Sample records for avada eli vaatlejate

  1. 78 FR 49723 - Humboldt-Toiyabe National Forests; Ely Ranger District; Ely Westside Rangeland Project

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Forest Service Humboldt-Toiyabe National Forests; Ely Ranger District; Ely Westside Rangeland Project... of the Ely Westside Rangeland Project began in 2006 with the original Notice of Intent published in... and conditions) on the allotments in the Ely Westside Rangeland Project area. The objection...

  2. "ELI"--The Educational Futures Game.

    ERIC Educational Resources Information Center

    Mahoney, V. L. Mike; Grantham, Lex

    This report describes ELI, a computer-based educational game that gives participants, as citizens of fictitious cities, the opportunity to examine a variety of typical community issues relating to education within the context of broader city and regional problems. After a brief introduction, the game structure is described, including the setting…

  3. Gamma beam system at ELI-NP

    SciTech Connect

    Ur, Calin Alexandru


    The Gamma Beam System of ELI-NP will produce brilliant, quasi-monochromatic gamma-ray beams via Inverse Compton Scattering of short laser pulses on relativistic electron beam pulses. The scattered radiation is Doppler upshifted by more than 1,000,000 times and is forward focused in a narrow, polarized, tunable, laser-like beam. The gamma-ray beam at ELI-NP will be characterized by large spectral density of about 10{sup 4} photons/s/eV, narrow bandwidth (< 0.5%) and tunable energy from 200 keV up to about 20 MeV. The Gamma Beam System is a state-of-the-art equipment employing techniques and technologies at the limits of the present-day's knowledge.


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    55. TOP OF STEEL TOWER WITH ELI WINDMILL LOCATED ABOUT 6-8 MILES SOUTH OF NEBRASKA CITY AT EAST SIDE OF NEBRASKA HIGHWAY 75. - Kregel Windmill Company Factory, 1416 Central Avenue, Nebraska City, Otoe County, NE


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    58. DETAIL OF HEAD OF ELI WINDMILL ON THE GROUND AT THE STOLL RESIDENCE, ABOUT 1-1/2 MILES WEST OF NEBRASKA CITY ON STEAM WAGON ROAD. - Kregel Windmill Company Factory, 1416 Central Avenue, Nebraska City, Otoe County, NE


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  7. Assessing Eli Broad's Assault on Public School System Leadership

    ERIC Educational Resources Information Center

    English, Fenwick W.; Crowder, Zan


    Eli Broad's approach to reforming urban public education does not recognize his own self-interest in promoting changes within such educational systems, a classic problem of misrecognition. The Broad agenda is an assault on the notion of the mission of public education as a service instead of a for-profit enterprise concerned with making money for…


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  11. Gamma beam industrial applications at ELI-NP

    NASA Astrophysics Data System (ADS)

    Suliman, Gabriel; Iancu, Violeta; Ur, Calin A.; Iovea, Mihai; Daito, Izuru; Ohgaki, Hideaki


    The Nuclear Physics oriented pillar of the pan-European Extreme Light Infrastructure (ELI-NP) will host an ultra-bright, energy tunable, and quasi-monochromatic gamma-ray beam system in the range of 0.2-19.5 MeV produced by laser Compton backscattering. This gamma beam satisfies the criteria for large-size product investigations with added capabilities like isotope detection through the use of nuclear resonance fluorescence (NRF) and is ideal for non-destructive testing applications. Two major applications of gamma beams are being envisaged at ELI-NP: industrial applications based on NRF and industrial radiography and tomography. Both applications exploit the unique characteristics of the gamma beam to deliver new opportunities for the industry. Here, we present the experimental setups proposed at ELI-NP and discuss their performance based on analytical calculations and GEANT4 numerical simulations. One of the main advantages of using the gamma beam at ELI-NP for applications based on NRF is the availability of an advanced detector array, which can enhance the advantages already provided by the high quality of the gamma beam.

  12. Patients' satisfaction evaluation with the health center of elis province.


    Karavida, Angeliki; Stamouli, Maria-Aggeliki; Balis, Charalampos


    Patient satisfaction related to the provided health services is a key indicator of the quality of the health sector. The SERVQUAL model was employed as a way of measuring the level of patient satisfaction with the services of the Health Center of Elis Province. Although certain aspects such as "Assurance" and "Empathy" meet the users' needs, improvements like a detailed medical record and an overhaul of the equipment need to be introduced. PMID:25000072

  13. Patients' satisfaction evaluation with the health center of elis province.


    Karavida, Angeliki; Stamouli, Maria-Aggeliki; Balis, Charalampos


    Patient satisfaction related to the provided health services is a key indicator of the quality of the health sector. The SERVQUAL model was employed as a way of measuring the level of patient satisfaction with the services of the Health Center of Elis Province. Although certain aspects such as "Assurance" and "Empathy" meet the users' needs, improvements like a detailed medical record and an overhaul of the equipment need to be introduced.

  14. Extreme Light Infrastructure - Nuclear Physics Eli-Np Project

    NASA Astrophysics Data System (ADS)

    Gales, S.


    The development of high power lasers and the combination of such novel devices with accelerator technology has enlarged the science reach of many research fields, in particular High energy, Nuclear and Astrophysics as well as societal applications in Material Science, Nuclear Energy and Medicine. The European Strategic Forum for Research Infrastructures (ESFRI) has selected a proposal based on these new premises called "ELI" for Extreme Light Infrastructure. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW class lasers and a Back Compton Scattering High Brilliance and Intense Low Energy Gamma Beam , a marriage of Laser and Accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  15. ELIMED, MEDical and multidisciplinary applications at ELI-Beamlines

    NASA Astrophysics Data System (ADS)

    Schillaci, F.; Anzalone, A.; Cirrone, G. A. P.; Carpinelli, M.; Cuttone, G.; Cutroneo, M.; De Martinis, C.; Giove, D.; Korn, G.; Maggiore, M.; Manti, L.; Margarone, D.; Musumarra, A.; Perozziello, F. M.; Petrovic, I.; Pisciotta, P.; Renis, M.; Ristic-Fira, A.; Romano, F.; Romano, F. P.; Schettino, G.; Scuderi, V.; Torrisi, L.; Tramontana, A.; Tudisco, S.


    ELI-Beamlines is one of the pillars of the pan-European project ELI (Extreme Light Infrastructure). It will be an ultra high-intensity, high repetition-rate, femtosecond laser facility whose main goal is generation and applications of high-brightness X-ray sources and accelerated charged particles in different fields. Particular care will be devoted to the potential applicability of laser-driven ion beams for medical treatments of tumors. Indeed, such kind of beams show very interesting peculiarities and, moreover, laser-driven based accelerators can really represent a competitive alternative to conventional machines since they are expected to be more compact in size and less expensive. The ELIMED project was launched thanks to a collaboration established between FZU-ASCR (ELI-Beamlines) and INFN-LNS researchers. Several European institutes have already shown a great interest in the project aiming to explore the possibility to use laser-driven ion (mostly proton) beams for several applications with a particular regard for medical ones. To reach the project goal several tasks need to be fulfilled, starting from the optimization of laser-target interaction to dosimetric studies at the irradiation point at the end of a proper designed transport beam-line. Researchers from LNS have already developed and successfully tested a high-dispersive power Thomson Parabola Spectrometer, which is the first prototype of a more performing device to be used within the ELIMED project. Also a Magnetic Selection System able to produce a small pencil beam out of a wide energy distribution of ions produced in laser-target interaction has been realized and some preliminary work for its testing and characterization is in progress. In this contribution the status of the project will be reported together with a short description of the of the features of device recently developed.

  16. Simulation of photofission experiments at the ELI-NP facility

    NASA Astrophysics Data System (ADS)

    Constantin, P.; Balabanski, D. L.; Cuong, P. V.


    An extensive experimental program for the study of photofission will take place at the Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility, where different actinide targets will be exposed to a brilliant gamma beam to produce fission fragments. We report on the implementation within the Geant4 simulation toolkit of the photofission process, of related background processes, and of extended ionic charge parameterization. These developments are used to evaluate the production rates of photofission fragments and their release efficiency from the actinide targets.

  17. The ELI-NP facility for nuclear physics

    NASA Astrophysics Data System (ADS)

    Ur, C. A.; Balabanski, D.; Cata-Danil, G.; Gales, S.; Morjan, I.; Tesileanu, O.; Ursescu, D.; Ursu, I.; Zamfir, N. V.


    Extreme Light Infrastructure-Nuclear Physics (ELI-NP) is aiming to use extreme electromagnetic fields for nuclear physics research. The facility, currently under construction at Magurele-Bucharest, will comprise a high power laser system and a very brilliant gamma beam system. The technology involved in the construction of both systems is at the limits of the present-day's technological capabilities. The high power laser system will consist of two 10 PW lasers and it will produce intensities of up to 1023-1024 W/cm2. The gamma beam, produced via Compton backscattering of a laser beam on a relativistic electron beam, will be characterized by a narrow bandwidth (<0.5%) and tunable energy of up to almost 20 MeV. The research program of the facility covers a broad range of key topics in frontier fundamental physics and new nuclear physics. A particular attention is given to the development of innovative applications. In the present paper an overview of the project status and the overall performance characteristics of the main research equipment will be given. The main fundamental physics and applied research topics proposed to be studied at ELI-NP will also be briefly reviewed.

  18. Chaos in the Showalter-Noyes-Bar-Eli model of the Belousov-Zhabotinskii reaction

    NASA Astrophysics Data System (ADS)

    Lindberg, David; Turner, Jack S.; Barkley, Dwight


    The observation of robust, large-scale chaos in the Showalter-Noyes-Bar-Eli model of the Belousov-Zhabotinskii reaction is reported. The chaos observed is comparable to that found in CSTR experiments at low flow rates.

  19. Straight talk with...Daniel Levy. Interviewed by Elie Dolgin.


    Levy, Daniel


    The Framingham Heart Study (FHS) has long been a beacon of biomedical research, yielding landmark findings on everything from the links between elevated blood pressure and stroke to the genetic risk factors underlying cardiac arrhythmias. Now, the fabled 65-year-long study of cardiovascular disease is the beacon of a more modern trend in science: tight budgets. Thanks to the automatic cuts in US government spending known as sequestration, the approximately $9-million-per-year contract the FHS receives from the US National Heart, Lung, and Blood Institute (NHLBI) was reduced by $4 million on 1 August. The renewal of the contract, scheduled for 2015, is expected to run for only two or three years, instead of the usual seven as it has been in the past. And next month, the most visible effects of the cuts will take hold, when 19 layoffs (out of a total of 90 total staff members) go into effect. Overseeing the budget-related turbulence is Daniel Levy, a medical officer at the NHLBI who joined the FHS nearly 30 years ago and has served as the study's director since 1994. Elie Dolgin met with Levy in Framingham, on the outskirts of Boston, to discuss how he's taking the new funding realities to heart.

  20. Eli Lilly and Company's bioethics framework for human biomedical research.


    Van Campen, Luann E; Therasse, Donald G; Klopfenstein, Mitchell; Levine, Robert J


    Current ethics and good clinical practice guidelines address various aspects of pharmaceutical research and development, but do not comprehensively address the bioethical responsibilities of sponsors. To fill this void, in 2010 Eli Lilly and Company developed and implemented a Bioethics Framework for Human Biomedical Research to guide ethical decisions. (See our companion article that describes how the framework was developed and implemented and provides a critique of its usefulness and limitations.) This paper presents the actual framework that serves as a company resource for employee education and bioethics deliberations. The framework consists of four basic ethical principles and 13 essential elements for ethical human biomedical research and resides within the context of our company's mission, vision and values. For each component of the framework, we provide a high-level overview followed by a detailed description with cross-references to relevant well regarded guidance documents. The principles and guidance described should be familiar to those acquainted with research ethics. Therefore the novelty of the framework lies not in the foundational concepts presented as much as the attempt to specify and compile a sponsor's bioethical responsibilities to multiple stakeholders into one resource. When such a framework is employed, it can serve as a bioethical foundation to inform decisions and actions throughout clinical planning, trial design, study implementation and closeout, as well as to inform company positions on bioethical issues. The framework is, therefore, a useful tool for translating ethical aspirations into action - to help ensure pharmaceutical human biomedical research is conducted in a manner that aligns with consensus ethics principles, as well as a sponsor's core values.

  1. The elicitin-like glycoprotein, ELI025, is secreted by the pathogenic oomycete Pythium insidiosum and evades host antibody responses.


    Lerksuthirat, Tassanee; Lohnoo, Tassanee; Inkomlue, Ruchuros; Rujirawat, Thidarat; Yingyong, Wanta; Khositnithikul, Rommanee; Phaonakrop, Narumon; Roytrakul, Sittiruk; Sullivan, Thomas D; Krajaejun, Theerapong


    Pythium insidiosum is a unique oomycete that can infect humans and animals. Patients with a P. insidiosum infection (pythiosis) have high rates of morbidity and mortality. The pathogen resists conventional antifungal drugs. Information on the biology and pathogenesis of P. insidiosum is limited. Many pathogens secrete proteins, known as effectors, which can affect the host response and promote the infection process. Elicitins are secretory proteins and are found only in the oomycetes, primarily in Phytophthora and Pythium species. In plant-pathogenic oomycetes, elicitins function as pathogen-associated molecular pattern molecules, sterol carriers, and plant defense stimulators. Recently, we reported a number of elicitin-encoding genes from the P. insidiosum transcriptome. The function of elicitins during human infections is unknown. One of the P. insidiosum elicitin-encoding genes, ELI025, is highly expressed and up-regulated at body temperature. This study aims to characterize the biochemical, immunological, and genetic properties of the elicitin protein, ELI025. A 12.4-kDa recombinant ELI025 protein (rELI025) was expressed in Escherichia coli. Rabbit anti-rELI025 antibodies reacted strongly with the native ELI025 in P. insidiosum's culture medium. The detected ELI025 had two isoforms: glycosylated and non-glycosylated. ELI025 was not immunoreactive with sera from pythiosis patients. The region near the transcriptional start site of ELI025 contained conserved oomycete core promoter elements. In conclusion, ELI025 is a small, abundant, secreted glycoprotein that evades host antibody responses. ELI025 is a promising candidate for development of diagnostic and therapeutic targets for pythiosis. PMID:25793767

  2. The Elicitin-Like Glycoprotein, ELI025, Is Secreted by the Pathogenic Oomycete Pythium insidiosum and Evades Host Antibody Responses

    PubMed Central

    Lerksuthirat, Tassanee; Lohnoo, Tassanee; Inkomlue, Ruchuros; Rujirawat, Thidarat; Yingyong, Wanta; Khositnithikul, Rommanee; Phaonakrop, Narumon; Roytrakul, Sittiruk; Sullivan, Thomas D.; Krajaejun, Theerapong


    Pythium insidiosum is a unique oomycete that can infect humans and animals. Patients with a P. insidiosum infection (pythiosis) have high rates of morbidity and mortality. The pathogen resists conventional antifungal drugs. Information on the biology and pathogenesis of P. insidiosum is limited. Many pathogens secrete proteins, known as effectors, which can affect the host response and promote the infection process. Elicitins are secretory proteins and are found only in the oomycetes, primarily in Phytophthora and Pythium species. In plant-pathogenic oomycetes, elicitins function as pathogen-associated molecular pattern molecules, sterol carriers, and plant defense stimulators. Recently, we reported a number of elicitin-encoding genes from the P. insidiosum transcriptome. The function of elicitins during human infections is unknown. One of the P. insidiosum elicitin-encoding genes, ELI025, is highly expressed and up-regulated at body temperature. This study aims to characterize the biochemical, immunological, and genetic properties of the elicitin protein, ELI025. A 12.4-kDa recombinant ELI025 protein (rELI025) was expressed in Escherichia coli. Rabbit anti-rELI025 antibodies reacted strongly with the native ELI025 in P. insidiosum’s culture medium. The detected ELI025 had two isoforms: glycosylated and non-glycosylated. ELI025 was not immunoreactive with sera from pythiosis patients. The region near the transcriptional start site of ELI025 contained conserved oomycete core promoter elements. In conclusion, ELI025 is a small, abundant, secreted glycoprotein that evades host antibody responses. ELI025 is a promising candidate for development of diagnostic and therapeutic targets for pythiosis. PMID:25793767

  3. Implementation status of the extreme light infrastructure - nuclear physics (ELI-NP) project

    NASA Astrophysics Data System (ADS)

    Gales, S.; Zamfir, N. V.


    The Project Extreme Light Infrastructure (ELI) is part of the European Strategic Forum for Research Infrastructures (ESFRI) Roadmap. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  4. Sercarzian immunology--In memoriam. Eli E. Sercarz, 1934-2009.


    Maverakis, Emanual


    During his long career as a principal investigator and educator, Eli Sercarz trained over 100 scientists. He is best known for developing hen egg white lysozyme (HEL) as a model antigen for immunologic studies. Working in his model system Eli furthered our understanding of antigen processing and immunologic tolerance. His work established important concepts of how the immune system recognizes antigenic determinants processed from whole protein antigens; specifically he developed the concepts of immunodominance and crypticity. Later in his career he focused more on autoimmunity using a variety of established animal models to develop theories on how T cells can circumvent tolerance induction and how an autoreactive immune response can evolve over time. His theory of "determinant spreading" is one of the cornerstones of our modern understanding of autoimmunity. This review covers Eli's entire scientific career outlining his many seminal discoveries.

  5. Implementation status of the extreme light infrastructure - nuclear physics (ELI-NP) project

    SciTech Connect

    Gales, S. Zamfir, N. V.


    The Project Extreme Light Infrastructure (ELI) is part of the European Strategic Forum for Research Infrastructures (ESFRI) Roadmap. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  6. Aquatic assessment of the Ely Copper Mine Superfund site, Vershire, Vermont

    USGS Publications Warehouse

    Seal, Robert R., II; Kiah, Richard G.; Piatak, Nadine M.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Argue, Denise M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.


    The information was used to develop an overall assessment of the impact on the aquatic system that appears to be a result of the acid rock drainage at the Ely Mine. More than 700 meters of Ely Brook, including two of the six ponds, were found to be severely impacted, on the basis of water-quality data and biological assessments. The reference location was of good quality based on the water quality and biological assessment. More than 3,125 meters of Schoolhouse Brook are also severely impacted, on the basis of water-quality data and biological assessments. The biological community begins to recover near the conflu

  7. [Validation of the Essen Quality of Life-Index for Eating Disorders (ELI)].


    Tagay, Sefik; Lindner, Marion; Friederich, Hans-Christoph; Schlottbohm, Ellen


    The aim of this study was the validation of a short disease-specific questionnaire (ELI, Essen Quality of Life Index for Eating Disorders) to measure the health-related quality of life in patients with eating disorders. A total of 182 currently ill and former eating disordered patients and 87 healthy controls completed the ELI questionnaire as well as other reliable and valid instruments (EDQOL, SF-12, EDI-2, FKB-20, SEED, BSI, IIP-D and SOC-13). In addition, 46 eating disorder patients completed the same questionnaires at the end of therapy. The ELI proved to have a high internal consistency of α=0.96. As expected, one main factor was found with a high declaration of variance of 71.25%. There is also evidence for very good construct validity and good sensitivity for change. Therefore, the ELI is an economic, reliable and valid instrument that assesses disease-specific health-related quality of life of individuals with eating disorders. The questionnaire can be recommended for research as well as clinical care contexts.

  8. 78 FR 21849 - Television Broadcasting Services; Ely, NV to Middletown Township, NJ

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Ely, NV to Middletown Township, NJ AGENCY... U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Television. Federal...

  9. 75 FR 81190 - Television Broadcasting Services; Vernal and Santaquin, UT, and Ely and Caliente, NV

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... COMMISSION 47 CFR Part 73 Television Broadcasting Services; Vernal and Santaquin, UT, and Ely and Caliente.... The Commission was required by the DTV Delay Act to ] terminate all licenses for full-power television... Commission no longer has the authority to act on rulemaking proposals in the full-power analog...

  10. Aquatic assessment of the Ely Copper Mine Superfund site, Vershire, Vermont

    USGS Publications Warehouse

    Seal, Robert R., II; Kiah, Richard G.; Piatak, Nadine M.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Argue, Denise M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.


    The information was used to develop an overall assessment of the impact on the aquatic system that appears to be a result of the acid rock drainage at the Ely Mine. More than 700 meters of Ely Brook, including two of the six ponds, were found to be severely impacted, on the basis of water-quality data and biological assessments. The reference location was of good quality based on the water quality and biological assessment. More than 3,125 meters of Schoolhouse Brook are also severely impacted, on the basis of water-quality data and biological assessments. The biological community begins to recover near the confluence with the Ompompanoosuc River. The evidence is less conclusive regarding the Ompompanoosuc River. The sediment data suggest that the sediments could be a source of toxicity in Ely Brook and Schoolhouse Brook. The surface-water assessment is consistent with the outcome of a surface-water toxicity testing program performed by the U.S. Environmental Protection Agency for Ely Brook and Schoolhouse Brook and a surface-water toxicity testing program and in situ amphibian testing program for the ponds.

  11. Notch effects on high-cycle fatigue properties of Ti 6Al 4V ELI alloy at cryogenic temperatures

    NASA Astrophysics Data System (ADS)

    Yuri, T.; Ono, Y.; Ogata, T.


    Notch effects on the high-cycle fatigue properties of the forged Ti-6Al-4V ELI alloy at cryogenic temperatures were investigated. Also, the high-cycle fatigue data were compared with the rolled Ti-5Al-2.5Sn ELI alloy. The one million cycles fatigue strength (FS) of the smooth specimen for the forged Ti-6Al-4V ELI alloy increased with a decrease of test temperature. However, the FS of each notched specimen at 4 K were lower than those at 77 K. On the other hand, the FS of the smooth and the notched specimens for the forged Ti-6Al-4V ELI alloy at 4 K were lower than those for the rolled Ti-5Al-2.5Sn ELI alloy. This is considered to be the early initiation of the fatigue crack in the forged Ti-6Al-4V ELI alloy compares with the forged Ti-5Al-2.5Sn ELI.

  12. Direct space decomposition of ELI-D: interplay of charge density and pair-volume function for different bonding situations.


    Wagner, Frank R; Kohout, Miroslav; Grin, Yuri


    The topological features, i.e., gradients and curvatures of the same-spin electron pair restricted electron localizability indicator (ELI-D) in position space are analyzed in terms of those of the electron density and the pair-volume function. The analysis of the topology of these constituent functions and their interplay on ELI-D attractor formation for a number of molecules representing chemically different bonding situations allows distinguishing between different chemical bonding scenarios on a quantum mechanical basis without the recourse to orbitals. The occurrence of the Laplacian of the electron density in the expression for the Laplacian of ELI-D allows us to establish a physical link between electron localizability and electron pairing as displayed by ELI-D and the role of Laplacian of the density in this context.

  13. Evaluation of the stiffness and friction of Ti6Al4V ELI treated by glow discharge nitriding

    NASA Astrophysics Data System (ADS)

    Tavera, J. R.; Peña Ballesteros, D. Y.; Estupiñán Duran, H. A.


    In this study, an evaluation of the elastic-plastic surface hardening on Ti6Al4V ELI titanium nitride films obtained by glow discharge method was carried out by nanoindentation tests according to the standard ISO 14577. The nanotribological properties (metal-metal) were also evaluated using the pin-on-disc system Ti6Al4V surface deposition ELI with nitrogen, obtaining a correlation between the coefficient of friction of Ti6Al4V ELI treated by PVD and the Young's modulus of the respective substrate modified by PVD. To characterize the substrate for the characterization tests, scanning electron microscopy, atomic force microscopy and X-ray diffraction and contact angle were carried out. The results demonstrated that the substrates nitrided improved mechanical and tribological properties, hardness, Young's modulus and coefficient of friction, making the alloy Ti6Al4V ELI support axial loads in tension and compression.

  14. The design and production of Ti-6Al-4V ELI customized dental implants

    NASA Astrophysics Data System (ADS)

    Chahine, Gilbert; Koike, Mari; Okabe, Toru; Smith, Pauline; Kovacevic, Radovan


    This paper addresses the production of customized Ti-6Al-4V ELI dental implants via electron beam melting (EBM). The melting of Ti-6Al-4V ELI powder produces implants with great biocompatibility, fi ne mechanical performance, and a high bone ingrowth potential. The EBM technology is used to produce one-component dental implants that mimic the exact shape of the patient’s tooth, replacing the traditional, three-component, “screw-like” standardized dental implants currently used. The new generation of implants provides the possibility of simplifying pre-insertion procedures leading to faster healing time, and the potential of better and stronger osseointegration, specifi cally through incorporating lattice structure design.

  15. 6D phase space electron beam analysis and machine sensitivity studies for ELI-NP GBS

    NASA Astrophysics Data System (ADS)

    Giribono, A.; Bacci, A.; Curatolo, C.; Drebot, I.; Palumbo, L.; Petrillo, V.; Rossi, A. R.; Serafini, L.; Vaccarezza, C.; Vannozzi, A.; Variola, A.


    The ELI-NP Gamma Beam Source (GBS) is now under construction in Magurele-Bucharest (RO). Here an advanced source of gamma photons with unprecedented specifications of brilliance (>1021), monochromaticity (0.5%) and energy tunability (0.2-19.5 MeV) is being built, based on Inverse Compton Scattering in the head-on configuration between an electron beam of maximum energy 750 MeV and a high quality high power ps laser beam. These requirements make the ELI-NP GBS an advanced and challenging gamma ray source. The electron beam dynamics analysis and control regarding the machine sensitivity to the possible jitter and misalignments are presented. The effects on the beam quality are illustrated providing the basis for the alignment procedure and jitter tolerances.

  16. Perspectives for neutron and gamma spectroscopy in high power laser driven experiments at ELI-NP

    NASA Astrophysics Data System (ADS)

    Negoita, F.; Gugiu, M.; Petrascu, H.; Petrone, C.; Pietreanu, D.; Fuchs, J.; Chen, S.; Higginson, D.; Vassura, L.; Hannachi, F.; Tarisien, M.; Versteegen, M.; Antici, P.; Balabanski, D.; Balascuta, S.; Cernaianu, M.; Dancus, I.; Gales, S.; Neagu, L.; Petcu, C.; Risca, M.; Toma, M.; Turcu, E.; Ursescu, D.


    The measurement of energy spectra of neutrons and gamma rays emitted by nuclei, together with charge particles spectroscopy, are the main tools for understanding nuclear phenomena occurring also in high power laser driven experiments. However, the large number of particles emitted in a very short time, in particular the strong X-rays flash produced in laser-target interaction, impose adaptation of technique currently used in nuclear physics experiment at accelerator based facilities. These aspects are discussed (Section 1) in the context of proposed studies at high power laser system of ELI-NP. Preliminary results from two experiments performed at Titan (LLNL) and ELFIE (LULI) facilities using plastic scintillators for neutron detection (Section 2) and LaBr3(Ce) scintillators for gamma detection (Section 3) are presented demonstrating the capabilities and the limitations of the employed methods. Possible improvements of these spectroscopic methods and their proposed implementation at ELI-NP will be discussed as well in the last section.

  17. Laser-based acceleration for nuclear physics experiments at ELI-NP

    NASA Astrophysics Data System (ADS)

    Tesileanu, O.; Asavei, Th.; Dancus, I.; Gales, S.; Negoita, F.; Turcu, I. C. E.; Ursescu, D.; Zamfir, N. V.


    As part of the Extreme Light pan-European research infrastructure, Extreme Light Infrastructure - Nuclear Physics (ELI-NP) in Romania will focus on topics in Nuclear Physics, fundamental Physics and applications, based on very intense photon beams. Laser-based acceleration of electrons, protons and heavy ions is a prerequisite for a multitude of laser-driven nuclear physics experiments already proposed by the international research community. A total of six outputs of the dual-amplification chain laser system, two of 100TW, two of 1PW and two of 10PW will be employed in 5 experimental areas, with the possibility to use long and short focal lengths, gas and solid targets, reaching the whole range of laser acceleration processes. We describe the main techniques and expectations regarding the acceleration of electrons, protons and heavy nuclei at ELI-NP, and some physics cases for which these techniques play an important role in the experiments.

  18. Tensile properties of cast titanium alloys: Titanium-6Al-4V ELI and Titanium-5Al-2.5Sn ELI

    NASA Technical Reports Server (NTRS)

    Billinghurst, E. E., Jr.


    This work was performed to determine the tensile properties of cast, hot isostatic pressed (HIP'ed), and annealed titanium alloys, Ti-6Al-4V ELI and Ti-5Al-2.5Sn ELI, that are candidate materials for the space transportation main engine (STME) liquid hydrogen turbopump impeller. Samples of the cast alloys were HIP'ed, annealed, and machined into tensile specimens. The specimens were tested in air at ambient temperature (70 F) and also at -423 F in liquid hydrogen. The Ti-6Al-4V alloy had an average ultimate strength of 129.1 ksi at 70 F and 212.2 ksi at -423 F. The Ti-5Al-2.5Sn alloy had an average ultimate strength of 108.4 ksi at 70 degrees F and 185.0 ksi at -423 F. The ductility, as measured by reduction of area, for the Ti-6Al-4V averaged 15.2 percent at 70 F and 8.7 percent at -423 F, whereas for the Ti-5Al-2.5Sn alloy average reduction of area was 24.6 percent at 70 F and 11.7 percent at -423 F.

  19. Geographic variation in the elicitin-like glycoprotein, ELI025, of Pythium insidiosum isolated from human and animal subjects.


    Lerksuthirat, Tassanee; Lohnoo, Tassanee; Rujirawat, Thidarat; Yingyong, Wanta; Jongruja, Nujarin; Krajaejun, Theerapong


    Oomycetes are fungus-like in appearance, but form a distinct clade within the eukaryotes. While most pathogenic oomycetes infect plants, the understudied oomycete Pythium insidiosum infects humans and animals, and causes a life-threatening infectious disease, called pythiosis. Phylogenetic analyses divide P. insidiosum into 3 groups, according to geographic origins: Clade-I (Americas), Clade-II (Asia and Australia), and Clade-III (Thailand). Surgical removal of the infected organ is the inevitable treatment for patients with pythiosis, but it is often too late or unsuccessful, and many patients die from advanced infection. Understanding P. insidiosum's basic biology could lead to improved infection control. Elicitins, a unique group of proteins found only in oomycetes, are involved in sterol acquisition and stimulation of host responses. Recently, we identified glycosylated and non-glycosylated forms of the elicitin-like protein, ELI025, which is secreted by P. insidiosum, and detected during P. insidiosum infection. In this study, we investigated geographic variation of ELI025 in 24 P. insidiosum strains isolated from humans, animals, and the environment. Genotypes of ELI025, based on 2 sets of PCR primers, correlated well with rDNA-based phylogenetic grouping. Unlike strains in Clade-I and -II, Clade-III strains secreted no glycosylated ELI025. Sera from 17 pythiosis patients yielded a broad range of antibody responses against ELI025, and ∼30% lacked reactivity against the protein. Selective production or secretion of glycosylated ELI025 by different P. insidiosum strains might contribute to the variable host antibody responses. In conclusion, ELI025 was secreted by all P. insidiosum strains isolated from different hosts and geographic origins, but the protein had different biochemical, and immunological characteristics. These finding contribute to the better understanding of the biology and evolution of P. insidiosum, and could lead to appropriate clinical

  20. Geographic variation in the elicitin-like glycoprotein, ELI025, of Pythium insidiosum isolated from human and animal subjects.


    Lerksuthirat, Tassanee; Lohnoo, Tassanee; Rujirawat, Thidarat; Yingyong, Wanta; Jongruja, Nujarin; Krajaejun, Theerapong


    Oomycetes are fungus-like in appearance, but form a distinct clade within the eukaryotes. While most pathogenic oomycetes infect plants, the understudied oomycete Pythium insidiosum infects humans and animals, and causes a life-threatening infectious disease, called pythiosis. Phylogenetic analyses divide P. insidiosum into 3 groups, according to geographic origins: Clade-I (Americas), Clade-II (Asia and Australia), and Clade-III (Thailand). Surgical removal of the infected organ is the inevitable treatment for patients with pythiosis, but it is often too late or unsuccessful, and many patients die from advanced infection. Understanding P. insidiosum's basic biology could lead to improved infection control. Elicitins, a unique group of proteins found only in oomycetes, are involved in sterol acquisition and stimulation of host responses. Recently, we identified glycosylated and non-glycosylated forms of the elicitin-like protein, ELI025, which is secreted by P. insidiosum, and detected during P. insidiosum infection. In this study, we investigated geographic variation of ELI025 in 24 P. insidiosum strains isolated from humans, animals, and the environment. Genotypes of ELI025, based on 2 sets of PCR primers, correlated well with rDNA-based phylogenetic grouping. Unlike strains in Clade-I and -II, Clade-III strains secreted no glycosylated ELI025. Sera from 17 pythiosis patients yielded a broad range of antibody responses against ELI025, and ∼30% lacked reactivity against the protein. Selective production or secretion of glycosylated ELI025 by different P. insidiosum strains might contribute to the variable host antibody responses. In conclusion, ELI025 was secreted by all P. insidiosum strains isolated from different hosts and geographic origins, but the protein had different biochemical, and immunological characteristics. These finding contribute to the better understanding of the biology and evolution of P. insidiosum, and could lead to appropriate clinical

  1. Study of nuclear reactions in laser plasmas at future ELI-NP facility

    NASA Astrophysics Data System (ADS)

    Lanzalone, G.; Altana, C.; Anzalone, A.; Cappuzzello, F.; Cavallaro, M.; Gizzi, L. A.; Labate, L.; Lamia, L.; Mascali, D.; Muoio, A.; Negoita, F.; Odorici, F.; Petrascu, H.; Trifirò, A.; Trimarchi, M.; Tudisco, S.


    In this contribution we will present the future activities that our collaboration will carry out at ELI-NP (Extreme Light Infrastructure Nuclear Physics), the new multi peta-watt Laser facility, currently under construction at Bucharest (Romania). The activities concerns the study of nuclear reactions in laser plasmas. In this framework we proposed the construction of a new, general-purpose experimental set-up able to detect and identify neutrons and charged particles.

  2. Eruptive history of an alkali basaltic diatreme from Elie Ness, Fife, Scotland

    NASA Astrophysics Data System (ADS)

    Gernon, T. M.; Upton, B. G. J.; Hincks, T. K.


    The Elie Ness diatreme (Fife, Scotland) is an ideal place to study the internal architecture and emplacement processes of diatremes. Elie Ness is one of approximately 100 alkali basaltic diatremes and intrusions in the East Fife area, emplaced during Upper Carboniferous to Early Permian times into an extensive rift system in the northern Variscan foreland. Within the diatreme, seven lithofacies and three lithofacies associations (LFAs 1-3) are recognised. Field, petrographic and geochemical studies demonstrate that the diatreme experienced a protracted history of eruption and infill, initially driven by volatile expansion and later by magma-water interaction. Massive lapilli tuffs of LFA 1 contain abundant highly vesicular juvenile scoria and magma-coated clasts, which are best explained by a magmatic origin for the early explosive eruptions. On a large-scale, the tuffs are well mixed and locally exhibit small-scale degassing structures attributed to fluidisation processes occurring within the diatreme fill. The occurrence of abundant volcaniclastic autoliths and megablocks within LFA 1 can be explained by subsidence of volcaniclastic strata from the maar crater and upper diatreme during emplacement. Pyroclastic density current deposits of LFA 2 form a series of continuous sheets across the diatreme, some of which may have originated from phreatomagmatic explosions in a neighbouring vent. We attribute the overall bedding pattern to a combination of primary volcanic processes and post-depositional folding related to movement along an adjacent fault. Minor steeply inclined breccias and tuffs of LFA 3 cross-cut the LFA 2 succession and are interpreted as late-stage volcaniclastic dykes and conduits, signalling the final phase of eruptive activity at Elie Ness. The study offers new insights into the volcanic evolution of diatremes fed by low viscosity, alkali-rich magmas.

  3. Cryogenic stopping cell for photofission fragments at the ELI-NP facility

    SciTech Connect

    Constantin, P. Balabanski, D. L.; Cuong, P. V.


    The brilliant gamma beam at the future Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility will be used to generate a beam of exotic neutron-rich isotopes via photofission of actinide targets. We present simulations with the Geant4 toolkit of the photofission process for the design and optimization of the expected performance parameters of the Cryogenic Stopping Cell (CSC). The CSC will be used to extract the photofission fragments into the secondary beam of about 10{sup 6} ions/s. We propose an experimental program to study refractory neutron-rich isotopes.

  4. Depositional processes of the basaltic Elie Ness diatreme, East Fife, Scotland

    NASA Astrophysics Data System (ADS)

    Gernon, Thomas; Hincks, Thea


    The East Fife coast of Scotland exposes multiple (~100) volcanic vents or diatremes of late Carboniferous to early Permian age. Here, we present preliminary results of detailed geological mapping of the Elie Ness (EN) diatreme. The key objective was to map the volcanic structure and lithofacies of the vent-fill, and to determine the eruption styles and key emplacement processes that occur more generally in basaltic maar-diatreme systems. Within the EN diatreme, seven lithofacies and three lithofacies associations (LFA 1-3) were recognised. Preliminary results demonstrate that the diatreme had a protracted history of eruption and infill. The massive lapilli tuffs of LFA 1 are texturally and compositionally homogeneous with occasional degassing structures, making them similar to typical massive volcaniclastic deposits infilling kimberlite pipes. The formation of such deposits are attributed to gas-fluidisation processes operating within the vent. The occurrence within LFA 1 of abundant volcaniclastic autoliths and megablocks together with steeply inclined lenticular breccia and tuff packages, makes the deposits similar to marginal lithofacies of the Jwaneng Centre kimberlite pipe, Botswana. All these features can be explained by subsidence of volcaniclastic strata from the surrounding tephra ring during emplacement. The steep internal contacts between the lithofacies of LFA 1 can be explained by variations in gas flux as the main eruptive phase waned. Pyroclastic base surge deposits of LFA 2 form a series of continuous sheets across the EN diatreme, and are therefore likely to have originated from a neighbouring pipe. The most probable source of the LFA 2 pyroclastic surges is a small vent to the NE of Elie Ness, where similar diffuse stratified lithofacies are observed. Minor steeply-inclined breccias and tuffs of LFA 3 cross-cut bedded tuffs of LFA 2, and are therefore likely to represent late-stage dykes and conduits. A significant observation is that the diatreme

  5. Immunology's foundation: the 100-year anniversary of the Nobel Prize to Paul Ehrlich and Elie Metchnikoff.


    Kaufmann, Stefan H E


    One hundred years ago the birth of immunology was made official by the Nobel Prize award to Elie Metchnikoff and Paul Ehrlich. Metchnikoff discovered phagocytosis by macrophages and microphages as a critical host-defense mechanism and thus is considered the father of cellular innate immunity. Ehrlich described the side-chain theory of antibody formation and the mechanisms of how antibodies neutralize toxins and induce bacterial lysis with the help of complement and thus is considered one of the fathers of humoral adaptive immunity. Despite many discordant discussions in the initial phase after these discoveries, innate and adaptive responses are now known to be complementary partners in producing robust immunity.

  6. Identification of Conserved MEL-28/ELYS Domains with Essential Roles in Nuclear Assembly and Chromosome Segregation.


    Gómez-Saldivar, Georgina; Fernandez, Anita; Hirano, Yasuhiro; Mauro, Michael; Lai, Allison; Ayuso, Cristina; Haraguchi, Tokuko; Hiraoka, Yasushi; Piano, Fabio; Askjaer, Peter


    Nucleoporins are the constituents of nuclear pore complexes (NPCs) and are essential regulators of nucleocytoplasmic transport, gene expression and genome stability. The nucleoporin MEL-28/ELYS plays a critical role in post-mitotic NPC reassembly through recruitment of the NUP107-160 subcomplex, and is required for correct segregation of mitotic chromosomes. Here we present a systematic functional and structural analysis of MEL-28 in C. elegans early development and human ELYS in cultured cells. We have identified functional domains responsible for nuclear envelope and kinetochore localization, chromatin binding, mitotic spindle matrix association and chromosome segregation. Surprisingly, we found that perturbations to MEL-28's conserved AT-hook domain do not affect MEL-28 localization although they disrupt MEL-28 function and delay cell cycle progression in a DNA damage checkpoint-dependent manner. Our analyses also uncover a novel meiotic role of MEL-28. Together, these results show that MEL-28 has conserved structural domains that are essential for its fundamental roles in NPC assembly and chromosome segregation. PMID:27341616

  7. The Electronic Logbook for the Information Storage of ATLAS Experiment at LHC (ELisA)

    NASA Astrophysics Data System (ADS)

    Corso Radu, A.; Lehmann Miotto, G.; Magnoni, L.


    A large experiment like ATLAS at LHC (CERN), with over three thousand members and a shift crew of 15 people running the experiment 24/7, needs an easy and reliable tool to gather all the information concerning the experiment development, installation, deployment and exploitation over its lifetime. With the increasing number of users and the accumulation of stored information since the experiment start-up, the electronic logbook actually in use, ATLOG, started to show its limitations in terms of speed and usability. Its monolithic architecture makes the maintenance and implementation of new functionality a hard-to-almost-impossible process. A new tool ELisA has been developed to replace the existing ATLOG. It is based on modern web technologies: the Spring framework using a Model-View-Controller architecture was chosen, thus helping building flexible and easy to maintain applications. The new tool implements all features of the old electronic logbook with increased performance and better graphics: it uses the same database back-end for portability reasons. In addition, several new requirements have been accommodated which could not be implemented in ATLOG. This paper describes the architecture, implementation and performance of ELisA, with particular emphasis on the choices that allowed having a scalable and very fast system and on the aspects that could be re-used in different contexts to build a similar application.

  8. Strong field physics and QED experiments with ELI-NP 2×10PW laser beams

    SciTech Connect

    Turcu, I. C. E. Balascuta, S. Negoita, F.; Jaroszynski, D.; McKenna, P.


    The ELI-NP facility will focus a 10 PW pulsed laser beam at intensities of ∼10{sup 23} W/cm{sup 2} for the first time, enabling investigation of the new physical phenomena at the interfaces of plasma, nuclear and particle physics. The electric field in the laser focus has a maximum value of ∼10{sup 15} V/m at such laser intensities. In the ELI-NP Experimental Area E6, we propose the study of Radiation Reaction, Strong Field Quantum Electrodynamics (QED) effects and resulting production of Ultra-bright Sources of Gamma-rays which could be used for nuclear activation. Two powerful, synchronized 10 PW laser beams will be focused in the E6 Interaction Chamber on either gas or solid targets. One 10 PW beam is the Pump-beam and the other is the Probe-beam. The focused Pump beam accelerates the electrons to relativistic energies. The accelerated electron bunches interact with the very high electro-magnetic field of the focused Probe beam. The layout of the experimental area E6 will be presented with several options for the experimental configurations.

  9. Identification of Conserved MEL-28/ELYS Domains with Essential Roles in Nuclear Assembly and Chromosome Segregation

    PubMed Central

    Hirano, Yasuhiro; Mauro, Michael; Lai, Allison; Ayuso, Cristina; Haraguchi, Tokuko; Hiraoka, Yasushi; Piano, Fabio


    Nucleoporins are the constituents of nuclear pore complexes (NPCs) and are essential regulators of nucleocytoplasmic transport, gene expression and genome stability. The nucleoporin MEL-28/ELYS plays a critical role in post-mitotic NPC reassembly through recruitment of the NUP107-160 subcomplex, and is required for correct segregation of mitotic chromosomes. Here we present a systematic functional and structural analysis of MEL-28 in C. elegans early development and human ELYS in cultured cells. We have identified functional domains responsible for nuclear envelope and kinetochore localization, chromatin binding, mitotic spindle matrix association and chromosome segregation. Surprisingly, we found that perturbations to MEL-28’s conserved AT-hook domain do not affect MEL-28 localization although they disrupt MEL-28 function and delay cell cycle progression in a DNA damage checkpoint-dependent manner. Our analyses also uncover a novel meiotic role of MEL-28. Together, these results show that MEL-28 has conserved structural domains that are essential for its fundamental roles in NPC assembly and chromosome segregation. PMID:27341616

  10. Perspectives for neutron and gamma spectroscopy in high power laser driven experiments at ELI-NP

    SciTech Connect

    Negoita, F. Gugiu, M. Petrascu, H. Petrone, C. Pietreanu, D.; Fuchs, J.; Chen, S.; Higginson, D.; Vassura, L.; Hannachi, F.; Tarisien, M.; Versteegen, M.; Antici, P.; Balabanski, D.; Balascuta, S.; Cernaianu, M.; Dancus, I.; Gales, S.; Neagu, L.; Petcu, C.; and others


    The measurement of energy spectra of neutrons and gamma rays emitted by nuclei, together with charge particles spectroscopy, are the main tools for understanding nuclear phenomena occurring also in high power laser driven experiments. However, the large number of particles emitted in a very short time, in particular the strong X-rays flash produced in laser-target interaction, impose adaptation of technique currently used in nuclear physics experiment at accelerator based facilities. These aspects are discussed (Section 1) in the context of proposed studies at high power laser system of ELI-NP. Preliminary results from two experiments performed at Titan (LLNL) and ELFIE (LULI) facilities using plastic scintillators for neutron detection (Section 2) and LaBr{sub 3}(Ce) scintillators for gamma detection (Section 3) are presented demonstrating the capabilities and the limitations of the employed methods. Possible improvements of these spectroscopic methods and their proposed implementation at ELI-NP will be discussed as well in the last section.

  11. Strain-based fatigue data for Ti-6Al-4V ELI under fully-reversed and mean strain loads.


    Carrion, Patricio E; Shamsaei, Nima


    This article presents the experimental data supporting the study to obtain the mean strain/stress effects on the fatigue behavior of Ti-6Al-4V ELI. A series of strain-controlled fatigue experiments on Ti-6Al-4V ELI were performed at four strain ratios (-1, -0.5, 0, and 0.5). Two types of data are included for each specimen. These are the hysteresis stress-strain responses for the cycle in a log10 increment, and the maximum and minimum stress-strain responses for each cycle. Fatigue lives are also reported for all the experiments.

  12. Strain-based fatigue data for Ti–6Al–4V ELI under fully-reversed and mean strain loads

    PubMed Central

    Carrion, Patricio E.; Shamsaei, Nima


    This article presents the experimental data supporting the study to obtain the mean strain/stress effects on the fatigue behavior of Ti–6Al–4V ELI. A series of strain-controlled fatigue experiments on Ti–6Al–4V ELI were performed at four strain ratios (−1, −0.5, 0, and 0.5). Two types of data are included for each specimen. These are the hysteresis stress–strain responses for the cycle in a log10 increment, and the maximum and minimum stress–strain responses for each cycle. Fatigue lives are also reported for all the experiments. PMID:26952022

  13. National uranium resource evaluation program: hydrogeochemical and stream sediment reconnaissance basic data for Ely quadrangle, Nevada; Utah

    SciTech Connect

    Not Available


    Field and laboratory data are presented for 1937 sediment samples from the Ely Quadrangle, Nevada; Utah. The samples were collected by Savannah River Laboratory; laboratory analysis and data reporting were performed by the Uranium Resource Evaluation Project at Oak Ridge, Tennessee.


    EPA Science Inventory

    This report summarizes the findings of an evaluation of the Unterdruck-Verdampfer-Brunnen (UVB) technology developed by IEG Technologies (IEG) and licensed in the eastern United States by Environmental Laboratories, Inc. (ELI) and SBP Technologies (SBP). This evaluation was cond...

  15. 78 FR 33426 - Eli Lilly and Co.; Withdrawal of Approval of a New Drug Application for ORAFLEX

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration Eli Lilly and Co.; Withdrawal of Approval of a New Drug... Administration (FDA) is withdrawing approval of a new drug application (NDA) for ORAFLEX (benoxaprofen) Tablets... Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm. 6250,...

  16. Eli Whitney's Patent for the Cotton Gin. The Constitution Community: Revolution and the New Nation (1754-1820s).

    ERIC Educational Resources Information Center

    Schur, Joan Brodsky

    This lesson focuses on the power of the U.S. Congress to pass laws related to issuing patents. Using Eli Whitney's 1812 Congressional petition to extend the patent on his cotton gin as an example, the lesson correlates to the National History Standards and the National Standards for Civics and Government. It contains two primary source documents,…

  17. CFL Labeling Harmonization in the United States, China, Brazil andELI Member Countries: Specifications, Testing, and MutualRecognition

    SciTech Connect

    Fridley, David; Lin, Jiang; Denver, Andrea; Biermayer, Peter; Dillavou, Tyler


    This report examines critical differences among energy-efficient labeling programs for CFLs in Brazil, China, the United States, and the seven members of the international Efficient Lighting Initiative (ELI) in terms of technical specifications and test procedures, and review issues related to international harmonization of these standards.

  18. A conceptual design of an electron spectrometer for ELI-NP

    SciTech Connect

    Balascuta, S. Turcu, I. C. E.


    We present the geometry and field parameters of an Electron Spectrometer (ES) with two dipole magnets, considered for electron energy measurements at the High Fields QED experimental area at ELI-NP. The first magnet is a 2 meter long permanent magnet, placed inside the Interaction Chamber (IC). The second magnet is a 1.5 meters long electromagnet, placed outside IC. The pulsed electron beam will be produced by the 10 PW pulsed Laser, ‘pump-beam’, focused into one meter long capillary low density plasma cell. A second 10 PW pulsed Laser, ‘probe-beam’, will interact with the relativistic electron bunch providing the strong electromagnetic field. The ES will measure the subtle changes in the electron energy spectrum as a result of the electron beam interaction with the probe-beam field.

  19. A Journey with Elie Metchnikoff: From Innate Cell Mechanisms in Infectious Diseases to Quantum Biology

    PubMed Central

    Merien, Fabrice


    Many reviews of Elie Metchnikoff’s work have been published, all unanimously acknowledging the significant contributions of his cellular theory to the fields of immunology and infectious diseases. In 1883, he published a key paper describing phagocytic cells in frogs. His descriptions were not just about phagocytes involved in host defense, he also described how these specialized cells eliminated degenerating or dying cells of the host. This perspective focuses on key concepts developed by Metchnikoff by presenting relevant excerpts of his 1883 paper and matching these concepts with challenges of modern immunology. A new approach to macrophage polarization is included to introduce some creative thinking about the exciting emerging area of quantum biology. PMID:27379227

  20. Positron production at extreme light infrastructure – nuclear physics (ELI-NP)

    SciTech Connect

    Oprisa, A. Balascuta, S. Ur, C. A.


    Applied and material physics studies with positron beams of Fermi–surfaces, defects, interfaces etc. offer excellent diagnostics tools. At ELI-NP, an intense γ beam of about 10{sup 11} photons/s with energies up to 3.5 MeV will be used to generate a positron beam via pair production in a tungsten converter target. To obtain a high intensity beam of moderated positrons the design of the positron source is of high importance. The design of a dedicated positron source at ELI–NP is being investigated based on extensive GEANT4 simulations. The goal of the simulations is to optimize the geometry of the target and the gamma beam collimation. We present here the characteristics of the positron beam obtained for different geometries of the converter target.

  1. ELI-Beamlines: development of next generation short-pulse laser systems

    NASA Astrophysics Data System (ADS)

    Rus, B.; Bakule, P.; Kramer, D.; Naylon, J.; Thoma, J.; Green, J. T.; Antipenkov, R.; Fibrich, M.; Novák, J.; Batysta, F.; Mazanec, T.; Drouin, M. A.; Kasl, K.; Baše, R.; Peceli, D.; Koubíková, L.; Trojek, P.; Boge, R.; Lagron, J. C.; Vyhlídka, Å.; Weiss, J.; Cupal, J.,; Hřebíček, J.; Hříbek, P.; Durák, M.; Polan, J.; Košelja, M.; Korn, G.; Horáček, M.; Horáček, J.; Himmel, B.; Havlíček, T.; Honsa, A.; Korouš, P.; Laub, M.; Haefner, C.; Bayramian, A.; Spinka, T.; Marshall, C.; Johnson, G.; Telford, S.; Horner, J.; Deri, B.; Metzger, T.; Schultze, M.; Mason, P.; Ertel, K.; Lintern, A.; Greenhalgh, J.; Edwards, C.; Hernandez-Gomez, C.; Collier, J.; Ditmire, T.,; Gaul, E.; Martinez, M.; Frederickson, C.; Hammond, D.; Malato, C.; White, W.; Houžvička, J.


    Overview of the laser systems being built for ELI-Beamlines is presented. The facility will make available high-brightness multi-TW ultrashort laser pulses at kHz repetition rate, PW 10 Hz repetition rate pulses, and kilojoule nanosecond pulses for generation of 10 PW peak power. The lasers will extensively employ the emerging technology of diode-pumped solid-state lasers (DPSSL) to pump OPCPA and Ti:sapphire broadband amplifiers. These systems will provide the user community with cutting-edge laser resources for programmatic research in generation and applications of high-intensity X-ray sources, in particle acceleration, and in dense-plasma and high-field physics.

  2. The development of molecularly targeted anticancer therapies: an Eli Lilly and Company perspective.


    Perry, William L; Weitzman, Aaron


    The ability to identify activated pathways that drive the growth and progression of cancer and to develop specific and potent inhibitors of key proteins in these pathways promises to dramatically change the treatment of cancer: A patient's cancer could be characterized at the molecular level and the information used to select the best treatment options. The development of successful therapies not only requires extensive target validation, but also new approaches to evaluating drug efficacy in animal models and in the clinic compared to the development of traditional cytotoxic agents. This article highlights Eli Lilly and Company's approach to developing targeted therapies, from target identification and validation through evaluation in the clinic. A selection of drugs in the Lilly Oncology pipeline is also discussed.

