of the most important objectives of ethnopharmacological studies. An ethnopharmacological survey conducted among migrants living in the Southeast Atlantic Forest remnants (Diadema, São Paulo, Brazil) is presented herein. Methods Ethnographical methods were used to select and interview the migrants, and botanical and zoological techniques were employed to collect the indicated resources. Results We interviewed five migrants who described knowledge on 12 animals and 85 plants. Only 78 plants were present in Diadema, they belong to 37 taxonomic families; 68 were used exclusively for medicinal purposes, whereas 10 were reported to be toxic and/or presented some restriction of use. These taxa were grouped into 12 therapeutic categories (e.g., gastrointestinal disturbances, inflammatory processes or respiratory problems) based on the 41 individual complaints cited by the migrants. While the twelve animal species were used by the migrants to treat nine complaints; these were divided into six categories, the largest of which related to respiratory problems. None of the animal species and only 57 of the 78 plant species analysed in the present study were previously reported in the pharmacological literature; the popular knowledge concurred with academic findings for 30 of the plants. The seven plants [Impatiens hawkeri W. Bull., Artemisia canphorata Vill., Equisetum arvensis L., Senna pendula (Humb. & Bonpl. ex Willd.) H.S. Irwin & Barneby, Zea mays L., Fevillea passiflora Vell. and Croton fuscescens Spreng)] and the two animals (Atta sexdens and Periplaneta americana) that showed maintenance of use among migrants during their displacement in Brazilian territory, have not been studied by pharmacologists yet. Conclusions Thus, they should be highlighted and focused in further pharmacology and phytochemical studies

  3. Comparative biochemical and immunological studies of the glycine betaine synthesis pathway in diverse families of dicotyledons.

    PubMed

    Weretilnyk, E A; Bednarek, S; McCue, K F; Rhodes, D; Hanson, A D

    1989-06-01

    Members of the Chenopodiaceae can accumulate high levels (>100 μmol·(g DW)(-1)) of glycine betaine (betaine) in leaves when salinized. Chenopodiaceae synthesize betaine by a two-step oxidation of choline (choline→betaine aldehyde→ betaine), with the second step catalyzed by betaine aldehyde dehydrogenase (BADH, EC 1.2.1.8). High betaine levels have also been reported in leaves of species from several distantly-related families of dicotyledons, raising the question of whether the same betaine-synthesis pathway is used in all cases.Fast atom bombardment mass spectrometry showed that betaine levels of >100 μmol·(g DW)(-1) are present in Lycium ferocissimum Miers (Solanaceae), Helianthus annuus L. (Asteraceae), Convolvulus arvensis L. (Convolvulaceae), and Amaranthus caudatus L. (Amaranthaceae), that salinization promotes betaine accumulation in these plants, and that they can convert supplied choline to betaine aldehyde and betaine. Nicotiana tabacum L. and Lycopersicon lycopersicum (L.) Karst. ex Farw. (Solanaceae), Lactuca sativa L. (Asteraceae) and Ipomoea purpurea L. (Convolvulaceae) also contained betaine, but at a low level (0.1-0.5 μmol·(g DW)(-1). Betaine aldehyde dehydrogenase activity assays, immunotitration and immunoblotting demonstrated that the betaine-accumulating species have a BADH enzyme recognized by antibodies raised against BADH from Spinacia oleracea L. (Chenopodiaceae), and that the Mr of the BADH monomer is in all cases close to 63 000. These data indicate that the choline→betaine aldehyde→betaine pathway may have evolved by vertical descent from an early angiosperm ancestor, and might be widespread (albeit not always strongly expressed) among flowering plants. Consistent with these suggestions, Magnolia x soulangiana was found to have a low level of betaine, and to express a protein of Mr 63 000 which cross-reacted with antibodies to BADH from Spinacia oleracea. PMID:24212901

  4. Effect of water content and temperature on seed longevity of seven Brassicaceae species after 5 years of storage.

    PubMed

    Mira, S; Estrelles, E; González-Benito, M E

    2015-01-01

    Maximising seed longevity is crucial for genetic resource preservation and longevity of orthodox seeds is determined by environmental conditions (water content and temperature). The effect of water content (down to 0.01 g·H₂O·g(-1) ) on seed viability was studied at different temperatures for a 5-year storage period in taxonomically related species. Seeds of seven Brassicaceae species (Brassica repanda, Eruca vesicaria, Malcolmia littorea, Moricandia arvensis, Rorippa nasturtium-aquaticum, Sinapis alba, Sisymbrium runcinatum) were stored at 48 environments comprising a combination of eight water contents, from 0.21 to 0.01 g·H₂O·g(-1) DW and six temperatures (45, 35, 20, 5, -25, -170 °C). Survival curves were modelled and P50 calculated for those conditions where germination was reduced over the 5-year assay period. Critical water content for storage of seeds of six species at 45 °C ranged from 0.02 to 0.03 g·H₂O·g(-1) . The effect of extreme desiccation at 45 °C showed variability among species: three species showed damaging effects of drying below the critical water content, while for three species it was neither detrimental nor beneficial to seed longevity. Lipid content could be related to longevity, depending on the storage conditions. A variable seed longevity response to water content among taxonomically related species was found. The relative position of some of the species as long- or short-lived at 45 °C varied depending on the humidity at which storage behaviour was evaluated. Therefore, predictions of survival under desiccated conditions based on results obtained at high humidity might be problematic for some species.