  3. EliXR: an approach to eligibility criteria extraction and representation

    PubMed Central

    Wu, Xiaoying; Luo, Zhihui; Boland, Mary Regina; Theodoratos, Dimitri; Johnson, Stephen B


    Objective To develop a semantic representation for clinical research eligibility criteria to automate semistructured information extraction from eligibility criteria text. Materials and Methods An analysis pipeline called eligibility criteria extraction and representation (EliXR) was developed that integrates syntactic parsing and tree pattern mining to discover common semantic patterns in 1000 eligibility criteria randomly selected from The semantic patterns were aggregated and enriched with unified medical language systems semantic knowledge to form a semantic representation for clinical research eligibility criteria. Results The authors arrived at 175 semantic patterns, which form 12 semantic role labels connected by their frequent semantic relations in a semantic network. Evaluation Three raters independently annotated all the sentence segments (N=396) for 79 test eligibility criteria using the 12 top-level semantic role labels. Eight-six per cent (339) of the sentence segments were unanimously labelled correctly and 13.8% (55) were correctly labelled by two raters. The Fleiss' κ was 0.88, indicating a nearly perfect interrater agreement. Conclusion This study present a semi-automated data-driven approach to developing a semantic network that aligns well with the top-level information structure in clinical research eligibility criteria text and demonstrates the feasibility of using the resulting semantic role labels to generate semistructured eligibility criteria with nearly perfect interrater reliability. PMID:21807647

  4. ELiXIR—Solid-State Luminaire With Enhanced Light Extraction by Internal Reflection

    NASA Astrophysics Data System (ADS)

    Allen, Steven C.; Steckl, Andrew J.


    A phosphor-converted light-emitting diode (pcLED) luminaire featuring enhanced light extraction by internal reflection (ELiXIR) with efficacy of 60 lm/W producing 18 lumens of yellowish green light at 100 mA is presented. The luminaire consists of a commercial blue high power LED, a polymer hemispherical shell lens with interior phosphor coating, and planar aluminized reflector. High extraction efficiency of the phosphor-converted light is achieved by separating the phosphor from the LED and using internal reflection to steer the light away from lossy reflectors and the LED package and out of the device. At 10 and 500 mA, the luminaire produces 2.1 and 66 lumens with efficacies of 80 and 37 lm/W, respectively. Technological improvements over existing commercial LEDs, such as more efficient pcLED packages or, alternatively, higher efficiency green or yellow for color mixing, will be essential to achieving 150 200 lm/W solid-state lighting. Advances in both areas are demonstrated.

  5. Straight talk with...Stephen O'Brien. Interviewed by Elie Dolgin.


    O'Brien, Stephen


    Stephen O'Brien joined the US National Cancer Institute as a post doc in 1971 and climbed the ranks to become head of the institute's Laboratory of Genomic Diversity, a position he held for 25 years. But, after four decades at the government agency, O'Brien was ready for something new. In December 2011, he stepped down and took up a three-year, $5 million 'megagrant' in Russia through a program started a year earlier by the Russian Ministry of Education and Science to attract big-name researchers to work at least part-time in that country. O'Brien used his money to help launch the Theodosius Dobzhansky Center for Genome Bioinformatics at Saint Petersburg State University. Although O'Brien is a cancer researcher, he has diverse scientific interests. He led the team that discovered the CCR5-Δ32 mutation that confers resistance to HIV, and he has helped document the remarkable genetic uniformity of African cheetahs. Recently, he and two California scientists started the Genome 10K project, which aims to sequence the genetic blueprints of 10,000 vertebrate species. On a trip back to the US, O'Brien spoke with Elie Dolgin about how comparative genomics and his new Russian center will help advance the search for new therapeutics. PMID:23295996

  6. Mutational analysis of the human immunodeficiency virus type 1 Eli Nef function.

    PubMed Central

    Zazopoulos, E; Haseltine, W A


    The studies presented here define an internally consistent experimental system that permits systematic analysis of the effect of nef on the rate of the human immunodeficiency virus type 1 (HIV-1) replication in a CD4+ tumor T-cell line and in primary peripheral blood mononuclear cells. The parental full-length Nef protein, derived from the Eli strain of HIV-1, accelerates virus replication in both cell types. Mutations that destabilize or alter the intracellular location of the protein affect the ability of the Nef protein to accelerate virus replication. A set of mutants was made in amino acids proposed to be required for Nef function, including threonine and serine residues proposed to be targets for phosphorylation, and in sequences thought to resemble the G-1, G-3, and G-4 sites of the family of G proteins. In most cases alterations of the critical amino acids yield stable Nef proteins of parental phenotype. These results challenge the existing theories for the mechanism of Nef function. The results also identify two residues in the carboxyl half of the protein that are important for Nef function. Images PMID:1631166

  7. Benthic macroinvertebrate assemblages and sediment toxicity testing in the Ely Creek watershed restoration project

    SciTech Connect

    Soucek, D.J.; Currie, R.J.; Cherry, D.S.; Latimer, H.A.; Trent, G.C.


    The Ely Creek watershed in Lee County, Virginia, contains an abundance of abandoned mined land (AML) seeps that contaminate the majority of the creek and its confluence into Big Stone Creek. Contaminated sediments had high concentrations of iron ({approximately}10,000 mg/kg), aluminum ({approximately}1,500 mg/kg), magnesium ({approximately}400 mg/kg) and manganese ({approximately}150 mg/kg). Copper and zinc generally ranged from 3 to 20 mg/kg. Benthic macroinvertebrates surveys at six of 20 sites sampled in the watershed yielded no macroinvertebrates, while eight others had total abundances of 1 to 9 organisms. Four reference sites contained {ge}100 organisms and at least 14 different taxa. Laboratory, 10-day survival/impairment sediments tests with Daphnia magna did not support the field data. Mortality of 92 to 100% for D. magna occurred in samples collected from six cities. Daphnid reproduction was more sensitive than laboratory test organism survivorship; however, neither daphnid survivorship nor reproduction were good predictors of taxa richness. Laboratory test concerns included the use of a reference diluent water rather than site specific diluent water.

  8. Ultrafast beam dump materials and mirror coatings tested with the ELI beamlines LIDT test station

    NASA Astrophysics Data System (ADS)

    Durák, Michal; Kramer, Daniel; Velpula, Praveen K.; Cupal, Josef; Medřík, TomáÅ.¡; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Fekete, Ladislav; Å tepán, Václav; Kozlová, Michaela; Rus, Bedřich


    The ELI Beamlines project will deliver ultrafast laser pulses with peak powers up to 10PW available every minute and PW class beams at 10Hz complemented by a 10TW 1kHz beamline. To properly determine damage thresholds of involved optical components in conditions similar to the operational environment and with expected laser parameters, a high vacuum LIDT test station was constructed at PALS facility. Our study presents results of ISO based S-on-1 and R-on-1 tests in femtosecond regime (50fs, 800nm, 10Hz/1kHz) performed on two different types of coatings: a) highabsorption black coatings with low outgassing rates, intended for use as a beam dump surface; and b) high-reflectivity, low-dispersion 45° AOI ultrafast mirror coatings. Testing of absorptive coatings was accompanied with QMS residual gas analysis to verify, that high intensity laser radiation approaching the damage threshold does not increase concentration of volatile organic compounds in the vacuum chamber. In case of HR mirror coatings, we also investigate the effect of cleaning on LIDT value, comparing characteristic S-on-1 curves of given sample with values obtained after 12h immersion in ethanol-water solution.

  9. Copper Speciation in Variably Toxic Sediments at the Ely Copper Mine, Vermont, United States.


    Kimball, Bryn E; Foster, Andrea L; Seal, Robert R; Piatak, Nadine M; Webb, Samuel M; Hammarstrom, Jane M


    At the Ely Copper Mine Superfund site, Cu concentrations exceed background values in both streamwater (160-1200 times) and sediments (15-79 times). Previously, these sediment samples were incubated with laboratory test organisms, and they exhibited variable toxicity for different stream sites. In this study we combined bulk- and microscale techniques to determine Cu speciation and distribution in these contaminated sediments on the basis of evidence from previous work that Cu was the most important stressor in this environment and that variable observed toxicity could have resulted from differences in Cu speciation. Copper speciation results were similar at microscopic and bulk scales. The major Cu species in the more toxic samples were sorbed or coprecipitated with secondary Mn (birnessite) and Fe minerals (jarosite and goethite), which together accounted for nearly 80% of the total Cu. The major Cu species in the less toxic samples were Cu sulfides (chalcopyrite and a covellite-like phase), making up about 80-95% of the total Cu, with minor amounts of Cu associated with jarosite or goethite. These Cu speciation results are consistent with the toxicity results, considering that Cu sorbed or coprecipitated with secondary phases at near-neutral pH is relatively less stable than Cu bound to sulfide at lower pH. The more toxic stream sediment sites were those that contained fewer detrital sulfides and were upstream of the major mine waste pile, suggesting that removal and consolidation of sulfide-bearing waste piles on site may not eliminate all sources of bioaccessible Cu.

  10. Copper Speciation in Variably Toxic Sediments at the Ely Copper Mine, Vermont, United States.


    Kimball, Bryn E; Foster, Andrea L; Seal, Robert R; Piatak, Nadine M; Webb, Samuel M; Hammarstrom, Jane M


    At the Ely Copper Mine Superfund site, Cu concentrations exceed background values in both streamwater (160-1200 times) and sediments (15-79 times). Previously, these sediment samples were incubated with laboratory test organisms, and they exhibited variable toxicity for different stream sites. In this study we combined bulk- and microscale techniques to determine Cu speciation and distribution in these contaminated sediments on the basis of evidence from previous work that Cu was the most important stressor in this environment and that variable observed toxicity could have resulted from differences in Cu speciation. Copper speciation results were similar at microscopic and bulk scales. The major Cu species in the more toxic samples were sorbed or coprecipitated with secondary Mn (birnessite) and Fe minerals (jarosite and goethite), which together accounted for nearly 80% of the total Cu. The major Cu species in the less toxic samples were Cu sulfides (chalcopyrite and a covellite-like phase), making up about 80-95% of the total Cu, with minor amounts of Cu associated with jarosite or goethite. These Cu speciation results are consistent with the toxicity results, considering that Cu sorbed or coprecipitated with secondary phases at near-neutral pH is relatively less stable than Cu bound to sulfide at lower pH. The more toxic stream sediment sites were those that contained fewer detrital sulfides and were upstream of the major mine waste pile, suggesting that removal and consolidation of sulfide-bearing waste piles on site may not eliminate all sources of bioaccessible Cu. PMID:26734712

  11. Copper speciation in variably toxic sediments at the Ely Copper Mine, Vermont, United States

    USGS Publications Warehouse

    Kimball, Bryn E.; Foster, Andrea L.; Seal, Robert; Piatak, Nadine; Webb, Samuel M.; Hammarstrom, Jane M.


    At the Ely Copper Mine Superfund site, Cu concentrations exceed background values in both streamwater (160–1200 times) and sediments (15–79 times). Previously, these sediment samples were incubated with laboratory test organisms, and they exhibited variable toxicity for different stream sites. In this study we combined bulk- and microscale techniques to determine Cu speciation and distribution in these contaminated sediments on the basis of evidence from previous work that Cu was the most important stressor in this environment and that variable observed toxicity could have resulted from differences in Cu speciation. Copper speciation results were similar at microscopic and bulk scales. The major Cu species in the more toxic samples were sorbed or coprecipitated with secondary Mn (birnessite) and Fe minerals (jarosite and goethite), which together accounted for nearly 80% of the total Cu. The major Cu species in the less toxic samples were Cu sulfides (chalcopyrite and a covellite-like phase), making up about 80–95% of the total Cu, with minor amounts of Cu associated with jarosite or goethite. These Cu speciation results are consistent with the toxicity results, considering that Cu sorbed or coprecipitated with secondary phases at near-neutral pH is relatively less stable than Cu bound to sulfide at lower pH. The more toxic stream sediment sites were those that contained fewer detrital sulfides and were upstream of the major mine waste pile, suggesting that removal and consolidation of sulfide-bearing waste piles on site may not eliminate all sources of bioaccessible Cu.

  12. Regulating Direct-to-Consumer Drug Information: A Case Study of Eli Lilly's Canadian 40over40 Erectile Dysfunction Campaign.


    Pipon, Jean-Christophe Bélisle; Williams-Jones, Bryn


    Like most jurisdictions, Canada prohibits direct-to-consumer advertising (DTCA) of prescribed drugs. However, direct-to-consumer information (DTCI) is permitted, allowing companies to inform the public about medical conditions. An analysis of Eli Lilly's 40over40 promotion campaign for erectile dysfunction (ED), which included a quiz on ED, shows that DTCI, like DTCA, can be an effective means of drug familiarization. The pharmaceutical industry is "playing by the rules" currently in effect in Canada. Regulators should thus seriously consider whether existing rules permitting DTCI actually meet stated objectives of protecting the public from marketing campaigns (i.e., DTCA) that may deliver misleading information.

  13. The effect of weld porosity on the cryogenic fatigue strength of ELI grade Ti-5Al-2.5Sn

    NASA Technical Reports Server (NTRS)

    Rogers, P. R.; Lambdin, R. C.; Fox, D. E.


    The effect of weld porosity on the fatigue strength of ELI grade Ti-5Al-2.5Sn at cryogenic temperature was determined. A series of high cycle fatigue (HCF) and tensile tests were performed at -320 F on specimens made from welded sheets of the material. All specimens were tested with weld beads intact and some amount of weld offset. Specimens containing porosity and control specimens containing no porosity were tested. Results indicate that for the weld configuration tested, the fatigue life of the material is not affected by the presence of spherical embedded pores.

  14. Regulating Direct-to-Consumer Drug Information: A Case Study of Eli Lilly's Canadian 40over40 Erectile Dysfunction Campaign.


    Pipon, Jean-Christophe Bélisle; Williams-Jones, Bryn


    Like most jurisdictions, Canada prohibits direct-to-consumer advertising (DTCA) of prescribed drugs. However, direct-to-consumer information (DTCI) is permitted, allowing companies to inform the public about medical conditions. An analysis of Eli Lilly's 40over40 promotion campaign for erectile dysfunction (ED), which included a quiz on ED, shows that DTCI, like DTCA, can be an effective means of drug familiarization. The pharmaceutical industry is "playing by the rules" currently in effect in Canada. Regulators should thus seriously consider whether existing rules permitting DTCI actually meet stated objectives of protecting the public from marketing campaigns (i.e., DTCA) that may deliver misleading information. PMID:26142356

  15. Regulating Direct-to-Consumer Drug Information: A Case Study of Eli Lilly's Canadian 40over40 Erectile Dysfunction Campaign

    PubMed Central

    Williams-Jones, Bryn


    Like most jurisdictions, Canada prohibits direct-to-consumer advertising (DTCA) of prescribed drugs. However, direct-to-consumer information (DTCI) is permitted, allowing companies to inform the public about medical conditions. An analysis of Eli Lilly's 40over40 promotion campaign for erectile dysfunction (ED), which included a quiz on ED, shows that DTCI, like DTCA, can be an effective means of drug familiarization. The pharmaceutical industry is “playing by the rules” currently in effect in Canada. Regulators should thus seriously consider whether existing rules permitting DTCI actually meet stated objectives of protecting the public from marketing campaigns (i.e., DTCA) that may deliver misleading information. PMID:26142356

  16. Electron localizability indicators ELI-D and ELIA for highly correlated wavefunctions of homonuclear dimers. II. N2, O2, F2, and Ne2.


    Bezugly, Viktor; Wielgus, Pawel; Kohout, Miroslav; Wagner, Frank R


    Electron localizability indicators based on the electron pair density ELI-D and ELIA Electron localizability indicators ELI-D and ELIA based on the electron pair density are studied for the correlated ground-state wavefunctions of N(2), O(2), F(2), and Ne(2) diatomics. Different basis sets and reference spaces are used for the multireference configuration interaction method following the complete active space calculations to investigate the local effect of electron correlation on the extent of electron localizability in position space determined by the two indicators. The results are complemented by calculations of effective bond order, vibrational frequency, and Laplacian of the electron density at the bond midpoint. It turns out that for O(2) and F(2), the reliable topology of ELI-D is obtained only at the correlated level of theory.

  17. C.T. Jackson's 15 October 1846 letter to J.-B.A.L. Elie de Beaumont: Jackson's thoughts on Ether Day's Eve?


    Bause, George S; Sim, Patrick P


    As did the previous letter on 30 November 1845 from Charles T. Jackson to J.-B.A.L. Elie de Beaumont, this 15 October 1846 missive underscores the cordial professional relationship between the two geologists. Remarkably, in this "Ether Day's Eve" letter, Jackson never reveals whether he had any clue that W.T.G. Morton would be publicly demonstrating ether anesthesia for surgery the next morning. More importantly, since Elie de Beaumont would play a future pivotal role in assigning initial credit for "discovering anesthesia" to his geological colleague Jackson, rather than to Morton, letters such as these from November of 1845 and October of 1846 can only raise more questions about the impartiality of Elie de Beaumont.

  18. Nuclear Science and Applications with the Next Generation of High-Power Lasers and Brilliant Low-Energy Gamma Beams at ELI-NP

    NASA Astrophysics Data System (ADS)

    Gales, S.; ELI-NP Team


    The development of high power lasers and the combination of such novel devices with accelerator technology has enlarged the science reach of many research fields, in particular High Energy, Nuclear and Astrophysics as well as societal applications in Material Science, Nuclear Energy and Medicine. The European Strategic Forum for Research Infrastructures (ESFRI) has selected a proposal based on these new premises called "ELI" for Extreme Light Infrastructure. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW class lasers and a Back Compton Scattering High Brilliance and Intense Low Energy Gamma Beam, a marriage of Laser and Accelerator technology at the frontier of knowledge. In the present paper, the technical and scientific status of the project as well as the applications of the gamma source will be discussed.

  19. Measuring GAMMA 10 end-loss ions with an ELIS (end-loss-ion spectrometers) from TMX-U

    SciTech Connect

    Foote, J.H.


    The author spent the period from March 22 to July 10, 1987, at the GAMMA 10 tandem-mirror experiment at the University of Tsukuba in Tsukuba, Japan. The purpose of this extended trip was to install on GAMMA 10 one of the end-loss-ion spectrometers (ELIS) used on TMX-U (Tandem Mirror Experiment-Upgrade) at LLNL and to make plasma measurements there with this diagnostic instrument. This report discusses the considerable planning and preparations that preceded the trip, the actual experience with the ELIS equipment at GAMMA 10, data and results obtained while the author was there, GAMMA 10 experimental procedures, the scientific and technical support during the stay, and some final comments and suggestions concerning an international exchange such as this one. The data acquired on GAMMA 10 while there, along with earlier data, present an encouraging picture of a plasma in a thermal-barrier mode in a tandem-mirror, magnetic-fusion machine. 6 refs.

  20. Medical research and multidisciplinary applications with laser-accelerated beams: the ELIMED netwotk at ELI-Beamlines

    NASA Astrophysics Data System (ADS)

    Tramontana, A.; Anzalone, A.; Candiano, G.; Carpinelli, M.; Cirrone, G. A. P.; Cuttone, G.; Korn, G.; Licciardello, T.; Maggiore, M.; Manti, L.; Margarone, D.; Musumarra, A.; Perozziello, F.; Pisciotta, P.; Raffaele, L.; Romano, F.; Romano, F. P.; Stancampiano, C.; Schillaci, F.; Scuderi, V.; Torrisi, L.; Tudisco, S.


    Laser accelerated proton beams represent nowadays an attractive alternative to the conventional ones and they have been proposed in different research fields. In particular, the interest has been focused in the possibility of replacing conventional accelerating machines with laser-based accelerators in order to develop a new concept of hadrontherapy facilities, which could result more compact and less expensive. With this background the ELIMED (ELIMED: ELI-Beamlines MEDical applications) research project has been launched by LNS-INFN researchers (Laboratori Nazionali del Sud-Istituto Nazionale di Fisica Nucleare, Catania, IT) and ASCR-FZU researchers (Academy of Sciences of the Czech Republic-Fyzikální ústar, Prague, Cz), within the pan-European ELI-Beamlines facility framework. Its main purposes are the demonstration of future applications in hadrontherapy of optically accelerated protons and the realization of a laser-accelerated ion transport beamline for multidisciplinary applications. Several challenges, starting from laser-target interaction and beam transport development, up to dosimetric and radiobiological issues, need to be overcome in order to reach the final goals. The design and the realization of a preliminary beam handling and dosimetric system and of an advanced spectrometer for high energy (multi-MeV) laser-accelerated ion beams will be shortly presented in this work.

  1. Fatigue testing of electron beam-melted Ti-6Al-4V ELI alloy for dental implants.


    Joshi, Gaurav V; Duan, Yuanyuan; Neidigh, John; Koike, Mari; Chahine, Gilbert; Kovacevic, Radovan; Okabe, Toru; Griggs, Jason A


    Customized one-component dental implants have been fabricated using Electron Beam Melting(®) (EBM(®)), which is a rapid prototyping and manufacturing technique. The goal of our study was to determine the effect of electron beam orientation on the fatigue resistance of EBM Ti-6Al-4V ELI alloy. EBM technique was used to fabricate Ti-6Al-4V ELI alloy blocks, which were cut into rectangular beam specimens with dimensions of 25 × 4 × 3 mm, such that electron beam orientation was either parallel (group A) or perpendicular (group B) to the long axis of the specimens. The specimens were subjected to cyclic fatigue (R = 0.1) in four-point flexure under ambient conditions using various stress amplitudes below the yield stress. The fatigue lifetime data were fit to an inverse power law-Weibull model to predict the peak stress corresponding to failure probabilities of 5 and 63% at 2M cycles (σ(max, 5%) and σ(max, 63%)). Groups A and B did not have significantly different Weibull modulus, m (p > 0.05). The specimens with parallel orientation showed significantly higher σ(max, 63%) (p ≤ 0.05), but there was no significant difference in the σ(max, 5%) (p > 0.05). Thus, it can be concluded that the fatigue resistance of the material was greatest when the electron beam orientation was perpendicular to the direction of crack propagation.

  2. Effect of Test Frequency on Fatigue Crack Growth Rates of Ti-6Al-4V ELI Alloy at Cryogenic Temperature

    SciTech Connect

    Yuri, T.; Ono, Y.; Ogata, T.


    In order to clarify the effect of test frequency on the fatigue crack growth rates (da/dN) of Ti-6Al-4V ELI alloy have been investigated at cryogenic temperature. The fatigue crack growth tests were conducted using the test frequencies of 5 and 20 Hz, respectively. At 4 K, the effects of the test frequencies on the fatigue crack growth rates of Ti-6Al-4V ELI alloy were not clear or significant. The fatigue crack growth rates in the low propagation rate region at 4 K were smaller than those at 293 K. On the other hand, those in the high propagation rate region at 4 K were bigger than those at 293 K. The former is considered that the crack closure level was higher as compared to that at 293 K and the latter is due to the difference values of the fracture toughness at 4 and 293 K, respectively. The fracture surfaces of compact tension (CT) specimens in the high propagation rate regions at each test temperature revealed the striations, and furthermore accompanied with the flute fracture surface at 4 K. On the other hand, those of CT specimens in the low propagation rate region at 4 K were found facet-like fracture surfaces corresponding with almost the {alpha}-grain size.

  3. Selected Water- and Sediment-Quality, Aquatic Biology, and Mine-Waste Data from the Ely Copper Mine Superfund Site, Vershire, VT, 1998-2007

    USGS Publications Warehouse

    Argue, Denise M.; Kiah, Richard G.; Piatak, Nadine M.; Seal, Robert R., II; Hammarstrom, Jane M.; Hathaway, Edward; Coles, James F.


    The data contained in this report are a compilation of selected water- and sediment-quality, aquatic biology, and mine-waste data collected at the Ely Copper Mine Superfund site in Vershire, VT, from August 1998 through May 2007. The Ely Copper Mine Superfund site is in eastern, central Vermont (fig. 1) within the Vermont Copper Belt (Hammarstrom and others, 2001). The Ely Copper Mine site was placed on the U.S. Environmental Protection Agency (USEPA) National Priorities List in 2001. Previous investigations conducted at the site documented that the mine is contributing metals and highly acidic waters to local streams (Hammarstrom and others, 2001; Holmes and others, 2002; Piatak and others, 2003, 2004, and 2006). The U.S. Geological Survey (USGS), in cooperation with the USEPA, compiled selected data from previous investigations into uniform datasets that will be used to help characterize the extent of contamination at the mine. The data may be used to determine the magnitude of biological impacts from the contamination and in the development of remediation activities. This report contains analytical data for samples collected from 98 stream locations, 6 pond locations, 21 surface-water seeps, and 29 mine-waste locations. The 98 stream locations are within 3 streams and their tributaries. Ely Brook flows directly through the Ely Copper Mine then into Schoolhouse Brook (fig. 2), which joins the Ompompanoosuc River (fig. 1). The six pond locations are along Ely Brook Tributary 2 (fig. 2). The surface-water seeps and mine-waste locations are near the headwaters of Ely Brook (fig. 2 and fig. 3). The datasets 'Site_Directory' and 'Coordinates' contain specific information about each of the sample locations including stream name, number of meters from the mouth of stream, geographic coordinates, types of samples collected (matrix of sample), and the figure on which the sample location is depicted. Data have been collected at the Ely Copper Mine Superfund site by the

  4. High-cycle fatigue behavior of Ti-5Al-2.5Sn ELI alloy forging at low temperatures

    NASA Astrophysics Data System (ADS)

    Ono, Yoshinori; Yuri, Tetsumi; Ogata, Toshio; Demura, Masahiko; Matsuoka, Saburo; Sunakawa, Hideo


    High-cycle fatigue properties of Ti-5Al-2.5Sn Extra Low Interstitial (ELI) alloy forging were investigated at low temperatures. The high-cycle fatigue strength at low temperatures of this alloy was relatively low compared with that at ambient temperature. The crystallographic orientation of a facet formed at a fatigue crack initiation site was determined by electron backscatter diffraction (EBSD) method in scanning electron microscope (SEM) to understand the fatigue crack initiation mechanism and discuss on the low fatigue strength at low temperature. Furthermore, in terms of the practical use of this alloy, the effect of the stress ratio (or mean stress) on the high-cycle fatigue properties was evaluated using the modified Goodman diagram.

  5. Future laser-accelerated proton beams at ELI-Beamlines as potential source of positron emitters for PET

    NASA Astrophysics Data System (ADS)

    Amato, E.; Italiano, A.; Margarone, D.; Pagano, B.; Baldari, S.; Korn, G.


    The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of novel, fast and efficient, radiopharmaceutical methods of labeling. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources expected at the ELI-Beamlines facility where a PW, 30 fs, 10 Hz laser system will be available. The production yields of several positron emitters were calculated through the TALYS software, by taking into account three possible scenarios of broad proton spectra expected, with maximum energies ranging from about 8 MeV to 100 MeV. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of radiopharmaceuticals exploiting modern fast and efficient labeling systems.

  6. High-cycle fatigue behavior of Ti-5Al-2.5Sn ELI alloy forging at low temperatures

    SciTech Connect

    Ono, Yoshinori; Yuri, Tetsumi; Ogata, Toshio; Demura, Masahiko; Matsuoka, Saburo; Sunakawa, Hideo


    High-cycle fatigue properties of Ti-5Al-2.5Sn Extra Low Interstitial (ELI) alloy forging were investigated at low temperatures. The high-cycle fatigue strength at low temperatures of this alloy was relatively low compared with that at ambient temperature. The crystallographic orientation of a facet formed at a fatigue crack initiation site was determined by electron backscatter diffraction (EBSD) method in scanning electron microscope (SEM) to understand the fatigue crack initiation mechanism and discuss on the low fatigue strength at low temperature. Furthermore, in terms of the practical use of this alloy, the effect of the stress ratio (or mean stress) on the high-cycle fatigue properties was evaluated using the modified Goodman diagram.

  7. Surface Quality of Ti-6%Al-4%V ELI When Machined Using CVD-Carbide Tools at High Cutting Speed

    SciTech Connect

    Gusri, A. I.; Che Hassan, C. H.; Jaharah, A. G.; Yasir, A.; Zaid, Y.; Yanuar, B.


    Machining of Ti-6Al-4V ELI becomes more interested topic due to extremely weight-to-strength ratio and resistance to corrosion at elevated temperature. Quality of machined surface is presented by surface roughness, surface texture and damages of microstructure of titanium alloys. The turning parameters evaluated are cutting speed of 55-95 m/min, feed rate of 0.15-0.35 mm/rev, depth of cut of 0.10-0.20 mm and tool grade of CVD carbide tools. The results show the trend lines of surface roughness value are higher at the initial machining and the surface texture profile has a strong correlation with the feed rate. At the machining condition of cutting speed of 95 m/min, feed rate of 0.35 mm/rev and depth of cut of 0.10 mm produced the with layer with thickness of 2.0 {mu}m.

  8. Investigation of the d(γ,n)p reaction for gamma beam monitoring at ELI-NP

    NASA Astrophysics Data System (ADS)

    Matei, C.; Mueller, J. M.; Sikora, M. H.; Suliman, G.; Ur, C. A.; Weller, H. R.


    The Extreme Light Infrastructure - Nuclear Physics facility will deliver brilliant gamma beams with high spectral density and a high degree of polarization starting in 2018 in Bucharest-Magurele, Romania. Several monitoring instruments are proposed for measuring the spectral, temporal, and spatial characteristics of the gamma beam. The d(γ,n)p reaction has been investigated for its use in determining the gamma beam parameters in a series of measurements carried out at the High Intensity Gamma Source, Durham, U.S.A.. Measurements of the emitted neutrons have been performed using liquid scintillator and 6Li-glass neutron detectors at several incident gamma energies between 2.5 to 20 MeV . The experimental results presented in this paper have shown that an instrument based on the d(γ,n)p reaction can be used to monitor the intensity and polarization of the gamma beam to be produced at ELI-NP.

  9. Laser Assisted Milling of Ti-6Al-4V ELI with the Analysis of Surface Integrity and its Economics

    NASA Astrophysics Data System (ADS)

    Hedberg, Gary K.; Shin, Yung C.


    This study presents the experimental evaluation of laser assisted milling (LAML) of Ti-6AL-4V ELI (Ti-64), which is used in the orthopedic industry, by using localized preheating of the workpiece via laser irradiation. Improvements to the machinability of this material with LAML are assessed while considering the surface integrity. Suitable laser heating conditions as well as machining conditions are determined based on temperature prediction modeling. Machinability improvements are shown in terms of tool wear, material removal rates and cutting force reduction. Systematic characterization of samples is shown to demonstrate that the machined sub-surfaces are not adversely affected during LAML by precisely controlling laser heating, via hardness measurements, scanning electron microscopy (SEM) for microstructure analysis, and X-ray diffraction (XRD) for residual stresses. An economic analysis shows that LAML provides the cost reduction over conventional machining.

  10. Complex subvolcanic magma plumbing system of an alkali basaltic maar-diatreme volcano (Elie Ness, Fife, Scotland)

    NASA Astrophysics Data System (ADS)

    Gernon, T. M.; Upton, B. G. J.; Ugra, R.; Yücel, C.; Taylor, R. N.; Elliott, H.


    Alkali basaltic diatremes such as Elie Ness (Fife, Scotland) expose a range of volcanic lithofacies that points to a complex, multi-stage emplacement history. Here, basanites contain phenocrysts including pyrope garnet and sub-calcic augites from depths of ~ 60 km. Volcanic rocks from all units, pyroclastic and hypabyssal, are characterised by rare earth element (REE) patterns that show continuous enrichment from heavy REE (HREE) to light REE (LREE), and high Zr/Y that are consistent with retention of garnet in the mantle source during melting of peridotite in a garnet lherzolite facies. Erupted garnets are euhedral and unresorbed, signifying rapid ascent through the lithosphere. The magmas also transported abundant pyroxenitic clasts, cognate with the basanite host, from shallower depths (~ 35-40 km). These clasts exhibit wide variation in texture, mode and mineralogy, consistent with growth from a range of compositionally diverse melts. Further, clinopyroxene phenocrysts from both the hypabyssal and pyroclastic units exhibit a very wide compositional range, indicative of polybaric fractionation and magma mixing. This is attributed to stalling of earlier magmas in the lower crust - principally from ~ 22 to 28 km - as indicated by pyroxene thermobarometry. Many clinopyroxenes display chemical zoning profiles, occasionally with mantles and rims of higher magnesium number (Mg#) suggesting the magmas were mobilised by juvenile basanite magma. The tuffs also contain alkali feldspar megacrysts together with Fe-clinopyroxene, zircon and related salic xenoliths, of the 'anorthoclasite suite' - inferred to have crystallised at upper mantle to lower crustal depths from salic magma in advance of the mafic host magmas. Despite evidence for entrainment of heterogeneous crystal mushes, the rapidly ascending melts experienced negligible crustal contamination. The complex association of phenocrysts, megacrysts and autoliths at Elie Ness indicates thorough mixing in a dynamic

  11. Electron localizability indicators ELI-D and ELIA for highly correlated wavefunctions of homonuclear dimers. I. Li2, Be2, B2, and C2.


    Bezugly, Viktor; Wielgus, Pawel; Kohout, Miroslav; Wagner, Frank R


    Electron localizability indicators based on the parallel-spin electron pair density (ELI-D) and the antiparallel-spin electron pair density (ELIA) are studied for the correlated ground-state wavefunctions of Li(2), Be(2), B(2), and C(2) diatomic molecules. Different basis sets and reference spaces are used for the multireference configuration interaction method following the complete active space calculations to investigate the local effect of electron correlation on the extent of electron localizability in position space determined by the two functionals. The results are complemented by calculations of effective bond order, vibrational frequency, and Laplacian of the electron density at the bond midpoint. It turns out that for Li(2), B(2), and C(2) the reliable topology of ELI-D is obtained only at the correlated level of theory.

  12. Nuclear Science and Applications with the Next Generation of High-Power Lasers and Brilliant Low-Energy Gamma Beams at ELI-NP

    NASA Astrophysics Data System (ADS)

    Gales, S.

    The development of high power lasers and the combination of such novel devices with accelerator technology has enlarged the science reach of many research fields, in particular Particle and Nuclear Physics, Astrophysics as well as societal applications in Material Science, Nuclear Energy and Medicine. The European Strategic Forum for Research Infrastructures (ESFRI) has selected a proposal based on these new premises called "ELI" for Extreme Light Infrastructure. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense low-energy gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  13. Nuclear Science and Applications with the Next Generation of High-Power Lasers and Brilliant Low-Energy Gamma Beams at ELI-NP

    NASA Astrophysics Data System (ADS)

    Gales, S.


    The development of high-power lasers and the combination of such novel devices with accelerator technology has enlarged the science reach of many research fields, in particular high-energy nuclear physics and astrophysics, as well as societal applications in material science, nuclear energy and medicine. The European Strategic Forum for Research Infrastructures (ESFRI) has selected a proposal based on these new premises called "ELI" for Extreme Light Infrastructure. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for nuclear physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10-PW lasers and a Compton back-scattering high-brilliance and intense low-energy gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.

  14. Gene expression of human osteoblasts cells on chemically treated surfaces of Ti-6Al-4V-ELI.


    Oliveira, D P; Palmieri, A; Carinci, F; Bolfarini, C


    Surface modifications of titanium alloys are useful methods to enhance the biological stability of intraosseous implants and to promote a well succeeded osseointegration in the early stages of implantation. This work aims to investigate the influence of chemically modified surfaces of Ti-6Al-4V-ELI (extra-low interstitial) on the gene expression of human osteoblastic (HOb) cells. The surface treatments by acid etching or acid etching plus alkaline treatment were carried out to modify the topography, effective area, contact angle and chemical composition of the samples. The surface morphology was investigated using: scanning electron microscopy (SEM) and confocal laser-scanning microscope (CLSM). Roughness measurements and effective surface area were obtained using the CLSM. Surface composition was analysed by energy dispersive X-ray spectroscopy (EDX) and by X-Ray Diffraction (XRD). The expression levels of some bone related genes (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analysed using real-time Reverse Transcription Polymerase Chain Reaction (real-time RT-PCR). The results showed that all the chemical modifications studied in this work influenced the surface morphology, wettability, roughness, effective area and gene expression of human osteoblasts. Acid phosphoric combined to alkaline treatment presented a more accelerated gene expression after 7days while the only phosphoric etching or chloride etching combined to alkaline treatment presented more effective responses after 15days.

  15. High and low energy gamma beam dump designs for the gamma beam delivery system at ELI-NP

    NASA Astrophysics Data System (ADS)

    Yasin, Zafar; Matei, Catalin; Ur, Calin A.; Mitu, Iani-Octavian; Udup, Emil; Petcu, Cristian


    The Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Magurele, Bucharest, Romania. The facility will use two 10 PW lasers and a high intensity, narrow bandwidth gamma beam for stand-alone and combined laser-gamma experiments. The accurate estimation of particle doses and their restriction within the limits for both personel and general public is very important in the design phase of any nuclear facility. In the present work, Monte Carlo simulations are performed using FLUKA and MCNPX to design 19.4 and 4 MeV gamma beam dumps along with shielding of experimental areas. Dose rate contour plots from both FLUKA and MCNPX along with numerical values of doses in experimental area E8 of the facility are performed. The calculated doses are within the permissible limits. Furthermore, a reasonable agreement between both codes enhances our confidence in using one or both of them for future calculations in beam dump designs, radiation shielding, radioactive inventory, and other calculations releated to radiation protection. Residual dose rates and residual activity calculations are also performed for high-energy beam dump and their effect is negligible in comparison to contributions from prompt radiation.

  16. Gene expression of human osteoblasts cells on chemically treated surfaces of Ti-6Al-4V-ELI.


    Oliveira, D P; Palmieri, A; Carinci, F; Bolfarini, C


    Surface modifications of titanium alloys are useful methods to enhance the biological stability of intraosseous implants and to promote a well succeeded osseointegration in the early stages of implantation. This work aims to investigate the influence of chemically modified surfaces of Ti-6Al-4V-ELI (extra-low interstitial) on the gene expression of human osteoblastic (HOb) cells. The surface treatments by acid etching or acid etching plus alkaline treatment were carried out to modify the topography, effective area, contact angle and chemical composition of the samples. The surface morphology was investigated using: scanning electron microscopy (SEM) and confocal laser-scanning microscope (CLSM). Roughness measurements and effective surface area were obtained using the CLSM. Surface composition was analysed by energy dispersive X-ray spectroscopy (EDX) and by X-Ray Diffraction (XRD). The expression levels of some bone related genes (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analysed using real-time Reverse Transcription Polymerase Chain Reaction (real-time RT-PCR). The results showed that all the chemical modifications studied in this work influenced the surface morphology, wettability, roughness, effective area and gene expression of human osteoblasts. Acid phosphoric combined to alkaline treatment presented a more accelerated gene expression after 7days while the only phosphoric etching or chloride etching combined to alkaline treatment presented more effective responses after 15days. PMID:25842132



    Stambler, I S


    The years 2015-2016 mark a double anniversary--the 170th anniversary of birth and the 100th anni- versary of death--of one of the greatest Russian scientists, a person that may be considered a founding figure of modern immunology, aging and longevity science--Elie Metchnikoff (May 15, 1845-July 15, 1916). At this time of the rapid aging of the world population and the rapid development of technologies that may ameliorate degenerative aging processes, Metchnikoff's pioneering contribution to the search for anti-aging and healthspan-extending means needs to be recalled and honored.

  18. Data Sheet Program and Mechanical Properties of Ti-5Al-2.5Sn ELI and Alloy 718 at Cryogenic Temperatures

    NASA Astrophysics Data System (ADS)

    Ogata, T.; Yuri, T.; Sumiyoshi, H.; Ono, Y.; Matsuoka, S.; Okita, K.


    In the development of Japan's self-developed H-IIA launch vehicle, it is important to sufficiently comprehend the properties of materials under conditions in which the materials are used in the system for its design and the improvement of its reliability. Through the process of failure analysis of the LE-7 engine of H-II No. 8 in 1999, detailed materials data and photographs of the fracture surface were required as reference data to determine in terms of fracture morphology and to analyze the fracture stress. A series of mechanical properties tests, such as tensile tests, impact tests, fracture toughness tests, and fatigue tests, on Ti-5Al-2.5Sn ELI and Alloy 718 at room temperature to 4K were mainly conducted by NIMS and NASDA. The obtained tensile and fracture toughness properties were a little bit smaller than those reported by NASA and NRIM, however, the fatigue properties were relatively lower than the data reported so far. Data resulting from the tests were reviewed in detail and published in the form of data sheets. This paper will introduce the data sheet program on space use materials and discuss an effect of microstructure of Ti-5Al-2.5Sn ELI and Alloy 718 on their mechanical properties at cryogenic temperatures.

  19. Effect of stress ratio on high-cycle fatigue properties of Ti-6Al-4V ELI alloy forging at low temperature

    NASA Astrophysics Data System (ADS)

    Ono, Yoshinori; Yuri, Tetsumi; Ogata, Toshio; Matsuoka, Saburo; Sunakawa, Hideo


    The effect of the stress ratio R (the ratio of minimum stress to maximum stress) on the high-cycle fatigue properties of Ti-6Al-4V extra-low interstitial (ELI) alloy forging was investigated at 293 and 77 K. At 293 K, the fatigue strength at 107 cycles exhibited deviations below the modified Goodman line in the R=0.01 and 0.5 tests. Moreover, at 77 K, larger deviations of the fatigue strength at 107 cycles below the modified Goodman line were confirmed in the same stress ratio conditions. The high-cycle fatigue strength of the present alloy forging exhibit an anomalous mean stress dependency at both temperatures and this dependency becomes remarkable at low temperature.

  20. Theoretical QTAIM, ELI-D, and Hirshfeld surface analysis of the Cu-(H)B interaction in [Cu2(bipy)2B10H10].


    Vologzhanina, Anna V; Korlyukov, Alexander A; Avdeeva, Varvara V; Polyakova, Irina N; Malinina, Elena A; Kuznetsov, Nikolai T


    Interaction of [Cu2B10H10] with 2,2'-bipyridine (bipy) afforded a novel binuclear discrete complex of the [Cu2(bipy)2B10H10] composition. Two copper(I) atoms coordinate a bridge boron cage through an apical edge and a triangular BBB face situated at its opposite apical vertices to form four 3c2e (CuHB) and one 2c2e Cu-B bonds. The charge density model was obtained by density functional theory calculations of isolated molecule and crystal. The resultant densities were analyzed using the quantum theory of atoms in molecules (QTAIM) and electron localizability indicator (ELI-D). The geometry and the topological parameters of copper(I) coordination environment were found to be sensitive to crystal-field effect. An annulus of flat electron density ρ(r) and small ∇(2)ρ(r) is formed at dianion faces. As a result, some of the expected B-B, Cu-B, or Cu-H bond critical points are absent. The topological instability in the region of multicentered bonds is observed. The Cu-B bonding was found to be presumably electrostatic in nature, which could be the reason of topological isomerism for copper(I) decaborates. The results show that an unambiguous real-space criterion for multicentered bonding between transition metals and polyhedral boron anions is not yet given. The molecular graph for this class of compounds does not provide a definitive picture of the chemical boding and can be complemented with other descriptors, such as virial graphs and the ELI-D distribution.

  1. Theoretical QTAIM, ELI-D, and Hirshfeld surface analysis of the Cu-(H)B interaction in [Cu2(bipy)2B10H10].


    Vologzhanina, Anna V; Korlyukov, Alexander A; Avdeeva, Varvara V; Polyakova, Irina N; Malinina, Elena A; Kuznetsov, Nikolai T


    Interaction of [Cu2B10H10] with 2,2'-bipyridine (bipy) afforded a novel binuclear discrete complex of the [Cu2(bipy)2B10H10] composition. Two copper(I) atoms coordinate a bridge boron cage through an apical edge and a triangular BBB face situated at its opposite apical vertices to form four 3c2e (CuHB) and one 2c2e Cu-B bonds. The charge density model was obtained by density functional theory calculations of isolated molecule and crystal. The resultant densities were analyzed using the quantum theory of atoms in molecules (QTAIM) and electron localizability indicator (ELI-D). The geometry and the topological parameters of copper(I) coordination environment were found to be sensitive to crystal-field effect. An annulus of flat electron density ρ(r) and small ∇(2)ρ(r) is formed at dianion faces. As a result, some of the expected B-B, Cu-B, or Cu-H bond critical points are absent. The topological instability in the region of multicentered bonds is observed. The Cu-B bonding was found to be presumably electrostatic in nature, which could be the reason of topological isomerism for copper(I) decaborates. The results show that an unambiguous real-space criterion for multicentered bonding between transition metals and polyhedral boron anions is not yet given. The molecular graph for this class of compounds does not provide a definitive picture of the chemical boding and can be complemented with other descriptors, such as virial graphs and the ELI-D distribution. PMID:24200215

  2. Fundamental relation between molecular geometry and real-space topology. Combined AIM, ELI-D, and ASF analysis of hapticities and intramolecular hydrogen-hydrogen bonds in zincocene-related compounds.


    Mebs, Stefan; Chilleck, Maren Annika; Meindl, Kathrin; Hübschle, Christian Bertram


    Despite numerous advanced and widely distributed bonding theories such as MO, VB, NBO, AIM, and ELF/ELI-D, complex modes of bonding such as M-Cp*((R)) interactions (hapticities) in asymmetrical metallocenes or weak intramolecular interactions (e.g., hydrogen-hydrogen (H···H) bonds) still remain a challenge for these theories in terms of defining whether or not an atom-atom interaction line (a "chemical bond") should be drawn. In this work the intramolecular Zn-C(Cp*(R)) (R = Me, -(CH2)2NMe2, and -(CH2)3NMe2) and H···H connectivity of a systematic set of 12 zincocene-related compounds is analyzed in terms of AIM and ELI-D topology combined with the recently introduced aspherical stockholder fragment (ASF) surfaces. This computational analysis unravels a distinct dependency of the AIM and ELI-D topology against the molecular geometry for both types of interactions, which confirms and extends earlier findings on smaller sets of compounds. According to these results the complete real-space topology including strong, medium, and weak interactions of very large compounds such as proteins may be reliably predicted by sole inspection of accurately determined molecular geometries, which would on the one hand afford new applications (e.g., accurate estimation of numbers, types, and strengths of intra- and intermolecular interactions) and on the other hand have deep implications on the significance of the method.

  3. High-Cycle Fatigue Properties and Fatigue Crack Initiation Behavior of Ti-5%Al-2.5%Sn Eli Alloy at Cryogenic Temperatures

    NASA Astrophysics Data System (ADS)

    Ono, Y.; Demura, M.; Yuri, T.; Ogata, T.; Matsuoka, S.; Hori, S.


    Tensile tests and uni-axial loading fatigue tests were performed at 4 K, 77 K and 293 K for Ti-5%Al-2.5%Sn extra low interstitial (ELI) forged alloy. The 0.2% proof stress and the tensile strength of this alloy increased with a decrease of temperature. However, high-cycle fatigue strength at cryogenic temperatures was relatively low compared to that at 293 K. In the specimens fatigue-tested at cryogenic temperatures, facets formed at the crack initiation site. On the other hand, there was not a distinct facet at the crack initiation site in the specimens tested at 293 K. The crystallographic orientation of the facet was determined by electron backscatter diffraction (EBSD) method in scanning electron microscope (SEM) to clarify the fatigue crack initiation mechanism at cryogenic temperatures. The SEM-EBSD analyses revealed that the facet plane was {112¯1} twin plane and the {112¯1} twins developed during high-cycle fatigue tests at cryogenic temperatures, leading to the fatigue crack initiation at {112¯1} twin/matrix interface. Based on these results, the fatigue crack initiation related with twin deformation is supposed to degrade high-cycle fatigue strength at cryogenic temperatures.

  4. Geochemical characterization of slags, other mines wastes, and their leachates from the Elizabeth and Ely mines (Vermont), the Ducktown mining district (Tennessee), and the Clayton smelter site (Idaho)

    USGS Publications Warehouse

    Piatak, Nadine M.; Seal, Robert R., II; Hammarstrom, Jane M.; Meier, Allen L.; Briggs, Paul H.


    Waste-rock material produced at historic metal mines contains elevated concentrations of potentially toxic trace elements. Two types of mine waste were examined in this study: sintered waste rock and slag. The samples were collected from the Elizabeth and Ely mines in the Vermont copper belt (Besshi-type massive sulfide deposits), from the Copper Basin mining district near Ducktown, Tennessee (Besshi-type massive sulfide deposits), and from the Clayton silver mine in the Bayhorse mining district, Idaho (polymetallic vein and replacement deposits). The data in this report are presented as a compilation with minimal interpretation or discussion. A detailed discussion and interpretation of the slag data are presented in a companion paper. Data collected from sintered waste rock and slag include: (1) bulk rock chemistry, (2) mineralogy, (3) and the distribution of trace elements among phases for the slag samples. In addition, the reactivity of the waste material under surficial conditions was assessed by examining secondary minerals formed on slag and by laboratory leaching tests using deionized water and a synthetic solution approximating precipitation in the eastern United States.

  5. Wear Mechanism of Chemical Vapor Deposition (CVD) Carbide Insert in Orthogonal Cutting Ti-6Al-4V ELI at High Cutting Speed

    NASA Astrophysics Data System (ADS)

    Gusri, A. I.; Che Hassan, C. H.; Jaharah, A. G.


    The performance of Chemical Vapor Deposition (CVD) carbide insert with ISO designation of CCMT 12 04 04 LF, when turning titanium alloys was investigated. There were four layers of coating materials for this insert i.e.TiN-Al2O3-TiCN-TiN. The insert performance was evaluated based on the insert's edge resistant towards the machining parameters used at high cutting speed range of machining Ti-6Al-4V ELI. Detailed study on the wear mechanism at the cutting edge of CVD carbide tools was carried out at cutting speed of 55-95 m/min, feed rate of 0.15-0.35 mm/rev and depth of cut of 0.10-0.20 mm. Wear mechanisms such as abrasive and adhesive were observed on the flank face. Crater wear due to diffusion was also observed on the rake race. The abrasive wear occurred more at nose radius and the fracture on tool were found at the feed rate of 0.35 mm/rev and the depth of cut of 0.20 mm. The adhesion wear takes place after the removal of the coating or coating delaminating. Therefore, adhesion or welding of titanium alloy onto the flank and rake faces demonstrates a strong bond at the workpiece-tool interface.

  6. Wear Mechanism of Chemical Vapor Deposition (CVD) Carbide Insert in Orthogonal Cutting Ti-6Al-4V ELI at High Cutting Speed

    SciTech Connect

    Gusri, A. I.; Che Hassan, C. H.; Jaharah, A. G.


    The performance of Chemical Vapor Deposition (CVD) carbide insert with ISO designation of CCMT 12 04 04 LF, when turning titanium alloys was investigated. There were four layers of coating materials for this insert i.e.TiN-Al2O3-TiCN-TiN. The insert performance was evaluated based on the insert's edge resistant towards the machining parameters used at high cutting speed range of machining Ti-6Al-4V ELI. Detailed study on the wear mechanism at the cutting edge of CVD carbide tools was carried out at cutting speed of 55-95 m/min, feed rate of 0.15-0.35 mm/rev and depth of cut of 0.10-0.20 mm. Wear mechanisms such as abrasive and adhesive were observed on the flank face. Crater wear due to diffusion was also observed on the rake race. The abrasive wear occurred more at nose radius and the fracture on tool were found at the feed rate of 0.35 mm/rev and the depth of cut of 0.20 mm. The adhesion wear takes place after the removal of the coating or coating delaminating. Therefore, adhesion or welding of titanium alloy onto the flank and rake faces demonstrates a strong bond at the workpiece-tool interface.

  7. Study of the production yields of 18F, 11C, 13N and 15O positron emitters from plasma-laser proton sources at ELI-Beamlines for labeling of PET radiopharmaceuticals

    NASA Astrophysics Data System (ADS)

    Amato, Ernesto; Italiano, Antonio; Margarone, Daniele; Pagano, Benedetta; Baldari, Sergio; Korn, Georg


    The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of microfluidics labeling approaches. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources such that expected at the ELI-Beamlines facility. 18F, 11C, 13N and 15O production yields were calculated through the TALYS software, by taking into account the broad proton spectra expected. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of 18F-, 11C- and 13N-labeled radiopharmaceuticals exploiting fast and efficient microfluidic labeling systems.

  8. Project ELI: Improving Early Literacy Outcomes

    ERIC Educational Resources Information Center

    Young, Robin Miller; Chandler, Lynette K.; Shields, LuAnn; Laubenstein, Pam; Butts, Jill; Black, Kristine


    Early childhood and elementary-level educators are engaging in conversations about how to coordinate their efforts to develop fluent readers. There is evidence that key early literacy skills that are predictive of subsequent literacy achievement in kindergarten and first grade can be taught to preschool-age children. Moreover, early childhood…

  9. Nobel prize winner trading card (CIRCA 1952). Elie Metchnikoff.


    Hammerschmidt, Dale E


    Russian doctor and bacteriologist, born in Ivanowca in 1845. He began his studies in Kharkov, continuing them at the Universities of Giessen, Gothingen, and Munich, later being named Professor of Zoology in Odessa in 1870. In the Canary Islands, he completed some anthropological works, but dedicated himself especially to studies of marine fauna. In 1887, much taken by the work of Pasteur, he wrote to him asking for a position in his laboratories; in a short time he became one of the principal collaborators with the master, especially in works concerning bacteriology. These were an inspiration to him, and led him to his famous theory of phagocytosis, the defensive act whereby white blood cells protect an organism against pathogenic microbes. Metchnikoff supposed that old age was avoidable, and subscribed to the materialistic school of thought. He was awarded the Nobel Prize in 1908. (With the complements of the Jose Lopez Luis Cigarillo Factory, Tenerife).

  10. Final EDP Ti: sapphire amplifiers for ELI project

    NASA Astrophysics Data System (ADS)

    Chvykov, Vladimir; Kalashnikov, Mikhail; Osvay, Károly


    Recently several ultrahigh intensity Chirped Pulse Amplification (CPA) laser systems have reached petawatt output powers [1, 2] setting the next milestone at tens or even hundreds petawatts for the next three to ten years [3, 4]. These remarkable results were reached when laser amplifiers (opposite to Optical Parametric Amplification (OPA) [5]) were used as final ones and from them Ti:Sapphire crystals supposed to be the working horses as well in the future design of these laser systems. Nevertheless, the main limitation that arises on the path toward ultrahigh output power and intensity is the restriction on the pumping and extraction energy imposed by Transverse Amplified Spontaneous Emission (TASE) [6] and/or transverse parasitic generation (TPG) [7] within the large aperture of the disc-shape amplifier volume.

  11. High power femtosecond lasers at ELI-NP

    SciTech Connect

    Dabu, Razvan


    Specifications of the high power laser system (HPLS) designed for nuclear physics experiments are presented. Configuration of the 2 × 10 PW femtosecond laser system is described. In order to reach the required laser beam parameters, advanced laser techniques are proposed for the HPLS: parametric amplification and cross-polarized wave generation for the intensity contrast improvement and spectral broadening, acousto-optic programmable filters to compensate for spectral phase dispersion, optical filters for spectrum management, combined methods for transversal laser suppression.

  12. Proposal for an LSW experiment (light shining through walls) at ELI-Beamlines

    NASA Astrophysics Data System (ADS)

    Le Garrec, Bruno J.; Grosz, Jakub


    The most promising approach for detecting WISPs (Weakly Interacting Slim Particles) is to use their small coupling to photons, which detection is easy, even at the single particle level. This is what is done in "light shining through the wall" experiments, which are based on the probability that a photon may be converted into a WISP, which would traverse a light-tight wall without interacting, then have a chance of being converted back into a photon with the same frequency and direction as the original one1. Because of the smallness of the WISPs-photon couplings, it is valuable to use the highest photon fluxes available together with a high magnetic field. In the near future, another interesting hidden-sector particle can be searched for on laser facilities, namely a hidden-sector photon (HP), also called paraphoton or dark photon. Indeed, the recent WMAP-7 observations and interpretations2 hint for an extra neutrino-like particle (the total number of neutrino species is found to be 4.34 ± 0.87 with 68% Confidence Level), which could be accounted for by a hidden photon with a mass μ and a HP-photon coupling χ in the parameters range accessible with laser shots. At ELIBeamlines, there will be a 1.5-kJ laser (L4) running at 1 shot per mn; it is therefore possible to have a dedicated LSW experiment inside one of the facility rooms that would take advantage both of the large number of photons delivered and of the "high repetition rate" of this laser.

  13. Electron localizability indicators ELI and ELIA: the case of highly correlated wavefunctions for the argon atom.


    Bezugly, Viktor; Wielgus, Pawel; Wagner, Frank R; Kohout, Miroslav; Grin, Yuri


    Electron localizability indicators based on the same-spin electron pair density and the opposite-spin electron pair density are studied for correlated wavefunctions of the argon atom. Different basis sets and reference spaces are used for the multireference configuration interaction method following the complete active space calculations aiming at the understanding of the effect of local electron correlation when approaching the exact wavefunction. The populations of the three atomic shells of Ar atom in real space are calculated for each case.

  14. Premium quality 5A1-2.5 Sn ELI titanium production

    NASA Technical Reports Server (NTRS)

    Dessau, P. P.; Harris, C. L.


    Preliminary design and reliability analysis conducted on the turbopump for the NERVA 75,000 full flow cycle engine, indicated that the turbopump bearings were the most critical turbopump parts in meeting the 10 hour life at the required turbopump reliability of .99978. The analysis revealed that significant reductions (approximately a factor of 3.25) in bearing loads would be achieved by fabricating the rotating parts from titanium in lieu of A286 or 718. This is basically due to the difference in density of the materials and the resulting mass effect on the location of the first and second stick mode critical speeds. For the selected rotor configuration, the lighter material has a first critical speed at approximately 36,000 rpm, while that of the heavier material has a first critical at approximately 27,000 rpm. As the operating range of the turbopump is from 0 to 30,000 rpm, the heavier material would have a stick mode critical in the operating range.

  15. 76 FR 53898 - Proposed Administrative Settlement Agreement and Order on Consent; In Re: Ely Copper Mine...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...), notice is hereby given of a proposed settlement for recovery of past and projected future response costs... withdraw its consent to the settlement if comments received disclose facts or considerations which...

  16. Photo-fusion reactions in a new compact device for ELI

    SciTech Connect

    Moustaizis, S. D.; Auvray, P.; Hora, H.; Lalousis, P.; Larour, J.; Mourou, G.


    In the last few years significant progress on technological, experimental and numerical studies on fusion process in high density and high temperature plasmas produced by a high intensity laser pulse interaction with clusters in a high external applied magnetic field, enable us to propose a compact photo-fusion magnetic device for high neutron production. For the purpose of the project a pulsed magnetic field driver with values up to 110 Tesla has been developed which allows increasing the trapping time of the high density plasma in the device and improving the neutron yield. Numerical simulations show that the proposed device is capable of producing up to 10{sup 9}-10{sup 10} neutrons per laser shot with an external magnetic field of 150 Tesla. The proposed device can be used for experiments and numerical code validation concerning different conventional and (or) exotic fusion fuels.

  17. Effects of hydrogen on ELI titanium alloy Ti-5Al-2.5Sn

    NASA Technical Reports Server (NTRS)

    Chandler, W. T.; Hensley, W. E.


    Tensile tests on titanium alloy, following abrasion under hydrogen and temperature cycling, reveal lowered tensile strength, increased ductility, and no embrittlement. Fretting the metal on itself in flowing hydrogen or abrading with an iron file in flowing hydrogen produces titanium hydride.


    EPA Science Inventory

    ECO Logic has developed a thermal desorption unit 0"DU) for the treatment of soils contaminated with hazardous organic contaminants. This TDU has been designed to be used in conjunction with Eco Logic's patented gas-phase chemical reduction reactor. The Eco Logic reactor is the s...

  19. Comment on: ``Chaos in the Showalter-Noyes-Bar-Eli model of the Belousov-Zhabotinskii reaction''

    NASA Astrophysics Data System (ADS)

    Györgyi, László; Field, Richard J.


    The recent numerical work of Lindberg et al. convincingly demonstrates that chemical chaos in a continuous flow, stirred tank reactor (CSTR) can be reproduced by a spatially homogeneous, accurate model of the kinetics of the Belousov-Zhabotinskii(BZ) reaction. However, some problems remain. The chaos in this model and two others, one using an accurate model of the chemical kinetics in conjunction with spatial inhomogeneity resulting from the finite CSTR mixing time and the other using a flawed model of the BZ chemical kinetics, results from coupling of two cycles coexisting within the complex dynamic model. The second cycle in the case of the homogeneous models involves a product of the main chemical limit cycle which is present at a high average concentration. In the Lindberg et al. model this product is assumed to be HOBr. It is clear, however, that a large [HOBr] does not accumulate in the real system because of its rapid reaction with Br-. We suggest that while the Lindberg et al. results are clearly important, this process still needs to be accounted for. Furthermore, the rate parameter values used by Lindberg et al. are not those currently thought to be correct, and the chaos disappears if the accurate rate constant values are used. We discuss why this is so. It is further argued that the Lindberg et al. results do not eliminate the possibility that at least part of the experimentally observed CSTR chaos results from effects related to incomplete mixing.

  20. Using Movies in EFL Classrooms: A Study Conducted at the English Language Institute (ELI), King Abdul-Aziz University

    ERIC Educational Resources Information Center

    Kabooha, Raniah Hassen


    The present study sought to examine the attitudes of Saudi English as a foreign language (EFL) learners as well as teachers towards the integration of English movies in their classes as a tool to develop students' language skills. Fifty female intermediate level students studying English in their Preparatory Year Program (PYP) in the English…

  1. The effects of weld-repair and hot isostatic pressing on the fracture properties of Ti-5Al-2.5Sn ELI castings

    NASA Technical Reports Server (NTRS)

    Misra, M. S.; Lemeshewsky, S.; Bolstad, D.


    The Ti-5Al-2.5Sn extremely low interstitial alloy employed in the large castings which form the critical attachment fittings of the Space Shuttle External Tank was selected because of its high fracture resistance at cryogenic temperatures. Casting was selected over alternative fabrication methods because of its lower cost and adaptability to design changes, although it was found necessary to weld-repair surface and subsurface casting defects in order to reduce the scrap rate and maintain the inherent cost advantage of the castings. Hot Isostatic Pressing was experimentally found to heal the surface and internal defects of the castings, but did not improve tensile or fracture properties and was therefore rejected as a production technique. Production castings are instead weld-repaired, without any mechanical property degradation.

  2. Management Information Reporting 2000-01 Data Analysis for Special Education, English as a Second Language (ESL), Early Literacy Initiative (ELI), and Technology Integration Funding (TIF).

    ERIC Educational Resources Information Center

    Alberta Learning, Edmonton.

    This report is intended to stimulate inquiry into the achievement of special groups of students in Alberta schools and model reporting to the public on these students, a traditionally weak area of school board Annual Education Results reports. The data in the report provide provincial level comparisons to data that may be compiled by school…

  3. Oxygen transfer from an intramolecularly coordinated diaryltellurium oxide to acetonitrile. Formation and combined AIM and ELI-D analysis of a novel diaryltellurium acetimidate.


    Mallow, Ole; Bolsinger, Jens; Finke, Pamela; Hesse, Malte; Chen, Yu-Sheng; Duthie, Andrew; Grabowsky, Simon; Luger, Peter; Mebs, Stefan; Beckmann, Jens


    The reaction of the intramolecularly coordinated diaryltellurium(IV) oxide (8-Me2NC10H6)2TeO with acetonitrile proceeds with oxygen transfer and gives rise to the formation of the novel zwitterionic diaryltelluronium(IV) acetimidate (8-Me2NC10H6)2TeNC(O)CH3 (1) in 57% yield. Hydrolysis of 1 with hydrochloric acid affords acetamide and the previously known diarylhydroxytelluronium(IV) chloride [(8-Me2NC10H6)2Te(OH)]Cl.

  4. FONO: a difficult case for theory. The ELF and ELI-D topological studies on the chemical bonding using correlated wavefunctions.


    Berski, Slawomir; Gordon, Agnieszka J; Latajka, Zdzislaw


    The complicated nature of the chemical bonding in cis and trans isomers of F-O-N=O is discussed based on the results obtained from the topological analysis of electron localization function (η) (ELF), electron localizability index (Y(D)(σ)), and electron density (ρ). The calculations have been performed for correlated wavefunctions using the CCSD and CASSCF methods. The F-O1 bond with non-bonding basins, V(F) and V(')(O1), belongs to the protocovalent type (η,Y(D)(σ)) and its total population ranges between 0.2 and 0.4e. The central N-O1 bond in the cis form is protocovalent (η, Y(D)(σ)) with two basins, V(N) and V(O1). The total population oscillates between 0.7 and 0.9e. In the trans isomer, topology of ELF depends on used method. At the CCSD level only one non-bonding basin, V(N), is observed (η). Its population is about 0.5e. According to the definition of a heteronuclear charge-shift (CS) bond, only N-O1 bond in trans-FONO belongs to the CS class. A relation between η- and ρ-topology and N-O1 bond length is discussed.

  5. FONO: A difficult case for theory. The ELF and ELI-D topological studies on the chemical bonding using correlated wavefunctions

    NASA Astrophysics Data System (ADS)

    Berski, Slawomir; Gordon, Agnieszka J.; Latajka, Zdzislaw


    The complicated nature of the chemical bonding in cis and trans isomers of F-O-N=O is discussed based on the results obtained from the topological analysis of electron localization function (η) (ELF), electron localizability index (Y_D^σ), and electron density (ρ). The calculations have been performed for correlated wavefunctions using the CCSD and CASSCF methods. The F-O1 bond with non-bonding basins, V(F) and V'(O1), belongs to the protocovalent type (η,Y_D^σ) and its total population ranges between 0.2 and 0.4e. The central N-O1 bond in the cis form is protocovalent (η, Y_D^σ) with two basins, V(N) and V(O1). The total population oscillates between 0.7 and 0.9e. In the trans isomer, topology of ELF depends on used method. At the CCSD level only one non-bonding basin, V(N), is observed (η). Its population is about 0.5e. According to the definition of a heteronuclear charge-shift (CS) bond, only N-O1 bond in trans-FONO belongs to the CS class. A relation between η- and ρ-topology and N-O1 bond length is discussed.

  6. Effects of the microstructure and porosity on properties of Ti-6Al-4V ELI alloy fabricated by electron beam melting (EBM)

    SciTech Connect

    Galarraga, Haize; Lados, Diana A.; Dehoff, Ryan R.; Kirka, Michael M.; Nandwana, Peeyush


    Electron Beam Melting (EBM) is a metal powder bed-based Additive Manufacturing (AM) technology that makes possible the fabrication of three dimensional near-net-shaped parts directly from computer models. EBM technology has been in continuously updating, obtaining optimized properties of the processed alloys. Ti-6Al-4V titanium alloy is the most widely used and studied alloy for this technology and is the focus of this work. Several research works have been completed to study the mechanisms of microstructure formation as well as its influence on mechanical properties. However, the relationship is not completely understood, and more systematic research work is necessary in order to attain a better understanding of these features. In this work, samples fabricated at different locations, orientations, and distances from the build platform have been characterized, studying the relationship of these variables with the resulting material intrinsic characteristics and properties (surface topography, microstructure, porosity, micro-hardness and static mechanical properties). This study has revealed that porosity is the main factor controlling mechanical properties relative to the other studied variables. Therefore, in future process developments, decreasing of the porosity should be considered as the primary goal in order to improve mechanical properties.

  7. Effects of the microstructure and porosity on properties of Ti-6Al-4V ELI alloy fabricated by electron beam melting (EBM)


    Galarraga, Haize; Lados, Diana A.; Dehoff, Ryan R.; Kirka, Michael M.; Nandwana, Peeyush


    Electron Beam Melting (EBM) is a metal powder bed-based Additive Manufacturing (AM) technology that makes possible the fabrication of three dimensional near-net-shaped parts directly from computer models. EBM technology has been in continuously updating, obtaining optimized properties of the processed alloys. Ti-6Al-4V titanium alloy is the most widely used and studied alloy for this technology and is the focus of this work. Several research works have been completed to study the mechanisms of microstructure formation as well as its influence on mechanical properties. However, the relationship is not completely understood, and more systematic research work is necessary in order tomore » attain a better understanding of these features. In this work, samples fabricated at different locations, orientations, and distances from the build platform have been characterized, studying the relationship of these variables with the resulting material intrinsic characteristics and properties (surface topography, microstructure, porosity, micro-hardness and static mechanical properties). This study has revealed that porosity is the main factor controlling mechanical properties relative to the other studied variables. Therefore, in future process developments, decreasing of the porosity should be considered as the primary goal in order to improve mechanical properties.« less

  8. Oxygen transfer from an intramolecularly coordinated diaryltellurium oxide to acetonitrile. Formation and combined AIM and ELI-D analysis of a novel diaryltellurium acetimidate.


    Mallow, Ole; Bolsinger, Jens; Finke, Pamela; Hesse, Malte; Chen, Yu-Sheng; Duthie, Andrew; Grabowsky, Simon; Luger, Peter; Mebs, Stefan; Beckmann, Jens


    The reaction of the intramolecularly coordinated diaryltellurium(IV) oxide (8-Me2NC10H6)2TeO with acetonitrile proceeds with oxygen transfer and gives rise to the formation of the novel zwitterionic diaryltelluronium(IV) acetimidate (8-Me2NC10H6)2TeNC(O)CH3 (1) in 57% yield. Hydrolysis of 1 with hydrochloric acid affords acetamide and the previously known diarylhydroxytelluronium(IV) chloride [(8-Me2NC10H6)2Te(OH)]Cl. PMID:25026100

  9. Expressing the sense of the House of Representatives regarding the life and work of Elie Wiesel in promoting human rights, peace, and Holocaust remembrance.

    THOMAS, 113th Congress

    Rep. Israel, Steve [D-NY-3


    09/12/2016 On motion to suspend the rules and agree to the resolution, as amended Agreed to by voice vote. (text: CR H5259) (All Actions) Tracker: This bill has the status Passed HouseHere are the steps for Status of Legislation:

  10. "I Leave It with the People of the United States to Say": Autobiographical Disruption in the Personal Narratives of Black Hawk and Ely S. Parker

    ERIC Educational Resources Information Center

    Raheja, Michelle H.


    This essay demonstrates how American Indian autobiographical narratives work to construct a sense of American Indian subjectivity for competing communities--indigenous and white--by simultaneously promoting and protecting tribal knowledge. Both Black Hawk and Parker understood the power of print circulation in the dominant culture. One of the…

  11. Behavior of Ti-5Al-2.5Sn ELI titanium alloy sheet parent and weld metal in the presence of cracks at 20 K

    NASA Technical Reports Server (NTRS)

    Sullivan, T. L.


    Through- and surface-cracked specimens of two thicknesses were tested in uniaxial tension. Surface-cracked specimens were generally found to be stronger than through-cracked specimens with the same crack length. Apparent surface-crack fracture toughness calculated using the Anderson modified Irwin equation remained relatively constant for cracks as deep as 90 percent of the sheet thickness. Subcritical growth of surface cracks was investigated. Comparison of chamber and open air welds showed chamber welds to be slightly tougher. Both methods produced welds with toughness that compared favorably with that of the parent metal. Weld efficiencies were above 94 percent.

  12. 76 FR 16445 - In the Matter of Certain Gemcitabine and Products Containing Same; Notice of Investigation

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Eli Lilly and Company of Indianapolis, Indiana. Eli Lilly filed letters supplementing the complaint on February 9 and 16, 2011. The Commission requested additional information on March 2, 1011. Eli Lilly... complainant is: Eli Lilly and Company, Lilly Corporate Center, Indianapolis, IN 46285. (b) The respondents...

  13. 77 FR 46612 - New Animal Drugs; Change of Sponsor; Change of Sponsor Address; Azaperone; Miconazole, Polymyxin...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... applications (NADAs) from Janssen Pharmaceutica NV, to Elanco Animal Health, a Division of Eli Lilly & Co. FDA... Animal Health, a Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis, IN 46285....

  14. The Elicited Language Inventory and the Influence of Contextual Cues.

    ERIC Educational Resources Information Center

    Nelson, Lauren K.; Weber-Olsen, Marcia


    The Elicited Language Inventory (ELI) was administered in standardized fashion and in a modified procedure with contextually supported cues and grammatical morpheme use under the two ELI presentation conditions was compared with use of the same morphemes in spontaneous speech. Results favored modified use of the ELI with contextually cued items…


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  16. Peritoneal elastic lamina invasion: limitations in its use as a prognostic marker in stage II colorectal cancer.


    Grin, Andrea; Messenger, David E; Cook, Megan; O'Connor, Brenda I; Hafezi, Sara; El-Zimaity, Hala; Kirsch, Richard


    Peritoneal involvement in colorectal cancer (CRC) is an adverse prognostic feature, which may prompt consideration of adjuvant chemotherapy in stage II disease. Controversies and challenges surrounding its assessment have led to consideration of peritoneal elastic lamina invasion (ELI) as an alternative marker of advanced local spread. The objectives of this study were (1) to evaluate the prognostic significance of peritoneal ELI in stage II CRC and (2) to determine the feasibility of ELI assessment in routine practice with the use of an elastic stain. Two hundred seventeen patients with stage II CRC (186, pT3; 31, pT4) were assessed for ELI and other established adverse histologic features. Of the pT3 tumors, 31 (16.7%) were ELI positive, 121 (65%) were ELI negative, and 34 (18.3%) lacked an identifiable elastic lamina. There were no significant differences in disease-free survival between pT3 ELI-negative and ELI-positive tumors (P = .517). The disease-free survival of pT4 tumors was significantly lower than that of pT3 ELI-negative tumors (P = .024) and pT3 ELI-positive tumors (P = .026), respectively. The elastic lamina was detected less frequently in right-sided pT3 tumors compared with left-sided tumors (65/91 [71.4%] versus 87/95 [91.6%], P < .001). Right-sided tumors were also associated with a reduction in the staining intensity of the elastic lamina (P < .001). In conclusion, peritoneal ELI was not an adverse prognostic factor in this study. The frequent absence of an identifiable elastic lamina, particularly in right-sided tumors, may limit the use of ELI as a prognostic marker in CRC.

  17. Attributes and Characteristics of Exemplary, Leading, and Innovative Career and Technical Education Teacher Preparation Programs.

    ERIC Educational Resources Information Center

    Bruening, Thomas H.; Scanlon, Dennis C.; Hoover, Tracy S.; Hodes, Carol; Shao, Xiaorong; Dhital, Purandhar; Zolotov, Alexandre; Harmon, Hobart

    A study determined critical attributes of the nation's exemplary, leading, or innovative (ELI) career-technical education teacher preparation programs. National experts identified 13 critical attributes of an ELI teacher preparation program. Researchers conducted site visits to 5 institutions--University of Georgia, University of Minnesota, The…

  18. Establishing and Maintaining an Early Childhood Emergent Literacy Technology Curriculum

    ERIC Educational Resources Information Center

    Hutinger, Patricia L.; Bell, Carol; Daytner, Gary; Johanson, Joyce


    The three-year Early Childhood Emergent Literacy Technology Curriculum (ELiTeC) study (E2) was designed to replicate, on a broad scale, the results of earlier research in which a curriculum model was developed, implemented, and studied in preschool classrooms for children with disabilities or those at risk. ELiTeC was based on the assumptions that…

  19. Everyday Life Information Seeking: Approaching Information Seeking in the Context of "Way of Life."

    ERIC Educational Resources Information Center

    Savolainen, Reijo


    Discusses everyday life information seeking (ELIS) and compares the seeking of orienting information versus practical information. Offers a framework for studying ELIS and presents results of testing the framework via interviews with teachers and workers as seekers of information using electronic and printed media. (JMV)

  20. Extended Learning Institute. Policies and Procedures Manual.

    ERIC Educational Resources Information Center

    Adams, Larry

    This manual describes the Extended Learning Institute (ELI) at John Tyler Community College in Virginia. The ELI is a comprehensive program of instruction using alternative delivery systems (e.g., television, print-based, radio, and newspapers). General procedures and policies are delineated in section I, including registration and student and…


    EPA Science Inventory

    The SITE Program funded a field demonstration to evaluate the Eco Logic Gas-Phase Chemical Reduction Process developed by ELI Eco Logic International Inc. (ELI), Ontario, Canada. The Demonstration took place at the Middleground Landfill in Bay City, Michigan using landfill wa...


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  3. Knowledge-based reusable software synthesis system

    NASA Technical Reports Server (NTRS)

    Donaldson, Cammie


    The Eli system, a knowledge-based reusable software synthesis system, is being developed for NASA Langley under a Phase 2 SBIR contract. Named after Eli Whitney, the inventor of interchangeable parts, Eli assists engineers of large-scale software systems in reusing components while they are composing their software specifications or designs. Eli will identify reuse potential, search for components, select component variants, and synthesize components into the developer's specifications. The Eli project began as a Phase 1 SBIR to define a reusable software synthesis methodology that integrates reusabilityinto the top-down development process and to develop an approach for an expert system to promote and accomplish reuse. The objectives of the Eli Phase 2 work are to integrate advanced technologies to automate the development of reusable components within the context of large system developments, to integrate with user development methodologies without significant changes in method or learning of special languages, and to make reuse the easiest operation to perform. Eli will try to address a number of reuse problems including developing software with reusable components, managing reusable components, identifying reusable components, and transitioning reuse technology. Eli is both a library facility for classifying, storing, and retrieving reusable components and a design environment that emphasizes, encourages, and supports reuse.

  4. Syracuse University English Language Institute: Business Communication for Executives

    ERIC Educational Resources Information Center

    de Berly, Geraldine; McGraw, Deborah


    The Syracuse University English Language Institute (ELI), housed within University College, has been offering noncredit executive English courses on a contract basis for the past 12 years. Despite its small size and limited resources, the ELI, whose main mission is to prepare international students for academic study, also manages a successful…

  5. On failures in education and public policy

    NASA Astrophysics Data System (ADS)

    Ely, John T. A.


    Education of the public and the resulting policies in many matters are grossly inadequate. Included as a small list of four samples of failings in vital matters are: 1. Societal Cohesiveness: A profound change in the school system will yield great benefit for the nation ( 2. Lack of understanding regarding the coming avian flu pandemic ( 3. Severe Hg intoxication from dentistry due to profound multifaceted ignorance (Ely JTA, Mercury induced Alzheimer's disease: accelerating incidence? Bull Environ Contam Toxicol. 2001; 67(6),800-6). 4. The end of the world by global warming due to Christian religion forcing family planning money to be withheld from UN leading to population excess (

  6. [Comparison of tests for SS-A/Ro, Ro52 and Ro60 in predicting congenital heart block].


    Miyano, Akira; Nakayama, Masahiro; Waguri, Masako; Nakanishi, Isao


    Neonatal lupus erythematosus (NLE) is a rare syndrome caused by the transplacental passage of maternal autoantibodies. Anti SS-A antibodies of a mother with Sjögren syndrome are associated with congenital heart block (CHB) in the newborns with NLE. The purpose of this study was to investigate the utility of maternal antibody titers for SS-A, Ro52 and Ro60 in mothers of newborns with CHB. The study involved a total of 304 cases, 25 from mothers of newborns with CHB, 104 from mothers of newborns without and 175 from mothers suspected to have connective tissue diseases. All sera were tested with the EliA SS-A, EliA Ro52, EliA Ro60, MESACUP Ro52 and MESACUP Ro60. The concordance rate of Ro52 assays was 93.4%, whereas Ro60 assays showed a lower concordance rate (74.7%). The areas under the curve (AUC) of the EliA assays were higher than those of the MESACUP assays. The optimal cut-off values for EliA SS-A/Ro and EliA Ro60 as derived from the ROC analysis were 2027 U/mL and 2446 U/mL, respectively. The sensitivity and specificity for EliA SS-A using optimal cut-off values were 96.0% and 92.3%, respectively. A titer of 90% positive predictive value for EliA SS-A was reached at a cut-off of 9897.1 U/mL, corresponding to sensitivity and specificity values of 36.0% and 100%, respectively. In conclusion, the optimal cut-off value for EliA SS-A is likely to be useful for application in clinical practice for the EliA SS-A measurements in mothers to evaluate the risk of NLE for their newborns.

  7. 75 FR 11549 - Determination That PRO-BANTHINE (Propantheline Bromide) Tablets and 14 Other Drug Products Were...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ..., 2009 (74 FR 6896).) Application No. Drug Applicant NDA 8-732 PRO-BANTHINE Shire Pharmaceuticals... NDA 20-101 PROZAC (fluoxetine HCl) Eli Lilly and Co., Oral Solution, EQ 20 Lilly Corporate mg base/5...

  8. 76 FR 55110 - In the Matter of Certain Gemcitabine and Products Containing Same; Notice of Commission...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...: The Commission instituted this investigation on March 23, 2011, based on a complaint filed by Eli Lilly and Company (``Lilly''). 76 FR 16445. The complaint alleges violations of section 337 of...


    EPA Science Inventory

    Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are considered highly toxic contaminants with the environmental monitoring of these compounds being of great importance. Immunoassay procedures such as the enzyme-linked immunosorbent assay (ELIS...


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  11. 40 CFR 80.215 - What is the scope of the geographic phase-in program?

    Code of Federal Regulations, 2010 CFR


    ... are included in the GPA: (i) The list of counties follows: Arizona Apache Coconino Gila Greenlee... Indian reservations follows: Burns Paiute, Cheyenne River, Colville, Duck Valley, Ely Colony, Fort...

  12. 13. Historic American Buildings Survey (Fed.) Stanley P. Mixon, Photographer ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    13. Historic American Buildings Survey (Fed.) Stanley P. Mixon, Photographer May 16, 1940 (K) INT. DETAIL OF PART OF FEATHER EDGE PANELING AND DOOR (NORTHEAST ROOM, FIRST FLOOR) - Eli Adams House, Oakham, Worcester County, MA

  13. New Treatment Approved for Soft-Tissue Cancers


    ... pain. Lartruvo's maker, Indianapolis-based Eli Lilly and Company, is conducting a larger study to further evaluate the drug's effectiveness among numerous types of soft-tissue sarcoma, the agency said. HealthDay ...


    EPA Science Inventory

    With advanced technologies, it is now possible to measure very low levels of many chemicals in biological fluids. However, the appropriate use and interpretation of biomarkers will depend upon many factors associated with the exposure, adsorption, deposition, metabolism, and eli...

  15. What Is Geometry?

    ERIC Educational Resources Information Center

    Chern, Shiing-Shen


    Discussed are the major historical developments of geometry. Euclid, Descartes, Klein's Erlanger Program, Gaus and Riemann, globalization, topology, Elie Cartan, and an application to molecular biology are included as topics. (KR)

  16. 78 FR 54674 - Notice of Intent To Prepare an Environmental Impact Statement for the Proposed Gold Rock Mine...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...:// , and the BLM's ePlanning NEPA Register at https://www... housing availability. (e) Potential effects to archaeological resources in the area, which could...

  17. Deep Space Atomic Clock Ticks Toward Success

    NASA Video Gallery

    Dr. Todd Ely, principal investigator for NASA's Deep Space Atomic Clock at the Jet Propulsion Laboratory in Pasadena, Calif., spotlights the paradigm-busting innovations now in development to revol...

  18. ELF communications system ecological monitoring program: Pollinating insect studies

    NASA Astrophysics Data System (ADS)

    Strickler, Karen; Schriber, J. Mark


    High voltage transmission lines and the earth's and other magnetic fields have been shown to affect honeybee reproduction, survival, orientation, and nest structure. ELY EM fields could have similar effects on native megachilid bees. Two species in the genus Megachile were abundant in artificial nests at experimental and control areas in Dickinson and Iron Counties in Michigan. Data on their nest architecture, nest activity, and emergence/mortality were collected between 1983 and 1993. Eight hypotheses concerning the possible effects of ELY EM fields were considered using these data. The ELY antenna has been fully operational since the summer of 1989. Tests of the hypotheses compare control vs. experimental areas before and after the ELY antenna became fully operational.

  19. 19. The 1860 armory building, c.1930 Photocopied from a film ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    19. The 1860 armory building, c.1930 Photocopied from a film negative, NHCHSL. A view from the southwest. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  20. 20. Mill River and rear of the 1860 armory building, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    20. Mill River and rear of the 1860 armory building, c. 1930. Photocopied from a print of a film negative, NHCHSL. View from the south. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  1. 21. General view from the southwest, c.1862 Photocopied from an ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    21. General view from the southwest, c.1862 Photocopied from an advertisement, 'Whitney's Improved Fire-Arms,' Dana Scrapbook v. 61, p. 68, NHCHSL. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  2. 24. Site plan, 1924 Photocopied from Sanborn Map Company, Insurance ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    24. Site plan, 1924 Photocopied from Sanborn Map Company, Insurance Maps of New Haven, v. 5, map no. 540, 1924 - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  3. 23. Site plan, 1931 Photocopied from Sanborn Map Company, Insurance ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    23. Site plan, 1931 Photocopied from Sanborn Map Company, Insurance Maps of New Haven, v. 5, map no. 540, 1924 updated to 1931. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  4. Analysis of state Superfund programs: 50 state study. 1998 update

    SciTech Connect


    States have remediated over 40,000 contaminated sites not on the federal Superfund list. ELI`s latest analysis of state Superfund programs examines the cleanup programs of all 50 states, Puerto Rico, and the District of Columbia. The study provides the most current data on state statutes, program organization, staffing, funding, expenditures, cleanup standards, and cleanup activities, voluntary cleanup programs and brownfields programs. State and federal policymakers and attorneys working on non-NPL sites should find this study useful.

  5. Development of an Anti-Elicitin Antibody-Based Immunohistochemical Assay for Diagnosis of Pythiosis.


    Inkomlue, Ruchuros; Larbcharoensub, Noppadol; Karnsombut, Patcharee; Lerksuthirat, Tassanee; Aroonroch, Rangsima; Lohnoo, Tassanee; Yingyong, Wanta; Santanirand, Pitak; Sansopha, Lalana; Krajaejun, Theerapong


    Pythiosis is an emerging and life-threatening infectious disease of humans and animals living in tropical and subtropical countries and is caused by the fungus-like organism Pythium insidiosum. Antifungals are ineffective against this pathogen. Most patients undergo surgical removal of the infected organ, and many die from advanced infections. Early and accurate diagnosis leads to prompt management and promotes better prognosis for affected patients. Immunohistochemical assays (IHCs) have been developed using rabbit antibodies raised against P. insidiosum crude extract, i.e., culture filtrate antigen (CFA), for the histodiagnosis of pythiosis, but cross-reactivity with pathogenic fungi compromises the diagnostic performance of the IHC. Therefore, there is a need to improve detection specificity. Recently, the elicitin protein, ELI025, was identified in P. insidiosum, but it was not identified in other human pathogens, including true fungi. The ELI025-encoding gene was successfully cloned and expressed as a recombinant protein in Escherichia coli. This study aims to develop a new IHC using the rabbit anti-ELI025 antibody (anti-ELI) and to compare its performance with the previously reported anti-CFA-based IHC. Thirty-eight P. insidiosum histological sections stained positive by anti-ELI-based and anti-CFA-based IHCs indicating 100% detection sensitivity for the two assays. The anti-ELI antibody stained negative for all 49 negative-control sections indicating 100% detection specificity. In contrast, the anti-CFA antibody stained positive for one of the 49 negative controls (a slide prepared from Fusarium-infected tissue) indicating 98% detection specificity. In conclusion, the anti-ELI based IHC is sensitive and specific for the histodiagnosis of pythiosis and is an improvement over the anti-CFA-based assay. PMID:26719582

  6. Development of an Anti-Elicitin Antibody-Based Immunohistochemical Assay for Diagnosis of Pythiosis

    PubMed Central

    Inkomlue, Ruchuros; Larbcharoensub, Noppadol; Karnsombut, Patcharee; Lerksuthirat, Tassanee; Aroonroch, Rangsima; Lohnoo, Tassanee; Yingyong, Wanta; Santanirand, Pitak; Sansopha, Lalana


    Pythiosis is an emerging and life-threatening infectious disease of humans and animals living in tropical and subtropical countries and is caused by the fungus-like organism Pythium insidiosum. Antifungals are ineffective against this pathogen. Most patients undergo surgical removal of the infected organ, and many die from advanced infections. Early and accurate diagnosis leads to prompt management and promotes better prognosis for affected patients. Immunohistochemical assays (IHCs) have been developed using rabbit antibodies raised against P. insidiosum crude extract, i.e., culture filtrate antigen (CFA), for the histodiagnosis of pythiosis, but cross-reactivity with pathogenic fungi compromises the diagnostic performance of the IHC. Therefore, there is a need to improve detection specificity. Recently, the elicitin protein, ELI025, was identified in P. insidiosum, but it was not identified in other human pathogens, including true fungi. The ELI025-encoding gene was successfully cloned and expressed as a recombinant protein in Escherichia coli. This study aims to develop a new IHC using the rabbit anti-ELI025 antibody (anti-ELI) and to compare its performance with the previously reported anti-CFA-based IHC. Thirty-eight P. insidiosum histological sections stained positive by anti-ELI-based and anti-CFA-based IHCs indicating 100% detection sensitivity for the two assays. The anti-ELI antibody stained negative for all 49 negative-control sections indicating 100% detection specificity. In contrast, the anti-CFA antibody stained positive for one of the 49 negative controls (a slide prepared from Fusarium-infected tissue) indicating 98% detection specificity. In conclusion, the anti-ELI based IHC is sensitive and specific for the histodiagnosis of pythiosis and is an improvement over the anti-CFA-based assay. PMID:26719582

  7. Science of Extreme Light Infrastructure

    NASA Astrophysics Data System (ADS)

    Tajima, Toshiki; Barish, Barry C.; Barty, C. P.; Bulanov, Sergei; Chen, Pisin; Feldhaus, Josef; Hajdu, Janos; Keitel, Christoph H.; Kieffer, Jean-Claude; Ko, Do-Kyeong; Leemans, Wim; Normand, Didier; Palumbo, Luigi; Rzazewski, Kazimierz; Sergeev, Alexander; Sheng, Zheng-Ming; Takasaki, Fumihiko; Teshima, Masahiro


    The infrastructure of Extreme Light Infrastructure (ELI) provides an unprecedented opportunity for a broad range of frontier science. Its highest ever intensity of lasers, as well as high fluence, high power, and/or ultrafast optical characteristics carve out new territories of discovery, ranging from attosecond science to photonuclear science, laser acceleration and associated beams, and high field science (Four Pillars of ELI). Its applications span from medicine, biology, engineering, energy, chemistry, physics, and fundamental understanding of the Universe. The relativistic optics that intense lasers have begun exploring may be extended into a new regime of ultra-relativistic regime, where even protons fly relativistically in the optical fields. ELI provides the highest intensity to date such that photon fields begin to feel even the texture of vacuum. This is a singular appeal of ELI with its relatively modest infrastructure (compared to the contemporary largest scientific infrastructures), yet provides an exceptional avenue along which the 21st Century science and society need to answer the toughest questions. The intensity frontier simultaneously brings in the energy horizon (TeV and PeV) as well as temporal frontier (attoseconds and zeptoseconds). It also turns over optics of atoms and molecules into that of nuclei with the ability to produce monoenergetic collimated γ-ray photons. As such, the ELI concept acutely demands an effort to encompass and integrate its Four Pillars.

  8. Transport and dosimetric solutions for the ELIMED laser-driven beam line

    NASA Astrophysics Data System (ADS)

    Cirrone, G. A. P.; Romano, F.; Scuderi, V.; Amato, A.; Candiano, G.; Cuttone, G.; Giove, D.; Korn, G.; Krasa, J.; Leanza, R.; Manna, R.; Maggiore, M.; Marchese, V.; Margarone, D.; Milluzzo, G.; Petringa, G.; Sabini, M. G.; Schillaci, F.; Tramontana, A.; Valastro, L.; Velyhan, A.


    Within 2017, the ELIMED (ELI-Beamlines MEDical applications) transport beam-line and dosimetric systems for laser-generated beams will be installed at the ELI-Beamlines facility in Prague (CZ), inside the ELIMAIA (ELI Multidisciplinary Applications of laser-Ion Acceleration) interaction room. The beam-line will be composed of two sections: one in vacuum, devoted to the collecting, focusing and energy selection of the primary beam and the second in air, where the ELIMED beam-line dosimetric devices will be located. This paper briefly describes the transport solutions that will be adopted together with the main dosimetric approaches. In particular, the description of an innovative Faraday Cup detector with its preliminary experimental tests will be reported.

  9. Watershed Restoration Project

    SciTech Connect

    Julie Thompson; Betsy Macfarlan


    In 2003, the U.S. Department of Energy issued the Eastern Nevada Landscape Coalition (ENLC) funding to implement ecological restoration in Gleason Creek and Smith Valley Watersheds. This project was made possible by congressionally directed funding that was provided through the US Department of Energy, Energy Efficiency and Renewable Energy, Office of the Biomass Program. The Ely District Bureau of Land Management (Ely BLM) manages these watersheds and considers them priority areas within the Ely BLM district. These three entities collaborated to address the issues and concerns of Gleason Creek and Smith Valley and prepared a restoration plan to improve the watersheds’ ecological health and resiliency. The restoration process began with watershed-scale vegetation assessments and state and transition models to focus on restoration sites. Design and implementation of restoration treatments ensued and were completed in January 2007. This report describes the restoration process ENLC undertook from planning to implementation of two watersheds in semi-arid Eastern Nevada.

  10. Rb-Sr ages of the Archean rocks from the Vermilion district, northeastern Minnesota

    NASA Technical Reports Server (NTRS)

    Jahn, B.-M.; Murthy, V. R.


    The Vermilion district in Northeastern Minnesota is a classic example of a lower Precambrian greenstone-granite terrane in the Superior Province of the Canadian Shield. The present study presents new Rb-Sr isotopic data for the Ely Greenstone, the Newton Lake Formation, granitic pebbles that occur within the Ely Greenstone, a graywacke composite of the Knife Lake Group, and some Algoman granites whose data are complementary to those of Peterman et al. (1972). The isochron ages obtained are statistically indistinguishable and therefore cannot be used to resolve the timing of specific geologic events. Volcanic extrusion, granitic intrusion, and metamorphism are shown to be less contemporaneous events which probably took place within a time span of less than 50 m.y. A major conclusion is that a granitic basement probably did not underlie the Ely Greenstone.

  11. Reuse research plans at Langley Research Center

    NASA Technical Reports Server (NTRS)

    Voigt, Susan J.; Walker, Carrie


    The reuse activities at Langley have centered on the development of the Eli System by SPS. The development of a computer systems design environment at Langley was described as a target application for the future Eli system. This environment combines software development tools with an architecture design and analysis tool. Specifically, a Computer-Aided Software Engineering (CASE) system, under development at Charles Stark Draper Laboratory for Langley, is being used to generate Ada code for use in architecture functional simulations using the Architecture Design and Assessment System (ADAS). The Eli system will be included in this tool set and will be used to organize and promote reuse of the functional simulation code modules.


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  13. Nucleosomal regulation of chromatin composition and nuclear assembly revealed by histone depletion

    PubMed Central

    Zierhut, Christian; Jenness, Christopher; Kimura, Hiroshi; Funabiki, Hironori


    Nucleosomes are the fundamental unit of chromatin, but the analysis of transcription-independent nucleosome functions has been thwarted by the confounding gene expression changes resultant of histone manipulation. Here we solve this dilemma by developing Xenopus laevis egg extracts deficient for nucleosome formation, and analyze the proteomic landscape and behavior of nucleosomal chromatin and nucleosome-free DNA. We show that while nucleosome-free DNA can recruit nuclear envelope membranes, nucleosomes are required for spindle assembly, lamina and nuclear pore complex (NPC) formation. In addition to RCC1, we reveal that ELYS, the initiator of NPC formation, fails to associate with naked DNA, but directly binds histones H2A–H2B and nucleosomes. Tethering ELYS and RCC1 to DNA bypassed the requirement for nucleosomes in NPC formation in a synergistic manner. Thus, the minimal essential function of nucleosomes in NPC formation is to recruit RCC1 and ELYS. PMID:24952593

  14. [Efficiency of a combination of haloaerosols and helium-neon laser in the multimodality treatment of patients with bronchial asthma].


    Faradzheva, N A


    A hundred and thirty-eight patients with infection-dependent bronchial asthma, including 73 with moderate persistent asthma and 65 with severe persistent one, were examined. Four modes of a combination of traditional (drug) therapy (DT) and untraditional (halotherapy (HT) and endobronchial helium-neon laser irradiation (ELI) one were used. The efficiency of the treatment performed was evaluated, by determining the time course of clinical symptoms of the disease on the basis of scores of their magnitude and the patients' condition. The findings indicated that in moderate persistent asthma, both HT and ELI in combination with DT exerted an equal therapeutic effect, which provided a good and excellent condition in 83.3% of cases. In severe persistent asthma, such a condition was achieved in 93.75% of cases only when multimodality treatment involving DT, HT, and ELI had been performed. PMID:17915468

  15. Estimates for production of radioisotopes of medical interest at Extreme Light Infrastructure - Nuclear Physics facility

    NASA Astrophysics Data System (ADS)

    Luo, Wen; Bobeica, Mariana; Gheorghe, Ioana; Filipescu, Dan M.; Niculae, Dana; Balabanski, Dimiter L.


    We report Monte Carlo simulations of the production of radioisotopes of medical interest through photoneutron reactions using the high-brilliance γ-beam of the Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility. The specific activity for three benchmark radioisotopes, 99Mo/99Tc, 225Ra/225Ac and 186Re, was obtained as a function of target geometry, irradiation time and γ-beam energy. Optimized conditions for the generation of these radioisotopes of medical interest with the ELI-NP γ-beams were discussed. We estimated that a saturation specific activity of the order of 1-2 mCi/g can be achieved for thin targets with about one gram of mass considering a γ-beam flux of 10^{11} photons/s. Based on these results, we suggest that the ELI-NP facility can provide a unique possibility for the production of radioisotopes in sufficient quantities for nuclear medicine research.

  16. Comparative analysis of the effects of internal lasing oscillation and external light injection on semiconductor optical amplifier performance

    NASA Astrophysics Data System (ADS)

    Park, Jongwoon; Kawakami, Yoichi; Li, Xun; Huang, Wei-Ping


    One of the key differences of a semiconductor optical amplifier (SOA) with internal lasing oscillation (ILO) from a SOA with external light injection (ELI) lies in a carrier-sharing mechanism. Since the internal lasing mode shares the same pool of carriers with the signals, the carriers (or photons) withdrawn from the circulating laser mode speed up the gain recovery. On the other hand, the external light injected into the SOA shortens the carrier recovery time through optical pumping without any carrier sharing involved. To find out a better scheme, we have made a comparative investigation on the effects of the ILO and ELI on the SOA performance. It turns out by way of simulation that the ELI scheme provides faster gain recovery, shorter carrier lifetime, and higher saturation power when the external injection power is higher than the internal lasing power. The performance enhancement is not so pronounced with the carrier-sharing mechanism, as the internal lasing mode itself gives rise to severe longitudinal spatial hole burning (LSHB). Nevertheless, the ILO scheme is preferable for linear-amplification applications. We also examine the use of the ELI for low-crosstalk optical amplifiers. It is found that the ELI scheme does not bring in a very strong resonance peak in the crosstalk, which appears in a SOA with ILO due to relaxation oscillations of the lasing mode. In comparison to the ILO in SOAs, the ELI into SOAs is likely to leave more optical gain for multi-channel amplification without any sacrifice on the crosstalk.

  17. Catalysis of Schwinger vacuum pair production

    SciTech Connect

    Dunne, Gerald V.; Gies, Holger; Schuetzhold, Ralf


    We propose a new catalysis mechanism for nonperturbative vacuum electron-positron pair production, by superimposing a plane-wave x-ray probe beam with a strongly focused optical laser pulse, such as is planned at the Extreme Light Infrastructure (ELI) facility. We compute the absorption coefficient arising from vacuum polarization effects for photons below threshold in a strong electric field. This setup should facilitate the (first) observation of this nonperturbative QED effect with planned light sources such as ELI yielding an envisioned intensity of order 10{sup 26} W/cm{sup 2}.

  18. Reactivity Differences between [alpha, beta]-Unsaturated Carbonyls and Hydrazones Investigated by Experimental and Theoretical Electron Density and Electron Localizability Analyses

    SciTech Connect

    Grabowsky, Simon; Weber, Manuela; Jayatilaka, Dylan; Chen, Yu-Sheng; Grabowski, Matthias T.; Brehme, Rainer; Hesse, Malte; Schirmeister, Tanja; Luger, Peter


    It is still a challenge to predict a compound's reactivity from its ground-state electronic nature although Bader-type topological analyses of the electron density (ED) and electron localizability indicator (ELI) give detailed and useful information on electron concentration and electron-pair localization, respectively. Both ED and ELI can be obtained from theoretical calculations as well as high-resolution X-ray diffraction experiments. Besides ED and ELI descriptors, the delocalization index is used here; it is likewise derived from theoretical calculations as well as from experimental X-ray results, but in the latter case, demonstrated here for the first time. We investigate {alpha},{beta}-unsaturated carbonyl and hydrazone compounds because resonance exhibited by these compounds in the electronic ground-state determines their reactive behavior. The degree of resonance as well as the reactivity contrast are quantified with the electronic descriptors. Moreover, competitive mesomeric substituent effects are studied using the two biologically important compounds acrolein and acrylamide. The reactivity differences predicted from the analyses are in line with the known reactivity of these compounds in organic synthesis. Hence, the capability of the ED and ELI for rationalizing and predicting different and competing substituent effects with respect to reactivity is demonstrated.

  19. Diagnostic Trends in Autistic Spectrum Disorders in the South Wales Valleys

    ERIC Educational Resources Information Center

    Latif, A. H. A.; Williams, W. R.


    This study provides an analysis of the diagnostic trends in autistic spectrum disorder (ASD) for children aged under 17 years in the Rhondda and Taff Ely districts of South Wales. In the period 1988-2004, 336 children received a diagnosis of ASD and represent the case registry data of one community pediatric team. For the period 1994-2003, the…

  20. Comparison of Ergot Alkaloid Biosynthesis Gene Clusters in Claviceps Species Indicates Loss of Late Pathway Steps in Evolution of C. fusiformis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The grass parasites Claviceps purpurea and Claviceps fusiformis produce ergot alkaloids (EA) in planta and in submerged culture. Whereas EA synthesis (EAS) in C. purpurea proceeds via clavine intermediates to lysergic acid and the complex ergopeptines, C. fusiformis produces only agroclavine and ely...

  1. Better Leaders for America's Schools: A Manifesto. With Profiles of Education Leaders and a Summary of State Certification Practices.

    ERIC Educational Resources Information Center

    Meyer, Lawrence; Feistritzer, Emily

    This volume was created around the premise that America's schools face a crisis in leadership. For America to have the great schools it needs, schools and their school systems must have great leaders. After a foreword by Chester E. Finn, Jr. and an introduction by Eli Broad, the book is divided into three parts. The first part presents a manifesto…

  2. Planning Full Employment

    ERIC Educational Resources Information Center

    Ginzberg, Eli


    An interview by Irving Louis Horowitz conducted at Princeton University, Horowitz seminar on Social Science and Public Policy, February 11, 1976. Eli Ginzberg is a Barton Hepburn Professor of Economics at Columbia University and director of the Conservation of Human Resources Project, Chairman of the National Commission for Manpower Policy. (JM)

  3. Disseminating and Replicating an Effective Emerging Literacy Technology Curriculum: A Final Report

    ERIC Educational Resources Information Center

    Hutinger, Patricia; Bell, Carol; Daytner, Gary; Johanson, Joyce


    Emerging Literacy Technology Curriculum (ELiTeC 2, [referred to as E2 in this report]), housed at the Center for Best Practices in Early Childhood at Western Illinois University, was funded in 2000 by the U.S. Department of Education's Office of Special Education Programs (OSEP) as a 3-year Phase 3 Steppingstones of Technology Research on…

  4. Delivering an A.S. Engineering Degree Program through Home Study Distance Education.

    ERIC Educational Resources Information Center

    Sener, John

    Northern Virginia Community College (NVCC) and the Extended Learning Institute (ELI) undertook a project to develop the mathematics, science, and engineering courses required to complete an entire Associate of Science degree in Engineering through home study distance education. The project's ultimate goal was to create asynchronous learning…

  5. The Broad Way

    ERIC Educational Resources Information Center

    Butler, Kevin


    In the world of corporate philanthropy, there are those who give to educational causes, and this article describes one such philanthropist, Eli Broad, who shares his take on schools in America. Broad is in a category unto himself not only because of the amount of money he has given--more than $280 million since 1999--but also for his unique…

  6. Online Information Retrieval for Economists: The Economic Literature Index.

    ERIC Educational Resources Information Center

    Ekwurzel, Drucilla; Saffran, Bernard


    The basics of online searching for bibliographic citations are presented through use of the "Economic Literature Index" (ELI), which is available as File 139 on Dialog Information Services. This article focuses on the choice of media for bibliographic searches, search strategies, and the selection of alternative databases, such as "Social…

  7. Impact: The Magazine for Innovation and Change in Counseling. Fall 1971.

    ERIC Educational Resources Information Center

    Walz, Garry, Ed.; And Others

    The first issue of this new quarterly magazine presents, as its central feature, an interview with Eli Ginzberg on career guidance, coupled with a section of reactions to this interview. Other sections elaborate on the "career guidance" theme, and present adoptable practices as well as an instrument for rating a career guidance program. Included…

  8. Innovations in Corporate Career Centers--Special Issue.

    ERIC Educational Resources Information Center

    Patch, Ken, Ed.