  5. Favorable fragmentation: river reservoirs can impede downstream expansion of riparian weeds.

    PubMed

    Rood, Stewart B; Braatne, Jeffrey H; Goater, Lori A

    2010-09-01

    River valleys represent biologically rich corridors characterized by natural disturbances that create moist and barren sites suitable for colonization by native riparian plants, and also by weeds. Dams and reservoirs interrupt the longitudinal corridors and we hypothesized that this could restrict downstream weed expansion. To consider this "reservoir impediment" hypothesis we assessed the occurrences and abundances of weeds along a 315-km river valley corridor that commenced with an unimpounded reach of the Snake River and extended through Brownlee, Oxbow, and Hells Canyon reservoirs and dams, and downstream along the Snake River. Sampling along 206 belt transects with 3610 quadrats revealed 16 noxious and four invasive weed species. Ten weeds were upland plants, with Canada thistle (Cirsium arvense) restricted to the upstream reaches, where field morning glory (Convolvulus arvensis) was also more common. In contrast, St. John's wort (Hypericum perforatum) was more abundant below the dams, and medusahead wildrye (Taeniatherum caput-medusae) occurred primarily along the reservoirs. All seven riparian species were abundant in the upstream zones but sparse or absent below the dams. This pattern was observed for the facultative riparian species, poison hemlock (Conium maculatum) and perennial pepperweed (Lepidium latifolium), the obligate riparian, yellow nut sedge (Cyperus esculentus), the invasive perennial, reed canary grass (Phalaris arundinacea), and three invasive riparian trees, Russian olive (Elaeagnus angustifolia), false indigo (Amorpha fruticosa), and tamarisk (Tamarix spp.). The hydrophyte purple loosestrife (Lythrum salicaria) was also restricted to the upstream zone. These longitudinal patterns indicate that the reservoirs have impeded the downstream expansion of riparian weeds, and this may especially result from the repetitive draw-down and refilling of Brownlee Reservoir that imposes a lethal combination of drought and flood stress. The dams and

  6. Survival of weed seeds and animal parasites as affected by anaerobic digestion at meso- and thermophilic conditions.

    PubMed

    Johansen, Anders; Nielsen, Henrik B; Hansen, Christian M; Andreasen, Christian; Carlsgart, Josefine; Hauggard-Nielsen, Henrik; Roepstorff, Allan

    2013-04-01

    Anaerobic digestion of residual materials from animals and crops offers an opportunity to simultaneously produce bioenergy and plant fertilizers at single farms and in farm communities where input substrate materials and resulting digested residues are shared among member farms. A surplus benefit from this practice may be the suppressing of propagules from harmful biological pests like weeds and animal pathogens (e.g. parasites). In the present work, batch experiments were performed, where survival of seeds of seven species of weeds and non-embryonated eggs of the large roundworm of pigs, Ascaris suum, was assessed under conditions similar to biogas plants managed at meso- (37°C) and thermophilic (55°C) conditions. Cattle manure was used as digestion substrate and experimental units were sampled destructively over time. Regarding weed seeds, the effect of thermophilic conditions (55°C) was very clear as complete mortality, irrespective of weed species, was reached after less than 2 days. At mesophilic conditions, seeds of Avena fatua, Sinapsis arvensis, Solidago canadensis had completely lost germination ability, while Brassica napus, Fallopia convolvulus and Amzinckia micrantha still maintained low levels (~1%) of germination ability after 1 week. Chenopodium album was the only weed species which survived 1 week at substantial levels (7%) although after 11 d germination ability was totally lost. Similarly, at 55°C, no Ascaris eggs survived more than 3h of incubation. Incubation at 37°C did not affect egg survival during the first 48 h and it took up to 10 days before total elimination was reached. In general, anaerobic digestion in biogas plants seems an efficient way (thermophilic more efficient than mesophilic) to treat organic farm wastes in a way that suppresses animal parasites and weeds so that the digestates can be applied without risking spread of these pests. PMID:23266071

  7. Favorable fragmentation: river reservoirs can impede downstream expansion of riparian weeds.

    PubMed

    Rood, Stewart B; Braatne, Jeffrey H; Goater, Lori A

    2010-09-01

    River valleys represent biologically rich corridors characterized by natural disturbances that create moist and barren sites suitable for colonization by native riparian plants, and also by weeds. Dams and reservoirs interrupt the longitudinal corridors and we hypothesized that this could restrict downstream weed expansion. To consider this "reservoir impediment" hypothesis we assessed the occurrences and abundances of weeds along a 315-km river valley corridor that commenced with an unimpounded reach of the Snake River and extended through Brownlee, Oxbow, and Hells Canyon reservoirs and dams, and downstream along the Snake River. Sampling along 206 belt transects with 3610 quadrats revealed 16 noxious and four invasive weed species. Ten weeds were upland plants, with Canada thistle (Cirsium arvense) restricted to the upstream reaches, where field morning glory (Convolvulus arvensis) was also more common. In contrast, St. John's wort (Hypericum perforatum) was more abundant below the dams, and medusahead wildrye (Taeniatherum caput-medusae) occurred primarily along the reservoirs. All seven riparian species were abundant in the upstream zones but sparse or absent below the dams. This pattern was observed for the facultative riparian species, poison hemlock (Conium maculatum) and perennial pepperweed (Lepidium latifolium), the obligate riparian, yellow nut sedge (Cyperus esculentus), the invasive perennial, reed canary grass (Phalaris arundinacea), and three invasive riparian trees, Russian olive (Elaeagnus angustifolia), false indigo (Amorpha fruticosa), and tamarisk (Tamarix spp.). The hydrophyte purple loosestrife (Lythrum salicari