    Nine articles describe corporate career centers at Advanced Macro Devices, Sun Microsystems, Tellabs, DaimlerChrysler, Eli Lilly, Toronto Dominion Bank, Motorola, Honeywell, and Dow Corning. Other articles give an historical overview and address virtual career centers, talent management, and future directions. (SK)

  9. Promoting Early Literacy Skills within Daily Activities and Routines in Preschool Classrooms

    ERIC Educational Resources Information Center

    Chandler, Lynette K.; Young, Robin Miller; Nylander, Donna; Shields, LuAnn; Ash, JoAnne; Bauman, Becky; Butts, Jill; Black, Kristine; Geraghty, Peggy; Hafer, Megan; Lay, Angie; Mitera, Brandie; Richardson, Debra; Steffen, Kara; Summers, Debra


    Many teachers and other service providers struggle with trying to address the many skills that are important for young children to acquire during the preschool years. Early Literacy Initiative project (Project ELI) is a comprehensive, two-tiered, early language and literacy intervention model that includes activities for all children as well as…

  10. Boot Camp for Education CEOs: The Broad Foundation Superintendents Academy

    ERIC Educational Resources Information Center

    Jehlen, Alain


    The Broad Foundation Superintendents Academy is the most prominent and most controversial training institute for school chiefs. The Academy is the flagship program of the Eli and Edythe Broad Foundation, the smallest of a triumvirate of corporate foundations that are at the heart of the billionaire campaign to remake public education in the image…

  11. Seizure Risk in Patients with Attention-Deficit-Hyperactivity Disorder Treated with Atomoxetine

    ERIC Educational Resources Information Center

    Wernicke, Joachim F.; Holdridge, Karen Chilcott; Jin, Ling; Edison, Timothy; Zhang, Shuyu; Bangs, Mark E.; Allen, Albert J.; Ball, Susan; Dunn, David


    The comorbidity of seizures, epilepsy, and attention-deficit-hyperactivity disorder (ADHD) prompted the examination of whether atomoxetine use for ADHD is associated with an increased risk of seizures. Seizures and seizure-related symptoms were reviewed from two independent Eli Lilly and Company databases: the atomoxetine clinical trials database…


    EPA Science Inventory

    ELI ECO Logic International, Inc.'s Thermal Desorption Unit (TDU) is specifically designed for use with Eco Logic's Gas Phase Chemical Reduction Process. The technology uses an externally heated bath of molten tin in a hydrogen atmosphere to desorb hazardous organic compounds fro...

  13. Grow Your Own School Leaders: A Case Study of Principal Development in Philadelphia Schools

    ERIC Educational Resources Information Center

    Urban Education Collaborative, 2010


    In 2004-05, the School District of Philadelphia (SDP) began a groundbreaking partnership with the Eli Broad Foundation to develop the Academy for Leadership in Philadelphia Schools (ALPS), one of several Broad-funded, alternative principal development programs initiated across the country. The ALPS effort was designed to respond to two challenges:…

  14. Comparison of Grade Distributions for Telecourses and Print Based Courses.

    ERIC Educational Resources Information Center

    Adams, Larry

    John Tyler Community College (JTCC) in Virginia founded the Extended Learning Institute (ELI) in 1982 as a program to develop and administer instruction via alternative delivery systems. Print-based, independent study courses have been the primary alternative system used, though telecourses were offered from fall 1983 through winter 1985 and again…


    EPA Science Inventory

    This technology capsule summarizes the findings of an evaluation of the Unterdruck-Verdampfer-Brunnen (UVB) technology developed by IEG Technologies (IEG) and licensed in the eastern United States by Environmental Laboratories, Inc. (ELI) and SBP Technologies, Inc. (SBP). This e...

  16. The Academic and the Everyday: Investigating the Overlap in Mature Undergraduates' Information-Seeking Behaviors.

    ERIC Educational Resources Information Center

    Given, Lisa M.


    This study explored information-seeking behavior of mature undergraduates at a Canadian university based on the study of everyday life information seeking (ELIS). Findings include the role of social and cultural capital, ways that everyday and academic contexts inform one another, and the importance of not separating the everyday from other life…

  17. Disadvantaged Children and Their First School Experiences. ETS-Head Start Longitudinal Study: Preschool Teacher's Beliefs on Effective Teaching Techniques and Their Relationships to Pupil Characteristics.

    ERIC Educational Resources Information Center

    Emmerich, Walter

    The pattern of responses to the Enhancement of Learning Inventory (ELI), designed to assess a teacher's belief about the effectiveness of methods for teaching each pupil, is expected to: (1) reliably describe characteristics on which teachers differ; (2) relate to individual differences in pupil background and behavioral characteristics; and (3)…

  18. The NMC Horizon Report: 2015 Higher Education Edition

    ERIC Educational Resources Information Center

    Johnson, L.; Adams Becker, S.; Estrada, V.; Freeman, A.


    The "NMC Horizon Report: 2015 Higher Education Edition" is a collaborative effort between the New Media Consortium (NMC) and the EDUCAUSE Learning Initiative (ELI). This 12th edition describes annual findings from the NMC Horizon Project, an ongoing research project designed to identify and describe emerging technologies likely to have…

  19. The Comparative Effects of Constructivist versus Traditional Teaching Methods on the Environmental Literacy of Postsecondary Nonscience Majors

    ERIC Educational Resources Information Center

    Wright, J. Michael


    Using a pretest-posttest quasi-experimental control group design, a learning environment study was conducted to evaluate the environmental literacy of postsecondary, nonscience majors. Data were collected from 183 students taking an introductory environmental science class--a 41-question Environmental Literacy Instrument (ELI) prompted students…

  20. Broad Academy's Growing Reach Draws Scrutiny

    ERIC Educational Resources Information Center

    Samuels, Christina A.


    Billionaire businessman Eli Broad, one of the country's most active philanthropists, founded the "Broad Superintendents Academy" in 2002 with an extraordinarily optimistic goal: Find leaders from both inside and outside education, train them, and have them occupying the superintendencies in a third of the 75 largest school districts--all in just…

  1. Broad Academy's Growing Reach Draws Scrutiny

    ERIC Educational Resources Information Center

    Samuels, Christina A.


    Billionaire businessman Eli Broad, one of the country's most active philanthropists, founded the Broad Superintendents Academy in 2002 with an extraordinarily optimistic goal: Find leaders from both inside and outside education, train them, and have them occupying the superintendencies in a third of the 75 largest school districts--in just two…

  2. Accommodating Diverse Language Needs within an Intensive English Language Program: A Study of the English Language Institute at Alaska Pacific University.

    ERIC Educational Resources Information Center

    Nichols, Patricia Diane Palmer

    The English Language Institute (ELI) at Alaska Pacific University provides an intensive academic program designed primarily to prepare foreign students for successful participation in undergraduate or graduate programs. Students from the local international community have also been admitted to the program. These students have motivations, language…

  3. Challenging the Status Quo

    ERIC Educational Resources Information Center

    Maxwell, Lesli A.


    Steeped in a distinctive view of leadership, graduates of the Broad Superintendents Academy have landed some of public education's top jobs. In this article, the author features the Broad Superintendents Academy, a program established by Eli Broad's Foundation which spends roughly $45,000 to train each of the business executives, military…

  4. The Seeds to Success Modified Field Test: Findings from the Impact and Implementation Studies

    ERIC Educational Resources Information Center

    Boller, Kimberly; Del Grosso, Patricia; Blair, Randall; Jolly, Yumiko; Fortson, Ken; Paulsell, Diane; Lundquist, Eric; Hallgren, Kristin; Kovac, Martha


    In 2006, the Bill & Melinda Gates Foundation launched the Early Learning Initiative (ELI) to improve the school readiness of Washington State's children through three main strategies: (1) development of high-quality, community-wide early learning initiatives in two communities; (2) enhancement of statewide systems that support early learning;…

  5. Investigating the News Seeking Behavior of Young Adults

    ERIC Educational Resources Information Center

    Qayyum, M. Asim; Williamson, Kirsty; Liu, Ying-Hsang; Hider, Philip


    This study investigated the news-seeking and browsing behaviours of young adults, partly in the context of everyday life information seeking (ELIS), in order to explore their perceptions of and attitudes towards print and online news media. The study is significant because traditional print newspapers face a steady decline in their readership with…

  6. Issues and Developments in English and Applied Linguistics (IDEAL), 1994.

    ERIC Educational Resources Information Center

    Dickerson, Wayne B., Ed.; Kachru, Yamuna, Ed.


    Seven papers on topics of English-as-a-Second-Language (ESL) instruction, language research, and applied linguistics are presented: "ESL Students and Common L2 Conversation-Making Expressions" (Eli Hinkel); "Thematic Options in Reporting Previous Research" (Sarah Thomas, Thomas Hawes); "Connected Speech Modifications in the English of Japanese ESL…

  7. Ethical Leadership: What Does It Look like?

    ERIC Educational Resources Information Center

    Schulte, Laura


    This article focuses on the development and validation of the Ethical Leadership Index (ELI). The development and validation processes included: adopting a framework; developing items; providing evidence of content validity; conducting a pilot study; and analyzing data to provide evidence of construct validity and reliability estimates. Five…

  8. Short-Term Memory (STM) Constraints in Children with Specific Language Impairment (SLI): Are There Differences between Receptive and Expressive SLI?

    ERIC Educational Resources Information Center

    Nickisch, Andreas; von Kries, Rudiger


    Purpose: Specific language impairment (SLI) is assumed to be causally related to deficits in auditory short-term memory (STM). Although verbal STM deficits have been consistently found in SLI, the results of visual STM tests are inconsistent. Do these inconsistencies reflect different study populations of expressive SLI (ELI) and…

  9. Analyzing English Noun Groups for Their Conceptual Content.

    ERIC Educational Resources Information Center

    Gershman, Anatole V.

    An expectation based system, NGP, for parsing English noun groups into the Conceptual Dependency representation is described. The system is a part of English Language Interpreter (ELI) which is used as the front end to several natural language understanding systems and is capable of handling a wide range of sentences of considerable complexity.…

  10. Exploring the Everyday Life Information Needs, Practices, and Challenges of Emerging Adults with Intellectual Disabilities

    ERIC Educational Resources Information Center

    Hanson-Baldauf, Dana


    This dissertation research addresses a gap in the library and information science literature on everyday life information (ELI) needs and experiences of emerging adults with intellectual disabilities (I/DD). Emerging adulthood refers to the period between the late teen years and mid-twenties. Although this is a period of significant change for all…

  11. Evaluation of Small System Filtration Technologies for the Treatment of Color, Disinfection ByProducts and Microbiological Contaminants in Surface Water

    EPA Science Inventory

    The U.S. Environmental Protection Agency (EPA) National Risk Management Research Laboratory (NRMRL) evaluated various filtration systems at the EPA T&E Facility in Cincinnati, Ohio and at a field site in Ely, Minnesota (MN) in collaboration with the Minnesota Department of Health...

  12. Developing Reading and Writing Skills of Learners' from Arabic-Speaking Backgrounds

    ERIC Educational Resources Information Center

    Fuqua, Jason


    The number of native Arabic-speaking students coming to America to study English in university programs has grown over the past few years, and continues to be substantial. It has also been noticed by the English Language Institute (ELI) at Sam Houston State University (SHSU) that these students often struggle more with reading activities in class,…

  13. ACS chemical neuroscience molecule spotlight on semagacestat (LY450139).


    Hopkins, Corey R


    Semagacestat (LY450139) is a novel γ-secretase inhibitor currently in late-stage development by Eli Lilly and Company as a potential treatment for Alzheimer's disease (AD). Semagacestat is currently being studied in two phase III clinical trials. PMID:22778845

  14. Applying Diversity Management Concepts to Improve the Minority Educational Pipeline

    ERIC Educational Resources Information Center

    Oguntebi, Joy; Shcherbakova, Maria; Wooten, Lynn P.


    The objective of this conceptual article is to investigate existing diversity management paradigms and extend their implications toward the goal of increasing minority representation in management education. We suggest that the existing learning-and-effectiveness diversity management paradigm (Thomas & Ely, 1996, "Harvard Business…

  15. Oxidation of methionine 216 in sheep and elk prion protein is highly dependent upon the amino acid at position 218 but is not important for prion propagation

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We developed a sensitive mass spectrometry-based method of quantitating the prions present in elk and sheep. Calibration curves relating the area ratios of the selected analyte peptides and their homologous stable isotope labeled internal standards were prepared. This method was compared to the ELIS...

  16. Identification and Characterization of the First Cholesterol-Dependent Cytolysins from Gram-Negative Bacteria

    PubMed Central

    Hotze, Eileen M.; Le, Huynh M.; Sieber, Jessica R.; Bruxvoort, Christina; McInerney, Michael J.


    The cholesterol-dependent cytolysins (CDCs) are pore-forming toxins that have been exclusively associated with a wide variety of bacterial pathogens and opportunistic pathogens from the Firmicutes and Actinobacteria, which exhibit a Gram-positive type of cell structure. We have characterized the first CDCs from Gram-negative bacterial species, which include Desulfobulbus propionicus type species Widdel 1981 (DSM 2032) (desulfolysin [DLY]) and Enterobacter lignolyticus (formerly Enterobacter cloacae) SCF1 (enterolysin [ELY]). The DLY and ELY primary structures show that they maintain the signature motifs of the CDCs but lack an obvious secretion signal. Recombinant, purified DLY (rDLY) and ELY (rELY) exhibited cholesterol-dependent binding and cytolytic activity and formed the typical large CDC membrane oligomeric pore complex. Unlike the CDCs from Gram-positive species, which are human- and animal-opportunistic pathogens, neither D. propionicus nor E. lignolyticus is known to be a pathogen or commensal of humans or animals: the habitats of both organisms appear to be restricted to anaerobic soils and/or sediments. These studies reveal for the first time that the genes for functional CDCs are present in bacterial species that exhibit a Gram-negative cell structure. These are also the first bacterial species containing a CDC gene that are not known to inhabit or cause disease in humans or animals, which suggests a role of these CDCs in the defense against eukaryote bacterial predators. PMID:23115036

  17. The 2010 Broad Prize

    ERIC Educational Resources Information Center

    Education Digest: Essential Readings Condensed for Quick Review, 2011


    A new data analysis, based on data collected as part of The Broad Prize process, provides insights into which large urban school districts in the United States are doing the best job of educating traditionally disadvantaged groups: African-American, Hispanics, and low-income students. Since 2002, The Eli and Edythe Broad Foundation has awarded The…

  18. Vocational Education and Training.

    ERIC Educational Resources Information Center

    van Leeuwen, Fred, Ed.


    This issue of the quarterly Education International focuses on vocational education and training (VET). The editorial, "Education and the Wealth of Nations" (Fred van Leeuwen), focuses on provision of quality education for all. "Education International's (EI's) First Joint Worldwide Action on Education Issues" (Elie Jouen) describes the Global…

  19. 76 FR 76894 - New Animal Drugs for Use in Animal Feeds; Tilmicosin

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 558 New Animal Drugs for Use in Animal Feeds... Administration (FDA) is amending the animal drug regulations to reflect approval of a supplemental new animal drug application (NADA) filed by Elanco Animal Health, a division of Eli Lilly & Co. The...

  20. 75 FR 1275 - New Animal Drugs; Ractopamine

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 558 New Animal Drugs; Ractopamine AGENCY: Food... amending the animal drug regulations to reflect approval of a supplemental new animal drug application (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The supplemental NADA provides...

  1. 75 FR 54019 - New Animal Drugs for Use in Animal Feed; Ractopamine

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 558 New Animal Drugs for Use in Animal Feed... Administration (FDA) is amending the animal drug regulations to reflect approval of two supplemental new animal drug applications (NADAs) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The...

  2. 77 FR 4228 - New Animal Drugs for Use in Animal Feeds; Monensin

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 558 New Animal Drugs for Use in Animal Feeds... Administration (FDA) is amending the animal drug regulations to reflect approval of a supplemental new animal drug application (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The...

  3. 75 FR 5887 - New Animal Drugs for Use in Animal Feeds; Ractopamine; Monensin

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 558 New Animal Drugs for Use in Animal Feeds... Drug Administration (FDA) is amending the animal drug regulations to reflect approval of an original new animal drug application (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co....

  4. Comprehensive multiphase NMR: a promising technology to study plants in their native state.


    Wheeler, Heather L; Soong, Ronald; Courtier-Murias, Denis; Botana, Adolfo; Fortier-Mcgill, Blythe; Maas, Werner E; Fey, Michael; Hutchins, Howard; Krishnamurthy, Sridevi; Kumar, Rajeev; Monette, Martine; Stronks, Henry J; Campbell, Malcolm M; Simpson, Andre


    Nuclear magnetic resonance (NMR) spectroscopy is arguably one the most powerful tools to study the interactions and molecular structure within plants. Traditionally, however, NMR has developed as two separate fields, one dealing with liquids and the other dealing with solids. Plants in their native state contain components that are soluble, swollen, and true solids. Here, a new form of NMR spectroscopy, developed in 2012, termed comprehensive multiphase (CMP)-NMR is applied for plant analysis. The technology composes all aspects of solution, gel, and solid-state NMR into a single NMR probe such that all components in all phases in native unaltered samples can be studied and differentiated in situ. The technology is evaluated using wild-type Arabidopsis thaliana and the cellulose-deficient mutant ectopic lignification1 (eli1) as examples. Using CMP-NMR to study intact samples eliminated the bias introduced by extraction methods and enabled the acquisition of a more complete structural and metabolic profile; thus, CMP-NMR revealed molecular differences between wild type (WT) and eli1 that could be overlooked by conventional methods. Methanol, fatty acids and/or lipids, glutamine, phenylalanine, starch, and nucleic acids were more abundant in eli1 than in WT. Pentaglycine was present in A. thaliana seedlings and more abundant in eli1 than in WT. PMID:25855560

  5. An Analysis of the Associations between Ambiguity Tolerance and EFL Reading Strategy Awareness

    ERIC Educational Resources Information Center

    Kamran, Saeedeh Karbalaee; Maftoon, Parviz


    The current study is an attempt to investigate whether any statistically significant relationship existed between Iranian EFL learners' ambiguity tolerance (AT) and their reading strategy use. To this end, three instruments of Survey of Reading Strategy (Mokhtari & Sheorey, 2002), Second Language Ambiguity Tolerance Scale (Ely, 1995), and a…


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  11. Evolution of the Conditions for Successful Innovation in Remote Networked Schools

    ERIC Educational Resources Information Center

    Hamel, Christine; Turcotte, Sandrine; Laferrière, Thérèse


    This paper investigates the presence (or absence) of Ely's (1999) conditions for implementing innovation in a rural context in the province of Quebec (Canada). The innovation, namely the Remote Networked School (RNS) initiative, is designed to bring new technology tools to enrich the learning environment of students and diminish teachers'…

  12. Guiding School Change: The Role and Work of Change Agents. The Series on School Reform.

    ERIC Educational Resources Information Center

    Rust, Frances O'Connell, Ed.; Freidus, Helen, Ed.

    This book examines facilitators of change, as viewed by the change agents themselves. It highlights their role and how they can be prepared and supported. In chapter 1, Frances O'Connell Rust, Margot Ely, Maris H. Krasnow, and LaMar P. Miller report on the successful professional development of early elementary teachers in New York City. In…

  13. Contemporary Approaches to Conditioning and Learning.

    ERIC Educational Resources Information Center

    McGuigan, F. J., Ed.; Lumsden, D. Barry, Ed.

    Chapters contained in this volume, each with a list of references appended, are: "Scientific Psychology in Transition" by Gregory A. Kimble; "Higher Mental Processes as the Bases for the Laws of Conditioning" by Eli Saltz; "Reification and Reality in Conditioning Paradigms: Implications of Results When Modes of Reinforcement are Changed" by David…

  14. Literature of the Holocaust: The Imagination after Auschwitz. A Course for Juniors and Seniors. A Teacher's Guide.

    ERIC Educational Resources Information Center

    Klau, Judith R.

    This guide presents a curriculum on the literature of the Holocaust which focuses on the ways in which a particular period in history affected the literature that was created to tell about it. The guide consists of a detailed set of lesson plans for six literary works: a diverse collection of short stories; Elie Wiesel's autobiographical novel,…

  15. Computer Chips and Paper Clips. Technology and Women's Employment. Volume II. Case Studies and Policy Perspectives.

    ERIC Educational Resources Information Center

    Hartmann, Heidi I., Ed.; And Others

    This volume contains 12 papers commissioned by the Panel on Technology and Women's Employment. "Technology, Women, and Work: Policy Perspectives" (Eli Ginzberg) is an overview that provides a context for the volume. The four case studies in Part II describe the impact of information technology in the insurance industry, among bookkeepers, among…

  16. God on the Gallows: Reading the Holocaust through Narratives of Redemption

    ERIC Educational Resources Information Center

    Spector, Karen


    "Where is God now?" is a question from the Holocaust memoir "Night" by Elie Wiesel and an underlying narrative dilemma for the teachers and most student participants in this qualitative study of three Holocaust units in secondary English classrooms in the Midwestern United States. Using a narrative theory framework, this study explores how…

  17. 40 CFR 80.215 - What is the scope of the geographic phase-in program?

    Code of Federal Regulations, 2013 CFR


    ...) of this section and the following Federal Indian reservations in paragraph (a)(2)(ii) of this section... Indian reservations follows: Burns Paiute, Cheyenne River, Colville, Duck Valley, Ely Colony, Fort Apache... Navajo Nebraska Banner Box Butte Cheyenne Dawes Deuel Garden Keith Kimball Morrill Scotts Bluff...

  18. 40 CFR 80.215 - What is the scope of the geographic phase-in program?

    Code of Federal Regulations, 2011 CFR


    ...) of this section and the following Federal Indian reservations in paragraph (a)(2)(ii) of this section... Indian reservations follows: Burns Paiute, Cheyenne River, Colville, Duck Valley, Ely Colony, Fort Apache... Navajo Nebraska Banner Box Butte Cheyenne Dawes Deuel Garden Keith Kimball Morrill Scotts Bluff...

  19. 40 CFR 80.215 - What is the scope of the geographic phase-in program?

    Code of Federal Regulations, 2014 CFR


    ...) of this section and the following Federal Indian reservations in paragraph (a)(2)(ii) of this section... Indian reservations follows: Burns Paiute, Cheyenne River, Colville, Duck Valley, Ely Colony, Fort Apache... Navajo Nebraska Banner Box Butte Cheyenne Dawes Deuel Garden Keith Kimball Morrill Scotts Bluff...

  20. Drug Advertising and the FDA.

    ERIC Educational Resources Information Center

    Levesque, Cynthia

    With increases in consumer focused advertising for prescription drugs, the Federal Drug Administration has renewed efforts to protect the public from false advertising. In 1982, it charged that the press kits Eli Lilly and Company distributed to reporters on its new antiarthritis drug, Oraflex, misrepresented the product. It recommended that Lilly…

  1. Networked Success and Failure at Hybritech

    ERIC Educational Resources Information Center

    Jones, Mark Peter


    The author presents an historical account of scientific work conducted at a commercial biotech firm in San Diego called Hybritech. It tells of disruptions in research programs following the acquisition of the company by the pharmaceutical giant Eli Lilly in 1986. The story centers on responses to an organizational challenge that research managers…

  2. TESL Reporter, Vol. 6, No. 3.

    ERIC Educational Resources Information Center

    Pack, Alice C., Ed.

    The following articles on teaching English as a second language are included in this issue: (1) "ELI Tutorial" (about the tutorial program at the English Language Institute of the Church College of Hawaii) by Michael E. Foley; (2) "English-TESL Programs at the Church College of Hawaii" by Jay Fox; (3) "Developmental Speech Classes" by Brent…

  3. Appreciating an Old Favorite: Sousa's All-Time Hit

    ERIC Educational Resources Information Center

    Van Outryve, Karen


    In this article, the author presents John Philip Sousa's all time hit, "The Stars and Stripes Forever". It is one of the most recognizable pieces of American music. Wherever John Philip Sousa and his band appeared, this march was likely to be played. According to American poet and educator Eli Siegel (1902-78), who first articulated the philosophy…

  4. Policy Issues in Work and Retirement.

    ERIC Educational Resources Information Center

    Parnes, Herbert S., Ed.

    This collection consists of papers presented at a 1982 conference on policy issues in work and retirement. Presented first is an introductory overview of the problems of retirement and aging by Herbert S. Parnes. The following conference reports are included in the volume: "Life without Work: Does It Make Sense?" by Eli Ginzberg; "Aging, Health,…

  5. Adaptation of Rural and Foreign Workers to Industry, International Joint Seminar (Wiesbaden, December 10-13, 1963). Final Report. International Seminars 1963-4.

    ERIC Educational Resources Information Center

    Organisation for Economic Cooperation and Development, Paris (France). Social Affairs Div.

    The major purpose of a seminar held in Wiesbaden, Germany, was to exchange experiences and views on the methods of expediating adjustment of rural and foreign workers to industry. Major presentations for discussion were "Internal Migration" by Magda Talamo, and "International Migration" by Elie Dimitras. Some conclusions were: (1) Movement of the…

  6. Academic Freedom on Trial: 100 Years of Sifting and Winnowing at the University of Wisconsin-Madison.

    ERIC Educational Resources Information Center

    Hansen, W. Lee, Ed.

    The 29 papers in this collection celebrate academic freedom at the University of Wisconsin-Madison and are organized around the 1894 "trial" of Richard T. Ely, an economist who was exonerated of fomenting unrest and discussing "dangerous" ideas in a Board of Regents Statement which stressed the importance of "sifting and winnowing" ideas to…

  7. In vitro activity of ponazuril against Theileria equi

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The equid hemoprotozoan parasite Theileria equi is endemic in most regions worldwide. Infection of horses is a cause of significant economic loss due to costs associated with disease and restriction of trade with non-endemic nations. The ability of certain drugs such as imidocarb dipropionate to eli...

  8. Perspective view of Wilcox Building (7 North E Street), with ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Perspective view of Wilcox Building (7 North E Street), with Eli Cafe (7 North E Street), the Palace Saloon (11 North E Street), and Fetsche's (15 North E Street) to left of frame, view looking north on E Street - Lakeview Downtown Historic District, E, F & G Streets between Second Street North & First Street South, Lakeview, Lake County, OR

  9. A Study on Correlation of Risk-Taking and the Oral Production of English Majors in China

    ERIC Educational Resources Information Center

    Wang, Yang; Lin, Yuewu


    Risk-taking refers to the tendency to engage in behaviors that have the potential to be harmful or dangerous, yet at the same time provides the opportunity for some kinds of outcome that can be perceived as positive. Ely (1986) and Bang (1999) have mentioned the relationship between risk-taking and oral production in the process of English…

  10. Trendspotting 2011

    ERIC Educational Resources Information Center

    Thomas, Lisa Carlucci


    In this article, the author discusses Connecticut Library Consortium's (CLC) recently held fifth annual Trendspotting symposium, "E-books: Collections at the Crossroads." She was pleased to work with CLC to develop a cutting-edge program of dynamic, thought-provoking speakers and presentations, including an outstanding keynote by Eli Neiburger on…

  11. 75 FR 9333 - Implantation or Injectable Dosage Form New Animal Drugs; Tilmicosin

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... supplemental new animal drug application (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The supplemental NADA provides a dose range for use of an injectable solution of tilmicosin phosphate... to NADA 140-929 for MICOTIL 300 (tilmicosin injection, USP) Injection, available by...

  12. The Role of the Social Scientist in Human Resource Development Policy and Programs for Hispanics. National Symposium on Hispanics and CETA (1980).

    ERIC Educational Resources Information Center

    Furino, Antonio, Ed.

    Conference speakers focused on three topics: Hispanics and Comprehensive Employment and Training Act (CETA) policy and implementation issues; data sources; and research regarding Hispanic manpower. After introductory remarks by James W. Wagener, Eli Ginzberg and Tomas Rivera, Ernest Green discussed Hispanics and CETA. Harry Greenspan described…

  13. Pathway-based Analysis of Fish Transcriptomics Data across Effluent Gradients in Minnesota Rivers

    EPA Science Inventory

    As part of a larger effort to assess the health of streams and rivers in Minnesota, a series of caged fish experiments were conducted in three locations: Ely, Hutchinson, and Rochester. The experimental design placed caged fish (fathead minnows, Pimephales promelas; FHM) across ...

  14. TESL Reporter, Vol. 11, No. 2.

    ERIC Educational Resources Information Center

    Pack, Alice C., Ed.

    This issue contains the following articles: "Progressive Decontrol through Deletion," by Robert C. Weissberg; "The Scrutable Chinese," by Jason B. Alter; "Gadgets: Some Non-Verbal Tools for Teaching Pronunciation," by Judy Gilbert; "ELI and English Skills in JFS Library-Media Complex," by Curtis Fawson; and "Aural Comprehension: Mini Lessons in…

  15. 18. View from East Rock, c. 1920 Photocopied from a ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    18. View from East Rock, c. 1920 Photocopied from a print from glass negative no. 6476 by Thomas S. Bronson, NHCHSL. An aerial view of the armory site evidently after the row of stone houses for married employees had been torn down. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  16. 11. Whitney's Armory, Near New Haven, Ct., 1842 Photocopied from ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    11. Whitney's Armory, Near New Haven, Ct., 1842 Photocopied from a woodcut in Henry Howe, Memoirs of the Most Eminent American Mechanics (New York, 1842), p. 124. The best early view of the filing shop and its raceway. See footnote 58. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  17. 9. Town of Hamden, 1868 Map detail photocopied from F. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    9. Town of Hamden, 1868 Map detail photocopied from F. W. Beers, et al., Atlas of New Haven County, Connecticut (New York, 1868), p. 25. Shows the newly created Lake Whitney and, one quarter mile south of the armory, a 'Rifle Factory.' - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  18. Business, Philanthropy, and Education in the United States.

    ERIC Educational Resources Information Center

    Hall, Peter Dobkin


    Traces the history of the relationship between business and public education from the 17th century through the depression, the war, and the post-liberal era; and notes the contributions of Eli Whitney, Andrew Carnegie, and other philanthropists. The article also examines the efforts to achieve social transformation through the schools. (SM)

  19. 26. Site plan of Lake Whitney; detail of original engineering ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    26. Site plan of Lake Whitney; detail of original engineering drawing, 1856 Photocopied from map drawn and surveyed by Nelson J. Welton, C.E., 'Contemplated Waterworks at Whitneyville, 1856,' unaccessioned New Haven Water Company Papers, collection of NHCHSL. Shows 'Whitney's Upper Armory,' 'Clock Shop,' 'E. Whitney's Lower Armory.' - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  20. 15. Site plan, 1915, bottom half With CT214, photocopied from ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    15. Site plan, 1915, bottom half With CT-2-14, photocopied from an ozalid print, 'Map of Plant of Sentinel Manufacturing Co.,' Folio 2, EWC. The Sentinel Manufacturing Co. produced gas stoves. They leased the Whitney Armory buildings about 1915. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  1. 17. Forge building, fuel storage shed, and foundry, 1906 Photocopied ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    17. Forge building, fuel storage shed, and foundry, 1906 Photocopied from a photograph by Thomas S. Bronson, 'Group at Whitney Factory, 5 November 1906,' NHCHSL. The most reliable view of the fuel storage sheds and foundry, together with a view of the forge building. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  2. 8. Town of Hamden, 1852. Photocopied from a photostatic detail ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    8. Town of Hamden, 1852. Photocopied from a photostatic detail in the collection of the Hamden Historical Society, Hamden, Connecticut. From R. Whiteford, 'Map of the County of New Haven, Connecticut' (New Haven, 1852). Shown are 'Witney's sic Armory,' 'Whitney's Marine Clock Factory,' and 'Whitney' s Pistol Factory.' - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  3. 22. Lake Whitney Dam, 1895 Photocopied from an original photograph, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    22. Lake Whitney Dam, 1895 Photocopied from an original photograph, NHCHSL. Shows the rear of the dam building, and on Lake Whitney, Day's Store and Boathouse, and an ice house and steam-powered elevators. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  4. 25. Site plan by New Haven Water Company, c.1900 Photocopied ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    25. Site plan by New Haven Water Company, c.1900 Photocopied from property map, Mill River Division, Sheet 51, Map Collection, Armory Street Filtration Plant, New Haven Water Company, Hamden, Connecticut. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  5. 16. Forge building and fuel storage shed from the southwest, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    16. Forge building and fuel storage shed from the southwest, c.1918 Photocopied from a photograph in the collection of William F. Applegate, 43 Grandview Avenue, Wallingford, Connecticut. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT


    EPA Science Inventory

    The ELI Eco Logic International Inc. (Eco Logic) process thermally separates organics, then chemically reduces them in a hydrogen atmosphere, converting them to a reformed gas that consists of light hydrocarbons and water. A scrubber treats the reformed gas to remove hydrogen chl...

  7. Laser driven nuclear science and applications: The need of high efficiency, high power and high repetition rate Laser beams

    NASA Astrophysics Data System (ADS)

    Gales, S.


    Extreme Light Infrastructure (ELI) is a pan European research initiative selected on the European Strategy Forum on Research Infrastructures Roadmap that aims to close the gap between the existing laboratory-based laser driven research and international facility-grade research centre. The ELI-NP facility, one of the three ELI pillars under construction, placed in Romania and to be operational in 2018, has as core elements a couple of new generation 10 PW laser systems and a narrow bandwidth Compton backscattering gamma source with photon energies up to 19 MeV. ELI-NP will address nuclear photonics, nuclear astrophysics and quantum electrodynamics involving extreme photon fields. Prospective applications of high power laser in nuclear astrophysics, accelerator physics, in particular towards future Accelerator Driven System, as well as in nuclear photonics, for detection and characterization of nuclear material, and for nuclear medicine, will be discussed. Key issues in these research areas will be at reach with significant increase of the repetition rates and of the efficiency at the plug of the high power laser systems as proposed by the ICAN collaboration.


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  10. 78 FR 70067 - Notice of Availability of the Final Environmental Impact Statement for the Proposed Pan Mine...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Mine Project, White Pine County, NV AGENCY: Bureau of Land Management, Interior. ACTION: Notice of... Office, Ely, Nevada, has prepared a Final Environmental Impact Statement (EIS) for the proposed Pan Mine... until after December 19, 2013. ADDRESSES: Copies of the Final EIS for the Pan Mine Project are...

  11. K-12 Computer Networking.

    ERIC Educational Resources Information Center

    ERIC Review, 1993


    The "ERIC Review" is published three times a year and announces research results, publications, and new programs relevant to each issue's theme topic. This issue explores computer networking in elementary and secondary schools via two principal articles: "Plugging into the 'Net'" (Michael B. Eisenberg and Donald P. Ely); and "Computer Networks for…

  12. The Learning Age: Experts Give Their Views on the Government's Green Paper.

    ERIC Educational Resources Information Center

    Adults Learning (England), 1998


    Includes reactions to "The Learning Age" from the following: A.G. Watts, Richard Taylor, Richard Ely, Carole Stott, Donald Rae, John Lawton, Philippa Langton, Mary Lord, and Sarah Perman. Emphasizes the need for practitioner input from their varied experiences and for knowledge of client groups into the continuing development of the educational…

  13. The Transformation of the Urban Economic Base. Special Report No. 19.

    ERIC Educational Resources Information Center

    Stanback, Thomas, Jr.; Drennan, Matthew

    The objective stated for this monograph is to provide some insights regarding the nature of urban economic systems and their growth processes which will be useful in formulating developmental policy. A foreword (by Eli Ginzberg) provides background on the history of and present challenge to reshape manpower policies and programs for cities…

  14. Phonological Awareness and Word Recognition in Reading by Children with Autism

    ERIC Educational Resources Information Center

    Gabig, Cheryl Smith


    This research examined phonological awareness (PA) and single word reading in 14 school-age children with autism and 10 age-matched, typically developing (TD) children between 5-7 years. Two measures of PA, an elision task (ELI) and a sound blending task (BLW), were given along with two measures of single word reading, word identification for real…

  15. Found in Translations: Using Multiple Versions of Translated Text for Close Analysis of Language

    ERIC Educational Resources Information Center

    Larochelle, Paul


    To prepare students for the rigorous tasks of the unseen written commentary and the oral commentary on an extract from a studied text, the author has had to explore new ways of engaging students in attending to the subtleties of language. Inspired by a classroom mishap regarding translations of Elie Wiesel's "Night," the author uses multiple text…

  16. Charters, Constitutions and By-Laws of the Indian Tribes of North America, Part XII: The Basin-Plateau Tribes (cont'd.). Occasional Publications in Anthropology, Ethnology Series, No. 13.

    ERIC Educational Resources Information Center

    Fay, George E., Comp.

    The Museum of Anthropology, University of Northern Colorado at Greeley, has assembled various American Indian tribal charters, constitutions, and by-laws to comprise a series of publications. The present volume, Part XII, is a continuation of the publication on Basin-Plateau Indian groups: the Ely Indian Colony and Reno-Sparks Indian Colony of…

  17. 21 CFR 510.600 - Names, addresses, and drug labeler codes of sponsors of approved applications.

    Code of Federal Regulations, 2011 CFR


    ...: For Federal Register citations affecting § 510.600, see the List of CFR Sections Affected, which..., WIllmar, MN 56201 053740 Nycomed US, Inc., 60 Baylis Rd., Melville, NY 11747 025463 Orion Corp.... South, Minneapolis, MN 55402 028459 Pegasus Laboratories, Inc., 8809 Ely Rd., Pensacola, FL 32514...

  18. 8 CFR 100.4 - Field offices.

    Code of Federal Regulations, 2012 CFR


    ... Sturgeon Bay, WI District No. 10—St. Paul, Minnesota Class A Ambrose, ND Antler, ND Baudette, MN Carbury, ND Duluth, MN (the port of Duluth includes, among others, the port facilities at Superior, WI) Dunseith, ND Ely, MN Fortuna, ND Grand Portage, MN Hannah, ND Hansboro, ND International Falls,...

  19. 8 CFR 100.4 - Field offices.

    Code of Federal Regulations, 2010 CFR


    ... Sturgeon Bay, WI District No. 10—St. Paul, Minnesota Class A Ambrose, ND Antler, ND Baudette, MN Carbury, ND Duluth, MN (the port of Duluth includes, among others, the port facilities at Superior, WI) Dunseith, ND Ely, MN Fortuna, ND Grand Portage, MN Hannah, ND Hansboro, ND International Falls,...

  20. 19 CFR 101.4 - Entry and clearance of vessels at Customs stations.

    Code of Federal Regulations, 2013 CFR


    ... § 101.4, see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed.... Marquette Sault Ste. Marie. Rogers City Saginaw-Bay City-Flint. Minnesota Crane Lake Duluth, MN-Superior, WI. Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile,...

  1. 19 CFR 101.4 - Entry and clearance of vessels at Customs stations.

    Code of Federal Regulations, 2010 CFR


    ... List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume and on.... Marquette Sault Ste. Marie. Rogers City Saginaw-Bay City-Flint. Minnesota Crane Lake Duluth, MN-Superior, WI. Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile,...

  2. 8 CFR 100.4 - Field offices.

    Code of Federal Regulations, 2014 CFR


    .... Paul, Minnesota Class A Ambrose, ND Antler, ND Baudette, MN Carbury, ND Duluth, MN (the port of Duluth includes, among others, the port facilities at Superior, WI) Dunseith, ND Ely, MN Fortuna, ND Grand Portage, MN Hannah, ND Hansboro, ND International Falls, MN Lancaster, MN Maida, ND Neche, ND Noonan,...

  3. 19 CFR 101.4 - Entry and clearance of vessels at Customs stations.

    Code of Federal Regulations, 2011 CFR


    ... List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume and at.... Marquette Sault Ste. Marie. Rogers City Saginaw-Bay City-Flint. Minnesota Crane Lake Duluth, MN-Superior, WI. Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile,...

  4. 8 CFR 100.4 - Field offices.

    Code of Federal Regulations, 2013 CFR


    ... Sturgeon Bay, WI District No. 10—St. Paul, Minnesota Class A Ambrose, ND Antler, ND Baudette, MN Carbury, ND Duluth, MN (the port of Duluth includes, among others, the port facilities at Superior, WI) Dunseith, ND Ely, MN Fortuna, ND Grand Portage, MN Hannah, ND Hansboro, ND International Falls,...

  5. 8 CFR 100.4 - Field offices.

    Code of Federal Regulations, 2011 CFR


    ... Sturgeon Bay, WI District No. 10—St. Paul, Minnesota Class A Ambrose, ND Antler, ND Baudette, MN Carbury, ND Duluth, MN (the port of Duluth includes, among others, the port facilities at Superior, WI) Dunseith, ND Ely, MN Fortuna, ND Grand Portage, MN Hannah, ND Hansboro, ND International Falls,...

  6. 19 CFR 101.4 - Entry and clearance of vessels at Customs stations.

    Code of Federal Regulations, 2012 CFR


    ... List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume and at.... Marquette Sault Ste. Marie. Rogers City Saginaw-Bay City-Flint. Minnesota Crane Lake Duluth, MN-Superior, WI. Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile,...


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  8. Broad Prize: Do the Successes Spread?

    ERIC Educational Resources Information Center

    Samuels, Christina A.


    When the Broad Prize for Urban Education was created in 2002, billionaire philanthropist Eli Broad said he hoped the awards, in addition to rewarding high-performing school districts, would foster healthy competition; boost the prestige of urban education, long viewed as dysfunctional; and showcase best practices. Over the 10 years the prize has…

  9. Lenticular stretch structures in eastern Nevada - possible trapping mechanism in supposed graben

    SciTech Connect

    Walker, C.T.; Dennis, J.G.; Lumsden, W.W.


    Eastern Nevada is widely recognized as a region of tectonic extension. The dominant structures are generally agreed to be low-dipping, younger over older faults and steeper listric faults that are responsible for the basins (grabens) and ranges (horsts). In the Schell Creek-Duck Creek Range, east of Ely, and in the White Pine Range, southwest of Ely, small lenticular structures bounded by tectonic discontinuities can be clearly seen in the field. These lenticular units, or stretch structures, range in length from a few meters to more than 200 m. All lenticular stretch structures that can be clearly seen in the field are stratigraphically restricted; the stretched formations are the Eureka Quartzite, the Pilot Shale, the Joana Limestone, and the Chainman Shale. Still larger stretch structures, which may include several formations, are inferred, and the authors suggest that extension has created lenticular structures at all scales. The Duck Creek and Schell Creek Ranges east of Ely consist mostly of Devonian and older rocks. They are separated by a topographically lower area containing mostly Mississippian and Pennsylvanian rocks. This structure, which separates the ranges, has been referred to as a graben, but field evidence suggests that it is a large-scale lenticular stretch structure. Unlike a true graben, the structure does not extend downward. For example, in several places within the supposed graben, Cambrian and Ordovician rocks project through a cover of Carboniferous Chainman Shale and Ely Limestone, suggesting the Chainman-Ely is a thin sheet underlain by Cambrian-Ordovician rocks. Accordingly, they suggest that extension in the Duck Creek-Schell Creek Ranges stretched the formations into lenticular bodies. Between the Duck Creek and Schell Creek Ranges, the Cambrian-Ordovician is attenuated, and the resulting tectonic depression is occupied by a lenticular mass of Carboniferous rocks.

  10. Fatigue Life of Titanium Alloys Fabricated by Additive Layer Manufacturing Techniques for Dental Implants

    NASA Astrophysics Data System (ADS)

    Chan, Kwai S.; Koike, Marie; Mason, Robert L.; Okabe, Toru


    Additive layer deposition techniques such as electron beam melting (EBM) and laser beam melting (LBM) have been utilized to fabricate rectangular plates of Ti-6Al-4V with extra low interstitial (ELI) contents. The layer-by-layer deposition techniques resulted in plates that have different surface finishes which can impact significantly on the fatigue life by providing potential sites for fatigue cracks to initiate. The fatigue life of Ti-6Al-4V ELI alloys fabricated by EBM and LBM deposition techniques was investigated by three-point testing of rectangular beams of as-fabricated and electro-discharge machined surfaces under stress-controlled conditions at 10 Hz until complete fracture. Fatigue life tests were also performed on rolled plates of Ti-6Al-4V ELI, regular Ti-6Al-4V, and CP Ti as controls. Fatigue surfaces were characterized by scanning electron microscopy to identify the crack initiation site in the various types of specimen surfaces. The fatigue life data were analyzed statistically using both analysis of variance techniques and the Kaplan-Meier survival analysis method with the Gehan-Breslow test. The results indicate that the LBM Ti-6Al-4V ELI material exhibits a longer fatigue life than the EBM counterpart and CP Ti, but a shorter fatigue life compared to rolled Ti-6Al-4V ELI. The difference in the fatigue life behavior may be largely attributed to the presence of rough surface features that act as fatigue crack initiation sites in the EBM material.

  11. Empowering the Community to Manage Diabetes Better: An Integrated Partnership-Based Model

    PubMed Central

    Bamne, Arun; Shah, Daksha; Palkar, Sanjivani; Uppal, Shweta; Majumdar, Anurita; Naik, Rohan


    Context Rising number of diabetes cases in India calls for collaboration between the public and private sectors. Aims: Municipal Corporation of Greater Mumbai (MCGM) partnered with Eli Lilly and Company (India) [Eli Lilly] to strengthen the capacity of their diabetes clinics. Materials and Methods Medical Officers, dispensaries and Assistant Medical Officers (AMOs) located at attached health posts were trained on an educational tool, Diabetes Conversation Map™ (DCM) by a Master Trainer. This tool was then used to educate patients and caregivers visiting the MCGM diabetes clinics. Results Twenty-eight centers conducted 168 sessions, and 1616 beneficiaries availed the education over six months. General feedback from health providers was that DCM helps clear misconceptions among patients and caregivers in an interactive way and also improves compliance of patients. Conclusions This communication highlights a unique public-private partnership where the sincere efforts of public sector organization (MCGM) were complemented by the educational expertise lent by a private firm. PMID:27051094

  12. Stress Corrosion Cracking and Fatigue Crack Growth Studies Pertinent to Spacecraft and Booster Pressure Vessels

    NASA Technical Reports Server (NTRS)

    Hall, L. R.; Finger, R. W.


    This experimental program was divided into two parts. The first part evaluated stress corrosion cracking in 2219-T87 aluminum and 5Al-2.5Sn (ELI) titanium alloy plate and weld metal. Both uniform height double cantilever beam and surface flawed specimens were tested in environments normally encountered during the fabrication and operation of pressure vessels in spacecraft and booster systems. The second part studied compatibility of material-environment combinations suitable for high energy upper stage propulsion systems. Surface flawed specimens having thicknesses representative of minimum gage fuel and oxidizer tanks were tested. Titanium alloys 5Al-2.5Sn (ELI), 6Al-4V annealed, and 6Al-4V STA were tested in both liquid and gaseous methane. Aluminum alloy 2219 in the T87 and T6E46 condition was tested in fluorine, a fluorine-oxygen mixture, and methane. Results were evaluated using modified linear elastic fracture mechanics parameters.

  13. Investigation of the fracture mechanism in Ti-5Al-2.5Sn at cryogenic temperatures

    NASA Technical Reports Server (NTRS)

    Vanstone, R. H.; Low, J. R., Jr.; Shannon, J. L., Jr.


    The influence of microstructure on the fracture mechanism and plane-strain fracture toughness of Ti-5Al-2.5Sn was studied through the use of fractography and metallographic sectioning techniques. One-inch thick plates of extra low interstitial (ELI) and normal interstitial Ti-5Al-2.5Sn were mill annealed at 815 C followed by either air or furnace cooling. These variations in composition and cooling rate resulted in differences in the volume fraction and internal structure of the iron-stabilized phase, and in the crystallographic texture and ordering of the alpha matrix. The tensile properties of these plates were determined at 20 K, 77 K, and 295 K. The air-cooled ELI plate was the toughest material evaluated.

  14. A Comparison of Glide Force Characteristics Between 2 Prefilled Insulin Lispro Pens

    PubMed Central

    Lennartz, Amanda H.; Ignaut, Debra A.


    Background: Glide force, average glide force, and glide force variability of the insulin lispro 200 units/mL pen (Eli Lilly and Company, Indianapolis, IN, USA) were compared to the Humalog® KwikPen® 100 units/mL pen (hereafter, KwikPen; Eli Lilly and Company, Indianapolis, IN, USA). Methods: Data were collected on 2 doses, 2 injection speeds, and 2 needle types. Results: Insulin lispro 200 units/mL pen showed significantly lower maximum glide force, average glide force, and glide force variability than the KwikPen across all combinations of dose size, dose speed, and needle type. Conclusions: The lower glide force observed with the insulin lispro 200 units/mL pen offers another treatment option for patients with type 1 or type 2 diabetes who require greater than 20 units of mealtime insulin daily. PMID:25591858

  15. Characterization of titanium alloys for cryogenic applications

    NASA Astrophysics Data System (ADS)

    Reytier, M.; Kircher, F.; Levesy, B.


    Titanium alloys are employed in the design of superconducting magnet support systems for their high mechanical strength associated with their low thermal conductivity. But their use requires a careful attention to their crack tolerance at cryogenic temperature. Measurements have been performed on two extra low interstitial materials (Ti-5Al-2.5Sn ELI and Ti-6Al-4V ELI) with different thickness and manufacturing process. The investigation includes the tensile properties at room and liquid helium temperatures using smooth and notched samples. Moreover, the fracture toughness has been determined at 4.2 K using Compact Tension specimens. The microstructure of the different alloys and the various fracture surfaces have also been studied. After a detailed description of the experimental procedures, practical engineering characteristics are given and a comparison of the different titanium alloys is proposed for cryogenic applications.

  16. Accuracy of three different fecal calprotectin tests in the diagnosis of inflammatory bowel disease

    PubMed Central

    Jang, Hui Won; Kim, Hyun Sook; Park, Soo Jung; Hong, Sung Pil; Kim, Tae Il; Kim, Won Ho


    Background/Aims Several studies have found that the measurement of fecal calprotectin is useful for the early diagnosis of inflammatory bowel disease (IBD). We compared the effectiveness of three different fecal calprotectin kits for initial diagnosis in patients with suspected IBD. Methods We enrolled 31 patients with IBD (18 Crohn's disease [CD], 11 ulcerative colitis [UC], and two intestinal Behçet's disease), five with irritable bowel syndrome (IBS), and five with other colitis (four infectious colitis and one intestinal tuberculosis). Diagnosis was based on clinical, laboratory, and endoscopic examinations. Fecal samples were obtained at the first diagnosis and calprotectin levels were measured using three different kits (Quantum Blue® Calprotectin, EliA™ Calprotectin, and RIDASCREEN® Calprotectin). Results The overall accuracy for differentiating IBD from IBS or other colitis was 94% and 91%, respectively, for Quantum Blue® (cutoff, 50 µg/g); 92% and 89%, respectively, for EliA™ (cutoff, 50 µg/g); and 82% and 76%, respectively, for RIDASCREEN® (cutoff, 50 µg/g). In patients with CD, the results of Quantum Blue® Calprotectin and EliA™ Calprotectin correlated significantly with levels of the Crohn's disease activity index (Spearman's rank correlation coefficient, r=0.66 and r=0.49, respectively). In patients with UC, the results of EliA™ Calprotectin correlated significantly with the Mayo score (r=0.70). Conclusions Fecal calprotectin measurement is useful for the identification of IBD. The overall accuracies of the three fecal calprotectin kits are comparable. PMID:27799881

  17. Aura of mystery.


    Dolgin, Elie


    It begins as a slowly expanding spot of light or similar visual disturbance, often accompanied by phantom noises and other sensory distortions. People who experience such 'auras' know all too well that these early warning signs will culminate in a head-splitting migraine, yet scientists have little idea what causes the debilitating deluge of symptoms. Elie Dolgin talks to neurologists hoping to change that - by triggering auras in the laboratory in order to study them.

  18. Nuclear astrophysics with intense photon beam

    SciTech Connect

    Shizuma, Toshiyuki


    Quasi-monochromatic photon beams generated by inverse Compton scattering of laser light with high energy electrons can be used for precise measurements of photoneutrons and resonant scattered {gamma} rays. Extremely high intensity and small energy spreading width of the photon beam expected at the ELI Nuclear Physics facility would increase the experimental sensitivities considerably. Possible photonuclear reaction measurements relevant to the p-process nucleosynthesis are discussed.


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  20. Faces of the Recovery Act: 1366 Technologies

    SciTech Connect

    Sachs, Ely; Mierlo, Frank van; Obama, Barack


    LEXINGTON, MA - At 1366 Technologies, Ely Sachs and Frank van Mierlo are using ARPA-E Recovery Act funding to dramatically reduce the costs of solar panel production. To read more about the project: To see more projects funded by the Recovery Act through ARPA-E:

  1. An Ultra-Violet Tolerant Wild-Type Strain of Melanin-Producing Bacillus thuringiensis

    PubMed Central

    Sansinenea, Estibaliz; Salazar, Francisco; Ramirez, Melanie; Ortiz, Aurelio


    Background: Bacillus thuringiensis is the most successful biological control agent used in agriculture, forestry and mosquito control. However, the insecticidal activity of the B. thuringiensis formulation is not very stable and rapidly loses its biological activity under field conditions, due to the ultraviolet radiation in sunlight. Melanin is known to absorb radiation therefore photo protection of B. thuringiensis based on melanin has been extensively studied. Objectives: The aim of this study was to find a wild type strain of naturally melanin-producing B. thuringiensis to avoid any mutation or manipulation that can affect the Cry protein content. Materials and Methods: Bacillus thuringiensis strains were isolated from soils of different States of Mexico and pigment extraction was followed by lowering the pH to 2 using 1N HCl. Pigment was characterized by some chemical tests based on its solubility, bleaching by H2O2 and flocculation with FeCl3, and using an Infrared (IR) spectrum. Ultraviolet (UV) irradiation experiment was performed to probe the melanin efficacy. Results: ELI52 strain of B. thuringiensis was confirmed to naturally produce melanin. The Cry protein analysis suggested that ELI52 is probably a B. thuringiensis subsp. israelensis strain with toxic activity against the Diptera order of insects. Ultra Violet protection efficacy of melanin was probed counting total viable colonies after UV radiation and comparing the results with the non-producing melanin strain L-DOPA (L-3, 4-dihydroxyphenylalanine) was also detected in the culture. ELI52 strain showed an antagonistic effect over some common bacteria from the environment. Conclusions: ELI52 wild-type strain of B. thuringiensis is a good bio-insecticide that produces melanin with UV-resistance that is probably toxic against the Diptera order of insects and can inhibit the growth of other environmental bacteria. PMID:26421136

  2. [Virus, provirus and cancer].


    Galperin, C


    Our purpose here is to retrace the history of the concept of prophage, to show how it expands into that of the episome and provirus. Its prehistory is that of lysogeny. We stress the relations between heredity and infection, the discovery of a non infectioius phase of the phage. André Lwoff is responsible for the concept of prophage. We then examine the research, discoveries and interpretations of François Jacob, Elie Wollman, William Hayes and Joshua Lederberg.

  3. Methionine enkephalin immunoreactivity in the brain of the budgerigar (Melopsittacus undulatus): similarities and differences with respect to oscine songbirds.


    Durand, S E; Liang, W; Brauth, S E


    The brain of the budgerigar (Melopsittacus undulatus), a small parrot that acquires new vocalizations throughout life, was examined for immunoreactivity to the opioid peptide methionine enkephalin (mENK). mENK is a highly prominent feature of the chemical architecture of the forebrain vocal system of oscine songbirds. Forebrain vocal control nuclei are believed to have evolved independently in parrots and songbirds (Streidter [1994] J. Comp. Neurol. 343:35-56); however, recent studies have found similarities in the neural organization of vocal control pathways in budgerigars and songbirds (Durand et al. [1997] J. Comp. Neurol. 377:179-206). Among the similarities are the existence of recursive pathways interconnecting vocal control neurons in the archistriatum, basal ganglia (i.e., lobus parolfactorius), and dorsal thalamus. In the present study, we found that all vocal control nuclei within the budgerigar forebrain exhibit prominent mENK-like immunoreactivity (ELI) in fibers and somata. We also found striking similarities between the morphology of ELI elements in budgerigar vocal control nuclei and that described previously in songbird vocal nuclei. Despite these similarities, the budgerigar dorsal striatopallidum (lobus parolfactorius, paleostriatum augmentatum, and paleostriatum primitivum) and somatomotor (anterior) archistriatum exhibit unique patterns of ELI. The dorsal striatopallidum contained far less ELI, whereas the archistriatum contained far more than would be expected on the basis of previous studies of opioid peptides in other avian species, including pigeons, chickens, and songbirds. These differences may reflect neural specializations unique to the budgerigar that contribute to the extraordinary flexibility of the vocal motor system of this species to acquire socially significant stimuli throughout life.

  4. The Confidence to Make a Difference

    ERIC Educational Resources Information Center

    Stanistreet, Paul


    Popularly known as "the biggest housing estate in Europe", Ely is the most deprived area of Cardiff and one of the most disadvantaged parts of the UK. It has, by the admission of its own residents, a bad reputation as an area associated with poverty, gangs, street crime and burnt-out cars. That is only one part of the story. Those who live in Ely…

  5. 13. Site plan, 1900 Photocopied from a blueprint, 'Appraisal of ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    13. Site plan, 1900 Photocopied from a blueprint, 'Appraisal of Water Power and Real Estate at Whitneyville, 1900,' New Haven Water Company, 100 Crown Street, New Haven, Connecticut. Shows the Whitney Arms Company as it existed for much of the period 1860-1904. Compare with photo CT-2-10. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  6. Nonlinear Propagation of Crossing Electromagnetic Waves in Vacuum due to Photon-Photon Scattering

    SciTech Connect

    Tommasini, Daniele; Michinel, Humberto; Ferrando, Albert; Seco, Marcos


    We review the theory for photon-photon scattering in vacuum, and some of the proposals for its experimental search, including the results of our recent works on the subject. We then describe a very simple and sensitive proposal of an experiment and discuss how it can be used at the present (HERCULES) and the future (ELI) ultrahigh power laser facilities either to find the first evidence of photon-photon scattering in vacuum, or to significantly improve the current experimental limits.

  7. Interactions of the public and private sectors in drug development: boundaries to protect scientific values while preserving innovation.


    Cassell, Gail H


    Industry, academia, and government have developed highly interwoven relationships in the pursuit of biomedical research. Establishing and maintaining boundaries among the public and private sectors at both the institutional level and the individual level is critical to protect core scientific values, preserve innovation, and allow product development to thrive. This article reviews principles that guide the interactions of these Biomdifferent sectors, sharing principles in place at Eli Lilly and Company as an example.

  8. Faces of the Recovery Act: 1366 Technologies


    Sachs, Ely; Mierlo, Frank van; Obama, Barack


    LEXINGTON, MA - At 1366 Technologies, Ely Sachs and Frank van Mierlo are using ARPA-E Recovery Act funding to dramatically reduce the costs of solar panel production. To read more about the project: To see more projects funded by the Recovery Act through ARPA-E:

  9. Saccades and prefrontal hemodynamics in basketball players.


    Fujiwara, K; Kiyota, N; Maekawa, M; Kunita, K; Kiyota, T; Maeda, K


    We investigated saccade performance and prefrontal hemodynamics in basketball players with different skill levels. Subjects were 27 undergraduate basketball players and 13 non-athlete undergraduates (control group: CON). The players were divided into two groups: those who had played in the National Athletic Meet during high school or played regularly (n=13, elite group: ELI) and those who were bench warmers (n=14, skilled group: SKI). Horizontal eye movement and oxy-, deoxy-, and total-hemoglobin (Hb) concentration in the prefrontal cortex during pro- and anti-saccade were measured using electro-oculography and near-infrared spectroscopy, respectively. Only error rate in anti-saccade was less in ELI (4.8+/-4.0%) than SKI (13.7+/-12.6%) and CON (13.9+/-8.3%) (p<0.05). In ELI alone, oxy- (-0.15+/-0.18 mmol*mm) and total-Hb (-0.12+/-0.15 mmol*mm) during anti-saccade decreased significantly compared with that during rest (p<0.05), while those in CON significantly increased (oxy-Hb: 0.17+/-0.15 mmol*mm, total-Hb: 0.14+/-0.14 mmol*mm) (p<0.05). These results suggest that inhibition of eye movement to a visual target changes from voluntary to automatic through the motor learning of basketball. PMID:19569008

  10. Nucleosomal regulation of chromatin composition and nuclear assembly revealed by histone depletion.


    Zierhut, Christian; Jenness, Christopher; Kimura, Hiroshi; Funabiki, Hironori


    Nucleosomes are the fundamental unit of chromatin, but analysis of transcription-independent nucleosome functions has been complicated by the gene-expression changes resulting from histone manipulation. Here we solve this dilemma by developing Xenopus laevis egg extracts deficient for nucleosome formation and by analyzing the proteomic landscape and behavior of nucleosomal chromatin and nucleosome-free DNA. We show that although nucleosome-free DNA can recruit nuclear-envelope membranes, nucleosomes are required for spindle assembly and for formation of the lamina and of nuclear pore complexes (NPCs). We show that, in addition to the Ran G-nucleotide exchange factor RCC1, ELYS, the initiator of NPC formation, fails to associate with naked DNA but directly binds histone H2A-H2B dimers and nucleosomes. Tethering ELYS and RCC1 to DNA bypasses the requirement for nucleosomes in NPC formation in a synergistic manner. Thus, the minimal essential function of nucleosomes in NPC formation is to recruit RCC1 and ELYS. PMID:24952593

  11. Amplification of ultra-short laser pulses via resonant backward Raman amplification in plasma

    NASA Astrophysics Data System (ADS)

    Mishra, S. K.; Andreev, A.


    In this paper, we have examined the possibility of using resonant backward Raman amplification (BRA) as an efficient mechanism in amplifying the low intensity ultra-short ( ≤ fs ) pulses using plasma as intermediate amplifying medium; such pulses are anticipated to get produced in the form of the secondary sources at ALPS (Attosecond Light Pulse Source) center of ELI (Extreme Light Infrastructure). In preliminary assessment of the scheme, the analytical expressions for the pump/seed laser pulses and plasma characteristic features are obtained which concisely describe the parameter regime of resonant BRA applicability in achieving significant amplification. The consistency of the scheme in the context of ELI-ALPS sources has been validated through particle in cell (PIC) simulations. The peak intensity of the amplified seed pulse predicted via simulation results is found in reasonable agreement with the analytical estimates. Utilizing these analytical expressions as a basis in perspective of ELI-ALPS parameter access, a specific example displaying the key plasma and laser parameters for amplifying weak seed pulse has been configured; the limitations and conceivable remedies in resonant BRA implementation have also been highlighted.

  12. The Development of a Roof Integrated Solar Hot Water System

    SciTech Connect

    Menicucci, David F.; Moss, Timothy A.; Palomino, G. Ernest


    The Salt River Project (SRP), in conjunction with Sandia National Laboratories (SNL) and Energy Laboratories, Inc. (ELI), collaborated to develop, test, and evaluate an advanced solar water-heating product for new homes. SRP and SNL collaborated under a Department of Energy Cooperative Research and Development Agreement (CRADA), with ELI as SRP's industry partner. The project has resulted in the design and development of the Roof Integrated Thermal Siphon (RITH) system, an innovative product that features complete roof integration, a storage tank in the back of the collector and below the roofline, easy installation by homebuilders, and a low installed cost. SRP's market research guided the design, and the laboratory tests conducted at SNL provided information used to refine the design of field test units and indicated that the RITH concept is viable. ELI provided design and construction expertise and is currently configured to manufacture the units. This final report for the project provides all of the pertinent and available materials connected to the project including market research studies, the design features and development of the system, and the testing and evaluation conducted at SNL and at a model home test site in Phoenix, Arizona.

  13. Pennsylvanian-Permian Antler foreland of eastern Nevada

    SciTech Connect

    Snyder, W.S. . Dept. of Geosciences); Trexler, J.H. Jr. . Dept. of Geological Sciences)


    Models for the Antler foreland generally assume that it was a Mississippian feature dominated by a single, large basin (the Antler foredeep). Recent work indicates that the foreland, as a tectonic region, is longer-lived, and is better described as a series of sub-basins separated by intervening structural highs. Long sections reveal space/time changes in depositional facies and sedimentologic features indicative or suggestive of this repeated tectonism. For example, in the southern Pancake Range, the fluvial-deltaic clastic units of the Late Mississippian-earliest Pennsylvanian Neward Canyon sequence are overlain by 540 m of cyclical Pennsylvanian Ely Limestone. The flooding event that marks the boundary between these units occurs during a long-term 2nd order eustatic low stand and thus reflects the regional tectonism that created the Ely basin'. Further, tectonically driven subsidence seems necessary to sustain deposition of the thick of marginal marine-open shelf Ely Limestone at this locality. Regionally, Early Permian deposition within the Dry Mountain trough was dominated by a complex series of local tectonic controls. Within eastern Nevada, tectonic influences on the stratigraphy continued through at least the Middle Permian, and this tectonism perhaps merged with that of the classic Late Permian-Early Triassic Sonoma orogeny. One consequence of this protracted tectonism was development or reactivation of zones of structural weakness that fragmented the foreland into a series of basins and highs and that accommodated differing geometries and styles of deformation.

  14. New frontiers in nuclear physics with high-power lasers and brilliant monochromatic gamma beams

    NASA Astrophysics Data System (ADS)

    Gales, S.; Balabanski, D. L.; Negoita, F.; Tesileanu, O.; Ur, C. A.; Ursescu, D.; Zamfir, N. V.


    The development of high power lasers and the combination of such novel devices with accelerator technology has enlarged the science reach of many research fields, in particular particle and nuclear physics, astrophysics as well as societal applications in material science, nuclear energy and applications for medicine. The European Strategic Forum for Research Infrastructures has selected a proposal based on these new premises called the Extreme Light Infrastructure (ELI). The ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for nuclear physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense low-energy gamma beam, a combination of laser and accelerator technology at the frontier of knowledge. This unique combination of beams that are unique worldwide allows us to develop an experimental program in nuclear physics at the frontiers of present-day knowledge as well as society driven applications. In the present paper, the technical description of the facility as well as the new perspectives in nuclear structure, nuclear reactions and nuclear astrophysics will be presented.

  15. Revival of pure titanium for dynamically loaded porous implants using additive manufacturing.


    Wauthle, Ruben; Ahmadi, Seyed Mohammad; Amin Yavari, Saber; Mulier, Michiel; Zadpoor, Amir Abbas; Weinans, Harrie; Van Humbeeck, Jan; Kruth, Jean-Pierre; Schrooten, Jan


    Additive manufacturing techniques are getting more and more established as reliable methods for producing porous metal implants thanks to the almost full geometrical and mechanical control of the designed porous biomaterial. Today, Ti6Al4V ELI is still the most widely used material for porous implants, and none or little interest goes to pure titanium for use in orthopedic or load-bearing implants. Given the special mechanical behavior of cellular structures and the material properties inherent to the additive manufacturing of metals, the aim of this study is to investigate the properties of selective laser melted pure unalloyed titanium porous structures. Therefore, the static and dynamic compressive properties of pure titanium structures are determined and compared to previously reported results for identical structures made from Ti6Al4V ELI and tantalum. The results show that porous Ti6Al4V ELI still remains the strongest material for statically loaded applications, whereas pure titanium has a mechanical behavior similar to tantalum and is the material of choice for cyclically loaded porous implants. These findings are considered to be important for future implant developments since it announces a potential revival of the use of pure titanium for additively manufactured porous implants.

  16. Revival of pure titanium for dynamically loaded porous implants using additive manufacturing.


    Wauthle, Ruben; Ahmadi, Seyed Mohammad; Amin Yavari, Saber; Mulier, Michiel; Zadpoor, Amir Abbas; Weinans, Harrie; Van Humbeeck, Jan; Kruth, Jean-Pierre; Schrooten, Jan


    Additive manufacturing techniques are getting more and more established as reliable methods for producing porous metal implants thanks to the almost full geometrical and mechanical control of the designed porous biomaterial. Today, Ti6Al4V ELI is still the most widely used material for porous implants, and none or little interest goes to pure titanium for use in orthopedic or load-bearing implants. Given the special mechanical behavior of cellular structures and the material properties inherent to the additive manufacturing of metals, the aim of this study is to investigate the properties of selective laser melted pure unalloyed titanium porous structures. Therefore, the static and dynamic compressive properties of pure titanium structures are determined and compared to previously reported results for identical structures made from Ti6Al4V ELI and tantalum. The results show that porous Ti6Al4V ELI still remains the strongest material for statically loaded applications, whereas pure titanium has a mechanical behavior similar to tantalum and is the material of choice for cyclically loaded porous implants. These findings are considered to be important for future implant developments since it announces a potential revival of the use of pure titanium for additively manufactured porous implants. PMID:26046272

  17. Saccades and prefrontal hemodynamics in basketball players.


    Fujiwara, K; Kiyota, N; Maekawa, M; Kunita, K; Kiyota, T; Maeda, K


    We investigated saccade performance and prefrontal hemodynamics in basketball players with different skill levels. Subjects were 27 undergraduate basketball players and 13 non-athlete undergraduates (control group: CON). The players were divided into two groups: those who had played in the National Athletic Meet during high school or played regularly (n=13, elite group: ELI) and those who were bench warmers (n=14, skilled group: SKI). Horizontal eye movement and oxy-, deoxy-, and total-hemoglobin (Hb) concentration in the prefrontal cortex during pro- and anti-saccade were measured using electro-oculography and near-infrared spectroscopy, respectively. Only error rate in anti-saccade was less in ELI (4.8+/-4.0%) than SKI (13.7+/-12.6%) and CON (13.9+/-8.3%) (p<0.05). In ELI alone, oxy- (-0.15+/-0.18 mmol*mm) and total-Hb (-0.12+/-0.15 mmol*mm) during anti-saccade decreased significantly compared with that during rest (p<0.05), while those in CON significantly increased (oxy-Hb: 0.17+/-0.15 mmol*mm, total-Hb: 0.14+/-0.14 mmol*mm) (p<0.05). These results suggest that inhibition of eye movement to a visual target changes from voluntary to automatic through the motor learning of basketball.

  18. Detection of Hemolysin Variants of Shiga Toxin-Producing Escherichia coli by PCR and Culture on VancomycinCefixime-Cefsulodin Blood Agar

    PubMed Central

    Lehmacher, Anselm; Meier, Heidi; Aleksic, Stojanka; Bockemühl, Jochen


    The presence of a hemolysin-encoding gene, elyA or hlyA, from Shiga toxin-producing Escherichia coli (STEC) was detected by PCR in each of 95 strains tested. PCR products of elyA from human STEC isolates of serovars frequently detected in Germany, such as O157:H−, O103:H2, O103:H−, O26:H11, and O26:H−, showed nucleotide sequences identical to previously reported ones for O157:H7 and O111:H− strains. Compared to them, four elyA amplicons derived from human isolates of rare STEC serovars showed identity of about 98% but lacked an AluI restriction site. However, the nucleotide sequence of an amplicon derived from a porcine O138:K81:H− STEC strain was identical to the corresponding region of hlyA, encoding alpha-hemolysin, from E. coli. This hlyA amplicon showed 68% identity with the nucleotide sequence of the corresponding elyA fragment. It differed from the elyA PCR product in restriction fragments generated by AluI, EcoRI, and MluI. Of the 95 representative STEC strains, 88 produced hemolysin on blood agar supplemented with vancomycin (30 mg/liter), cefixime (20 μg/liter), and cefsulodin (3 mg/liter) (BVCC). The lowest added numbers of two to six STEC CFU per g of stool or per ml of raw milk were detectable on BVCC plates after seeding of the preenrichment broth, modified tryptic soy broth (mTSB) supplemented with novobiocin (10 mg/liter), with 16 STEC strains. These strains represented the seven prevailing serovars diagnosed from German patients. However, with ground-beef samples, PCR was essential to identify the lowest added numbers of two to six STEC CFU among colonies of hemolyzing Enterobacteriaceae, such as Serratia spp. and alpha-hemolysin-producing E. coli. We conclude that preenrichment of stool and food samples in mTSB for 6 h followed by overnight culturing on BVCC is a simple method for the isolation and presumptive identification of STEC. PMID:9647814

  19. Strike-Slip displacement along the Furnace Creek Fault Zone, southern Basins and Ranges, Death Valley, California

    NASA Astrophysics Data System (ADS)

    Baucke, W.; Cemen, I.


    The southern Basins and Ranges contain several strike-slip fault zones in addition to predominant normal faults. One of the strike-slip faults is the Furnace Creek fault zone (FCFZ) which extends from the Amor¬gosa Valley in eastern California northwestward continuously about 200 km and termi¬nates in the Fish Lake Valley in Nevada. The fault zone is a part of the Eastern California Shear Zone. Although the right-lateral sense of strike-slip movement along the FCFZ is undisputed, the magnitude of displacement has been controversial since the 1970s. Recently, we have mapped conglomerates exposed in the Travertine point area of the Furnace Creek Wash of the Death Valley region. The conglomerates are composed of Paleozoic clasts from the following formations: Bonanza King, Nopah, Pogonip, Eureka Quartzite, Hidden Valley, and Ely Springs Dolomite. Our analysis of these breccias showed that they are made out of clasts of one composition and a matrix that was slightly different. This observation and our microscopic analysis suggest to us that these breccias were formed as fault breccias along the Furnace Creek fault zone. We have also mapped breccias in the Desolation Canyon on the southwestern side of the FCFZ where the Bonanza King Formation is brought into structural contact over the Ely Spring Dolomite and Eureka Quartzite suggesting the presence of a thrust fault. We correlate this thrust fault with a similar structural setting along the Clery Thrust of the southern Funeral Mountains on northeastern sides of the FCFZ where the Clery thrust brings the Cambrian Bonanza King Formation over the Eureka Quartzite and Ely Spring Dolomite in the southern Funeral Mountains. These observations suggest to us that the thrust fault in the Desolation Canyon area is the continuation of the Clery Thrust of the southern Funeral Mountains. If this interpretation is correct, the strike-slip displacement along the FCFZ is about 30 km.

  20. Reporting on Climate Change: Understanding the Science, Third Edition

    SciTech Connect

    Ward, Morris A.; Parker, Elissa A.


    The Environmental Law Institute, the grantee, in the final quarter of operation under Department of Energy Grant DE-FG02-02ER63414, successfully completed the following tasks associated with the grant: (1) published ''Reporting on Climate Change: Understanding the Science'', the third edition of this resource intended primarily to help print and broadcast journalists report more effectively on scientific aspects of global climate change; (2) distributed the reporters guide directly to roughly 500 journalists and journalism educators participating in the annual meeting of the Society of Environmental Journalists in New Orleans, La.; (3) distributed the reporters guide to an additional 1,500 journalists and journalism educators by mail; (4) provided journalism educators bulk copies, upon specific request, for their use in upper-level science journalism and environmental journalism classes; (5) conducted outreach to science editors and environmental reporters on availability and use of the reporter's guide; (6) completed financial reporting associated with the reporter's guide grant. ELI has provided requested bulk numbers of copies of ''Reporting on Climate Change: Understanding the Science'' to the DOE Project Officer, David C. Bader, Ph.D., and to Jeffrey Amthor, Ph.D., in the Office of Science. ELI currently has a remaining inventory of roughly 500 copies from the original printing of more than 3,000 copies of the guide. These copies are used for responding to continuing requests from journalists and educators for the guide. ELI is currently exploring opportunities for reprinting additional copies to help meet the continuing demand from the educational and journalism communities.

  1. High heterogeneity and low reliability in the diagnosis of major depression will impair the development of new drugs

    PubMed Central

    Castle, David J.; Pantelis, Christos; Hopwood, Malcolm; Young, Allan Hunter; Everall, Ian P.


    Summary Major depressive disorder is a common diagnosis associated with a high burden of disease that has proven to be highly heterogeneous and unreliable. Treatments currently available demonstrate limited efficacy and effectiveness. New drug development is urgently required but is likely to be hindered by diagnostic limitations. Declarations of interest D.J.C. has received grants and personal fees from Eli Lilly, Janssen-Cilag, Roche, Allergen, Bristol-Myers Squibb, Pfizer, Lundbeck, AstraZeneca, Hospira, Organon, Sanofi-Aventis, and Wyeth during the writing of this review. C.P. has received grant support from Janssen-Cilag, Eli Lilly, Hospira (Mayne), AstraZeneca, and received honoraria for consultancy to Janssen-Cilag, Eli Lilly, Hospira (Mayne), AstraZeneca, Pfizer, Schering Plough, and Lundbeck. Over the past 2 years he has participated on advisory boards for Janssen-Cilag and Lundbeck, and received honoraria for talks presented at educational meetings organised by AstraZeneca, Janssen-Cilag and Lundbeck. M.H. has received personal fees or grants from Lundbeck, AstraZeneca and Servier during the writing of this review. A.H.Y. reports personal fees from Lundbeck, Sunovion, AstraZeneca and Janssen outside the submitted work. I.P.E. has received personal fees or grants from Lundbeck, AstraZeneca, and Abbvie during the writing of this review. Copyright and usage © The Royal College of Psychiatrists 2015. This is an open access article distributed under the terms of the Creative Commons Non-Commercial, No Derivatives (CC BY-NC-ND) licence. PMID:27703745

  2. Real-space indicators for chemical bonding. Experimental and theoretical electron density studies of four deltahedral boranes.


    Mebs, Stefan; Kalinowski, Roman; Grabowsky, Simon; Förster, Diana; Kickbusch, Rainer; Justus, Eugen; Morgenroth, Wolfgang; Paulmann, Carsten; Luger, Peter; Gabel, Detlef; Lentz, Dieter


    In an approach combining high-resolution X-ray diffraction at low temperatures with density functional theory calculations, two closo-borates, B(12)H(12)(2-) (1) and B(10)H(10)(2-) (2), and two arachno-boranes, B(10)H(12)L(2) [L = amine (3) or acetonitrile (4)], were analyzed by means of the atoms-in-molecules (AIM) theory and electron localizability indicator (ELI-D). The two-electron three-center (2e3c) bonds of the borane cages are investigated with the focus on real-space indicators for chemical bonding and electron delocalization. In compound 2, only two of the three expected bond critical points (bcp's) are found. However, a weakly populated ELI-D basin is found for this pair of adjacent B atoms and the delocalization index and the Source contributions are on the same order of magnitude as those for the other pairs. The opposite situation is found in the arachno-boranes, where no ELI-D basins are found for two types of B-B pairs, which, in turn, exhibit a bcp. However, again the delocalization index is on the same order of magnitude for this bonding interaction. The results show that an unambiguous real-space criterion for chemical bonding is not given yet for this class of compounds. The arachno-boranes carry a special B-B bond, which is the edge of the crown-shaped molecule. This bond is very long and extremely curved inward the B-B-B ring. Nevertheless, the corresponding bond ellipticity is quite small and the ELI-D value at the attractor position of the disynaptic valence basin is remarkably larger than those for all other B-B valence basins. Furthermore, the value of the ED is large in relation to the B-B bond length, so that only this bond type does not follow a linear relationship of the ED value at the bcp versus B-B bond distances, which is found for all other B-B bcp's. The results indicate that both 2e2c and 2e3c bonding play a distinct role in borane chemistry. PMID:21114266

  3. Validated stability-indicating HPLC method for the determination of pridinol mesylate. Kinetics study of its degradation in acid medium.


    Bianchini, Romina M; Castellano, Patricia M; Kaufman, Teodoro S


    The stability of pridinol mesylate (PRI) was investigated under different stress conditions, including hydrolytic, oxidative, photolytic and thermal, as recommended by the ICH guidelines. Relevant degradation was found to take place under acidic (0.1N HCl) and photolytic (visible and long-wavelength UV-light) conditions, both yielding the product resulting from water elimination (ELI), while submission to an oxidizing environment gave the N-oxidation derivative (NOX). The standards of these degradation products were synthesized and characterized by IR, (1)H and (13)C NMR spectroscopy. A simple, sensitive and specific HPLC method was developed for the quantification of PRI, ELI and NOX in bulk drug, and the conditions were optimized by means of a statistical design strategy. The separation employs a C(18) column and a 51:9:40 (v/v/v) mixture of MeOH, 2-propanol and potassium phosphate solution (50mM, pH 6.0), as mobile phase, delivered at 1.0 ml min(-1); the analytes were detected and quantified at 220 nm. The method was validated, demonstrating to be accurate and precise (repeatability and intermediate precision levels) within the corresponding linear ranges of PRI (0.1-1.5 mg ml(-1); r=0.9983, n=18) and both impurities (0.1-1.3% relative to PRI, r=0.9996 and 0.9995 for ELI and NOX, respectively, n=18). Robustness against small modifications of pH and percentage of the aqueous mobile phase was ascertained and the limits of quantification of the analytes were also determined (0.4 and 0.5 microg ml(-1); 0.04% and 0.05% relative to PRI for ELI and NOX, respectively). Peak purity indices (>0.9997), obtained with the aid of diode-array detection, and satisfactory resolution (R(s)>2.0) between PRI and its impurities established the specificity of the determination, all these results proving the stability-indicating capability of the method. The kinetics of the degradation of PRI in acid medium was also studied, determining that this is a first-order process with regards


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey



    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  6. Preliminary results of sequential extraction experiments for selenium on mine waste and stream sediments from Vermont, Maine, and New Zealand

    USGS Publications Warehouse

    Piatak, N.M.; Seal, R.R.; Sanzolone, R.F.; Lamothe, P.J.; Brown, Z.A.


    We report the preliminary results of sequential partial dissolutions used to characterize the geochemical distribution of selenium in stream sediments, mine wastes, and flotation-mill tailings. In general, extraction schemes are designed to extract metals associated with operationally defined solid phases. Total Se concentrations and the mineralogy of the samples are also presented. Samples were obtained from the Elizabeth, Ely, and Pike Hill mines in Vermont, the Callahan mine in Maine, and the Martha mine in New Zealand. These data are presented here with minimal interpretation or discussion. Further analysis of the data will be presented elsewhere.

  7. Software Reuse Issues

    NASA Technical Reports Server (NTRS)

    Voigt, Susan J. (Editor); Smith, Kathryn A. (Editor)


    NASA Langley Research Center sponsored a Workshop on NASA Research in Software Reuse on November 17-18, 1988 in Melbourne, Florida, hosted by Software Productivity Solutions, Inc. Participants came from four NASA centers and headquarters, eight NASA contractor companies, and three research institutes. Presentations were made on software reuse research at the four NASA centers; on Eli, the reusable software synthesis system designed and currently under development by SPS; on Space Station Freedom plans for reuse; and on other reuse research projects. This publication summarizes the presentations made and the issues discussed during the workshop.

  8. Experiences of aging among immigrants from India to the United States: social work practice in a global context.


    Bhattacharya, Gauri; Shibusawa, Tazuko


    The aging of immigrants is a critical component in the health dynamics of the nation's aging population. To date, few studies have addressed within-group diversity and linked contemporary contexts of global connectedness with the aging experiences of older immigrants. This study aims to conceptually understand the diversity in aging dynamics within a specific immigrant group: Indian immigrants in New York City. The impact of globalization and transnational connection on aging experiences on 2 within groups-Indians who came to the United States at age of 65 or older (LLIs) and those who came at an early age (ELIs) are analyzed. Implications for social work practice, research and policy are discussed.

  9. The influence of composition, annealing treatment, and texture on the fracture toughness of Ti-5Al-2.5Sn plate at cryogenic temperatures

    NASA Technical Reports Server (NTRS)

    Vanstone, R. H.; Shannon, J. L., Jr.; Pierce, W. S.; Low, J. R., Jr.


    The plane strain fracture toughness K sub Ic and conventional tensile properties of two commercially produced one-inch thick Ti-5Al-2.5Sn plates were determined at cryogenic temperatures. One plate was extra-low interstitial (ELI) grade, the other normal interstitial. Portions of each plate were mill annealed at 1088 K (1500 F) followed by either air cooling or furnace cooling. The tensile properties, flow curves, and K sub Ic of these plates were determined at 295 K (room temperature), 77 K (liquid nitrogen temperature), and 20 K (liquid hydrogen temperature).


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  11. 6. South View of Whitneyville in Hamden, 1836 by John ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    6. South View of Whitneyville in Hamden, 1836 by John Warner Barber Photocopied from John Warner Barber, Connecticut Historical Collections (New Haven, 1856), p. 220. 'The engraving... shows the appearance of the little village of Whitneyville, as seen from a few rods south, on the New Haven road.' (Barber, p. 219). The right fork, with Ithiel Town's truss, carries the New Haven & Hartford Turnpike, the left the Cheshire Turnpike. The factory is on the right, the village on the left. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  12. 10. Whitney Arms Company, Van Slyck steel engraving, 1880 Photocopied ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    10. Whitney Arms Company, Van Slyck steel engraving, 1880 Photocopied from Charles B. Norton, American Inventions and Improvements in Breech-Loading Small Arms (Springfield, Mass., 1880), p. 154 The engraving does not seem to have been included in the earlier 1872 edition. This is probably the single most widely copied view of the Whitney Arms Company works, and it is without doubt the most accurate. Compare with site plan, photo CT-2-13. - Eli Whitney Armory, West of Whitney Avenue, Armory Street Vicinity, Hamden, New Haven County, CT

  13. Alterations in dorsal and ventral posterior cingulate connectivity in APOE ε4 carriers at risk of Alzheimer's disease

    PubMed Central

    Phal, Pramit M.; Steward, Chris; Moffat, Bradford A.; Salinas, Simon; Cox, Kay L.; Ellis, Kathryn A.; Cyarto, Elizabeth V.; Ames, David; Martins, Ralph N.; Masters, Colin L.; Rowe, Christopher C.; Sharman, Matthew J.; Salvado, Olivier; Szoeke, Cassandra; Lai, Michelle; Lautenschlager, Nicola T.; Desmond, Patricia M.


    Background Recent evidence suggests that exercise plays a role in cognition and that the posterior cingulate cortex (PCC) can be divided into dorsal and ventral subregions based on distinct connectivity patterns. Aims To examine the effect of physical activity and division of the PCC on brain functional connectivity measures in subjective memory complainers (SMC) carrying the epsilon 4 allele of apolipoprotein E (APOE ε4) allele. Method Participants were 22 SMC carrying the APOE ε4 allele (ε4+; mean age 72.18 years) and 58 SMC non-carriers (ε4–; mean age 72.79 years). Connectivity of four dorsal and ventral seeds was examined. Relationships between PCC connectivity and physical activity measures were explored. Results ε4+ individuals showed increased connectivity between the dorsal PCC and dorsolateral prefrontal cortex, and the ventral PCC and supplementary motor area (SMA). Greater levels of physical activity correlated with the magnitude of ventral PCC–SMA connectivity. Conclusions The results provide the first evidence that ε4+ individuals at increased risk of cognitive decline show distinct alterations in dorsal and ventral PCC functional connectivity. Declaration of interest D.A. has served on scientific advisory boards for Novartis, Eli Lilly, Janssen, Prana and Pfizer, and as Editor-in-Chief for International Psychogeriatrics; received speaker honoraria from Pfizer and Lundbeck, and research support from Eli Lilly, GlaxoSmithKline, Forest Laboratories, Novartis, and CSIRO. C.L.M. has received consulting fees from Eli Lilly and Prana Biotechnology, and has stock ownership in Prana Biotechnology. C.C.R. has received consultancy payments from Roche and Piramal, and research support from Avid Radiopharmaceuticals, Eli Lilly, GE Healthcare, Piramal and Navidea for amyloid imaging. C.S. has provided clinical consultancy and been on scientific advisory committees for the Australian CSIRO, Alzheimer's Australia, University of Melbourne and other

  14. Properties of Hot Pressed Titanium Alloy Powders for Cryogenic Applications.

    NASA Technical Reports Server (NTRS)

    Friedman, G. I.; Kazaroff, J. M.


    Evaluation of strength and toughness of hot-pressed titanium alloy powders at room and at cryogenic temperatures. The purpose was to determine how the mechanical properties of solid bodies formed from powder would compare with wrought specimens of the same size and with the same chemical analysis. It was found that of five titanium powder-making processes investigated, only the Rotating Electrode Process (REP) was capable of producing ELI-grade titanium alloy powder. Blocks hot-pressed from spherical REP powders had tensile properties equivalent to or better than those obtained from wrought bar.

  15. Design and development of the HELL user station: beam transport, characterization, and shielding

    NASA Astrophysics Data System (ADS)

    Grittani, Gabriele Maria; Levato, Tadzio; Krus, Miroslav; Fasso, Alberto; Jeong, Tae Moon; Kim, Hyung Taek; Margarone, Daniele; Mocek, Tomáś; Precek, Martin; Versaci, Roberto; Korn, Georg


    In the framework of the ELI-Beamlines project, the HELL (High energy ELectron by Laser) platform will host an electron beamline with a dual aim: to explore innovative concepts of laser driven electron acceleration and to deliver a stable and reliable electron beam to external users, according to their specific needs. Because of this, it is crucial to identify the possible applications and their respective range of parameters. In order to accomplish this goal, Monte Carlo simulations of electron radiography and radiotherapy are performed and discussed. Once identified those parameter spaces, a beam transport line is studied and presented for each energy range. Finally, beam diagnostics are discussed.

  16. Fracture control of H-O engine components. [titanium tin alloy fuel pump impellers

    NASA Technical Reports Server (NTRS)

    Ryder, J. T.


    An investigation was made to obtain the material characterization and fatigue crack propagation data necessary to establish the salient characteristics of a Ti-6Al-2.5Sn(ELI) alloy fuel pump impeller to be used in a cryogenic service environment. Testing variables considered were: coupon orientation, frequency, load range ratio, and temperature. Data analysis correlated crack propagation data from conventional laboratory coupons with data from a parallel sided rotating disk used to model rotor stresses. Four major design recommendations when bore regions of fuel pump impellers to be operated in cryogenic environments are to be relatively highly stressed are discussed.

  17. Dynamic Young's moduli of space materials at low temperatures

    NASA Astrophysics Data System (ADS)

    Zhang, Z.; Zhao, L. Z.; Tu, Z. H.; Zhang, P. Q.

    Using vibration analysis methods, the dynamic mechanical properties of space materials at low temperatures (from 4.2 to 300 K) are studied in this paper. System identification techniques in the time domain are used to identify the dynamic parameters of the space materials Ti-5Al-2.5Sn extra-low-interstitial (ELI) alloy and Al-2.5Li-1.3Cu-0.9Mg-0.13Zr (Al-Li) alloy. The dynamic Young's moduli of these materials are calculated using the basic natural frequencies at different temperatures.

  18. Urban, Forest, and Agricultural AIS Data: Fine Spectral Structure

    NASA Technical Reports Server (NTRS)

    Vanderbilt, V. C.


    Spectra acquired by the Airborne Imaging Spectrometer (AIS) near Lafayette, IN, Ely, MN, and over the Stanford University campus, CA were analyzed for fine spectral structure using two techniques: the ratio of radiance of a ground target to the radiance of a standard and also the correlation coefficient of radiances at adjacent wavelengths. The results show ramp like features in the ratios. These features are due to the biochemical composition of the leaf and to the optical scattering properties of its cuticle. The size and shape of the ramps vary with ground cover.

  19. Design of the ELIMAIA ion collection system

    NASA Astrophysics Data System (ADS)

    Schillaci, F.; Cirrone, G. A. P.; Cuttone, G.; Maggiore, M.; Andó, L.; Amato, A.; Costa, M.; Gallo, G.; Korn, G.; Larosa, G.; Leanza, R.; Manna, R.; Margarone, D.; Milluzzo, G.; Pulvirenti, S.; Romano, F.; Salamone, S.; Sedita, M.; Scuderi, V.; Tramontana, A.


    A system of permanent magnet quadrupoles (PMQs) is going to be realized by INFN-LNS to be used as a collection system for the injection of laser driven ion beams up to 60 MeV/u in an energy selector based on four resistive dipoles. This system is the first element of the ELIMED (ELI-Beamlines MEDical and Multidisciplinary applications) beam transport, dosimetry and irradiation line that will be developed by INFN-LNS (It) and installed at the ELI-Beamlines facility in Prague (Cz). ELIMED will be the first user's open transport beam-line where a controlled laser-driven ion beam will be used for multidisciplinary researches. The definition of well specified characteristics, both in terms of performances and field quality, of the magnetic lenses is crucial for the system realization, for the accurate study of the beam dynamics and for the proper matching with the magnetic selection system which will be designed in the next months. Here, we report the design of the collection system and the adopted solutions in order to realize a robust system form the magnetic point of view. Moreover, the first preliminary transport simulations are also described.

  20. MRSA Pediatric clone expressing ermC plus lnuA genes causing nosocomial transmission and healthcare workers colonization in a neonatal intensive care unit.


    Faccone, Diego; Togneri, Ana M; Podesta, Laura; Perez, Marcela; Gagetti, Paula; Sanchez, Susana; Romero, Graciela; Corso, Alejandra


    Methicillin-resistant Staphylococcus aureus (MRSA) is a major cause of both nosocomial and community-acquired infections. We describe an outbreak caused by the MRSA Pediatric clone expressing an unusual lincosamide resistant phenotype. Between January and May 2006, an MRSA outbreak was detected at the Neonatal Unit of Hospital Interzonal General de Agudos "Evita", Buenos Aires Province, Argentina that affected ten patients. Seven isolates from seven patients plus five MRSA recovered from health care workers (nasal carriage) were studied. Two phenotypes were observed: (i) ELCi (10), resistance to erythromycin and lincomycin and inducible resistance to clindamycin; (ii) ELiCi (2), resistance to erythromycin and inducible resistance to lincomycin and clindamycin. All 12 MRSA were resistant to oxacillin, erythromycin and gentamicin. Isolates expressing the ELCi-phenotype showed lincomycin MIC values between 16 and 32mg/L, while the remaining 2 isolates with ELiCi-phenotype presented a MIC value of 0.5mg/L. No differences were observed between the clindamycin MIC values in both phenotypes, ranging 0.25-0.5mg/L. Isolates showing ELCi-phenotype harbored ermC plus lnuA genes, and the other two only ermC gene. All 12 isolates were genetically related and belonged to the Pediatric clone (ST100) harboring a new variant of SCCmecIV. This is the first MRSA outbreak expressing an unusual ELCi phenotype due to a combination of ermC plus lnuA genes.

  1. How do electron localization functions describe π-electron delocalization?


    Steinmann, Stephan N; Mo, Yirong; Corminboeuf, Clemence


    Scalar fields provide an intuitive picture of chemical bonding. In particular, the electron localization function (ELF) has proven to be highly valuable in interpreting a broad range of bonding patterns. The discrimination between enhanced or reduced electron (de)localization within cyclic π-conjugated systems remains, however, challenging for ELF. In order to clearly distinguish between the local properties of ten highly and weakly π-(de)localized prototype systems, we compare the ELFs of both the canonical wave functions and electron-localized states (diabatic) with those of two closely related scalar fields: the electron localizability indicator (ELI-D) and the localized orbital locator (LOL). The simplest LOL function distinguishes enhanced from weak π-(de)localization in an insightful and reliable manner. LOL offers the finest contrast between annulenes with 4n/4n + 2 π electrons and their inorganic analogues as well as between hyperconjugated cyclopentadiene derivatives. LOL(π) also gives an appealing and intuitive picture of the π-bond. In contrast, the most popular ELF fails to capture subtle contrasting local electronic properties and suffers from the arbitrariness of the σ/π dissection. The orbital separation of the most recent ELI-D is clear-cut but the interpretations sometime less straightforward in the present context. PMID:21660323

  2. Surface modification by alkali and heat treatments in titanium alloys.


    Lee, Baek-Hee; Do Kim, Young; Shin, Ji Hoon; Hwan Lee, Kyu


    Pure titanium and titanium alloys are normally used for orthopedic and dental prostheses. Nevertheless, their chemical, biological, and mechanical properties still can be improved by the development of new preparation technologies. This has been the limiting factor for these metals to show low affinity to living bone. The purpose of this study is to improve the bone-bonding ability between titanium alloys and living bone through a chemically activated process and a thermally activated one. Two kinds of titanium alloys, a newly designed Ti-In-Nb-Ta alloy and a commercially available Ti-6Al-4V ELI alloy, were used in this study. In this study, surface modification of the titanium alloys by alkali and heat treatments (AHT), alkali treated in 5.0M NaOH solution, and heat treated in vacuum furnace at 600 degrees C, is reported. After AHT, the effects of the AHT on the bone integration property were evaluated in vitro. Surface morphologies of AHT were observed by optical microscopy (OM) and scanning electron microscopy (SEM). Chemical compositional surface changes were investigated by X-ray diffractometry (XRD), energy dispersive spectroscopy (EDS), and auger electron spectroscopy (AES). Titanium alloys with surface modification by AHT showed improved bioactive behavior, and the Ti-In-Nb-Ta alloy had better bioactivity than the Ti-6Al-4V ELI alloy in vitro.

  3. Effect of grain size on high-cycle fatigue properties in alpha-type titanium alloy at cryogenic temperatures

    NASA Astrophysics Data System (ADS)

    Ono, Y.; Yuri, T.; Sumiyoshi, H.; Matsuoka, S.; Ogata, T.


    High-cycle fatigue properties were investigated at 4, 77 and 293 K in Ti-5%Al-2.5%Sn ELI alloy which was used for liquid hydrogen turbo-pumps of Japanese-built launch vehicles. Mean grain size of specimens was controlled to be about 30 or 80 μm. In the specimens with a grain size of 30 μm, fatigue strengths at 10 6 cycles at 4 and 77 K are 1.6 and 1.5 times higher than that at 293 K, respectively. On the other hand, in the specimen with a grain size of 80 μm, fatigue strengths at 10 6 cycles at 4 and 77 K get lower to the same level as that at 293 K. Thus, it is concluded that refinement of α grains is one of important factors to obtain the good high-cycle fatigue properties for Ti-5%Al-2.5%Sn ELI alloy at cryogenic temperature.

  4. Drotrecogin alfa (activated)...a sad final fizzle to a roller-coaster party.


    Angus, Derek C


    Following the failure of PROWESS-SHOCK to demonstrate efficacy, Eli Lilly and Company withdrew drotrecogin alfa (activated) from the worldwide market. Drotrecogin was initially approved after the original trial, PROWESS, was stopped early for overwhelming efficacy. These events prompt consideration of both the initial approval decision and the later decision to withdraw. It is regrettable that the initial decision was made largely on a single trial that was stopped early. However, the decision to approve was within the bounds of normal regulatory practice and was made by many approval bodies around the world. Furthermore, the overall withdrawal rate of approved drugs remains very low. The decision to withdraw was a voluntary decision by Eli Lilly and Company and likely reflected key business considerations. Drotrecogin does have important biologic effects, and it is probable that we do not know how best to select patients who would benefit. Overall, there may still be a small advantage to drotrecogin alfa, even used non-selectively, but the costs of determining such an effect with adequate certainty are likely prohibitive, and the point is now moot. In the future, we should consider ways to make clinical trials easier and quicker so that more information can be available in a timely manner when considering regulatory approval. At the same time, more sophisticated selection of patients seems key if we are to most wisely test agents designed to manipulate the septic host response. PMID:22309988

  5. Hydrogen Exchange Mass Spectrometry of Related Proteins with Divergent Sequences: A Comparative Study of HIV-1 Nef Allelic Variants

    NASA Astrophysics Data System (ADS)

    Wales, Thomas E.; Poe, Jerrod A.; Emert-Sedlak, Lori; Morgan, Christopher R.; Smithgall, Thomas E.; Engen, John R.


    Hydrogen exchange mass spectrometry can be used to compare the conformation and dynamics of proteins that are similar in tertiary structure. If relative deuterium levels are measured, differences in sequence, deuterium forward- and back-exchange, peptide retention time, and protease digestion patterns all complicate the data analysis. We illustrate what can be learned from such data sets by analyzing five variants (Consensus G2E, SF2, NL4-3, ELI, and LTNP4) of the HIV-1 Nef protein, both alone and when bound to the human Hck SH3 domain. Regions with similar sequence could be compared between variants. Although much of the hydrogen exchange features were preserved across the five proteins, the kinetics of Nef binding to Hck SH3 were not the same. These observations may be related to biological function, particularly for ELI Nef where we also observed an impaired ability to downregulate CD4 surface presentation. The data illustrate some of the caveats that must be considered for comparison experiments and provide a framework for investigations of other protein relatives, families, and superfamilies with HX MS.

  6. The Development of Titanium Alloys for Application in the Space Shuttle Main Engine

    NASA Technical Reports Server (NTRS)

    Halchak, John A.; Jerman, Gregory A.; Zimmerman, Frank R.


    The high-strength-to-weight ratio of titanium alloys, particularly at cryogenic temperatures, make them attractive for application in rocket engines - offering the potential of superior performance while minimizing component weight. This was particularly attractive for rotating components, such as pump impellers, where titanium alloys presented the potential to achieve a major advance in rotational tip speed, with a reduction in stages and resultant saving in pump weight and complexity. The investigation into titanium alloys for application in cryogenic turbopumps began in the early 1960's. However, it was found that the reactivity of titanium limited applications and produced unique processing challenges. Specialized chemical compositions and processing techniques had to be developed. A substantial amount of material properties testing and trials in experimental turbopumps occurred, ultimately leading to application in the Space Shuttle Main Engine. One particular alloy stood out for use at liquid hydrogen temperatures, Ti-5Al-2.5Sn ELI. This alloy was employed for several critical components. This presentation deals with the development effort, the challenges that were encountered and operational experiences with Ti-5Al-2.5Sn ELI in the SSME.

  7. Terbinafine hydrochloride nanovesicular gel: In vitro characterization, ex vivo permeation and clinical investigation.


    AbdelSamie, Sara M; Kamel, Amany O; Sammour, Omaima A; Ibrahim, Shady M


    In this work, nanovesicular chitosan gels were prepared for dermal delivery of terbinafine hydrochloride (TBN HCl). Ethosomes and vesicles containing different types of penetration enhancers (PEs) viz. Terpenes (cineole and limonene), labrasol and transcutol were developed. The prepared vesicles were evaluated for physical characteristics as well as skin interaction. The selected vesicles were incorporated into chitosan gel. An in vivo animal study was done on rat induced superficial Candida infection model. Moreover, randomized double blind clinical study was done on patients to compare the effect of the selected nanovesicular gel against the market product. Results showed the formation of nearly spherical, mostly deformable vesicular systems with size range of 95.5-530nm, zeta potential range of -0.1 to 15mV and entrapment efficiency range of 20-96.7%. Penetration enhancer vesicles (PEVs) prepared with 4% limonene (ELI4) showed the highest percent of drug deposition in the skin (53%) and the highest local accumulation efficiency value (35.3). In vivo animal study showed that the lowest fungal burden produced with ELI4 chitosan gel. Clinical studies showed cure rate of 86% within 7days treatment in case of limonene nanovesicular gel compared to 20% for market product (Lamisil® cream). PMID:27072432

  8. Drotrecogin alfa (activated)...a sad final fizzle to a roller-coaster party.


    Angus, Derek C


    Following the failure of PROWESS-SHOCK to demonstrate efficacy, Eli Lilly and Company withdrew drotrecogin alfa (activated) from the worldwide market. Drotrecogin was initially approved after the original trial, PROWESS, was stopped early for overwhelming efficacy. These events prompt consideration of both the initial approval decision and the later decision to withdraw. It is regrettable that the initial decision was made largely on a single trial that was stopped early. However, the decision to approve was within the bounds of normal regulatory practice and was made by many approval bodies around the world. Furthermore, the overall withdrawal rate of approved drugs remains very low. The decision to withdraw was a voluntary decision by Eli Lilly and Company and likely reflected key business considerations. Drotrecogin does have important biologic effects, and it is probable that we do not know how best to select patients who would benefit. Overall, there may still be a small advantage to drotrecogin alfa, even used non-selectively, but the costs of determining such an effect with adequate certainty are likely prohibitive, and the point is now moot. In the future, we should consider ways to make clinical trials easier and quicker so that more information can be available in a timely manner when considering regulatory approval. At the same time, more sophisticated selection of patients seems key if we are to most wisely test agents designed to manipulate the septic host response.

  9. Physics with gamma-beams and charged particle detectors: I) Nuclear structure II) Nuclear astrophysics

    SciTech Connect

    Gai, Moshe


    The Charged Particle Working Group (CPWG) is proposing to construct large area Silicon Strip Detector (SSD), a gas Time Projection Chamber detector read by an electronic readout system (eTPC) and a Bubble Chamber (BC) containing superheated high purity water to be used in measurements utilizing intense gamma-ray beams from the newly constructed ELI-NP facility at Magurele, Bucharest in Romania. We intend to use the SSD and eTPC detectors to address essential problems in nuclear structure physics, such as clustering and the many alpha-decay of light nuclei such as {sup 12}C and {sup 16}O. All three detectors (SSD, eTPC and BC) will be used to address central problems in nuclear astrophysics such as the astrophysical cross section factor of the {sup 12}C(α,γ) reaction and other processes central to stellar evolution. The CPWG intends to submit to the ELI-NP facility a Technical Design Report (TDR) for the proposed detectors.

  10. Subcritical crack growth of selected aerospace pressure vessel materials

    NASA Technical Reports Server (NTRS)

    Hall, L. R.; Bixler, W. D.


    This experimental program was undertaken to determine the effects of combined cyclic/sustained loads, stress level, and crack shape on the fatigue crack growth rate behavior of cracks subjected to plane strain conditions. Material/environment combinations tested included: 2219-T87 aluminum plate in gaseous helium, room air, and 3.5% NaCl solution at room temperature, liquid nitrogen, and liquid hydrogen; 5Al-2.5 Sn (ELI) titanium plate in liquid nitrogen and liquid hydrogen and 6AL-4V (ELI) STA titanium plate in gaseous helium and methanol at room temperature. Most testing was accomplished using surface flawed specimens instrumented with a clip gage to continuously monitor crack opening displacements at the specimen surface. Tapered double cantilever beam specimens were also tested. Static fracture and ten hour sustained load tests were conducted to determine fracture toughness and apparent threshold stress intensity values. Cyclic tests were performed using sinusoidal loading profiles at 333 MHz (20 cpm) and trapezoidal loading profiles at both 8.3 MHz (0.5 cpm) and 3.3 MHz (0.2 cpm). Data were evaluated using modified linear elastic fracture mechanics parameters.

  11. Physics with gamma-beams and charged particle detectors: I) Nuclear structure II) Nuclear astrophysics

    NASA Astrophysics Data System (ADS)

    Gai, Moshe


    The Charged Particle Working Group (CPWG) is proposing to construct large area Silicon Strip Detector (SSD), a gas Time Projection Chamber detector read by an electronic readout system (eTPC) and a Bubble Chamber (BC) containing superheated high purity water to be used in measurements utilizing intense gamma-ray beams from the newly constructed ELI-NP facility at Magurele, Bucharest in Romania. We intend to use the SSD and eTPC detectors to address essential problems in nuclear structure physics, such as clustering and the many alpha-decay of light nuclei such as 12C and 16O . All three detectors (SSD, eTPC and BC) will be used to address central problems in nuclear astrophysics such as the astrophysical cross section factor of the 12C (α,γ) reaction and other processes central to stellar evolution. The CPWG intends to submit to the ELI-NP facility a Technical Design Report (TDR) for the proposed detectors.

  12. Cosmic Rays, the Black Pole and Extreme Climate.

    NASA Astrophysics Data System (ADS)

    Ely, J.


    The Magnetic Coupling Model predicts many climate anomalies due to solar oscillations (from gravitational torque impulses), galactic cosmic ray modulations, etc, back thru the Pleistocene. A major process in this era is Hale cycle reconnection of solar and galactic B, causing strong recurring "Cirrus Holes." These: shift pressure centers, making drought cycles, record floods, etc; disguised global warming (causing disunity on its reality) by high contrast (deglaciating) climate in the northern hemisphere in alternate sunspot cycles. Fossil fuel CO2 ended major ice ages and risks imminent rapid (decade) CO2 runaway via sea surface exchange (see refs: Ely, Session A8, APS Mtg March 2001; Bette Hileman, Chem Eng News 9, Apr 24, 2000; Ely, Proc. IEEE Conf. Oceans '91, 3: 1658-1665, 1991) Polar regions warm much more in summer than the global averages and now, having lost snow cover, in the Arctic radiate as a black body in winter becoming extremely cold. Hence, altho the record highest average first quarter year US temperature was in April 2000, the most severe US winter ever recorded began in Nov, due to polar breakthrough. Using fossil fuel to survive the winter, hastens the 6m sea level rise.

  13. Pennsylvanian-Permian tectonism in the Great Basin: The Dry Mountain trough and related basins

    SciTech Connect

    Snyder, W.S.; Spinosa, C.; Gallegos, D.M. )


    Pennsylvanian-Permian tectonism affected the continental margin of western North America from the Yukon to the Mojave Desert. Specific signatures of this tectonism include local angular unconformities, regional disconformities, renewed outpouring of clastic debris from a reactivated Antler and related highlands, and development of deeper water basins with anoxic sediments deposited below wave base. The basins formed include Ishbel trough (Canada), the Wood River basin (Idaho), Cassia basin, Ferguson trough, Dry Mountain trough (all Nevada), and unnamed basins in Death Valley-Mojave Desert region. The Dry Mountain trough (DMT) was initiated during early Wolfcampian and received up to 1,200 m of sediment by the late Leonardian. The lower contact is a regional unconformity with the Ely Limestone, or locally with the Diamond Peak or Vinini formations. Thus, following a period of localized regional uplift that destroyed the Ely basin, portions of the uplifted and exposed shelf subsided creating the Dry Mountain trough. Evidence suggesting a tectonic origin for the DMT includes (1) high subsidence rates (60-140 m/m.y.); (2) renewed influx of coarse clastic debris from the Antler highlands: (3) possible pre-Early Permian folding, thrusting, and tilting within the highlands; and (4) differential subsidence within the Dry Mountain trough, suggesting the existence of independent fault blocks.

  14. Laser damage testing of optical components under cryogenic conditions

    NASA Astrophysics Data System (ADS)

    Oulehla, Jindrich; Pokorný, Pavel; Lazar, Josef


    In this contribution we present a technology for deposition and testing of interference coatings for optical components designed to operate in power pulsed lasers. The aim of the technology is to prepare components for high power laser facilities such as ELI (Extreme Light Infrastructure) or HiLASE. ELI is a part of the European plan to build a new generation of large research facilities selected by the European Strategy Forum for Research Infrastructures (ESFRI). These facilities rely on the use of diode pumped solid state lasers (DPSSL). The choice of the material for the lasers' optical components is critical. Some of the most important properties include the ability to be antireflection and high reflection coated to reduce the energy losses and increase the overall efficiency. As large amounts of heat need to be dissipated during laser operation, cryogenic cooling is necessary. The conducted experiments served as preliminary tests of laser damage threshold measurement methodology that we plan to use in the future. We designed a special apparatus consisting of a vacuum chamber and a cooling system. The samples were placed into the vacuum chamber which was evacuated and then the samples were cooled down to approximately 120K and illuminated by a pulsed laser. Pulse duration was in the nanosecond region. Multiple test sites on the sample's surface were used for different laser pulse energies. We used optical and electron microscopy and spectrophotometer measurements for coating investigation after the conducted experiments.

  15. 3D reconstruction of nuclear reactions using GEM TPC with planar readout

    SciTech Connect

    Bihałowicz, Jan Stefan


    The research program of the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) laboratory under construction in Magurele, Romania facilities the need of developing a gaseous active-target detector providing 3D reconstruction of charged products of nuclear reactions induced by gamma beam. The monoenergetic, high-energy (E{sub γ} > 19 MeV) gamma beam of intensity 10{sup 13}γ/s allows studying nuclear reactions in astrophysics. A Time Projection Chamber with crossed strip readout (eTPC) is proposed as one of the imaging detectors. The special feature of the readout electrode structure is a 2D reconstruction based on the information read out simultaneously from three arrays of strips that form virtual pixels. It is expected to reach similar spatial resolution as for pixel readout at largely reduced cost of electronics. The paper presents the current progress and first results of the small scale prototype TPC which is a one of implementation steps towards eTPC detector proposed in the Technical Design Report of Charged Particles Detection at ELI-NP.

  16. Characterization and analysis of surface notches on Ti-alloy plates fabricated by additive manufacturing techniques

    NASA Astrophysics Data System (ADS)

    Chan, Kwai S.


    Rectangular plates of Ti-6Al-4V with extra low interstitial (ELI) were fabricated by layer-by-layer deposition techniques that included electron beam melting (EBM) and laser beam melting (LBM). The surface conditions of these plates were characterized using x-ray micro-computed tomography. The depth and radius of surface notch-like features on the LBM and EBM plates were measured from sectional images of individual virtual slices of the rectangular plates. The stress concentration factors of individual surface notches were computed and analyzed statistically to determine the appropriate distributions for the notch depth, notch radius, and stress concentration factor. These results were correlated with the fatigue life of the Ti-6Al-4V ELI alloys from an earlier investigation. A surface notch analysis was performed to assess the debit in the fatigue strength due to the surface notches. The assessment revealed that the fatigue lives of the additively manufactured plates with rough surface topographies and notch-like features are dominated by the fatigue crack growth of large cracks for both the LBM and EBM materials. The fatigue strength reduction due to the surface notches can be as large as 60%-75%. It is concluded that for better fatigue performance, the surface notches on EBM and LBM materials need to be removed by machining and the surface roughness be improved to a surface finish of about 1 μm.

  17. The ELIMED transport and dosimetry beamline for laser-driven ion beams

    NASA Astrophysics Data System (ADS)

    Romano, F.; Schillaci, F.; Cirrone, G. A. P.; Cuttone, G.; Scuderi, V.; Allegra, L.; Amato, A.; Amico, A.; Candiano, G.; De Luca, G.; Gallo, G.; Giordanengo, S.; Guarachi, L. Fanola; Korn, G.; Larosa, G.; Leanza, R.; Manna, R.; Marchese, V.; Marchetto, F.; Margarone, D.; Milluzzo, G.; Petringa, G.; Pipek, J.; Pulvirenti, S.; Rizzo, D.; Sacchi, R.; Salamone, S.; Sedita, M.; Vignati, A.


    A growing interest of the scientific community towards multidisciplinary applications of laser-driven beams has led to the development of several projects aiming to demonstrate the possible use of these beams for therapeutic purposes. Nevertheless, laser-accelerated particles differ from the conventional beams typically used for multiscipilinary and medical applications, due to the wide energy spread, the angular divergence and the extremely intense pulses. The peculiarities of optically accelerated beams led to develop new strategies and advanced techniques for transport, diagnostics and dosimetry of the accelerated particles. In this framework, the realization of the ELIMED (ELI-Beamlines MEDical and multidisciplinary applications) beamline, developed by INFN-LNS (Catania, Italy) and that will be installed in 2017 as a part of the ELIMAIA beamline at the ELI-Beamlines (Extreme Light Infrastructure Beamlines) facility in Prague, has the aim to investigate the feasibility of using laser-driven ion beams for multidisciplinary applications. In this contribution, an overview of the beamline along with a detailed description of the main transport elements as well as the detectors composing the final section of the beamline will be presented.

  18. Intranuclear dynamics of the Nup107-160 complex

    PubMed Central

    Morchoisne-Bolhy, Stéphanie; Geoffroy, Marie-Claude; Bouhlel, Imène B.; Alves, Annabelle; Audugé, Nicolas; Baudin, Xavier; Van Bortle, Kevin; Powers, Maureen A.; Doye, Valérie


    Nup98 is a glycine-leucine-phenylalanine-glycine (GLFG) repeat–containing nucleoporin that, in addition to nuclear transport, contributes to multiple aspects of gene regulation. Previous studies revealed its dynamic localization within intranuclear structures known as GLFG bodies. Here we show that the mammalian Nup107-160 complex (Y-complex), a major scaffold module of the nuclear pore, together with its partner Elys, colocalizes with Nup98 in GLFG bodies. The frequency and size of GLFG bodies vary among HeLa sublines, and we find that an increased level of Nup98 is associated with the presence of bodies. Recruitment of the Y-complex and Elys into GLFG bodies requires the C-terminal domain of Nup98. During cell division, Y-Nup–containing GLFG bodies are disassembled in mitotic prophase, significantly ahead of nuclear pore disassembly. FRAP studies revealed that, unlike at nuclear pores, the Y-complex shuttles into and out of GLFG bodies. Finally, we show that within the nucleoplasm, a fraction of Nup107, a key component of the Y-complex, displays reduced mobility, suggesting interaction with other nuclear components. Together our data uncover a previously neglected intranuclear pool of the Y-complex that may underscore a yet-uncharacterized function of these nucleoporins inside the nucleus, even in cells that contain no detectable GLFG bodies. PMID:25904327

  19. Intranuclear dynamics of the Nup107-160 complex.


    Morchoisne-Bolhy, Stéphanie; Geoffroy, Marie-Claude; Bouhlel, Imène B; Alves, Annabelle; Audugé, Nicolas; Baudin, Xavier; Van Bortle, Kevin; Powers, Maureen A; Doye, Valérie


    Nup98 is a glycine-leucine-phenylalanine-glycine (GLFG) repeat-containing nucleoporin that, in addition to nuclear transport, contributes to multiple aspects of gene regulation. Previous studies revealed its dynamic localization within intranuclear structures known as GLFG bodies. Here we show that the mammalian Nup107-160 complex (Y-complex), a major scaffold module of the nuclear pore, together with its partner Elys, colocalizes with Nup98 in GLFG bodies. The frequency and size of GLFG bodies vary among HeLa sublines, and we find that an increased level of Nup98 is associated with the presence of bodies. Recruitment of the Y-complex and Elys into GLFG bodies requires the C-terminal domain of Nup98. During cell division, Y-Nup-containing GLFG bodies are disassembled in mitotic prophase, significantly ahead of nuclear pore disassembly. FRAP studies revealed that, unlike at nuclear pores, the Y-complex shuttles into and out of GLFG bodies. Finally, we show that within the nucleoplasm, a fraction of Nup107, a key component of the Y-complex, displays reduced mobility, suggesting interaction with other nuclear components. Together our data uncover a previously neglected intranuclear pool of the Y-complex that may underscore a yet-uncharacterized function of these nucleoporins inside the nucleus, even in cells that contain no detectable GLFG bodies.

  20. ISIS-3521. Isis Pharmaceuticals.


    Li, K; Zhang, J


    ISIS-3521 is a 20-mer antisense phosphorothioate oligonucleotide PKCa expression inhibitor, under development by Isis (formerly in collaboration with Novartis) for the potential treatment of solid tumors that are refractory to, or recurrent with, standard treatment regimens [175741]. In November 1999, Novartis announced that it would end its codevelopment of ISIS-3521 [348221], [348222]. In August 2001, Eli Lilly in-licensed ISIS-3521 [420062]. In October 2000, phase III trials of ISIS-3521, in combination with carboplatin and paclitaxel, were initiated for the treatment of non-small cell lung cancer (NSCLC) [386128]. The FDA granted ISIS-3521 Fast Track review status for NSCLC in November 2000 [388930]. In April 2001, Bear Sterns & Co predicted US approval of ISIS-3521 in 2002 [411081]. In August 2001, Eli Lilly and Isis entered into a four-year strategic alliance that includes ISIS-3521. For the license of ISIS-3521, Isis will receive $25 million in upfront fees and will be reimbursed for remaining phase III development and registration costs [420062].

  1. How do electron localization functions describe π-electron delocalization?


    Steinmann, Stephan N; Mo, Yirong; Corminboeuf, Clemence


    Scalar fields provide an intuitive picture of chemical bonding. In particular, the electron localization function (ELF) has proven to be highly valuable in interpreting a broad range of bonding patterns. The discrimination between enhanced or reduced electron (de)localization within cyclic π-conjugated systems remains, however, challenging for ELF. In order to clearly distinguish between the local properties of ten highly and weakly π-(de)localized prototype systems, we compare the ELFs of both the canonical wave functions and electron-localized states (diabatic) with those of two closely related scalar fields: the electron localizability indicator (ELI-D) and the localized orbital locator (LOL). The simplest LOL function distinguishes enhanced from weak π-(de)localization in an insightful and reliable manner. LOL offers the finest contrast between annulenes with 4n/4n + 2 π electrons and their inorganic analogues as well as between hyperconjugated cyclopentadiene derivatives. LOL(π) also gives an appealing and intuitive picture of the π-bond. In contrast, the most popular ELF fails to capture subtle contrasting local electronic properties and suffers from the arbitrariness of the σ/π dissection. The orbital separation of the most recent ELI-D is clear-cut but the interpretations sometime less straightforward in the present context.

  2. Laser damage testing of optical components under cryogenic conditions

    NASA Astrophysics Data System (ADS)

    Oulehla, Jindřich; Pokorný, Pavel; Lazar, Josef


    In this contribution we present a technology for deposition and testing of interference coatings for optical components designed to operate in power pulsed lasers. The aim of the technology is to prepare components for high power laser facilities such as ELI (Extreme Light Infrastructure) or HiLASE. ELI is a part of the Eropean plan to build a new generation of large research facilities selected by the the Eropean Strategy Forum for Research Infrastructures (ESFRI). These facilities rely on the use of diode pumped solid state lasers (DPSSL). The choice of the material or the lasers' optical components is critical. Some of the most important properties include the ability to be antireflection and high reflection coated to reduce the energy losses and increase the overall efficiency. As large amounts of hear need to be dissipated during laser operation, cryogenic cooling is necessary. The conducted experiments served as preliminary tests of laser damage threshold measurement methodology that we plan to use in the future. We designed a special apparatus consistion of a vacuum chamber an a cooling system. The samples were placed into the vacuum chamber which was evacuated and them the samples were cooled down to approximately 120K and illuminated by a pulsed laser. Pulse duration was in the nanosecond region. Multiple test sites on the sample's surface were used for different laser pulse energies. We used optical and electron microscopy and spectrophotometer measurements for coating investigation after the conducted experiments.

  3. Chemical bonding analysis and properties of La{sub 7}Os{sub 4}C{sub 9}-A new structure type containing C- and C{sub 2}-units as Os-coordinating ligands

    SciTech Connect

    Dashjav, Enkhtsetseg; Prots, Yurii; Kreiner, Guido; Schnelle, Walter; Wagner, Frank R. Kniep, Ruediger


    The new ternary carbide La{sub 7}Os{sub 4}C{sub 9} was prepared by argon arc-melting of the elements followed by subsequent heat treatment at 900 deg. C for 250 h. The compound crystallizes monoclinic, in the space group C2/m (a=1198.5(2) pm, b=542.0(1) pm, c=1196.2(2) pm, {beta}=111.04(1){sup o}, V=725.2(2)x10{sup 6} pm{sup 3}, Z=2). The structure was determined from single crystal X-ray diffraction data and refined to a residual of R{sub 1}=0.02 (wR{sub 2}=0.03) for 4812 unique reflections and 64 variable parameters. Electrical resistivity and magnetic susceptibility measurements characterize the compound as a Pauli-paramagnetic metal. The crystal structure contains bridging C- and terminal C{sub 2}-units as Os-coordinating ligands, thereby forming polyanions {sub {infinity}}{sup 1}[Os{sub 4}(C{sub 2}){sub 2}C{sub 5}] running along the [101] direction. The polyanions are composed of alternating Os(C{sub 2})C{sub 2} and OsC{sub 3} units with the transition metal in distorted trigonal planar coordination. Charge compensation is ensured by La cations which are situated in-between the polyanions. The carbon-carbon bond (131 pm) within the C{sub 2} pairs is slightly shorter than the value of a common C-C double bond, and is discussed on the basis of COHP curves on the one side, and with ELI-D and electron density distributions on the other side. The method of partial ELI-D decomposition is shown to be well suited for the characterization of separated DOS structures in terms of chemical bonding signatures provided by ELI-D. The Os-La interactions are shown to be of a polar multicenter-bonding type with Os playing the role of the electron donor. Compared to an acetylide the C{sub 2} species were found to possess a significantly reduced bond order and an enhanced number of electrons in lone pair type spatial regions. This type of species cannot be simply classified in terms of model pictures such as C{sub 2}{sup 2-} and C{sub 2}{sup 4-}, respectively. - Graphical

  4. From laser particle acceleration to the synthesis of extremely neutron rich isotopes via the novel fission-fusion mechanism

    SciTech Connect

    Thirolf, P. G.


    High-power, short pulse lasers have emerged in the last decade as attractive tools for accelerating charged particles (electrons, ions) to high energies over mm-scale acceleration lengths, thus promising to rival conventional acceleration techniques in the years ahead. In the first part of the article, the principles of laser-plasma interaction as well as the techniques and the current status of the acceleration of electron and ion beams will be briefly introduced. In particular with the upcoming next generation of multi-PW class laser systems, such as the one under construction for the ELI-Nuclear Physics project in Bucharest (ELI-NP), very efficient acceleration mechanisms for brilliant ion beams like radiation pressure acceleration (RPA) come into reach. Here, ultra-dense ion beams reaching solid-state density can be accelerated from thin target foils, exceeding the density of conventionally accelerated ion beams by about 14 orders of magnitude. This unique property of laser-accelerated ion beams can be exploited to explore the scenario of a new reaction mechanism called ‘fission-fusion’, which will be introduced in the second part of the article. Accelerating fissile species (e.g. {sup 232}Th) towards a second layer of the same material will lead to fission both of the beam-like and target-like particles. Due to the close to solid-state density of the accelerated ion bunches, fusion may occur between neutron-rich (light) fission products. This may open an access path towards extremely neutron-rich nuclides in the vicinity of the N=126 waiting point of the astrophysical r process. ‘Waiting points’ at closed nucleon shells play a crucial role in controlling the reaction rates. However, since most of the pathway of heavy-element formation via the rapid-neutron capture process (r-process) runs in ‘terra incognita’ of the nuclear landscape, in particular the waiting point at N=126 is yet unexplored and will remain largely inaccessible to conventional

  5. β-Alkyloxazolochlorins: Revisiting the Ozonation of Octaalkylporphyrins, and Beyond.


    Sharma, Meenakshi; Meehan, Eileen; Mercado, Brandon Q; Brückner, Christian


    The reaction of β-octaalkylporphyrins (octaethylporphyrin and etioporphyrin I) with ozone generated the corresponding heptaalkyloxazolochlorinhemiacetals in which a pyrrolic subunit of the porphyrins was replaced by an oxazoline moiety. Thus, a pyrrolic β-carbon with its alkyl substituent was excised and replaced by an oxygen atom, and the neighboring β-carbon was hydroxylated. This work clarifies the nature of the products first described by Fischer and Deželić, in 1933, and verifies the work by Shulg'a and coworkers, from 1977. Furthermore, the chemistry of the oxazolochlorin hemiacetals was studied: They could be dehydroxylated or converted to alkyl acetals and gem-dialkyl derivatives, all possessing chlorin-type optical spectra. Their oxidative conversions generated a unique tetrahydrofuran-linked oxazolochlorin dimer and a hexaethylporpholactone. The work expands on the knowledge of converting porphyrins to porphyrinoids of potential utility containing nonpyrrolic building heterocycles.

  6. Green chemistry approach to the synthesis of N-substituted piperidones.


    Faul, Margaret M; Kobierski, Michael E; Kopach, Michael E


    An efficient green chemistry approach to the synthesis of N-substituted piperidones and piperidines was developed and applied to the synthesis of 1-(2-pyridinylmethyl)-piperidin-4-one, 1, a key starting material for the synthesis of LY317615, an antiangiogenic agent currently under development at Eli Lilly and Company (Chart 1).(1) The general utility of this methodology, which presents significant advantages over the classical Dieckman approach to this class of compounds, was also demonstrated by the direct synthesis of a series of substituted piperidones and piperidines, including potential dopamine D4 receptor antagonists 2 and 3, that have been evaluated in the clinic as antipsychotic agents (Chart 2).(2) PMID:12839473

  7. Managing laboratory automation in a changing pharmaceutical industry.


    Rutherford, M L


    The health care reform movement in the USA and increased requirements by regulatory agencies continue to have a major impact on the pharmaceutical industry and the laboratory. Laboratory management is expected to improve effciency by providing more analytical results at a lower cost, increasing customer service, reducing cycle time, while ensuring accurate results and more effective use of their staff. To achieve these expectations, many laboratories are using robotics and automated work stations. Establishing automated systems presents many challenges for laboratory management, including project and hardware selection, budget justification, implementation, validation, training, and support. To address these management challenges, the rationale for project selection and implementation, the obstacles encountered, project outcome, and learning points for several automated systems recently implemented in the Quality Control Laboratories at Eli Lilly are presented. PMID:18925014

  8. Dissipative particle dynamics model for colloid transport in porous media

    SciTech Connect

    Pan, W.; Tartakovsky, A. M.


    We present that the transport of colloidal particles in porous media can be effectively modeled with a new formulation of dissipative particle dynamics, which augments standard DPD with non-central dissipative shear forces between particles while preserving angular momentum. Our previous studies have demonstrated that the new formulation is able to capture accurately the drag forces as well as the drag torques on colloidal particles that result from the hydrodynamic retardation effect. In the present work, we use the new formulation to study the contact efficiency in colloid filtration in saturated porous media. Note that the present model include all transport mechanisms simultaneously, including gravitational sedimentation, interception and Brownian diffusion. Our results of contact efficiency show a good agreement with the predictions of the correlation equation proposed by Tufenkji and EliMelech, which also incorporate all transport mechanisms simultaneously without the additivity assumption.

  9. Surficial geologic map of parts of the Misheguk Mountain and Baird Mountains quadrangles, Noatak National Preserve, Alaska

    USGS Publications Warehouse

    Hamilton, Thomas D.


    The map area, which comprises part of the Noatak National Preserve, includes approximately the southern two-thirds of the Misheguk Mountain quadrangle and the northern one-third of the Baird Mountains quadrangle. It is centered on a belt of west-trending lowlands along the Noatak River which separates the De Long Mountains to the north from the Baird Mountains to the south (Burch, 1990, p. 196-201). The map area extends between the drainage divides which bound the Noatak drainage system to the north and south, separating that network from streams that flow north into the Arctic Ocean and south into the Kobuk River. An additional small segment in the southwest corner of the map area covers the upper drainage basin of Eli River, which flows west and then south to intersect the Noatak River about 50 km upvalley from Kotzebue Sound.

  10. Recent data on Mediterranean diet, cardiovascular disease, cancer, diabetes and life expectancy.


    Ginter, E; Simko, V


    Benefits of dietary moderation when on a Mediterranean diet type (MD) have been known for well over half a century. In the past, there has been a vigorous renewal of interest in preventive potential of MD. This review is unique, by focusing on the very recent confirmatory data on the MD, all published within the first half of 2014. Benefits of MD in preventing and reducing cardiovascular disorders (CVD), known before, have been strongly confirmed. While there is little doubt regarding potential benefit of MD for obesity, diabetes type II, metabolic syndrome and fatty liver, critical evaluation has to be aimed at reported benefits of MD in such widely metabolic diverse disorders as cancer, pulmonary disease and cognition defects, including Alzheimer disease (Ref. 20). Text in PDF PMID:26084734

  11. Biophysical, morphological, canopy optical property, and productivity data from the Superior National Forest

    NASA Technical Reports Server (NTRS)

    Hall, F. G.; Huemmrich, K. F.; Strebel, D. E.; Goetz, S. J.; Nickeson, J. E.; Woods, K. D.


    Described here are the results of a NASA field experiment conducted in the Superior National Forest near Ely, Minnesota, during the summers of 1983 and 1984. The purpose of the experiment was to examine the use of remote sensing to provide measurements of biophysical parameters in the boreal forests. Leaf area index, biomass, net primary productivity, canopy coverage, overstory and understory species composition data are reported for about 60 sites, representing a range of stand density and age for aspen and spruce. Leaf, needle, and bark high-resolution spectral reflectance and transmittance data are reported for the major boreal forest species. Canopy bidirectional reflectance measurements are provided from a helicopter-mounted Barnes Multiband Modular Radiometer (MMR) and the Thematic Mapper Simulator (TMS) on the NASA C-130 aircraft.

  12. Optimization of positrons generation based on laser wakefield electron acceleration

    NASA Astrophysics Data System (ADS)

    Wu, Yuchi; Han, Dan; Zhang, Tiankui; Dong, Kegong; Zhu, Bin; Yan, Yonghong; Gu, Yuqiu


    Laser based positron represents a new particle source with short pulse duration and high charge density. Positron production based on laser wakefield electron acceleration (LWFA) has been investigated theoretically in this paper. Analytical expressions for positron spectra and yield have been obtained through a combination of LWFA and cascade shower theories. The maximum positron yield and corresponding converter thickness have been optimized as a function of driven laser power. Under the optimal condition, high energy (>100 MeV ) positron yield up to 5 ×1011 can be produced by high power femtosecond lasers at ELI-NP. The percentage of positrons shows that a quasineutral electron-positron jet can be generated by setting the converter thickness greater than 5 radiation lengths.

  13. Investigation of flaw geometry and loading effects on plane strain fracture in metallic structures

    NASA Technical Reports Server (NTRS)

    Hall, L. R.; Finger, R. W.


    The effects on fracture and flaw growth of weld-induced residual stresses, combined bending and tension stresses, and stress fields adjacent to circular holes in 2219-T87 aluminum and 5AI-2.5Sn(ELI) titanium alloys were evaluated. Static fracture tests were conducted in liquid nitrogen; fatigue tests were performed in room air, liquid nitrogen, and liquid hydrogen. Evaluation of results was based on linear elastic fracture mechanics concepts and was directed to improving existing methods of estimating minimum fracture strength and fatigue lives for pressurized structure in spacecraft and booster systems. Effects of specimen design in plane-strain fracture toughness testing were investigated. Four different specimen types were tested in room air, liquid nitrogen and liquid hydrogen environments using the aluminum and titanium alloys. Interferometry and holograph were used to measure crack-opening displacements in surface-flawed plexiglass test specimens. Comparisons were made between stress intensities calculated using displacement measurements, and approximate analytical solutions.

  14. Expert systems and the CPI product substitution review: A needs analysis for the US Bureau of Labor Statistics

    SciTech Connect

    Arrowood, L.F.; Tonn, B.E.


    This report presents recommendations relative to the use of expert systems and machine learning techniques by the Bureau of Labor Statistics (BLS) to substantially automate product substitution decisions associated with the Consumer Price Index (CPI). Thirteen commercially available, PC-based expert system shells have received in-depth evaluations. Various machine learning techniques were also reviewed. Two recommendations are given: (1) BLS should use the expert system shell LEVEL5 OBJECT and establish a software development methodology for expert systems; and (2) BLS should undertake a small study to evaluate the potential of machine learning techniques to create and maintain the approximately 350 ELI-specific knowledge bases to be used in CPI product substitution review.

  15. Essays from the Edinburgh and Quarterly Reviews

    NASA Astrophysics Data System (ADS)

    Herschel, John


    1. Address to the subscribers to the Windsor and Eton Public Library; 2. Mechanism of the heavens; 3. Terrestrial magnetism; 4. Inductive sciences; 5. Kosmos; 6. Probabilities; 7. Address to the Royal Astronomical Society, 1827; 8. Address to the Royal Astronomical Society, 1828; 9. Address to the Royal Astronomical Society, 1829; 10. Address to the Royal Astronomical Society, 1840; 11. Address to the Royal Astronomical Society, 1841; 12. Memoir of the late F. Baily; 13. Address to the Royal Astronomical Society, 1849; 14. Address to the British Association for the Advancement of Science; 15. The walk; 16. Funeral dirge of a Nadowessie; 17. Dithyrambics; 18. Saying of Confucius - time; 19. Saying of Confucius - space; 20. Leonora; 21. Prose and verses; 22. To the lark; 23. Man the interpreter of nature; 24. A scene in Ely cathedral; 25. Mira; 26. The parting dove; 27. On burning a parcel of old MSS; 28. A dream which was not all a dream; 29. Appendix.

  16. Historical estimates of external gamma exposure and collective external gamma exposure from testing at the Nevada Test Site. I. Test series through HARDTACK II, 1958

    SciTech Connect

    Anspaugh, L.R.; Church, B.W.


    In 1959, the Test Manager's Committee to Establish Fallout Doses calculated estimated external gamma exposure at populated locations based upon measurements of external gamma-exposure rate. Using these calculations and estimates of population, we have tabulated the collective estimated external gamma exposures for communities within established fallout patterns. The total collective estimated external gamma exposure is 85,000 person-R. The greatest collective exposures occurred in three general areas: Saint George, UT; Ely, NV; and Las Vegas, NV. Three events, HARRY (19 May 1953), BEE (22 March 1955), and SMOKY (31 August 1957), accounted for more than half the total collective estimated external gamma exposure. The bases of the calculational models for external gamma exposure of infinite exposure, estimated exposure, and 1-yr effective biological exposure are explained.

  17. Patents, antibiotics, and autarky in Spain.


    Romero De Pablos, Ana


    Patents on antibiotics were introduced in Spain in 1949. Preliminary research reveals diversification in the types of antibiotics: patents relating to penicillin were followed by those relating to streptomycin, erythromycin and tetracycline. There was also diversification in the firms that applied for patents: while Merck & Co. Incorporated and Schenley Industries Inc. were the main partners with Spanish antibiotics manufacturers in the late 1940s, this industrial space also included many others, such as Eli Lilly & Company, Abbott Laboratories, Chas. Pfizer & Co. Incorporated, and American Cyanamid Company in the mid-1970s. The introduction of these drugs in Spain adds new elements to a re-evaluation of the autarkic politics of the early years of the Franco dictatorship.

  18. β-Alkyloxazolochlorins: Revisiting the Ozonation of Octaalkylporphyrins, and Beyond.


    Sharma, Meenakshi; Meehan, Eileen; Mercado, Brandon Q; Brückner, Christian


    The reaction of β-octaalkylporphyrins (octaethylporphyrin and etioporphyrin I) with ozone generated the corresponding heptaalkyloxazolochlorinhemiacetals in which a pyrrolic subunit of the porphyrins was replaced by an oxazoline moiety. Thus, a pyrrolic β-carbon with its alkyl substituent was excised and replaced by an oxygen atom, and the neighboring β-carbon was hydroxylated. This work clarifies the nature of the products first described by Fischer and Deželić, in 1933, and verifies the work by Shulg'a and coworkers, from 1977. Furthermore, the chemistry of the oxazolochlorin hemiacetals was studied: They could be dehydroxylated or converted to alkyl acetals and gem-dialkyl derivatives, all possessing chlorin-type optical spectra. Their oxidative conversions generated a unique tetrahydrofuran-linked oxazolochlorin dimer and a hexaethylporpholactone. The work expands on the knowledge of converting porphyrins to porphyrinoids of potential utility containing nonpyrrolic building heterocycles. PMID:27400266

  19. Assessing an early modern Fenland population: Whittlesey (Cambridgeshire).


    Falvey, Heather


    Improvement writers argued that drainage would bring prosperity and population growth to fenland communities; locals counter-argued that their communities were already thriving. The detailed surviving records from early modern Whittlesey, in the Isle of Ely, are analysed here to test the accuracy of these opposing claims. Using the returns of the 1523 Lay Subsidy, the 1563 ecclesiastical census, the Lady Day 1674 Hearth Tax records and the 1676 Compton Census, together with bishops' transcripts and probate inventories, this article finds that although the population did indeed increase after drainage, the pre-drainage population was also increasing. The Michaelmas 1664 Hearth Tax records are analysed to uncover something of the character of the inhabitants and the 1674 Lady Day returns are then used to test the relative wealth of the community compared with that of sub-regions throughout England identified by Tom Arkell. Finally, there is a discussion of Whittlesey's housing stock.

  20. Patents, antibiotics, and autarky in Spain.


    Romero De Pablos, Ana


    Patents on antibiotics were introduced in Spain in 1949. Preliminary research reveals diversification in the types of antibiotics: patents relating to penicillin were followed by those relating to streptomycin, erythromycin and tetracycline. There was also diversification in the firms that applied for patents: while Merck & Co. Incorporated and Schenley Industries Inc. were the main partners with Spanish antibiotics manufacturers in the late 1940s, this industrial space also included many others, such as Eli Lilly & Company, Abbott Laboratories, Chas. Pfizer & Co. Incorporated, and American Cyanamid Company in the mid-1970s. The introduction of these drugs in Spain adds new elements to a re-evaluation of the autarkic politics of the early years of the Franco dictatorship. PMID:26054209

  1. Two companies turn bright ideas into winning technologies

    SciTech Connect

    Bishop, J.


    Every environmentalist and environmental manager dreams of a day when it will be possible to load hazardous waste into one end of a magic machine and retrieve beneficial -- or at least benign -- products from the other end. Two unrelated companies -- Molten Metal Technology Inc., (Waltham, Mass.) and ELI Eco Logic Inc. (Rockwood, Ontario, Canada) -- have developed different technologies that show promise of realizing such dreams. Whether either company`s solution to the problem of effectively managing hazardous wastes proves to be the dream machine remains to be seen, but their stories offer insight into what the future may hold for hazardous waste management. The Eco Logic Process was demonstrated in 1991 at Hamilton Harbour, Ontario, and later at Bay City, Mich., in cleanups of polychlorinated biphenyls (PCBs) and other soil contaminants. The technology was accepted into the US Environmental Protection Agency`s Superfund Innovative Technology Evaluation (SITE) program in 1992.

  2. CD4, CXCR-4, and CCR-5 dependencies for infections by primary patient and laboratory-adapted isolates of human immunodeficiency virus type 1.

    PubMed Central

    Kozak, S L; Platt, E J; Madani, N; Ferro, F E; Peden, K; Kabat, D


    We have used a focal infectivity method to quantitatively analyze the CD4, CXCR-4, and CCR-5 dependencies for infections by diverse primary patient (PR) and laboratory-adapted (LA) isolates of human immunodeficiency virus type 1 (HIV-1). Infectivities of T-cell-tropic viruses were analyzed in a panel of HeLa-CD4 cell clones that have distinct quantities of CD4 and in human astroglioma U87MG-CD4 cells that express a large quantity of CD4 and become highly susceptible to infection after transfection with a CXCR-4 expression vector. The latter analysis indicated that PR as well as LA T-cell-tropic viruses efficiently employ CXCR-4 as a coreceptor in an optimal human cell line that contains abundant CD4. Previous uncertainties regarding coreceptor usage by PR T-cell-tropic HIV-1 isolates may therefore have derived from the assay conditions. As reported previously, unrelated LA and PR T-cell-tropic HIV-1 isolates differ in infectivities for the HeLa-CD4 clonal panel, with LA viruses infecting all clones equally and PR viruses infecting the clones in proportion to cellular CD4 quantities (D. Kabat, S. L. Kozak, K. Wherly, and B. Chesebro, J. Virol. 68:2570-2577, 1994). To analyze the basis for this difference, we used the HeLa-CD4 panel to compare a molecularly cloned T-cell-tropic PR virus (ELI1) with six of its variants that grow to different extents in CD4-positive leukemic cell lines and that differ only at specific positions in their gp120 and gp41 envelope glycoproteins. All mutations in gp120 or gp41 that contributed to laboratory adaptation preferentially enhanced infectivity for cells that had little CD4 and thereby decreased the CD4 dependencies of the infections. There was a close correlation between abilities of T-cell-tropic ELI viruses to grow in an expanded repertoire of leukemic cell lines, the reduced CD4 dependencies of their infections of the HeLa-CD4 panel, and their sensitivities to inactivation by soluble CD4 (sCD4). Since all of the ELI viruses can

  3. Centennial of Metchnikoff's discovery.


    Heifets, L


    Phagocytosis was discovered by Elie Metchnikoff (Ilia Mechnikov) in 1882. Although the phenomenon of endocytosis by the leukocytes (more related to the pinocytosis) had been described 30 years earlier [8], it was Metchnikoff who explained its function, and alerted the scientific community to the importance of phagocytosis in immunity. He devoted most of his life to studying different aspects of phagocytosis and related immunological phenomena. It required 25 years of intense effort to achieve recognition of the phagocytosis theory, the first experimentally based theory in immunology. This struggle culminated in 1908 with the awarding of the Nobel Prize to Metchnikoff and Ehrlich for their two theories of immunity, "cellular" and "humoral," respectively. That was an official recognition of the existence and importance of immunology, but modern immunology began at the moment of Metchnikoff's discovery, which is why 1982 may be considered the 100th year anniversary of immunology. PMID:6750115

  4. Intravital multiphoton microscopy for imaging hepatobiliary function

    NASA Astrophysics Data System (ADS)

    Li, Feng-Chieh; Sun, Tzu-Lin; Lee, Hsuan-Shu; Yang, Shu-Mei; Dong, Chen-Yuan


    Liver is the chemical factory in body responsible for important functions such as metabolism and detoxification. When liver can not be regenerated in time to amend damages that has occurred, failure of hepatic functions can result. Traditionally, the study of liver pathology has depended on histological techniques, but such methods are limited to ex-vivo observation. In order to study hepatic metabolism in vivo, we have designed a hepatic imaging chamber made of biocompatible titanium alloy (6V4Al-Ti, ELI grade). In combination with multiphoton and second harmonic generation microscopy, our approach allows the intravital observation of hepatic intravital activities to be achieved. Processes such as hepatic metabolism and disease progression can be studied using this methodology.

  5. The effect of polyethylene glycol adhesion barrier (Spray Gel) on preventing peritoneal adhesions.


    Dasiran, F; Eryilmaz, R; Isik, A; Okan, I; Somay, A; Sahin, M


    The prominent cells in the late phase of wound healing during proliferation and matrix deposition are fibroblasts. Foreign materials in the operation site like prosthesis prolong the inflammation and induce fibroblast proliferation (8). 3 different prostheses used in this study induced chronic inflammation and fibrosis and provided an effective repair. Dense and thick adhesions due to fibrosis also induced strong adhesions to omentum and small intestine if only polypropylene mesh used for hernia repair. However, there was no difference between SprayGel treated polypropylene mesh and Sepramesh when compared for fibrosis. It also prevents the intraabdominal adhesion formation. It is nontoxic, sticky adherent, non- immigrant and easy to use both in open and laparoscopic surgeries. This experimental study revealed that polyethyleneglycol applied polypropylene mesh accomplishes hernia repair with significantly less adhesion formation than polypropylene mesh alone while securing a remarkable economy than adhesion barrier coated dual meshes (Tab. 6, Fig. 7, Ref. 23). Text in PDF PMID:26084740

  6. Influence of gaseous hydrogen on metals

    NASA Technical Reports Server (NTRS)

    Walter, R. J.; Chandler, W. T.


    Tensile, fracture toughness, threshold stress intensity for sustained-load crack growth, and cyclic and sustained load crack growth rate measurements were performed on a number of alloys in high-pressure hydrogen and helium environments. The results of tensile tests performed in 34.5 MN/m2 (5000 psi) hydrogen indicated that Inconel 625 was considerable embrittled at ambient temperature but was not embrittled at 144 K (-200 F). The tensile properties of AISI 321 stainless steel were slightly reduced at ambient temperature and 144 K (-200 F). The tensile properties of Ti-5Al-2.5 Sn ELI were essentially unaffected by hydrogen at 144 K (-200 F). OFHC copper was not embrittled by hydrogen at ambient temperature or at 144 K (-200 F).

  7. From ugly fish to conquer death: J J R Macleod's fish insulin research, 1922-24.


    Wright, James R


    Fish insulin research had a very short heyday. Throughout most of 1922, production of insulin from livestock was difficult, erratic, and expensive. Although fish insulin was easy to extract and seemed to be a brilliant and logical solution to the shortage of insulin, collection of fish islets was a logistical nightmare. By the end of 1922, a scientist at the pharmaceutical company Eli Lilly in Indianapolis, IN, USA had developed a way to concentrate and purify insulin by isoelectric precipitation. As a result of this breakthrough, the scales began to tip heavily in favour of livestock insulin. Nevertheless, research on commercial production of fish insulin continued for another 18 months but was finally abandoned.

  8. Bilayer Graphene: An Electrically Tunable Semiconductor

    NASA Astrophysics Data System (ADS)

    Min, Hongki; Sahu, Bhagawan; Banerjee, Sanjay; MacDonald, Allan


    Using ab initio density functional theory calculations, we verify [1,2] that the energy band structure of bilayer graphene can be tuned by applying an external electric field. As the strength of the external electric field increases, the electronic spectrum of bilayer graphene changes from a that of a zero-gap semiconductor to that of a gapped semiconductor. From the ab initio calculations the external field dependence of the screened interlayer potential difference and tunneling amplitudes are extracted by fitting to a tight-binding model. We discuss the role of interlayer correlations in determining the size of the gap and the accuracy of local density approximation. [1] Edward McCann and Vladimir I. Fal'ko, Phys. Rev. Lett. 96, 086805 (2006). [2] Taisuke Ohta, Aaron Bostwick,, Thomas Seyller, Karsten Horn, and Eli Rotenberg, Science 313, 951 (2006).

  9. Interview with Lisa Shipley. Interviewed by Lisa Parks.


    Shipley, Lisa


    Lisa Shipley is Vice President of Pharmacokinetics, Pharmacodynamics and Drug Metabolism at Merck Research Laboratories. She is responsible for preclinical and clinical ADME activities and molecular biomarker assay development activities at all Merck research sites and support of all programs from discovery through to post-product launch. Prior to joining Merck in 2008, Shipley spent over 20 years at Eli Lilly and Company in roles of increasing responsibility, including the positions of executive director at Lean Six Sigma and vice president of Drug Disposition, PK/PD and Trial Simulations. Shipley obtained her undergraduate degree from McDaniel College and her doctoral degree in Pharmacology and Toxicology from the University of Maryland at Baltimore. This interview was conducted by Lisa Parks, Assistant Commissioning Editor of Bioanalysis.

  10. High repetition rate laser systems: targets, diagnostics and radiation protection

    SciTech Connect

    Gizzi, Leonida A.; Clark, Eugene; Neely, David; Tolley, Martin; Roso, Luis


    Accessing the high repetition regime of ultra intense laser-target interactions at small or moderate laser energies is now possible at a large number of facilities worldwide. New projects such as HiPER and ELI promise to extend this regime to the high energy realm at the multi-kJ level. This opportunity raises several issues on how best to approach this new regime of operation in a safe and efficient way. At the same time, a new class of experiments or a new generation of secondary sources of particles and radiation may become accessible, provided that target fabrication and diagnostics are capable of handling this rep-rated regime. In this paper, we explore this scenario and analyse existing and perspective techniques that promise to address some of the above issues.

  11. Pile-up recovery in gamma-ray detection

    SciTech Connect

    Vencelj, Matjaz; Likar, Andrej; Loeher, Bastian; Miklavec, Mojca; Novak, Roman; Pietralla, Norbert; Savran, Deniz


    Count rates in gamma-ray detectors are fundamentally limited at the high end by the physics of the detection process but should not be limited further by the design of read-out. Using intense stimuli, such as the ELI, it is desirable to extract the full wealth of information flow that sensors can deliver. We discuss the photon-statistical limitations of scintillation systems and charge-collection issues of solid-state detectors. With high-speed digitizing in particular, two promising approach architectures are those of posterior list mode corrections and of time-domain adaptive filters, introducing a 'rich list mode with uncertainties' and thus a somewhat different look at experimental spectra. Real-time performance is also considered.

  12. Clinical utility of orally disintegrating olanzapine in Chinese patients with schizophrenia: a review of effectiveness, patient preference, adherence, and other properties.


    Zhao, Jingping; Ou, Jianjun; Xue, Haibo; Liu, Li; Montgomery, William; Treuer, Tamas


    The primary objective of this systematic review was to examine the evidence for the efficacy, effectiveness, and safety of orally disintegrating olanzapine in Chinese populations. A systematic literature search was conducted using databases covering international and Chinese journals,, and internal and external trial registries at Eli Lilly and Company using search terms related to target countries (People's Republic of China, Hong Kong, and Taiwan) and orally disintegrating olanzapine treatment. A publication and one clinical study report were retrieved. The clinical study showed orally disintegrating olanzapine and the standard oral tablet to have similar efficacy and tolerability profiles. A bioequivalence study has shown that orally disintegrating olanzapine and the standard oral tablet have similar pharmacokinetic profiles. Orally disintegrating olanzapine and the standard oral tablet have similar efficacy and tolerability profiles.

  13. Managing laboratory automation in a changing pharmaceutical industry.


    Rutherford, M L


    The health care reform movement in the USA and increased requirements by regulatory agencies continue to have a major impact on the pharmaceutical industry and the laboratory. Laboratory management is expected to improve effciency by providing more analytical results at a lower cost, increasing customer service, reducing cycle time, while ensuring accurate results and more effective use of their staff. To achieve these expectations, many laboratories are using robotics and automated work stations. Establishing automated systems presents many challenges for laboratory management, including project and hardware selection, budget justification, implementation, validation, training, and support. To address these management challenges, the rationale for project selection and implementation, the obstacles encountered, project outcome, and learning points for several automated systems recently implemented in the Quality Control Laboratories at Eli Lilly are presented.

  14. Effect of cryogenic irradiation on NERVA structural alloys

    NASA Technical Reports Server (NTRS)

    Dixon, C. E.; Davidson, M. J.; Funk, C. W.


    Several alloys (Hastelloy X, AISI 347, A-286 bolts, Inconel 718, Al 7039-T63 and Ti-5Al-2.5Sn ELI) were irradiated in liquid nitrogen (140 R) to neutron fluences between 10 to the 17th power and 10 to the 19th power nvt (E greater than 1.0 Mev). After irradiation, tensile properties were obtained in liquid nitrogen without permitting any warmup except for some specimens which were annealed at 540 R. The usual trend of radiation damage typical for materials irradiated at and above room temperature was observed, such as an increase in strength and decrease in ductility. However, the damage at 140 R was greater because this temperature prevented the annealing of radiation-induced defects which occurs above 140 R.

  15. Observations on Gulf of Alaska seamount chains by multi-beam sonar

    NASA Astrophysics Data System (ADS)

    Smoot, N. Christian


    Geomorphic and age data are presented for the Dellwood, Denson, Dickins, Giacomini, and Ely seamounts, the Tsimshian Seachannel, and the southern Juan de Fuca Ridge with Brown Bear, Bear Cub, Grizzly Bear, and Cobb seamounts. Formational speculations extrapolated to a regional scale allow the strikes and outer limits of the seamount chains to be interpreted. Six of these chains are shown in the Gulf of Alaska, none of which conform to the Pratt-Welker or Kodiak-Bowie in the literature. Different strikes show the chains/plate to have rotated 23° about 17 m.y. ago. Morphology also shows that there are four less guyots in the Gulf than previously thought, and that, at least in the Gulf of Alaska, guyot heights do not necessarily reflect sealevel during erosion.

  16. On the problems of relativistic laboratory astrophysics and fundamental physics with super powerful lasers

    NASA Astrophysics Data System (ADS)

    Bulanov, S. V.; Esirkepov, T. Zh.; Kando, M.; Koga, J.; Kondo, K.; Korn, G.


    The ways toward modeling of astrophysical processes and extreme field regimes with super-power lasers are discussed. The main attention is paid to the problem of limited similarity in using the dimensionless parameters characterizing the processes in the laser and astrophysical plasmas. As the most typical examples, we address the magnetic reconnection and collisionless shock waves relevant to the problem of ultrarelativistic particle acceleration. In the extreme field limits we consider the regimes of dominant radiation reaction, changing the electromagnetic wave-matter interaction. In these regimes it, in particular, results in a new powerful source of ultra high-brightness gamma-rays and will make possible electron-positron pair creation in vacuum in a multiphoton processes. This will allow modeling under terrestrial laboratory conditions the processes in astrophysical objects and paves the way to experimental verifications using ultra intense lasers as they are currently developed within the ELI project.

  17. Butyrylcholinesterase as a biochemical marker.


    Pohanka, M


    Butyrylcholinesterase (BChE) is an enzyme expressed in multiple organs and abundant in plasma. BChE can fluctuate in course of several reasons while both hypercholiensterasemia and hypocholinesterasemia are known. Considering evidence of BChE activity alterations, hepatocellular carcinoma, chronic liver diseases and poisoning with carbamates or organophosphates can be diagnosed by activity assay. BChE is responsible for detoxification reactions, and the compounds such as cocaine, succinylcholine, and acetylsalicylic acid are degraded in the body. The detoxification can be slowed in patients carrying the K variant of the enzyme. Summarization of literature, discussion on the meaning of BChE in the body, and the principles of BChE assay in samples are described in the review (Tab. 2, Fig. 8, Ref. 86). Text in PDF

  18. An empirical method for calculating the viscosities of hydrocarbon liquids and liquid mixtures

    SciTech Connect

    Peng, D.Y.; Vermani, R.


    The viscosities of pure liquid normal alkanes ranging from propane to n-tetradecane are correlated using the Peng-Robinson equation of state in conjunction with Hildebrand's empirical theory of fluidity. A mixing rule and an excess fluidity function are proposed. Simulated viscosity data generated from the corresponding states method of Ely and Hanley are used to determine the binary interaction parameters needed in the excess function which has its form based on the Wilson equation. The procedure has been used to calculate the viscosities of binary mixtures and simulated multicomponent liquid n-alkane mixtures involving the above-mentioned components at temperatures to 444 K and pressures to 200 bar. The results are compared with the predicted values obtained from the corresponding states method. The procedure is simple to use and it has an accuracy comparable to that of the theoretically based but more elaborate method.

  19. Protective effects of D-002 on experimentally induced gastroesophageal reflux in rats

    PubMed Central

    Zamora, Zullyt; Molina, Vivian; Mas, Rosa; Ravelo, Yazmin; Perez, Yohany; Oyarzabal, Ambar


    AIM: To investigate the effects of beeswax alcohols (D-002) on the esophageal damage induced by gastroesophageal reflux (GER) in rats. METHODS: Sixty male rats were randomized into six groups (10 rats/group): a negative control and five groups with experimentally induced GER: a positive vehicle control, three treated with D-002 (25, 100 and 200 mg/kg, respectively), and one with omeprazole 10 mg/kg. All treatments were given by gastric gavage. One hour after dosing, GER was produced by simultaneous ligation of the pyloric end and the forestomach. Esophageal lesions index (ELI), gastric secretion volume and acidity, and esophageal malondialdehyde (MDA) and sulfhydryl (SH) group concentrations were measured. Statistical significance was considered at P < 0.05. RESULTS: As compared to the negative control, the positive control group exhibited increased ELI (5.2 ± 0.33 vs 0 ± 0, P = 0.0003), gastric secretion volume (2.69 ± 0.09 vs 0.1 ± 0.0, P = 0.0003) and acidity (238 ± 19.37 vs 120.0 ± 5.77, P = 0.001), and esophageal concentrations of MDA (2.56 ± 0.1 vs 1.76 ± 0.28, P = 0.001) and SH groups (1.02 ± 0.05 vs 0.56 ± 0.08, P = 0.0003). D-002 (25, 100 and 200 mg/kg) reduced ELI (3.36 ± 0.31, 2.90 ± 0.46 and 2.8 ± 0.23, respectively) vs the positive control (5.2 ± 0.33) (P = 0.004; P = 0.002; P = 0.001, respectively). There were no significant changes in acidity with D-002 treatment, and only the highest dose reduced the volume of the gastric secretion (1.92 ± 0.25) vs the positive control (2.69 ± 0.09, P = 0.013). D-002 (25, 100 and 200 mg/kg) lowered the esophageal MDA (2.05 ± 0.16, 1.98 ± 0.22 and 1.93 ± 0.22, respectively) (P = 0.01; P = 0.03; P = 0.03, respectively) and SH group concentration (0.87 ± 0.06, 0.79 ± 0.08 and 0.77 ± 0.06, respectively) (P = 0.04; P = 0.04; P = 0.02) vs the positive control (2.56 ± 0.10 and 1.02 ± 0.05, respectively). Omeprazole decreased ELI (2.54 ± 0.47), gastric secretion volume (1.97 ± 0.14) and acidity

  20. Ramucirumab: first global approval.


    Poole, Raewyn M; Vaidya, Asha


    Ramucirumab (Cyramza™ [US]), a fully human immunoglobulin G1 (IgG1) monoclonal antibody that inhibits vascular endothelial growth factor receptor-2 (VEGFR-2), has been developed by Eli Lilly (formerly ImClone Systems) for the treatment of cancer. Ramucirumab has received its first global approval in the US for use as monotherapy in the treatment of advanced or metastatic gastric cancer or gastro-oesophageal junction adenocarcinoma in patients who experience disease progression on or after fluoropyrimidine- or platinum-containing chemotherapy. Ramucirumab is the first treatment to be approved by the US FDA for this setting. This article summarizes the milestones in the development of ramucirumab leading to this first approval for the treatment of gastric cancer and gastro-oesophageal junction adenocarcinoma.

  1. Health Advocacy Organizations and the Pharmaceutical Industry: An Analysis of Disclosure Practices

    PubMed Central

    Raveis, Victoria H.; Friedman, Anne; Rothman, David J.


    Health advocacy organizations (HAOs) are influential stakeholders in health policy. Although their advocacy tends to closely correspond with the pharmaceutical industry's marketing aims, the financial relationships between HAOs and the pharmaceutical industry have rarely been analyzed. We used Eli Lilly and Company's grant registry to examine its grant-giving policies. We also examined HAO Web sites to determine their grant-disclosure patterns. Only 25% of HAOs that received Lilly grants acknowledged Lilly's contributions on their Web sites, and only 10% acknowledged Lilly as a grant event sponsor. No HAO disclosed the exact amount of a Lilly grant. As highly trusted organizations, HAOs should disclose all corporate grants, including the purpose and the amount. Absent this disclosure, legislators, regulators, and the public cannot evaluate possible conflicts of interest or biases in HAO advocacy. PMID:21233424

  2. Health advocacy organizations and the pharmaceutical industry: an analysis of disclosure practices.


    Rothman, Sheila M; Raveis, Victoria H; Friedman, Anne; Rothman, David J


    Health advocacy organizations (HAOs) are influential stakeholders in health policy. Although their advocacy tends to closely correspond with the pharmaceutical industry's marketing aims, the financial relationships between HAOs and the pharmaceutical industry have rarely been analyzed. We used Eli Lilly and Company's grant registry to examine its grant-giving policies. We also examined HAO Web sites to determine their grant-disclosure patterns. Only 25% of HAOs that received Lilly grants acknowledged Lilly's contributions on their Web sites, and only 10% acknowledged Lilly as a grant event sponsor. No HAO disclosed the exact amount of a Lilly grant. As highly trusted organizations, HAOs should disclose all corporate grants, including the purpose and the amount. Absent this disclosure, legislators, regulators, and the public cannot evaluate possible conflicts of interest or biases in HAO advocacy.

  3. Complete genome sequence of Marinomonas posidonica type strain (IVIA-Po-181T)

    SciTech Connect

    Lucas-Elio, Patricia; Goodwin, Lynne A.; Woyke, Tanja; Pitluck, Sam; Nolan, Matt; Kyrpides, Nikos C; Detter, J C; Copeland, A; Lu, Megan; Bruce, David; Detter, J. Chris; Tapia, Roxanne; Han, Cliff; Land, Miriam L; Ivanova, N; Mikhailova, Natalia; Johnston, Andrew W. B.; Sanchez-Amat, Antonio


    Marinomonas posidonica IVIA-Po-181T Lucas-Eli o et al. 2011 belongs to the family Oceanospirillaceae within the phylum Proteobacteria. Different species of the genus Marinomonas can be readily isolated from the seagrass Posidonia oceanica. M. posidonica is among the most abundant species of the genus detected in the cultured microbiota of P. oceanica, suggesting a close relationship with this plant, which has a great ecological value in the Mediterranean Sea, covering an estimated surface of 38,000 Km2. Here we describe the genomic features of M. posidonica. The 3,899,940 bp long genome harbors 3,544 pro- tein-coding genes and 107 RNA genes and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  4. Validation Analysis of the Groundwater Flow and Transport Model of the Central Nevada Test Area

    SciTech Connect

    A. Hassan; J. Chapman; H. Bekhit; B. Lyles; K. Pohlmann


    The Central Nevada Test Area (CNTA) is a U.S. Department of Energy (DOE) site undergoing environmental restoration. The CNTA is located about 95 km northeast of Tonopah, Nevada, and 175 km southwest of Ely, Nevada (Figure 1.1). It was the site of the Faultless underground nuclear test conducted by the U.S. Atomic Energy Commission (DOE's predecessor agency) in January 1968. The purposes of this test were to gauge the seismic effects of a relatively large, high-yield detonation completed in Hot Creek Valley (outside the Nevada Test Site [NTS]) and to determine the suitability of the site for future large detonations. The yield of the Faultless underground nuclear test was between 200 kilotons and 1 megaton (DOE, 2000). A three-dimensional flow and transport model was created for the CNTA site (Pohlmann et al., 1999) and determined acceptable by DOE and the Nevada Division of Environmental Protection (NDEP) for predicting contaminant boundaries for the site.

  5. Influence of UFG structure formation on mechanical and fatigue properties in Ti-6Al-7Nb alloy

    NASA Astrophysics Data System (ADS)

    Polyakova, V. V.; Anumalasetty, V. N.; Semenova, I. P.; Valiev, R. Z.


    Ultrafine-grained (UFG) Ti alloys have potential applications in osteosynthesis and orthopedics due to high bio-compatibility and increased weight-to- strength ratio. In current study, Ti6Al7Nb ELI alloy is processed through equal channel angular pressing-conform (ECAP-Conform) and subsequent thermomechanical processing to generate a UFG microstructure. The fatigue properties of UFG alloys are compared to coarse grained (CG) alloys. Our study demonstrates that the UFG alloys with an average grain size of ~180 nm showed 35% enhancement of fatigue endurance limit as compared to coarse-grained alloys. On the fracture surfaces of the UFG and CG samples fatigue striations and dimpled relief were observed. However, the fracture surface of the UFG sample looks smoother; fewer amounts of secondary micro-cracks and more ductile rupture were also observed, which testifies to the good crack resistance in the UFG alloy after high-cyclic fatigue tests.

  6. Introducing the fission-fusion reaction process: using a laser-accelerated Th beam to produce neutron-rich nuclei towards the N=126 waiting point of the r-process

    NASA Astrophysics Data System (ADS)

    Habs, D.; Thirolf, P. G.; Gross, M.; Allinger, K.; Bin, J.; Henig, A.; Kiefer, D.; Ma, W.; Schreiber, J.


    -lived, light fission fragments from both beam and target. Moreover, the high ion beam density may lead to a strong collective modification of the stopping power in the target by `snowplough-like' removal of target electrons, leading to significant range enhancement, thus allowing us to use rather thick targets. Using a high-intensity laser with two beams with a total energy of 300 J, 32 fs pulse length and 3 μm focal diameter, as, e.g. envisaged for the ELI-Nuclear Physics project in Bucharest (ELI-NP) (" TargetType="URL"/> , 2010), order-of-magnitude estimates promise a fusion yield of about 103 ions per laser pulse in the mass range of A=180-190, thus enabling us to approach the r-process waiting point at N=126. First studies on ion acceleration, collective modifications of the stopping behaviour and the production of neutron-rich nuclei can also be performed at the upcoming new laser facility CALA (Center for Advanced Laser Applications) in Garching.

  7. Fracture characteristics, microstructure, and tissue reaction of Ti-5Al-2.5Fe for orthopedic surgery

    NASA Astrophysics Data System (ADS)

    Niinomi, Mitsuo; Kobayashi, Toshiro; Toriyama, Osamu; Kawakami, Noriaki; Ishida, Yoshihito; Matsuyama, Yukihiro


    The microstructure of Ti-5Al-2.5Fe, which is expected to be used widely as an implant material not only for artificial hip joints but also for instrumentations of scoliosis surgery, was variously changed by heat treatments. The effect of the microstructure on mechanical properties, fracture toughness, and rotating-bending fatigue strength in the air and simulated body environment, that is, Ringer’s solution, was then investigated. Furthermore, the effect of the living body environment on mechanical properties and fracture toughness in Ti-5Al-2.5Fe were investigated on the specimens implanted into rabbit for about 11 months. The data of Ti-5Al-2.5Fe were compared with those of Ti-6Al-4V ELI, which has been used as an implant material mainly for artificial hip joints, and SUS 316L, which has been used as an implant material for many parts, including the instrumentation of scoliosis surgery. The equiaxed α structure, which is formed by annealing at a temperature below β transus, gives the best balance of strength and ductility in Ti-5Al-2.5Fe. The coarse Widmanstätten α structure, which is formed by solutionizing over β transus followed by air cooling and aging, gives the greatest fracture toughness in Ti-5Al-2.5Fe. This trend is similar to that reported in Ti-6Al-4V ELI. The rotating-bending fatigue strength is the greatest in the equiaxed α structure, which is formed by solutionizing below β transus followed by air cooling and aging in Ti-5Al-2.5Fe. Ti-5Al-2.5Fe exhibits much greater rotating-bending fatigue strength compared with SUS 316L, and equivalent rotating-bending fatigue strength to that of Ti-6Al-4V ELI in both the air and simulated body environments. The rotating-bending fatigue strength of SUS 316L is degraded in the simulated body environment. The corrosion fatigue, therefore, occurs in SUS 316L in the simulated body environment. Fatigue strength of Ti-5Al-2.5Fe in the simulated body environment is degraded by lowering oxygen content in the

  8. On the problems of relativistic laboratory astrophysics and fundamental physics with super powerful lasers

    SciTech Connect

    Bulanov, S. V.; Esirkepov, T. Zh.; Kando, M.; Koga, J.; Kondo, K.; Korn, G.


    The ways toward modeling of astrophysical processes and extreme field regimes with super-power lasers are discussed. The main attention is paid to the problem of limited similarity in using the dimensionless parameters characterizing the processes in the laser and astrophysical plasmas. As the most typical examples, we address the magnetic reconnection and collisionless shock waves relevant to the problem of ultrarelativistic particle acceleration. In the extreme field limits we consider the regimes of dominant radiation reaction, changing the electromagnetic wave-matter interaction. In these regimes it, in particular, results in a new powerful source of ultra high-brightness gamma-rays and will make possible electron-positron pair creation in vacuum in a multiphoton processes. This will allow modeling under terrestrial laboratory conditions the processes in astrophysical objects and paves the way to experimental verifications using ultra intense lasers as they are currently developed within the ELI project.


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey


  10. Team 408 prepares for the FIRST competition

    NASA Technical Reports Server (NTRS)


    The Roboticks team (408) carries their robot, which is named R2K, during the FIRST competition. The team of students from Blanche Ely High School in Ft. Lauderdale was co-sponsored by Nortel Networks and NASA Kennedy Space Center. Students from all over the country are at the KSC Visitor Complex for the FIRST (For Inspiration and Recognition of Science and Technology) Southeast Regional competition March 9-11 in the Rocket Garden. Teams of high school students are testing the limits of their imagination using robots they have designed, with the support of business and engineering professionals and corporate sponsors, to compete in a technological battle against other schools' robots. Of the 30 high school teams competing, 16 are Florida teams co-sponsored by NASA and KSC contractors. Local high schools participating are Astronaut, Bayside, Cocoa Beach, Eau Gallie, Melbourne, Melbourne Central Catholic, Palm Bay, Rockledge, Satellite, and Titusville.

  11. A decade of innovation in pharmaceutical R&D: the Chorus model.


    Owens, Paul K; Raddad, Eyas; Miller, Jeffrey W; Stille, John R; Olovich, Kenneth G; Smith, Neil V; Jones, Rosie S; Scherer, Joel C


    Chorus is a small, operationally independent clinical development organization within Eli Lilly and Company that specializes in drug development from candidate selection to clinical proof of concept. The mission of Chorus is to achieve proof of concept rapidly and at a low cost while positioning successful projects for 'pharma-quality' late-stage development. Chorus uses a small internal staff of experienced drug developers and a network of external vendors to design and implement chemistry, manufacturing and control processes, preclinical toxicology and biology, and Phase I/II clinical trials. In the decade since it was established, Chorus has demonstrated substantial productivity improvements in both time and cost compared to traditional pharmaceutical research and development. Here, we describe its development philosophy, organizational structure, operational model and results to date.

  12. Clinical use of amyloid-positron emission tomography neuroimaging: Practical and bioethical considerations.


    Witte, Michael M; Foster, Norman L; Fleisher, Adam S; Williams, Monique M; Quaid, Kimberly; Wasserman, Michael; Hunt, Gail; Roberts, J Scott; Rabinovici, Gil D; Levenson, James L; Hake, Ann Marie; Hunter, Craig A; Van Campen, Luann E; Pontecorvo, Michael J; Hochstetler, Helen M; Tabas, Linda B; Trzepacz, Paula T


    Until recently, estimation of β-amyloid plaque density as a key element for identifying Alzheimer's disease (AD) pathology as the cause of cognitive impairment was only possible at autopsy. Now with amyloid-positron emission tomography (amyloid-PET) neuroimaging, this AD hallmark can be detected antemortem. Practitioners and patients need to better understand potential diagnostic benefits and limitations of amyloid-PET and the complex practical, ethical, and social implications surrounding this new technology. To complement the practical considerations, Eli Lilly and Company sponsored a Bioethics Advisory Board to discuss ethical issues that might arise from clinical use of amyloid-PET neuroimaging with patients being evaluated for causes of cognitive decline. To best address the multifaceted issues associated with amyloid-PET neuroimaging, we recommend this technology be used only by experienced imaging and treating physicians in appropriately selected patients and only in the context of a comprehensive clinical evaluation with adequate explanations before and after the scan. PMID:27239516

  13. Historical estimates of external gamma exposure and collective external gamma exposure from testing at the Nevada Test Site. I. Test series through HARDTACK II, 1958

    SciTech Connect

    Anspaugh, L.R.; Church, B.W.


    In 1959, the Test Manager's Committee to Establish Fallout Doses calculated estimated external gamma exposure at populated locations based upon measurements of external gamma-exposure rate. Using these calculations and estimates of population, we have tabulated the collective estimated external gamma exposures for communities within established fallout patterns. The total collective estimated external gamma exposure is 85,000 person-R. The greatest collective exposures occurred in three general areas: Saint George, Utah; Ely, Nevada; and Las Vegas, Nevada. Three events, HARRY (May 19, 1953), BEE (March 22, 1955), and SMOKY (August 31, 1957), accounted for over half of the total collective estimated external gamma exposure. The bases of the calculational models for external gamma exposure of ''infinite exposure,'' ''estimated exposure,'' and ''one year effective biological exposure'' are explained. 4 figs., 7 tabs.

  14. Research on recognition of the geologic framework of porphyry copper deposits on ERTS-1 imagery. [New Guinea, Alaska, and Colorado

    NASA Technical Reports Server (NTRS)

    Wilson, J. C. (Principal Investigator)


    The author has identified the following significant results. Many new linear and circular features were found. These features prompted novel tectonic classification and analysis especially in the Ray and Ely areas. Tectonic analyses of the Ok Tedi, Tanacross, and Silvertone areas follow conventional interpretations. Circular features are mapped in many cases and are interpreted as exposed or covered intrusive centers. The small circular features reported in the Ok Tedi test area are valid and useful correlations with tertiary intrusion and volcanism in this remote part of New Guinea. Several major faults of regional dimensions, such as the Denali fault in Alaska and the Colorado mineral belt structures in Colorado are detected in the imagery. Many more faults and regional structures are found in the imagery than exist on present maps.

  15. The Occurrence of Type S1A Serine Proteases in Sponge and Jellyfish

    NASA Technical Reports Server (NTRS)

    Rojas, Ana; Doolittle, Russell F.


    Although serine proteases are found in all kinds of cellular organisms and many viruses, the classic "chymotrypsin family" (Group S1A by th e 1998 Barrett nomenclature) has an unusual phylogenetic distribution , being especially common in animals, entirely absent from plants and protists, and rare among fungi. The distribution in Bacteria is larg ely restricted to the genus Streptomyces, although a few isolated occ urrences in other bacteria have been reported. The family may be enti rely absent from Archaea. Although more than a thousand sequences have been reported for enzymes of this type from animals, none of them ha ve been from early diverging phyla like Porifera or Cnidaria, We now report the existence of Group SlA serine proteases in a sponge (phylu m Porifera) and a jellyfish (phylum Cnidaria), making it safe to conc lude that all animal groups possess these enzymes.

  16. Industrial demand side management: A status report

    SciTech Connect

    Hopkins, M.F.; Conger, R.L.; Foley, T.J.


    This report provides an overview of and rationale for industrial demand side management (DSM) programs. Benefits and barriers are described, and data from the Manufacturing Energy Consumption Survey are used to estimate potential energy savings in kilowatt hours. The report presents types and examples of programs and explores elements of successful programs. Two in-depth case studies (from Boise Cascade and Eli Lilly and Company) illustrate two types of effective DSM programs. Interviews with staff from state public utility commissions indicate the current thinking about the status and future of industrial DSM programs. A comprehensive bibliography is included, technical assistance programs are listed and described, and a methodology for evaluating potential or actual savings from projects is delineated.

  17. Biomedical Applications for Introductory Physics

    NASA Astrophysics Data System (ADS)

    Tuszynski, J. A.; Dixon, J. M.


    Can be utilized in either Algebra or Calculus-based courses and is available either as a standalone text or as a supplement for books like Cutnell PHYSICS, 5e or Halliday, Resnick, & Walker FUNDAMENTALS OF PHYSICS, 6e.> Math level is Algebra & Trigonometry; however, a few examples require the use of integration and differentiation.

  18. Unlike competing supplements, Tuszinski offers both a wealth of engaging biomedical applications as well as quantitative problem-solving. The quantitative problem-solving is presented in the form of worked examples and homework problems. The quantitative problem-solving is presented in the form of worked examples and homework problems. The standard organization facilitates the integration of the material into most introductory courses.

  19. Separability of boreal forest species in the Lake Jennette area, Minnesota

    NASA Technical Reports Server (NTRS)

    Shen, S. S.; Carnes, J. G.; Badhwar, G. D.


    In order to exploit the use of thematic mapper (TM) data to obtain vegetation and net primary productivity maps in the boreal forest, three aircraft flights were undertaken over the area near Ely, MN, with the NS 001 Thematic Mapper Simulator. Attention is presently given to an analysis of these 1983 data, which attempted to separate coniferous trees from deciduous ones. Canopy reflectance models and measured optical properties of the scattering elements have been used to deepen understanding of this separability, and to relate the ratio of nadir view reflectances in TM bands 4 and 3 to the overstory leaf area index. A map that is proportional to the leaf area index for deciduous species is presented.

  20. Society of Nuclear Medicine--57th annual meeting.


    Searle, Ben


    The 57th Annual Meeting of the Society of Nuclear Medicine, held in Salt Lake City, UT, USA, included topics covering new developments in imaging agents and radiopharmaceutical therapies in the field of nuclear medicine. This conference report highlights selected presentations related to imaging of the brain, the prediction of heart disease, and the detection and treatment of various cancers. Investigational drugs discussed include TF-2 plus [68Ga]IMP-288 and TF-2 plus [111In]IMP-288 (both Immunomedics Inc), [11C]PBR-170 (Royal Prince Alfred Hospital/Australian Nuclear Science & Technology Organization), [11C]LY-2795050 (Eli Lilly & Co), yttrium (90Y) clivatuzumab tetraxetan (Garden State Cancer Center/Immunomedics Inc), [18F]LMI-1195 (Lantheus Medical Imaging Inc), fluciclovine (18F) (GE Healthcare/Nihon Medi-Physics Co Ltd), [99mTc]MIP-1340 and [99mTc]MIP-1407 (both Molecular Insight Pharmaceuticals Inc).

  21. Platelet receptor glycoprotein IIb/IIIa inhibition with eptifibatide in a patient with thrombocytopenia after treatment with abciximab.


    Coto, H


    Clinical experience suggests that patients treated with the glycoprotein (GP) IIb/IIIa inhibitor abciximab (ReoPro , Eli Lilly and Company, Indianapolis, Indiana) may be at increased risk of thrombocytopenia. This case report details the successful use of the GP IIb/IIIa inhibitor eptifibatide (Integrilin , COR Therapeutics, South San Francisco, California) in a patient who developed acute thrombocytopenia (platelet count: 67,000/mm3) approximately 10 hours after initiation of abciximab therapy. Five hours after abciximab was discontinued, platelet count returned to normal (191,000/mm3) and eptifibatide was started because of persistent electrocardiographic evidence of ischemia. The patient underwent diagnostic catheterization during eptifibatide therapy, which was administered for approximately three days. Four days after the initial course of therapy with eptifibatide was discontinued, percutaneous revascularization with adjunct eptifibatide was performed. During both courses of eptifibatide therapy, platelet counts remained in the normal range (> 100,000/mm3) and no adverse ischemic or bleeding events occurred.

  1. The Lichnerowicz-Weitzenboeck formula and superconductivity

    SciTech Connect

    Vargas-Paredes, Alfredo A.; Doria, Mauro M.; Neto, Jose Abdala Helayeel


    We derive the Lichnerowicz-Weitzenboeck formula for the two-component order parameter superconductor, which provides a twofold view of the kinetic energy of the superconductor. For the one component order parameter superconductor we review the connection between the Lichnerowicz-Weitzenboeck formula and the Ginzburg-Landau theory. For the two-component case we claim that this formula opens a venue to describe inhomogeneous superconducting states intertwined by spin correlations and charged dislocation. In this case the Lichnerowicz-Weitzenboeck formula displays local rotational and electromagnetic gauge symmetry (SU(2) Circled-Times U(1)) and relies on local commuting momentum and spin operators. The order parameter lives in a space with curvature and torsion described by Elie Cartan geometrical formalism. The Lichnerowickz-Weitzenboeck formula leads to first order differential equations that are a three-dimensional version of the Seiberg-Witten equations.

  2. Allelic Spectra of Risk SNPs Are Different for Environment/Lifestyle Dependent versus Independent Diseases

    PubMed Central

    Amos, Christopher I.


    Genome-wide association studies (GWAS) have generated sufficient data to assess the role of selection in shaping allelic diversity of disease-associated SNPs. Negative selection against disease risk variants is expected to reduce their frequencies making them overrepresented in the group of minor (<50%) alleles. Indeed, we found that the overall proportion of risk alleles was higher among alleles with frequency <50% (minor alleles) compared to that in the group of major alleles. We hypothesized that negative selection may have different effects on environment (or lifestyle)-dependent versus environment (or lifestyle)-independent diseases. We used an environment/lifestyle index (ELI) to assess influence of environmental/lifestyle factors on disease etiology. ELI was defined as the number of publications mentioning “environment” or “lifestyle” AND disease per 1,000 disease-mentioning publications. We found that the frequency distributions of the risk alleles for the diseases with strong environmental/lifestyle components follow the distribution expected under a selectively neutral model, while frequency distributions of the risk alleles for the diseases with weak environmental/lifestyle influences is shifted to the lower values indicating effects of negative selection. We hypothesized that previously selectively neutral variants become risk alleles when environment changes. The hypothesis of ancestrally neutral, currently disadvantageous risk-associated alleles predicts that the distribution of risk alleles for the environment/lifestyle dependent diseases will follow a neutral model since natural selection has not had enough time to influence allele frequencies. The results of our analysis suggest that prediction of SNP functionality based on the level of evolutionary conservation may not be useful for SNPs associated with environment/lifestyle dependent diseases. PMID:26201053

  3. Development, implementation and critique of a bioethics framework for pharmaceutical sponsors of human biomedical research.


    Van Campen, Luann E; Therasse, Donald G; Klopfenstein, Mitchell; Levine, Robert J


    Pharmaceutical human biomedical research is a multi-dimensional endeavor that requires collaboration among many parties, including those who sponsor, conduct, participate in, or stand to benefit from the research. Human subjects' protections have been promulgated to ensure that the benefits of such research are accomplished with respect for and minimal risk to individual research participants, and with an overall sense of fairness. Although these protections are foundational to clinical research, most ethics guidance primarily highlights the responsibilities of investigators and ethics review boards. Currently, there is no published resource that comprehensively addresses bioethical responsibilities of industry sponsors; including their responsibilities to parties who are not research participants, but are, nevertheless key stakeholders in the endeavor. To fill this void, in 2010 Eli Lilly and Company instituted a Bioethics Framework for Human Biomedical Research. This paper describes how the framework was developed and implemented and provides a critique based on four years of experience. A companion article provides the actual document used by Eli Lilly and Company to guide ethical decisions regarding all phases of human clinical trials. While many of the concepts presented in this framework are not novel, compiling them in a manner that articulates the ethical responsibilities of a sponsor is novel. By utilizing this type of bioethics framework, we have been able to develop bioethics positions on various topics, provide research ethics consultations, and integrate bioethics into the daily operations of our human biomedical research. We hope that by sharing these companion papers we will stimulate discussion within and outside the biopharmaceutical industry for the benefit of the multiple parties involved in pharmaceutical human biomedical research.

  4. Design of a large acceptance, high efficiency energy selection system for the ELIMAIA beam-line

    NASA Astrophysics Data System (ADS)

    Schillaci, F.; Maggiore, M.; Andó, L.; Cirrone, G. A. P.; Cuttone, G.; Romano, F.; Scuderi, V.; Allegra, L.; Amato, A.; Gallo, G.; Korn, G.; Leanza, R.; Margarone, D.; Milluzzo, G.; Petringa, G.


    A magnetic chicane based on four electromagnetic dipoles is going to be realized by INFN-LNS to be used as an Energy Selection System (ESS) for laser driven proton beams up to 300 MeV and C6+ up to 70 MeV/u. The system will provide, as output, ion beams with a contrallable energy spread varying from 5% up to 20% according to the aperture slit size. Moreover, it has a very wide acceptance in order to ensure a very high transmission efficiency and, in principle, it has been designed to be used also as an active energy modulator. This system is the core element of the ELIMED (ELI-Beamlines MEDical and Multidisciplinary applications) beam transport, dosimetry and irradiation line that will be developed by INFN-LNS (It) and installed at the ELI-Beamlines facility in Prague (Cz). ELIMED will be the first user's open transport beam-line where a controlled laser-driven ion beam will be used for multidisciplinary research. The definition of well specified characteristics, both in terms of performance and field quality, of the magnetic chicane is crucial for the system realization, for the accurate study of the beam dynamics and for the proper matching with the Permanent Magnet Quadrupoles (PMQs) used as a collection system already designed. Here, the design of the magnetic chicane is described in details together with the adopted solutions in order to realize a robust system form the magnetic point of view. Moreover, the first preliminary transport simulations are also described showing the good performance of the whole beam line (PMQs+ESS).

  5. Quantitative evaluation of susceptibility effects caused by dental materials in head magnetic resonance imaging

    NASA Astrophysics Data System (ADS)

    Strocchi, S.; Ghielmi, M.; Basilico, F.; Macchi, A.; Novario, R.; Ferretti, R.; Binaghi, E.


    This work quantitatively evaluates the effects induced by susceptibility characteristics of materials commonly used in dental practice on the quality of head MR images in a clinical 1.5T device. The proposed evaluation procedure measures the image artifacts induced by susceptibility in MR images by providing an index consistent with the global degradation as perceived by the experts. Susceptibility artifacts were evaluated in a near-clinical setup, using a phantom with susceptibility and geometric characteristics similar to that of a human head. We tested different dentist materials, called PAL Keramit, Ti6Al4V-ELI, Keramit NP, ILOR F, Zirconia and used different clinical MR acquisition sequences, such as "classical" SE and fast, gradient, and diffusion sequences. The evaluation is designed as a matching process between reference and artifacts affected images recording the same scene. The extent of the degradation induced by susceptibility is then measured in terms of similarity with the corresponding reference image. The matching process involves a multimodal registration task and the use an adequate similarity index psychophysically validated, based on correlation coefficient. The proposed analyses are integrated within a computer-supported procedure that interactively guides the users in the different phases of the evaluation method. 2-Dimensional and 3-dimensional indexes are used for each material and each acquisition sequence. From these, we drew a ranking of the materials, averaging the results obtained. Zirconia and ILOR F appear to be the best choice from the susceptibility artefacts point of view, followed, in order, by PAL Keramit, Ti6Al4V-ELI and Keramit NP.

  6. ELIMED, future hadrontherapy applications of laser-accelerated beams

    NASA Astrophysics Data System (ADS)

    Cirrone, Giuseppe A. P.; Carpinelli, Massimo; Cuttone, Giacomo; Gammino, Santo; Bijan Jia, S.; Korn, Georg; Maggiore, Mario; Manti, Lorenzo; Margarone, Daniele; Prokupek, Jan; Renis, Marcella; Romano, Francesco; Schillaci, Francesco; Tomasello, Barbara; Torrisi, Lorenzo; Tramontana, Antonella; Velyhan, Andriy


    Laser-ion acceleration has recently gained a great interest as an alternative to conventional and more expensive acceleration techniques. These ion beams have desirable qualities such as small source size, high luminosity and small emittance to be used in different fields as Nuclear Physics, Medical Physics, etc. This is very promising specially for the future perspective of a new concept of hadrontherapy based on laser-based devices could be developed, replacing traditional accelerating machines. Before delivering laser-driven beams for treatments they have to be handled, cleaned from unwanted particles and characterized in order to have the clinical requirements. In fact ion energy spectra have exponential trend, almost 100% energy spread and a wide angular divergence which is the biggest issue in the beam transport and, hence, in a wider use of this technology. In order to demonstrate the clinical applicability of laser-driven beams new collaboration between ELI-Beamlines project researchers from Prague (Cz) and a INFN-LNS group from Catania (I) has been already launched and scientists from different countries have already express their will in joining the project. This cooperation has been named ELIMED (MEDical application at ELIBeamlines) and will take place inside the ELI-Beamlines infrastructure located in Prague. This work describes the schedule of the ELIMED project and the design of the energy selector which will be realized at INFN-LNS. The device is an important part of the whole transport beam line which will be realised in order to make the ion beams suitable for medical applications.

  7. Introduction to special issue on 'Cosmology and Time' for SHPMP

    NASA Astrophysics Data System (ADS)

    Grosholz, Emily


    This collection of essays stems from the Workshop on Cosmology and Time held at the Pennsylvania State University on April 16-17, 2013, with support from the Department of Philosophy, the Schreyer Honors College, and the Center for Fundamental Theory/Institute for Gravitation and the Cosmos. My thanks to Shannon Sullivan and Susan Welch, Arun Upneja and Christian Brady, and Abhay Ashtekar, Murat Gunaydin and Randi Neshteruk. I'd also like to acknowledge helpful counsel from Gordon Fleming (Professor of Physics Emeritus, Penn State), who has been generous with his time and expertise, and John Norton (Director, Center for History and Philosophy of Science, University of Pittsburgh), who not only contributed to the workshop but also introduced me to the work of two of his graduate students. The original intention of the workshop was to pair younger scholars with older, more established scholars; during the workshop, we listened to exchanges between Bryan Roberts and Abhay Ashtekar, William Nelson and Sarah Shandera, Thomas Pashby and Gordon Fleming, David Sloan and Kurt Gibble, Elie During and myself, and Alexis de Saint-Ours and John Norton. Though some of these exchanges did not persist through the creation of this collection of essays, those that did were further developed in useful ways. I also wanted to bring philosophers and scientists together, as well as colleagues from Europe and North America. The latter intention was strengthened by the later addition of responses or essays by Jeremy Butterfield, Julian Barbour, Klaus Mainzer, and Lee Smolin, to complement the 'overview' essays by Abhay Ashtekar and John Norton that begin and end the second part. Though the thoughtful and stimulating essays and responses by William Nelson, Sarah Shandera, Kurt Gibble, Elie During and Klaus Mainzer did not survive the process of assembling this special issue, because they were too technical or did not fit in structurally or could not be revised in time, their contributions

  8. Submarine gravity slides on the Paleozoic continental slope at the western edge of the Great Basin, east-cental California: A mechanism for development of unconformities in slope environments

    USGS Publications Warehouse

    Stevens, C.H.; Stone, P.


    The middle Paleozoic continental slope, represented by rocks exposed near Badger Flat in the northwestern Inyo Mountains, at the western edge of the Great Basin in east-central California, failed by submarine gravity sliding twice during Silurian and Devonian time. Each time a major unconformity was developed between the surface exposed beneath the slides and the much younger rocks deposited after the slope failures. The first slope-failure event took place between the late Early Silurian and the end of the Late Silurian when much of the upper member of the Late Ordovician-Early Silurian Ely Springs Dolomite was detached and displaced as a coherent slab ???1 km down slope. The second event occurred in the Middle Devonian when rocks of the Ely Springs Dolomite were again detached, this time forming a rockslide that traveled about 10km down slope to the northwest where it was deposited as a chaotic breccia >250m thick. These events took place as the region was undergoing substantial geomorphic change. The first detachment resulted from an abrupt steepening of the slope, an event previously recognized as having occurred all along the continental margin from eastern California to central Idaho. The second event probably was triggered by a pronounced drop in sea level on the already rather steep slope. At least one similar detachment resulting in an unconformity has been recognized along the middle Paleozoic margin in central Nevada. Recognition of these slope-failure events in an area of unusually complete exposure of middle Paleozoic slope deposits provides an excellent example of a mechanism other than submarine erosion or nondeposition to explain the development of unconformities in ancient slope sequences.

  9. Nuclear photonics at ultra-high counting rates and higher multipole excitations

    NASA Astrophysics Data System (ADS)

    Thirolf, P. G.; Habs, D.; Filipescu, D.; Gernhäuser, R.; Günther, M. M.; Jentschel, M.; Marginean, N.; Pietralla, N.


    Next-generation γ beams from laser Compton-backscattering facilities like ELI-NP (Bucharest)] or MEGa-Ray (Livermore) will drastically exceed the photon flux presently available at existing facilities, reaching or even exceeding 1013 γ/sec. The beam structure as presently foreseen for MEGa-Ray and ELI-NP builds upon a structure of macro-pulses (˜120 Hz) for the electron beam, accelerated with X-band technology at 11.5 GHz, resulting in a micro structure of 87 ps distance between the electron pulses acting as mirrors for a counterpropagating intense laser. In total each 8.3 ms a γ pulse series with a duration of about 100 ns will impinge on the target, resulting in an instantaneous photon flux of about 1018 γ/s, thus introducing major challenges in view of pile-up. Novel γ optics will be applied to monochromatize the γ beam to ultimately ΔE/E˜10-6. Thus level-selective spectroscopy of higher multipole excitations will become accessible with good contrast for the first time. Fast responding γ detectors, e.g. based on advanced scintillator technology (e.g. LaBr3(Ce)) allow for measurements with count rates as high as 106-107 γ/s without significant drop of performance. Data handling adapted to the beam conditions could be performed by fast digitizing electronics, able to sample data traces during the micro-pulse duration, while the subsequent macro-pulse gap of ca. 8 ms leaves ample time for data readout. A ball of LaBr3 detectors with digital readout appears to best suited for this novel type of nuclear photonics at ultra-high counting rates.

  10. Diagnostic potential of structural neuroimaging for depression from a multi-ethnic community sample

    PubMed Central

    Sankar, Anjali; Zhang, Tianhao; Gaonkar, Bilwaj; Doshi, Jimit; Erus, Guray; Costafreda, Sergi G.; Marangell, Lauren; Davatzikos, Christos


    Background At present, we do not have any biological tests which can contribute towards a diagnosis of depression. Neuroimaging measures have shown some potential as biomarkers for diagnosis. However, participants have generally been from the same ethnic background while the applicability of a biomarker would require replication in individuals of diverse ethnicities. Aims We sought to examine the diagnostic potential of the structural neuroanatomy of depression in a sample of a wide ethnic diversity. Method Structural magnetic resonance imaging (MRI) scans were obtained from 23 patients with major depressive disorder in an acute depressive episode (mean age: 39.8 years) and 20 matched healthy volunteers (mean age: 38.8 years). Participants were of Asian, African and Caucasian ethnicity recruited from the general community. Results Structural neuroanatomy combining white and grey matter distinguished patients from controls at the highest accuracy of 81% with the most stable pattern being at around 70%. A widespread network encompassing frontal, parietal, occipital and cerebellar regions contributed towards diagnostic classification. Conclusions These findings provide an important step in the development of potential neuroimaging-based tools for diagnosis as they demonstrate that the identification of depression is feasible within a multi-ethnic group from the community. Declaration of interests C.H.Y.F. has held recent research grants from Eli Lilly and Company and GlaxoSmithKline. L.M. is a former employee and stockholder of Eli Lilly and Company. Copyright and usage © The Royal College of Psychiatrists 2016. This is an open access article distributed under the terms of the Creative Commons Non-Commercial, No Derivatives (CC BY-NC-ND) licence. PMID:27703783

  11. Fatigue properties of a metastable beta-type titanium alloy with reversible phase transformation.


    Li, S J; Cui, T C; Hao, Y L; Yang, R


    Due to recent concern about allergic and toxic effects of Ni ions released from TiNi alloy into human body, much attention has been focused on the development of new Ni-free, metastable beta-type biomedical titanium alloys with a reversible phase transformation between the beta phase and the alpha'' martensite. This study investigates the effect of the stress-induced alpha'' martensite on the mechanical and fatigue properties of Ti-24Nb-4Zr-7.6Sn (wt.%) alloy. The results show that the as-forged alloy has a low dynamic Young's modulus of 55GPa and a recoverable tensile strain of approximately 3%. Compared with Ti-6Al-4V ELI, the studied alloy has quite a high low-cycle fatigue strength because of the effective suppression of microplastic deformation by the reversible martensitic transformation. Due to the low critical stress required to induce the martensitic transformation, it has low fatigue endurance comparable to that of Ti-6Al-4V ELI. Cold rolling produces a beta+alpha'' two-phase microstructure that is characterized by regions of nano-size beta grains interspersed with coarse grains containing alpha'' martensite plates. Cold rolling increases fatigue endurance by approximately 50% while decreasing the Young's modulus to 49GPa along the rolling direction but increasing it to 68GPa along the transverse direction. Due to the effective suppression of the brittle isothermal omega phase, balanced properties of high strength, low Young's modulus and good ductility can be achieved through ageing treatment at intermediate temperature.

  12. Charge transfer via the dative N-B bond and dihydrogen contacts. Experimental and theoretical electron density studies of four deltahedral boranes.


    Mebs, Stefan; Kalinowski, Roman; Grabowsky, Simon; Förster, Diana; Kickbusch, Rainer; Justus, Eugen; Morgenroth, Wolfgang; Paulmann, Carsten; Luger, Peter; Gabel, Detlef; Lentz, Dieter


    In an approach combining high resolution X-ray diffraction at low temperatures with density functional calculations, two closo-borates, B12H12(2-) (1) and B10H10(2-) (2), and two arachno-boranes, B10H12L2 (L = amine (3) or acetonitrile (4)), are studied by means of Atoms In Molecules (AIM) theory and Electron Localizability Indicator (ELI-D). The charge transfer via the dative N-B bonds in the arachno-boranes and via dihydrogen contacts in the closo-borates is quantified. The dative N-B bond in 4 is significantly shorter and stronger than that in 3 and in small N-B Lewis acid base adducts from the literature. It is even shorter in the gas phase than in the crystal environment in contrast to the bond shortening in the crystal generally found for N-B Lewis acid-base adducts. Furthermore, the calculated charge transfer in terms of AIM charges is opposite to the expected N → B direction but still weak as found for all other N-B bonds. The intramolecular charge redistributions due to intermolecular interactions are quantified by the AIM and ELI-D analysis of contact ion pairs. The latter method gives a deeper understanding of delocalization effects in the borane cages as well as in the counterions. Since dihydrogen bonds are rarely found in crystal structures, one focus was directed to the topologies of the large number of 58 experimentally found contacts of this type. The analysis reveals that the electron density at the bond critical point, the corresponding Laplace function, and the curvature along the bond path (λ3) show a behavior that clearly discriminates these interactions from classical hydrogen bonds, confirming earlier theoretical findings.

  13. A Genome-Wide Screen for Bacterial Envelope Biogenesis Mutants Identifies a Novel Factor Involved in Cell Wall Precursor Metabolism

    PubMed Central

    Paradis-Bleau, Catherine; Kritikos, George; Orlova, Katya; Typas, Athanasios; Bernhardt, Thomas G.


    The cell envelope of Gram-negative bacteria is a formidable barrier that is difficult for antimicrobial drugs to penetrate. Thus, the list of treatments effective against these organisms is small and with the rise of new resistance mechanisms is shrinking rapidly. New therapies to treat Gram-negative bacterial infections are therefore sorely needed. This goal will be greatly aided by a detailed mechanistic understanding of envelope assembly. Although excellent progress in the identification of essential envelope biogenesis systems has been made in recent years, many aspects of the process remain to be elucidated. We therefore developed a simple, quantitative, and high-throughput assay for mutants with envelope biogenesis defects and used it to screen an ordered single-gene deletion library of Escherichia coli. The screen was robust and correctly identified numerous mutants known to be involved in envelope assembly. Importantly, the screen also implicated 102 genes of unknown function as encoding factors that likely impact envelope biogenesis. As a proof of principle, one of these factors, ElyC (YcbC), was characterized further and shown to play a critical role in the metabolism of the essential lipid carrier used for the biogenesis of cell wall and other bacterial surface polysaccharides. Further analysis of the function of ElyC and other hits identified in our screen is likely to uncover a wealth of new information about the biogenesis of the Gram-negative envelope and the vulnerabilities in the system suitable for drug targeting. Moreover, the screening assay described here should be readily adaptable to other organisms to study the biogenesis of different envelope architectures. PMID:24391520

  14. Lower Permian stratigraphy of east-central Nevada and adjacent Utah

    USGS Publications Warehouse

    Barosh, Patrick James


    The Permian section near Ely, Nevada, consists of, in ascending order: Riepe Spring Limestone, a bluff-forming limestone with abundant corals, and Reipetown Sandstone, a buff to red very coarse-grained siltstone with minor carbonates, both formations of Steele (1960); Arcturus Formation, divisible into a Lower Member composed of alternating medium-bedded limestone and buff siltstone, and an Upper Member composed of alternating thin-bedded limestone and buff to red siltstone and gypsum; and Kaibab Limestone, a massive bioclastic limestone. The Wolfcamp-Leonard boundary occurs within the Arcturus Formation. West of Ely the Riepe Spring Limestone and Reipetown Sandstone thin and change into thin-bedded cherty limestone. These beds, plus the basal part of the Arcturus Formation, form the Carbon Ridge Formation at Dry Mountain at Eureka. At Dry Mountain, minor clastic chert occurs in the Arcturus Formation, and beyond to the west clastic chert replaces most of the limestone to form the conglomeratic Garden Valley Formation. The cherty limestone at the base of the Garden Valley is apparently equivalent to the upper part of the Carbon Ridge Formation at Carbon Ridge. Eastward in Utah the Riepe Spring Limestone is recognizable in the Confusion Range, but is almost unrecognizable in the Needle Range. The dolomite content in the Reipetown Sandstone usually increases to 25 percent of the formation in the Confusion and Needle ranges. The Arcturus Formation thins and undergoes moderate lithologic changes. It is equivalent to the rocks above a horizon 300 feet below Bed A of the Arcturus Formation as mapped in the Confusion Range by Hose and Repenning (1959, 1963).

  15. Nuclear photonics at ultra-high counting rates and higher multipole excitations

    SciTech Connect

    Thirolf, P. G.; Habs, D.; Filipescu, D.; Gernhaeuser, R.; Guenther, M. M.; Jentschel, M.; Marginean, N.; Pietralla, N.


    Next-generation {gamma} beams from laser Compton-backscattering facilities like ELI-NP (Bucharest)] or MEGa-Ray (Livermore) will drastically exceed the photon flux presently available at existing facilities, reaching or even exceeding 10{sup 13}{gamma}/sec. The beam structure as presently foreseen for MEGa-Ray and ELI-NP builds upon a structure of macro-pulses ({approx}120 Hz) for the electron beam, accelerated with X-band technology at 11.5 GHz, resulting in a micro structure of 87 ps distance between the electron pulses acting as mirrors for a counterpropagating intense laser. In total each 8.3 ms a {gamma} pulse series with a duration of about 100 ns will impinge on the target, resulting in an instantaneous photon flux of about 10{sup 18}{gamma}/s, thus introducing major challenges in view of pile-up. Novel {gamma} optics will be applied to monochromatize the {gamma} beam to ultimately {Delta}E/E{approx}10{sup -6}. Thus level-selective spectroscopy of higher multipole excitations will become accessible with good contrast for the first time. Fast responding {gamma} detectors, e.g. based on advanced scintillator technology (e.g. LaBr{sub 3}(Ce)) allow for measurements with count rates as high as 10{sup 6}-10{sup 7}{gamma}/s without significant drop of performance. Data handling adapted to the beam conditions could be performed by fast digitizing electronics, able to sample data traces during the micro-pulse duration, while the subsequent macro-pulse gap of ca. 8 ms leaves ample time for data readout. A ball of LaBr{sub 3} detectors with digital readout appears to best suited for this novel type of nuclear photonics at ultra-high counting rates.

  16. Sulfur and oxygen isotope study of the Vermont copper belt: evidence of seawater hydrothermal alteration and sulfate reduction in a high-grade metamorphic terrane

    SciTech Connect

    Shanks, W.C. III; Woodruff, L.G.; Slack, J.F.


    Massive sulfide deposits of the Orange County copper district, in east-central Vermont, consist of stratiform lenses of pyrrhotite, chalcopyrite, and minor sphalerite within amphibolite-facies rocks of Early Devonian (.) age. The deposits occur at several different stratigraphic levels. The two largest, Elizabeth and Ely, are in quartz-mica schists of the Gile Mountain Formation; the Pike Hill deposit occurs in calcareous quartz-mica schist of the underlying Waits River Formation. Two small deposits (Orange and Gove) are within the Standing Pond Volcanics, a thin tholeiitic amphibolite near the Gile Mountain-Waits River contact. The Elizabeth deposit in particularly distinctive, and contains a suite of unusual wall rocks rich in quartz, carbonate, muscovite, amphibole, phlogopite, tourmaline, spessartine, and sodic plagioclase. Sulfur isotope values at Elizabeth and Ely of 5.1 to 9.1 per thousands contrast with values for Gove (1.9 to 4.2) and Pike Hill (1.5 to 4.6). Disseminated sulfides in amphibolites of the Standing Pond Volcanics have sulfur isotope values in the range -0.1 to 1.7 per thousands, typical of MORB. These data require sulfur contributions to massive sulfide deposits both from basalt and from contemporaneous seawater sulfate sources. Whole-rock (carbonate free) oxygen isotope analyses of host lithologies range from 7.9 per thousands (Standing Pond Volcanics) to 19.9 per thousands (Waits River Formation). Detailed sampling of Elizabeth wall rocks (including those high in B, Na, Mg, Al, Si, Mn) yields a narrow range of oxygen isotope values (11.1 to 14.1); heavier values correlate with higher silica contents. Isotopically light wallrock lithologies are probably due to premetamorphic seawater hydrothermal alteration.

  17. The role of GLP-1 mimetics and basal insulin analogues in type 2 diabetes mellitus: guidance from studies of liraglutide

    PubMed Central

    Barnett, A H


    In people with type 2 diabetes mellitus (T2DM), the incretin effect is reduced, but the recent advent of dipeptidyl peptidase-4 inhibitors and glucagon-like peptide (GLP)-1 agonists/analogues has enabled restoration of at least some of the function of the incretin system, with accompanying improvements in glycaemic control. Two GLP-1 receptor agonists/analogues are currently approved for the treatment of T2DM—exenatide (Byetta®, Eli Lilly & Co., Indianapolis, IN, US) and liraglutide (Victoza®, Novo Nordisk, Bagsvaerd, Denmark); a once-weekly formulation of exenatide (Bydureon®, Eli Lilly & Co.) has also been approved by the European Medicines Agency. The National Institute for Health and Clinical Excellence (NICE) has recently published guidance on the use of liraglutide in T2DM, based on evidence from the Liraglutide Effect and Action in Diabetes (LEAD) Phase III trial programme, which compared liraglutide with existing glucose-lowering therapies, such as exenatide and insulin glargine. The LEAD programme reported HbA1c reductions from 0.8 to 1.5% with liraglutide (1.2 and 1.8 mg), accompanied by low rates of hypoglycaemia and some weight loss; side effects were primarily gastrointestinal in nature (e.g. nausea and diarrhoea). Based on the findings of the LEAD studies and the NICE recommendation, liraglutide now represents an important therapy widely available in the UK for certain patient groups, including those with a body mass index (BMI) ≥35.0 kg/m2, and patients with a BMI <35 kg/m2 who are considered unsuitable for insulin and are failing to meet targets for glycaemic control with oral agents. NICE guidelines still suggest that most patients without considerable obesity (BMI <35 kg/m2) are probably best managed using insulin therapy. Evidence also suggests a future role for GLP-1 mimetics in combination with basal insulin. PMID:22051096

  18. Developing your leadership pipeline.


    Conger, Jay A; Fulmer, Robert M


    Why do so many newly minted leaders fail so spectacularly? Part of the problem is that in many companies, succession planning is little more than creating a list of high-potential employees and the slots they might fill. It's a mechanical process that's too narrow and hidebound to uncover and correct skill gaps that can derail promising young executives. And it's completely divorced from organizational efforts to transform managers into leaders. Some companies, however, do succeed in building a steady, reliable pipeline of leadership talent by marrying succession planning with leadership development. Eli Lilly, Dow Chemical, Bank of America, and Sonoco Products have created long-term processes for managing the talent roster throughout their organizations--a process Conger and Fulmer call succession management. Drawing on the experiences of these best-practice organizations, the authors outline five rules for establishing a healthy succession management system: Focus on opportunities for development, identify linchpin positions, make the system transparent, measure progress regularly, and be flexible. In Eli Lilly's "action-learning" program, high-potential employees are given a strategic problem to solve so they can learn something of what it takes to be a general manager. The company--and most other best-practice organizations--also relies on Web-based succession management tools to demystify the succession process, and it makes employees themselves responsible for updating the information in their personnel files. Best-practice organizations also track various metrics that reveal whether the right people are moving into the right jobs at the right time, and they assess the strengths and weaknesses not only of individuals but of the entire group. These companies also expect to be tweaking their systems continually, making them easier to use and more responsive to the needs of the organization.

  19. Effective theory and breakdown of conformal symmetry in a long-range quantum chain

    NASA Astrophysics Data System (ADS)

    Lepori, L.; Vodola, D.; Pupillo, G.; Gori, G.; Trombettoni, A.


    We deal with the problem of studying the symmetries and the effective theories of long-range models around their critical points. A prominent issue is to determine whether they possess (or not) conformal symmetry (CS) at criticality and how the presence of CS depends on the range of the interactions. To have a model, both simple to treat and interesting, where to investigate these questions, we focus on the Kitaev chain with long-range pairings decaying with distance as power-law with exponent α. This is a quadratic solvable model, yet displaying non-trivial quantum phase transitions. Two critical lines are found, occurring respectively at a positive and a negative chemical potential. Focusing first on the critical line at positive chemical potential, by means of a renormalization group approach we derive its effective theory close to criticality. Our main result is that the effective action is the sum of two terms: a Dirac action SD, found in the short-range Ising universality class, and an "anomalous" CS breaking term SAN. While SD originates from low-energy excitations in the spectrum, SAN originates from the higher energy modes where singularities develop, due to the long-range nature of the model. At criticality SAN flows to zero for α > 2, while for α < 2 it dominates and determines the breakdown of the CS. Out of criticality SAN breaks, in the considered approximation, the effective Lorentz invariance (ELI) for every finite α. As α increases such ELI breakdown becomes less and less pronounced and in the short-range limit α → ∞ the ELI is restored. In order to test the validity of the determined effective theory, we compared the two-fermion static correlation functions and the von Neumann entropy obtained from them with the ones calculated on the lattice, finding agreement. These results explain two observed features characteristic of long-range models, the hybrid decay of static correlation functions within gapped phases and the area-law violation

  20. Characterization of Ti-6%Al-4%V and VascoMax C-350

    SciTech Connect

    Sunwoo, A J


    failed in the center of the gage section. The Ti64 alloy contains extra low interstitials (ELI). There are an advantage and a disadvantage to having ELI. The advantage is that the alloy can exhibit good ductility since there is no effective deformation hindrance to mitigate the deformation twinning. The strength of the alloy is predominantly obtained from fine, equiaxed a grains. Given only the SHT, the alloy exhibits an adequate strength and ductility combination. The disadvantage of ELI is that the Young's modulus is sensitive to composition and heat treatment. The present alloy displays slightly lower Young's modulus values than the reported value of 108 GPa with the comparable SHT [1]. If needed, higher Young's modulus and strength can be obtained with subsequent aging treatment. The fracture surfaces of the specimens suggest ductile, dimple failure. Figure 3 shows the representative fracture characteristics of SHT Ti64. The cross-sectional view of the broken specimen has the appearance of extensive deformation prior to fracture (see Fig. 3a). The contribution of microstructure is clearly seen in the fracture surface, where the larger dimples represent the {alpha} phase since the dimple sizes are equivalent to the grain size. The smaller dimples are surmised to be {beta} precipitates. In addition to dimples, the fracture surface contained some sheared grains, indicated by the arrow in Figure 3b. It is inferred that since the deformation mechanism is twinning, it could be the twin interface separation.

  1. Digital Pulse Shape Analysis with Phoswich Detectors to Simplify Coincidence Measurements of Radioactive Xenon

    SciTech Connect

    Hennig, Wolfgang; Tan, Hui; Warburton, William K.; McIntyre, Justin I.


    The Comprehensive Nuclear-Test-Ban Treaty establishes a network of monitoring stations to detect radioactive Xenon in the atmosphere from nuclear weapons testing. One such monitoring system is the Automated Radio-xenon Sampler/Analyzer (ARSA) developed at Pacific Northwest National Laboratory, which uses a complex arrangement of separate beta and gamma detectors to detect beta-gamma coincidences from the Xe isotopes of interest. The coincidence measurement is very sensitive, but the large number of detectors and photomultiplier tubes require careful calibration which makes the system hard to use. It has been suggested that beta-gamma coincidences could be detected with only a single photomultiplier tube and electronics channel by using a phoswich detector consisting of optically coupled beta and gamma detectors (Ely, 2003). In that work, rise time analysis of signals from a phoswich detector was explored as a method to determine if interactions occurred in either the beta or the gamma detector or in both simultaneously. However, this approach was not able to detect coincidences with the required sensitivity or to measure the beta and gamma energies with sufficient precision for Xenon monitoring. In this paper, we present a new algorithm to detect coincidences by pulse shape analysis of the signals from a BC-404/CsI(Tl) phoswich detector. Implemented on fast digital readout electronics, the algorithm achieves clear separation of beta only, gamma only and coincidence events, accurate measurement of both beta and gamma energies, and has an error rate for detecting coincidences of less than 0.1%. Monte Carlo simulations of radiation transport and light collection were performed to optimize design parameters for a replacement detector module for the ARSA system, obtaining an estimated coincidence detection efficiency of 82-92% and a background rejection rate better than 99%. The new phoswich/pulse shape analysis method is thus suitable to simplify the existing ARSA

  2. Desmozoon lepeophtherii n. gen., n. sp., (Microsporidia: Enterocytozoonidae) infecting the salmon louse Lepeophtheirus salmonis (Copepoda: Caligidae)

    PubMed Central


    Background A microsporidian was previously reported to infect the crustacean parasite, Lepeophtheirus salmonis (Krøyer, 1837) (Copepoda, Caligidae), on farmed Atlantic salmon (Salmo salar L.) in Scotland. The microsporidian was shown to be a novel species with a molecular phylogenetic relationship to Nucleospora (Enterocytozoonidae), but the original report did not assign it to a genus or species. Further studies examined the development of the microsporidian in L. salmonis using electron microscopy and re-evaluated the molecular findings using new sequence data available for the group. Here we report a full description for the microsporidian and assign it to a new genus and species. Results The microsporidian infects subcuticular cells that lie on the innermost region of the epidermal tissue layer beneath the cuticle and along the internal haemocoelic divisions. The mature spores are sub-spherical with a single nucleus and an isofilar polar filament with 5-8 turns in a double coil. The entire development is in direct contact with the host cell cytoplasm and is polysporous. During early merogony, a diplokaryotic nuclear arrangement exists which is absent throughout the rest of the developmental cycle. Large merogonial plasmodia form which divide to form single uninucleate sporonts. Sporogonial plasmodia were not observed; instead, binucleate sporonts divide to form two sporoblasts. Prior to final division, there is a precocious development of the polar filament extrusion apparatus which is associated with large electron lucent inclusions (ELIs). Analyses of DNA sequences reveal that the microsporidian is robustly supported in a clade with other members of the Enterocytozoonidae and confirms a close phylogenetic relationship with Nucleospora. Conclusion The ultrastructural findings of the precocious development of the polar filament and the presence of ELIs are consistent with those of the Enterocytozoonidae. However, the confirmed presence of an early

  3. Fast Ignition Realization Experiments (FIREX) and Beyond

    NASA Astrophysics Data System (ADS)

    Azechi, Hiroshi


    After 50 years journey from the innovation of lasers, controlled ignition and subsequent burn will be demonstrated within a couple of years at the US National Ignition Facility (NIF). Fast ignition has the high potential to ignite a fuel using only about one tenth of laser energy of NIF [1]. One of the most advanced fast ignition programs is the Fast Ignition Realization Experiment (FIREX) [2]. The goal of its first phase is to demonstrate ignition temperature of 5 keV, followed by the second phase to demonstrate the ignition-and-burn. The first experiment of FIREX-I, reported here, gives a confidence that one can achieve ignition temperature at the heating laser energy of 10 kJ. One beam of LFEX laser was equipped with a pair of tiled gratings and successfully compressed to 1.2 ps with the energy of 1 kJ, providing about 1 PW laser power. The first experiment with the LFEX laser was performed using deuterated polystyrene shells with a gold cone. Ion temperatures of the core plasmas were deduced from the observed neutron yield, fuel density and the fuel mass. The result gives a confidence that ion temperature will increase up to the 5-keV level with using sharp rising rectangular laser pulse. Given the demonstrations of the ignition temperature at FIREX-I and the ignition-and-burn at NIF, the inertial fusion research would then shift from the plasma physics era to electric power era. Success of the high power short pulse laser system LFEX also makes us envisage future ultra high intensity lasers, such as, GEKKO-EXA and ELI [3] with sub exa Watt power. Extremely high intensity achieved in such facilities will open up ultra high-field physics. [4pt] [1] E.I. Moses, Nucl. Fusion 49(2009)104022. [0pt] [2] H. Azechi et al., Nucl. Fusion 49 (2009) 104024. [0pt] [3]

  4. Elbow and Shoulder Lesions of Baseball Players*

    PubMed Central


    George Eli Bennett was born in Claryville, NY, in the Catskill Mountains, in 1885 [3]. His parents both died by the time he was 11, leaving him the need to work while going to school, but he excelled in school and sports. He played semipro baseball at the age of 16. After high school he work in various jobs in the Midwest before he could afford to attend the University of Maryland Medical School, from which he graduated in 1908. At the age of 25 in 1910, he joined the staff at the Johns Hopkins Hospital, where he remained until his resignation in 1947. Dr. Bennett was one of a few men who served as President of both the American Orthopaedic Association and the American Academy of Orthopaedic Surgeons. While Dr. Bennett made many contributions to orthopaedic surgery, including children’s and nonoperative orthopaedics, he was best known for his work in sports medicine (undoubtedly related to his being a gifted athlete). His fame extended well beyond the orthopaedic community, for he treated many famous athletes. Sports Illustrated recognized him upon his death in an article entitled, “Mender of Immortals” [4]. His intimate knowledge of sports undoubtedly contributed to his sage judgments. At an emotional dinner in 1958 many famous athletes sometimes tearfully paid tribute to Dr. Bennett. Joe Garagiola commented on the occasion, “After listening to that all-star team of players Dr. Bennett has mended, I’m sorry I didn’t break my leg” [4]. Among Dr. Bennett’s many publications, including those related to sports, we have chosen one [2] of two articles [1,2] he wrote on elbow and shoulder problems in baseball players. He described the now well-known degenerative changes and periarticular calcific deposits that occur in the elbows and shoulders of pitchers. Some of these, he suggested, were not symptomatic and he advised against treatment. Dr. Bennett commented, however, “Since professional athletes are human beings, not supermen, general health often

  5. [Study on biocompatibility of titanium alloys].


    Kodama, T


    The biocompatibility of two different titanium alloys, Ti-6Al-4V ELI and Ti-5Al-2, 5Fe, and pure titanium were evaluated. The results were as follows: 1) Titanium alloys were implanted into the dorsal subcutaneous tissues of the Hartley guinea-pig for 12 weeks, immersed in calf serum or in Ringer's solution for 8 weeks. The surface changes of the titanium alloys were observed by SEM and the chemical composition was analyzed by XMA. No evident surface changes were found. 2) Three hundred mg, 200 mg and 100 mg of the powders of the tested materials were immersed in 2ml of Eagle's MEM, incubated for 1-7 days, 8-21 days and 22-70 days at 37 C degrees. The amount of metallic elements dissolved in the solutions was measured by ICP and AAS. The detected corrosion rates of V and Al contained in the solution, in which Ti-6Al-4V ELI 100 mg was immersed for 1-7 days, were 194.3 +/- 17.6 and 73.0 +/- 28, 1 pg/mg alloy/day, respectively. V was released more than Al. The amount of Ti was below the detectable limit. The solution Ti-5Al-2.5 Fe 100 mg immersed for 1-7 days contained 31.9 +/- 34.4 pg/mg alloy/day Fe and 25.7 +/- 6.3 pg/mg alloy/day Al. Only in the solution 300 mg immersed for 1-7 days was Ti detected at 1.4 pg/mg alloy/day. 3) By the bacterial mutation assay of Salmonella typhimurium TA 98, Salmonella typhimurium TA 100 and Escherichia coli WP2 uvrA, the solutions, in which the tested materials were immersed, were not found to be mutagenic. 4) By the UDS assay, the grain counts on autoradiography with the solutions, in which the tested materials were immersed, were not greater than the negative control. The results suggest an excellent corrosion resistance of the titanium alloys. Mutagenicity was negative by these mutation assays, indicating that the tested alloys and pure titanium are safe for humans and animals.

  6. Suicidality and aggression during antidepressant treatment: systematic review and meta-analyses based on clinical study reports

    PubMed Central

    Guski, Louise Schow; Freund, Nanna; Gøtzsche, Peter C


    Objective To study serious harms associated with selective serotonin and serotonin-norepinephrine reuptake inhibitors. Design Systematic review and meta-analysis. Main outcome measures Mortality and suicidality. Secondary outcomes were aggressive behaviour and akathisia. Data sources Clinical study reports for duloxetine, fluoxetine, paroxetine, sertraline, and venlafaxine obtained from the European and UK drug regulators, and summary trial reports for duloxetine and fluoxetine from Eli Lilly’s website. Eligibility criteria for study selection Double blind placebo controlled trials that contained any patient narratives or individual patient listings of harms. Data extraction and analysis Two researchers extracted data independently; the outcomes were meta-analysed by Peto’s exact method (fixed effect model). Results We included 70 trials (64 381 pages of clinical study reports) with 18 526 patients. These trials had limitations in the study design and discrepancies in reporting, which may have led to serious under-reporting of harms. For example, some outcomes appeared only in individual patient listings in appendices, which we had for only 32 trials, and we did not have case report forms for any of the trials. Differences in mortality (all deaths were in adults, odds ratio 1.28, 95% confidence interval 0.40 to 4.06), suicidality (1.21, 0.84 to 1.74), and akathisia (2.04, 0.93 to 4.48) were not significant, whereas patients taking antidepressants displayed more aggressive behaviour (1.93, 1.26 to 2.95). For adults, the odds ratios were 0.81 (0.51 to 1.28) for suicidality, 1.09 (0.55 to 2.14) for aggression, and 2.00 (0.79 to 5.04) for akathisia. The corresponding values for children and adolescents were 2.39 (1.31 to 4.33), 2.79 (1.62 to 4.81), and 2.15 (0.48 to 9.65). In the summary trial reports on Eli Lilly’s website, almost all deaths were noted, but all suicidal ideation events were missing, and the information on the remaining outcomes was

  7. Microstructural and strain rate effects on the environment-assisted cracking of alpha/beta-titanium alloys in aqueous chloride

    NASA Astrophysics Data System (ADS)

    Richey, Edward, III


    The objectives of this research are to determine the effect of microstructure and crack tip strain rate on environment assisted cracking (EAC) of Ti-6Al-2Sn-2Zr-2Mo-2Cr-Si, and to understand crack tip damage in terms of hydrogen/microstructure/plasticity interaction. Beta-extrusion of Ti-6-22-22, in the alpha/beta solution treated and aged (STA) condition, is susceptible to EAC under active loading in NaCl. KJTH is as low as 33% of KJIC and a fracture mode transition to transgranular (alpha-cleavage is affected by chloride exposure. Ti-6-4 (ELI) in chloride solution exhibits a minimum KJTH of 65 MPa√m, corresponding to a mill-annealed microstructure with alpha2 (K JIC = 79 MPa√m), and higher EAC resistance for a Widmanstatten microstructure. EAC growth rates in Ti-6-4 (ELI) average 3mum/s and are 10-fold slower than those for Ti-6-22-22. Ti-6-22-22 was susceptible to EAC for active loading rates ranging between 10--4 MPa√m/s and 5 Mpa√m/s. alpha2, formed during slow cooling or isothermal aging, dominates the EAC susceptibility of Ti-6-22-22. alpha/beta microstructures without intermetallics or alphas exhibit the highest EAC resistance (KJTH = 50 MPa√m, KJIC = 74 MPa√m). alpha 2 promotes a large reduction in the EAC threshold; KJTH = 34 MPa√m when alpha2 and alphas are present (KJIC = 69 MPa√m). For all microstructures, the fracture path is transgranular through alpha plates. Based on hydrogen environment embrittlement, the increased EAC in STA Ti-6-22-22 vs STA Ti-6-4 is due to increased strain localization occurring in the Ti-6-22-22 which results in larger slip offsets at the surface and increased hydrogen uptake. alphas precipitates in Ti-6--22--22 may exacerbate strain localization; alphas precipitates were not observed in Ti-6-4. A change in the operative dislocation mechanism to dislocation looping would have homogenized deformation and reduced EAC susceptibility; rather, severe EAC was observed in all aged Ti-6-22-22 microstructures

  8. Biologically induced initiation of snowball-Earth events, and the circulations of ice and ocean in a globally glaciated scenario

    NASA Astrophysics Data System (ADS)

    McPhaden, M. J.; Finn, C.; McEntee, C.; Krause, F.; Harden, J. W.; Rosenbloom, N. A.; Pendall, E.; Alves Jesus Rydin, C.; Krasa, D.; Shrestha, G.; Cavallaro, N.; Kuperberg, J.; Løvholt, F.; Horspool, N.; Cavanaugh, M. A.; Hankin, E. R.; Davis, J. L.; Evans, J. E.; Gurwick, N. P.; Richardson, R. M.; Landau, E. A.; Uhlenbrock, K. M.; Albert, M. R.; Rack, F. R.; Van Wyk de Vries, B.; Giardino, M.; Wiggins, H. V.; Habib, M. A.; Horan, P.; Stover, D. B.; Kuperberg, J.; Koch, D. M.; Jacob, D. J.; Isern, A. R.; Borg, S. G.; Ryabinin, V.; Hik, D.; Winther, J.; McConnell, W. J.; Baerwald, T. J.; Liu, J.; Winter, J. M.; Ruane, A. C.; Rosenzweig, C.; Jacobs, C. A.; Zanzerkia, E. E.; Cummins, P. R.; Harjadi, P.; Widiyantoro, S.; Natawidjaja, D. H.; Netting, R.; Grunsfeld, J. M.; Freilich, M. H.; Green, J. L.; Giles, B. L.; Stammer, D.; Wefer, G.; Lefebvre, A.; Lucarini, V.; Kanzow, T.; Goddard, L.; McCreary, J. P.; Sprintall, J.; Patterson, M.; Manduca, C. A.; Bralower, T. J.; Egger, A. E.; Klimchuk, J. A.; Nave, L. E.; Harden, J. W.; Horan, P.; Koch, D. M.; Laviolette, R.; Frost, G. J.; Middleton, P.; Uhle, M. E.; Gurney, R. J.; Impey, A.; Carroll, M.; Brown, M. E.; Escobar, V. M.; Murphy, F.; Callaghan, S.; Graber, J. R.; Lawford, R. G.; Koike, T.; Cripe, D.; Gundersen, L. C.; Valette-Silver, N. J.; Bohan, M.; Kaye, J. A.; Freilich, M. H.; Volz, S. M.; Friedl, L.; Komar, G.; Jacobberger-Jellison, P. A.; Luce, P.; Torn, M. S.; Baldocchi, D. D.; Agarwal, D.; Biraud, S. C.; Billesbach, D. P.; Humphrey, M.; Law, B. E.; Papale, D.; Wofsy, S. C.; Quadrelli, R.; Wilson, S.; Liverman, D. M.; Liss, P. S.; Killeen, T.; Watson, R.; Zebiak, S. E.; Tang, Q.; Hong, Y.; Chen, D.; Yang, D.; Rumburg, J.; Newmark, J. S.; Giles, B. L.; DeLuca, E.; Hagan, M. E.; Studinger, M.; Jezek, K. C.; Richter-Menge, J.; Lea, P.; Passalacqua, P.; Oskin, M. E.; Crosby, C.; Glennie, C. L.; Lechner, H. N.; Bowman, L. J.; Barton, T.; Uhle, M. E.; Anderson, G. J.; Fountain, D. M.; Hess, J. W.; Harper, H. E.; Gingerich, P. D.; Groffman, P. M.; Weathers, K. C.; Bernhardt, E. S.; SanClements, M.; Loescher, H. W.; Pitelka, L.; Sandgathe, S. A.; Eleuterio, D. P.; Cortinas, J. V.; McElroy, B. J.; Hsu, L.; Kim, W.; Martin, R. L.; Arrowsmith, R.; Hill, M. C.; Freymueller, J. T.; Marks, D. G.; Sztein, E.; Eichelberger, J. C.; Ismail-Zadeh, A.; Gordeev, E.; Myers, M.; Scholl, D. W.; Ackley, S. F.; Schofield, O.; Costa, D. P.; Marin, J. A.; Pilpipenko, V. A.; Vega, P.; Zesta, E.; Stepanova, M. V.; Uozumi, T.; Nolin, A. W.; Sturm, M.; Tziperman, E.; Abbot, D. S.; Ashkenazy, Y.; Gildor, H.; Halevy, I.; Johnston, D. T.; Knoll, A.; Losch, M. J.; Pollard, D.; Schoof, C.; Schrag, D. P.


    , Martin Losch, Hezi Gildor, Dan Schrag). References: Eli Tziperman, I. Halevy, D. T. Johnston, A. H. Knoll, and D. P. Schrag. Biologically induced initiation of Neoproterozoic Snowball-Earth events. Proc. Natl. Acad. Sci. U.S.A., 108(37):15091-15096, doi/10.1073/pnas.1016361108, 2011. Eli Tziperman, Dorian Schuyler Abbot, Yosef Ashkenazy, Hezi Gildor, David Pollard, Christian Schoof, and Daniel P. Schrag. Continental constriction and sea ice thickness in a Snowball-Earth scenario. J. Geophys. Res., 117(C05016):doi:10.1029/2011JC007730, 2012. Yosef Ashkenazy et al, in prep. 2012.

  9. Local Government Implementation of Long-Term Stewardship at Two DOE Facilities

    SciTech Connect

    John Pendergrass; Roman Czebiniak; Kelly Mott; Seth Kirshenberg; Audrey Eidelman; Zachary Lamb; Erica Pencak; Wendy Sandoz


    The Department of Energy (DOE) is responsible for cleaning up the radioactive and chemical contamination that resulted from the production of nuclear weapons. At more than one hundred sites throughout the country DOE will leave some contamination in place after the cleanup is complete. In order to protect human health and the environment from the remaining contamination DOE, U.S. Environmental Protection Agency (EPA), state environmental regulatory agencies, local governments, citizens and other entities will need to undertake long-term stewardship of such sites. Long-term stewardship includes a wide range of actions needed to protect human health in the environment for as long as the risk from the contamination remains above acceptable levels, such as barriers, caps, and other engineering controls and land use controls, signs, notices, records, and other institutional controls. In this report the Environmental Law Institute (ELI) and the Energy Communities Alliance (ECA) examine how local governments, state environmental agencies, and real property professionals implement long-term stewardship at two DOE facilities, Losa Alamos National Laboratory and Oak Ridge Reservation.

  10. Keystone Symposium on Antibodies as Drugs: March 27-April 1, 2009, Whistler, BC CA.


    Wurch, Thierry; Larbouret, Christel; Robert, Bruno


    The symposium on Antibodies as Drugs, organized by Keystone Symposia and chaired by J. Marks, (University of California Los Angeles, USA), E.S. Ward (University of Texas Southwestern Medical Center, USA) and L. Weiner (Georgetown University Medical Center, USA), was held in Whistler, British Columbia. This Canadian Rockies village, which will host the 2010 Olympic Games, served as an enchanting backdrop to the meeting. The more than 350 speakers and attendees included scientists from major pharmaceutical firms, e.g., Abbott, MedImmune/Astra Zeneca, Bristol-Myers Squibb, Merck & Co., Pfizer, Sanofi-Aventis, Schering, GlaxoSmithKline, Eli Lilly, Hoffmann LaRoche, Novartis, Wyeth, and biotechnology companies, e.g., Ablynx, Medarex, Morphosys, GenMab, Amgen, Genentech, ImmunoGen, Agensys, Domantis, Biogen Idec, Centocor, LFB, Micromet, PDL Biopharma, Borean Pharma, Dyax Corp., Symphogen and Syntonix. Academic research groups at Imperial College London, University of Oxford, ETH Zürich, Scripps, Institute Cochin, Karolinska Institute, Utrecht University, Harvard Medical School, Massachusetts Institute of Technology, Baylor College, Paul Ehrlich Institute, University of California San Francisco, University of California San Diego, University of Nantes, University of Tours and Ludwig Institute were also represented, as were regulatory authorities, including the US Food and Drug Administration, National Institutes of Health and the Public Health Agency of Canada). The meeting was very interactive and included thoughtful exchanges during the different sessions and networking events.

  11. Using measures to guide the continuous improvement journey: a partnership between quality assurance and toxicology.


    Gentry, P E; Sites, D L


    It has been said that you cannot improve what you cannot measure. At Eli Lilly and Company, measurement is one of the five pillars of Total Quality. Quality Assurance and Toxicology have partnered in the use of measures to drive improvements in both areas. Quality Assurance and Toxicology have embarked on a journey in Total Quality to achieve customer satisfaction and drive continuous improvement. Measurement in the research and development world has traditionally not been well received. Contrary to popular belief, we have found that many processes can be measured in the research and development environment. Measurement is critical to the continuous improvement of processes because improvements are made using data. In Quality Assurance and Toxicology, the initial measures were put in place to gather baseline data. As we learned from our measures, we customized them to align with all of our processes. This article describes the journey of measuring Quality Assurance and Toxicology, including highlights of implementation strategies and lessons learned along the way. PMID:7804620

  12. Measurement and modeling of viscosity of supercritical carbon dioxide/biomaterial(s) mixtures

    SciTech Connect

    Tuan, D.Q.; Zollweg, J.A.; Harriott, P.; Rizvi, S.S.H.


    The viscosities of a binary, supercritical carbon dioxide/methyl oleate (SC-CO{sub 2}/MO), and a multicomponent, SC-CO{sub 2}/anhydrous milkfat (AMF) system at 40 C and over a pressure range of 10.6--25.0 MPa were measured in a high-pressure capillary viscometer. The experimental data, and data from the literature, were utilized in viscosity modeling with Ely and Hanley`s corresponding states model for SC-CO{sub 2}/biomaterial(s) systems. The modified Benedict-Webb-Rubin equation of state and a viscosity correlation with propane as the reference material were used. An adjustable parameter was added to the energy shape factor equation. This approach worked well for both the fluid and liquid phases of the SC-CO{sub 2}/biomaterial(s) systems with an average absolute deviation of 3--6%. Compared to the purely correlative Grunberg and Nissan model, this method has better predictive capability, while maintaining comparable accuracy.

  13. The unexpected outcomes of anti-aging, rejuvenation, and life extension studies: an origin of modern therapies.


    Stambler, Ilia


    The search for life-extending interventions has been often perceived as a purely academic pursuit, or as an unorthodox medical enterprise, with little or no practical outcome. Yet, in fact, these studies, explicitly aiming to prolong human life, often constituted a formidable, though hardly ever acknowledged, motivation for biomedical research and discovery. At least several modern biomedical fields have originated directly from rejuvenation and life extension research: (1) Hormone replacement therapy was born in Charles-Edouard Brown-Séquard's rejuvenation experiments with animal gland extracts (1889). (2) Probiotic diets originated in Elie Metchnikoff's conception of radically prolonged "orthobiosis" (c. 1900). (3) The development of clinical endocrinology owed much to Eugen Steinach's "endocrine rejuvenation" operations (c. 1910s-1920s). (4) Tissue transplantations in humans (allografts and xenografts) were first widely performed in Serge Voronoff's "rejuvenation by grafting" experiments (c. 1910s-1920s). (5) Tissue engineering was pioneered during Alexis Carrel's work on cell and tissue immortalization (c. 1900-1920). (6) Cell therapy (and particularly human embryonic cell therapy) was first widely conducted by Paul Niehans for the purposes of rejuvenation as early as the 1930s. Thus, the pursuit of life extension and rejuvenation has constituted an inseparable and crucial element in the history of biomedicine. Notably, the common principle of these studies was the proactive maintenance of stable, long-term homeostasis of the entire organism.

  14. White Pine Co. Public School System Biomass Conversion Heating Project

    SciTech Connect

    Paul Johnson


    The White Pine County School District and the Nevada Division of Forestry agreed to develop a pilot project for Nevada using wood chips to heat the David E. Norman Elementary School in Ely, Nevada. Consideration of the project was triggered by a ''Fuels for Schools'' grant that was brought to the attention of the School District. The biomass project that was part of a district-wide energy retrofit, called for the installation of a biomass heating system for the school, while the current fuel oil system remained as back-up. Woody biomass from forest fuel reduction programs will be the main source of fuel. The heating system as planned and completed consists of a biomass steam boiler, storage facility, and an area for unloading and handling equipment necessary to deliver and load fuel. This was the first project of it's kind in Nevada. The purpose of the DOE funded project was to accomplish the following goals: (1) Fuel Efficiency: Purchase and install a fuel efficient biomass heating system. (2) Demonstration Project: Demonstrate the project and gather data to assist with further research and development of biomass technology; and (3) Education: Educate the White Pine community and others about biomass and other non-fossil fuels.

  15. Regional Long-Term Sea Level and Sea Surface Temperature Characteristics from Satellite Observations

    NASA Astrophysics Data System (ADS)

    Andersen, O. B.; Knudsen, P.; Beckley, B.


    For a the large portion of the world's population liv ing in coastal zones forecasts of long- term sea lev el change is importan t for a var iety of environmen tal and socio- economic r easons. Satellite altimetry offers a unique opportunity for improving our knowledge about glob al and r egional sea level change on bo th global and reg ional scale. Joint TOPEX/PO SEIDON(T/P) +JASON-1 sea level observations and Reyno lds AVH RR sea surface temperature observ ations over th e most recen t 12 years hav e qualitativ ely been used to study regional correlations between long-term changes in sea level and sea surface temper ature. Long-term is here tak en to be lin ear signals in the 12-year time per iod Consistent in creases in both sea level and sea surface temp eratures ar e found in large parts of the world's oceans over this per iod. In the Indian Ocean and particularly th e Pacif ic Ocean , the trends in both sea level and temper ature are domin ated by the larg e changes associated w ith th e El N iño Southern Oscillation (ENSO) . Co mparison with similar trend estimates u sing only 8 years of satellite data shows the incr eased decoupling with ENSO and th e imp act of inter-annual variability on sea lev el tr end estimates.

  16. Development of the REFPROP database and transport properties of refrigerants. Final report

    SciTech Connect

    McLinden, M.O.


    This task consisted of developing Version 6.0 of the NIST Thermodynamic and Transport Properties of Refrigerants and Refrigerant Mixtures Database (REFPROP), entailing a complete revision of this database. This program is based on the most accurate pure fluid and mixture models currently available. The database development is further divided into the development of a graphical user interface and the development of Fortran subroutines which implement the property models. Three models are used for the thermodynamic properties of pure components, depending on the availability of data. The first is the modified Benedict-Webb-Rubin (MBWR) equation of state. It is capable of accurately representing the properties of a fluid over wide ranges of temperature, pressure, and density. The MBWR equation is the basis for the current international standard for the properties of R123. The second high-accuracy pure-fluid equation of state is written in terms of reduced molar Helmholtz free energy. This Helmholtz energy model is the basis for the international standard formulation for R134a. The third pure-fluid model is the extended corresponding states (ECS) model of Huber and Ely (1994). It is used for fluids with limited experimental data. The database calculates seventeen thermodynamic and transport properties, including surface tensions of pure fluids and mixtures. Commercialized blends, such as R407C and R410A, are predefined in the interface and are listed in a table.

  17. In vitro assessment of Staphylococcus epidermidis and Staphylococcus aureus adhesion on TiO₂ nanotubes on Ti-6Al-4V alloy.


    Pérez-Jorge, Concepción; Conde, Ana; Arenas, Maria A; Pérez-Tanoira, Ramón; Matykina, Endhze; de Damborenea, Juan J; Gómez-Barrena, Enrique; Esteban, Jaime


    The aim of this study was to evaluate Staphylococcus sp. adhesion to modified surfaces of titanium alloy (Ti-6Al-4V). Specimens of Ti-6Al-4V alloy 6-4 ELI-grade 23 that meets the requirements of ASTM F136 2002A (AMS 2631B class A1) were anodized in a mixture of sulfuric/hydrofluoric acid at 20 V for 5 and 60 min to form nanoporous (NP) and nanotubular (NT) oxide layers with pore diameter of 20 and 100 nm, respectively. The amount of fluorine incorporated in the oxide films from the electrolyte was 6 and 4 wt %, respectively. Bacterial adherence was studied using laboratory strains and six clinical strains each of Staphylococcus aureus and Staphylococcus epidermidis. Lower adherence of laboratory strains was demonstrated on fluoride nanostructured surfaces in comparison with the fluoride-free surfaces. Significant differences between clinical strains and laboratory strains were also found (p < 0.0001, Kruskal-Wallis test) when NP and NT specimens were compared with chemically polished (CP) surfaces. The results of the tests using multiple clinical strains confirmed a decrease in bacterial adherence on F-containing titanium oxide surfaces, suggesting a potential applicability of this surface, with a confirmed added value of decreasing clinical staphylococci adherence, for medical prosthetic devices.

  18. Seizure risk in patients with attention-deficit-hyperactivity disorder treated with atomoxetine.


    Wernicke, Joachim F; Holdridge, Karen Chilcott; Jin, Ling; Edison, Timothy; Zhang, Shuyu; Bangs, Mark E; Allen, Albert J; Ball, Susan; Dunn, David


    The comorbidity of seizures, epilepsy, and attention-deficit-hyperactivity disorder (ADHD) prompted the examination of whether atomoxetine use for ADHD is associated with an increased risk of seizures. Seizures and seizure-related symptoms were reviewed from two independent Eli Lilly and Company databases: the atomoxetine clinical trials database and the atomoxetine postmarketing spontaneous adverse event database. Review of clinical trial data indicated that the crude incidence rates of seizure adverse events were between 0.1 and 0.2%, and were not significantly different between atomoxetine, placebo, and methylphenidate. Only 2% of the postmarketing spontaneous reports of seizure events were classified as having no clear contributing or confounding factors, and the reporting rate (8 per 100 000 patients exposed) was within the expected range of population-based incidence. Although children with ADHD are increasingly recognized as being at an elevated risk for seizures, treatment of ADHD symptoms with atomoxetine does not appear to elevate this risk further. The shared vulnerability between ADHD and seizure activity should be taken into account when making treatment decisions for populations of children with epilepsy and children with ADHD. PMID:17593120

  19. Targets for AD treatment: conflicting messages from γ-secretase inhibitors

    PubMed Central

    Sambamurti, Kumar; Greig, Nigel H.; Utsuki, Tadanobu; Barnwell, Eliza L.; Sharma, Ekta; Mazell, Cheryl; Bhat, Narayan R.; Kindy, Mark S.; Lahiri, Debomoy K.; Pappolla, Miguel A


    Current evidence suggests that Alzheimer’s disease (AD) is a multi-factorial disease that starts with accumulation of multiple proteins. We have previously proposed that inhibition of γ-secretase may impair membrane recycling causing neurodegeneration starting at synapses (Sambamurti et al., 2006). We also proposed familal AD (FAD) mutations increase Aβ42 by inhibiting γ-secretase. Herein, we discuss the failure of Eli Lilly’s γ-secretase inhibitor, semagacestat, in clinical trials in the light of our hypothesis, which extends the problem beyond toxicity of Aβ aggregates. We elaborate that γ-secretase inhibitors lead to accumulation of amyloid precursor protein (APP) C-terminal fragments (CTFs) that can later be processed by γ-secretase to yields bursts of Aβ to facilitate aggregation. Although we do not exclude a role for toxic Aβ aggregates, inhibition of γ-secretase can affect numerous substrates other than APP to affect multiple pathways and the combined accumulation of multiple peptides in the membrane may impair its function and turnover. Taken together, protein processing and turnover pathways play an important role in maintaining cellular homeostasis and unless we clearly see consistent disease-related increase in their levels or activity, we need to focus on preserving their function rather than inhibiting them for treatment of AD and similar diseases. PMID:21320126

  20. Aberrant phenotypes in Kikuchi’s disease

    PubMed Central

    Wei, Xue-Jing; Zhou, Xiao-Ge; Xie, Jian-Lan; Zheng, Xiao-Dan; Zheng, Yuan-Yuan


    Initial reports emphasized the immunophenotypic similarities between benign and malignant T cell populations, while some previous studies indicating that aberrant T-cell antigen loss is a good marker for detecting malignant T-cell proliferation. Recently, we found a very interesting and thought-provoking phenomenon: In benign disease-28 of 38 (73.7%) cases of Kikuchi’s disease also showed aberrant phenotypes with loss of pan-T cell antigens, which makes the differential diagnosis between Kikuchi’s disease and T cell lymphoma more challenging. In our study, 38 cases of Kikuchi’s disease and 30 cases of reactive lymphoid hyperplasia (RLH) were studied by EliVision immunohistochemical staining. As well as TCR gene rearrangement using PCR was negative in 10 tested cases of the Kikuchi’s disease. Among these cases, the most common antigen deficiency was CD5 (22 cases), then CD7 (11 cases), CD2 (8 cases) and CD3 (2 cases). Compared with proliferative and xanthomatous types of Kikuchi’s disease, antigens tended to be lost in necrotizing type. Based on follow-up data, a correlation was not found between the occurrence of aberrant phenotypes and prognosis. In RLH, obvious pan-T cell antigen loss was also not found. In conclusion, this is the first study to demonstrate distinct patterns of antigen loss in Kikuchi’s disease, suggesting that T cell antigen loss is not reliable as an auxiliary diagnostic standard for T cell lymphoma. PMID:25337197

  1. Development of On-line Instrumentation and Techniques to Detect and Measure Particulates

    SciTech Connect

    Sheng Wu; Steve Palm; Yongchun Tang; William A. Goddard III


    In this final quarter, we have continued to collect more field data. Here, in this report representative data collected in the field with turbine engine are presented. We also made substantial progress in calibration of standard particles using MOUDI. During the 12th quarter of this project, we collected a myriad of field data at our industrial partner's test site. These data verified the system performances. (1) The system could detect light scattering signal for all 9 wavelength lasers under different load conditions--We verified that the ELIS1024 chip could reliably collect light scattering signal from the 9 wavelength lasers, even the weakest wavelength at 355nm, thanks to our effort in improving the signal to noise ratio of the detector. (2) The data collected for each wavelength channel under the same load is consistent and repeatable--Although different wavelength channel has drastically different signal to noise ratio, after certain averages, we are able to repeat the scattering signal under the same engine conditions. (3) The data collected for each channel under different load conditions are qualitatively consistent with prediction--The data collected for each channel under different load conditions change according to the predictions. We are conducting simulation models to simulate the data and use the model to predict the PM emission pattern.

  2. Consequences of players' dismissal in professional soccer: a crisis-related analysis of group-size effects.


    Bar-Eli, Michael; Tenenbaum, Gershon; Geister, Sabine


    This study documents the effect of players' dismissals on team performance in professional soccer. Our aim was to determine whether the punishment meted out for unacceptable player behaviour results in reduced team performance. The official web site of the German Soccer Association was used for coding data from games played in the first Bundesliga between the 1963 - 64 and 2003 - 04 (n = 41) seasons. A sample of 743 games where at least one red card was issued was used to test hypotheses derived from crisis theory (Bar-Eli & Tenenbaum, 1989a). Players' dismissals weaken a sanctioned team in terms of the goals and final score following the punishment. The chances of a sanctioned team scoring or winning were substantially reduced following the sanction. Most cards were issued in the later stages of matches. The statistics pertaining to outcome results as a function of game standing, game location, and time phases - all strongly support the view that teams can be considered conceptually similar to individuals regarding the link between stress and performance. To further develop the concept of team and individual psychological performance crisis in competition, it is recommended that reversal theory (Apter, 1982) and self-monitoring and distraction theories (Baumeister, 1984) be included in the design of future investigations pertaining to choking under pressure.

  3. Geology and ore deposits of the Pioche district, Nevada

    USGS Publications Warehouse

    Westgate, L.G.; Knopf, Adolph


    LOCATION AND SURFACE FEATURES The Bristol Range, Highland, and Ely Range quadrangles make up the larger part of a. rectangular area 35 miles north and south by 24 miles east and west, which lies 19 miles west of the Nevada-Utah line and about 250 miles southwest of Salt Lake City. The district lies within the Great Basin, a semiarid region of alternating mountain ranges and intermontane plains floored largely by outwash from the mountains. The plain, which slopes away from the ranges, stands between 4,700 and 6,000 feet above the sea. The Bristol and Highland Ranges, which are separated only by a low gap, form an almost continuous north-south range that rises about 2,500 feet above the highest part of the surrounding plain, to general altitudes of 8,000 to 9,000 feet, though the highest point, Highland Peak, reaches 9,395 feet. A lower range, the Ely Range, with a northwesterly trend, lies farther east and nearly in touch with the Bristol-Highland Range. The town of Pioche lies midway on the. eastern foot of the Ely Range. ROOKS OF THE PIOOHB REGION The rocks of the ranges are Paleozoic sediments, Tertiary (?) lavas and intrusive rocks, and Pliocene (?) tuffs. The Paleozoic sediments have a total thickness of nearly 18,000 feet. Over 8,000 feet of the Cambrian has been measured without reaching its base. The lowest Cambrian formation is a quartzite, of which only the upper 1,500 feet is exposed, and this is followed by 1,200 feet of shale, 400 feet of limestone, aoid 150 feet of shale. Above this second shale the upper three-fourths of the Cambrian consists of limestone and dolomitic limestone. It is in the quartzite and in the limestone interbedded in and bounding the shales that the main ore bodies of the district have been found. Above the Cambrian comes 1,795 feet of Ordovician limestone, with some interbedded dolomite and with a 50-foot quartzite a, third of the way down from the top; 75 feet of Silurian dolomite; 3,000 feet of Middle Devonian dolomite with

  4. An automated training paradigm reveals long-term memory in planarians and its persistence through head regeneration.


    Shomrat, Tal; Levin, Michael


    Planarian flatworms are a popular system for research into the molecular mechanisms that enable these complex organisms to regenerate their entire body, including the brain. Classical data suggest that they may also be capable of long-term memory. Thus, the planarian system may offer the unique opportunity to study brain regeneration and memory in the same animal. To establish a system for the investigation of the dynamics of memory in a regenerating brain, we developed a computerized training and testing paradigm that avoided the many issues that confounded previous, manual attempts to train planarians. We then used this new system to train flatworms in an environmental familiarization protocol. We show that worms exhibit environmental familiarization, and that this memory persists for at least 14 days - long enough for the brain to regenerate. We further show that trained, decapitated planarians exhibit evidence of memory retrieval in a savings paradigm after regenerating a new head. Our work establishes a foundation for objective, high-throughput assays in this molecularly tractable model system that will shed light on the fundamental interface between body patterning and stored memories. We propose planarians as key emerging model species for mechanistic investigations of the encoding of specific memories in biological tissues. Moreover, this system is lik ely to have important implications for the biomedicine of stem-cell-derived treatments of degenerative brain disorders in human adults.

  5. [Epidemics of cutaneous leishmaniasis in military personnel working in French Guiana].


    Banzet, S


    Cutaneous leishmaniasis transmitted by phlebotomine sandflies is endemic in the rain forests of French Guyana. The 3rd Régiment Etranger d'Infanterie, based in Kourou carries out numerous operations in the Amazonian areas. In 1998 two outbreaks of cutaneous leishmaniasis occurred: one during an exercise at the training center in the equatorial forest of Regina (10 patients) and the other during a mission in Saint Elie (21 patients). Clinical findings were variable and diagnosis was confirmed by skin smear tests. Patients were treated by two intramuscular injections of pentmidine isethionate (Pentacarinate). Recurrence was observed in two patients who were retreated using the same agent. Persistent lesions were treated by intralesional injection of meglumine antimoniate (Glucantime). Both outbreaks were characterized by high attack rates (91 p. 100 and 84 p. 100) and were facilitated by non-observance of standard procedures because of training or operational requirements at the beginning of the leishmaniasis season. Strict planning of activities, wearing protective clothing, deployment of insecticide treated bed nets, and of candles rather than electrical lamps for lighting are key preventive measures. Greater emphasis is needed on the use of insect repellents. PMID:11258067

  6. Impact of Eccentricity on East-west Stationkeeping for GPS Class of Orbits

    NASA Technical Reports Server (NTRS)

    Ely, Todd A.


    There exists a strong relationship between eccentricity and the potential for a repeating groundtrack orbit to exhibit chaotic motion. This is true at all values of eccentricity, but, perhaps most dramatic, is that it is true even for orbits that are nearly circular. These complex motions can have a significant impact on the east-west stationkeeping process for maintaining the repeating groundtrack property of a commensurate orbit. Ely and Howell have shown that traditional stationkeeping (SK) methods are unable to maintain a repeating groundtrack in the presence of complex dynamics, such as with chaotic motion. They developed an alternate SK method that is able to maintain a repeating groundtrack for eccentric, commensurate orbits. The focus of the current study is to investigate orbits with characteristics that are similar to GPS satellites except with modestly larger eccentricities. It will be shown that at eccentricities larger than approx. .01 the chaotic regions become significant, and the need arises for a robust stationkeeping approach, such as developed in. FurtheRmore, the investigation will reveal that the influence of luni-solar perturbations contributes to the growth of eccentricity, thus increasing the probability of encountering chaotic motion during a typical satellite lifetime.

  7. Thyroid calcitonin cells in response to glucagon-induced hypocalcaemia in the Indian jackal, Canis aureus (Linnaeus--lex).


    Swarup, K; Tewari, N P


    Jackal (Canis aureus) puppies (10) were subjected to hypocalcaemia by a single intravenous injection of crystalline porcine glucagon (Eli Lilly and Co.) in a dosage of 0.2 mg/kg body weight. Fasting blood samples from each specimen were collected 30 minutes before injection. Then again after an interval of 15, 30, 60, 90, 120, 150, 180, 210, 240, 270 and 300 minutes blood samples were taken. For histological study animals were killed after 30, 90, 120, 240 and 300 minutes of the injection. The mean serum calcium level records a fall upto 90 minutes but it tends to return to normal and at 300 minutes it returns to the preinjection level. The mean serum inorganic phosphate level records a fall upto 180 minutes and therafter the value increases approaching the preinjection levles after 300 minutes. Specific stains were used for staining the calcitonin cells. Animals killed 30 minutes after the injection exhibit beginning of degranulation of secretory granules in their C cells, while those killed after 300 minutes show marked degranulation. A progressive degranulation of calcitonin cells at the various stages of experimentation displays correspondingly poorer response to the staining reaction. There is no change in the histological picture of the parathyroid. PMID:7424080

  8. [Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice].


    Lan, Jiaming; Lu, Shuai; Deng, Yao; Wen, Bo; Chen, Hong; Wang, Wen; Tan, Wenjie


    Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.

  9. A Nucleoporin Docks Protein Phosphatase 1 to Direct Meiotic Chromosome Segregation and Nuclear Assembly.


    Hattersley, Neil; Cheerambathur, Dhanya; Moyle, Mark; Stefanutti, Marine; Richardson, Amelia; Lee, Kian-Yong; Dumont, Julien; Oegema, Karen; Desai, Arshad


    During M-phase entry in metazoans with open mitosis, the concerted action of mitotic kinases disassembles nuclei and promotes assembly of kinetochores-the primary microtubule attachment sites on chromosomes. At M-phase exit, these major changes in cellular architecture must be reversed. Here, we show that the conserved kinetochore-localized nucleoporin MEL-28/ELYS docks the catalytic subunit of protein phosphatase 1 (PP1c) to direct kinetochore disassembly-dependent chromosome segregation during oocyte meiosis I and nuclear assembly during the transition from M phase to interphase. During oocyte meiosis I, MEL-28-PP1c disassembles kinetochores in a timely manner to promote elongation of the acentrosomal spindles that segregate homologous chromosomes. During nuclear assembly, MEL-28 recruits PP1c to the periphery of decondensed chromatin, where it directs formation of a functional nuclear compartment. Thus, a pool of phosphatase activity associated with a kinetochore-localized nucleoporin contributes to two key events that occur during M-phase exit in metazoans: kinetochore disassembly and nuclear reassembly. PMID:27623381

  10. Chemically defined media modifications to lower tryptophan oxidation of biopharmaceuticals.


    Hazeltine, Laurie B; Knueven, Kristine M; Zhang, Yan; Lian, Zhirui; Olson, Donald J; Ouyang, Anli


    Oxidation of biopharmaceuticals is a major product quality issue with potential impacts on activity and immunogenicity. At Eli Lilly and Company, high tryptophan oxidation was observed for two biopharmaceuticals in development produced in Chinese hamster ovary cells. A switch from historical hydrolysate-containing media to chemically defined media with a reformulated basal powder was thought to be responsible, so mitigation efforts focused on media modification. Shake flask studies identified that increasing tryptophan, copper, and manganese and decreasing cysteine concentrations were individual approaches to lower tryptophan oxidation. When amino acid and metal changes were combined, the modified formulation had a synergistic impact that led to substantially less tryptophan oxidation for both biopharmaceuticals. Similar results were achieved in shake flasks and benchtop bioreactors, demonstrating the potential to implement these modifications at manufacturing scale. The modified formulation did not negatively impact cell growth and viability, product titer, purity, charge variants, or glycan profile. A potential mechanism of action is presented for each amino acid or metal factor based on its role in oxidation chemistry. This work served not only to mitigate the tryptophan oxidation issue in two Lilly biopharmaceuticals in development, but also to increase our knowledge and appreciation for the impact of media components on product quality. PMID:26560440

  11. New scintillator materials for future and present facilities

    SciTech Connect

    Camera, Franco; Giaz, Agnese


    In the recent years LaBr3:Ce crystals started a new generation of high performing scintillator detectors. In fact, a large number of different, new and promising scintillators are now becoming commercially available, as for example CeBr{sub 3}, CLYC, SrI{sub 2}. Some others, like GYGAG:Ce, CLLB, CLLC, will be available in the near future. The CLYC crystal enriched with {sup 6}Li provides extremely high efficiency for thermal neutron identification and detection with performances comparable to {sup 3}He tubes. The CLYC enriched with {sup 7}Li can provide the direct measurement of the neutron kinetic energy from the energy pulse signal. The most recent R and D activity shows that ‘co-doping’ technique has the effect to improve the crystal proportionality and the mechanical properties thus significantly increasing the reliability and energy resolution of LaBr{sub 3};Ce and CeBr{sub 3} scintillators. Such a new generation of detectors can be the backbone for the detectors array of the future accelerator facilities as for example ELI-NP which will provide very intense high-energy γ-ray beam with very low bandwidth.

  12. On the fatigue behavior of medical Ti6Al4V roughened by grit blasting and abrasiveless waterjet peening.


    Lieblich, M; Barriuso, S; Ibáñez, J; Ruiz-de-Lara, L; Díaz, M; Ocaña, J L; Alberdi, A; González-Carrasco, J L


    Flat fatigue specimens of biomedical Ti6Al4V ELI alloy were surface-processed by high pressure waterjet peening (WJP) without abrasive particles using moderate to severe conditions that yield roughness values in the range of those obtained by commercial grit blasting (BL) with alumina particles. Fatigue behavior of WJP and BL specimens was characterized under cyclical uniaxial tension tests (R=0.1). The emphasis was put on a comparative analysis of the surface and subsurface induced effects and in their relevance on fatigue behavior. Within the experimental setup of this investigation it resulted that blasting with alumina particles was less harmful for fatigue resistance than abrasiveless WJP. BL specimens resulted in higher subsurface hardening and compressive residual stresses. Specimens treated with more severe WJP parameters presented much higher mass loss and lower compressive residual stresses. From the analysis performed in this work, it follows that, in addition to roughness, waviness emerges as another important topographic parameter to be taken into account to try to predict fatigue behavior. It is envisaged that optimization of WJP parameters with the aim of reducing waviness and mass loss should lead to an improvement of fatigue resistance.

  13. The story of insulin discovery.


    Karamitsos, Dimitrios T


    Many researchers had tried to isolate insulin from animal pancreas, but Frederick Banting, a young surgeon, and Charles Best, a medical student, were the ones that succeeded. They both worked hard in very difficult conditions in the late 1921 and early 1922 until final success. They encountered problems with the impurities of their extract that was causing inflammations, but J. Collip, their late biochemist collaborator, worked many hours and was soon able to prepare cleaner insulin, free from impurities. This extract was administered successfully to L. Thomson, a ketotic young diabetic patient, on 23 January 1922. Following this, Eli Lilly & Co of USA started the commercial production of insulin, soon followed by the Danish factories Nordisc and NOVO as well as the British Wellcome. Nicolae Paulescu who was professor of Physiology in Bucharest, was also quite close to the discovery of insulin but the researchers in Toronto were faster and more efficient. Banting and Macleod won the Nobel price, which Banting shared with Best and Macleod with J. Collip. The contribution of Paulescu in insulin discovery was recognized after his death. PMID:21864746

  14. Devonian-Mississippian carbonate sequence in the Maiyumerak Mountains, western Brooks Range, Alaska

    SciTech Connect

    Dumoulin, J.A. ); Harris, A.G. )


    Essentially continuous, dominantly carbonate sedimentation occurred from at least the Early Devonian through the Mississippian in the area that is now the Maiyumerak Mountains, western Brooks Range. This succession is in striking contrast to Paleozoic sequences in the eastern Brooks Range and in the subsurface across northern Alaska, where uppermost Devonian-Mississippian clastic and Carboniferous carbonates unconformably overlie Proterozoic or lower Paleozoic metasedimentary or sedimentary rocks. Conodonts obtained throughout the Maiyumerak Mountains sequence indicate that any hiatus is less than a stage in duration, and there is no apparent physical evidence of unconformity within the succession. The sequence is best exposed northwest of the Eli River, where Emsian-Eifelian dolostones (Baird Group) are conformably overlain by Kinderhookian-Osagian sandy limestones (Utukok Formation) and Osagian-Chesterian fossiliferous limestones (Kogruk Formation) of the Lisburne Group. Conodont species assemblages and sedimentary structures indicate deposition in a range of shallow-water shelf environments. The sequence extends at least 30 km, from the Noatak Quadrangle northeast into the Baird Mountains Quadrangle; its easternmost extent has not been definitively determined. The Ellesmerian orogeny, thought to have produced the extensive middle Paleozoic unconformity seen through much of northern Alaska apparently had little effect on this western Brooks Range sedimentary succession.

  15. Stratigraphy and petroleum potential of the Mississippian Chainman Shale and Diamond Peak Formation, east-central Nevada

    SciTech Connect

    Jacaruso, T.J. )


    An eastward-thinning and shallowing-upward Middle and Late Mississippian group of sedimentary rocks accumulated east of the Antler orogenic highland. The Chainman Shale consists of fine-grained siliciclastic and carbonate rocks deposited in deep-water and slope environments; it ranges from 400 ft thick in the east to 2,400 ft thick in the west, where it interfingers with the Diamond Peak Formation. Fine- to coarse-grained siliciclastic and carbonate rocks up to 5,100 ft thick comprise the Diamond Peak Formation and were deposited in submarine fan, fluvial, shoreline, and deltaic settings. Antler basin, up to 600 ft of medium-grained siliciclastic strata, the Scotty Wash Quartzite, represent deposition in shelf and deltaic environments. The Chainman, Diamond Peak, Scotty Wash, and Pennsylvanian Ely Limestone comprise two unconformity-bounded stratigraphic sequences. Sequence 1 strata were deposited in an asymmetric basin formed by subsidence due to thrust loading, which controlled sedimentation. Sequence 2 strata were deposited in a symmetric, shallow to emergent setting where variation in subsidence and sediment supply controlled sedimentation. Mississippian sandstone reservoir quality is a function of depositional environment, with maximum porosity occurring in Diamond Peak shoreline strata (sequence 2) in the central Antler basin. Organic carbon and maturation data suggest the Chainman Shale is presently generating hydrocarbons capable of sourcing structural-, stratigraphic-, and unconformity-controlled traps in east-central Nevada.

  16. Sequential Extraction Results and Mineralogy of Mine Waste and Stream Sediments Associated With Metal Mines in Vermont, Maine, and New Zealand

    USGS Publications Warehouse

    Piatak, N.M.; Seal, R.R.; Sanzolone, R.F.; Lamothe, P.J.; Brown, Z.A.; Adams, M.


    We report results from sequential extraction experiments and the quantitative mineralogy for samples of stream sediments and mine wastes collected from metal mines. Samples were from the Elizabeth, Ely Copper, and Pike Hill Copper mines in Vermont, the Callahan Mine in Maine, and the Martha Mine in New Zealand. The extraction technique targeted the following operationally defined fractions and solid-phase forms: (1) soluble, adsorbed, and exchangeable fractions; (2) carbonates; (3) organic material; (4) amorphous iron- and aluminum-hydroxides and crystalline manganese-oxides; (5) crystalline iron-oxides; (6) sulfides and selenides; and (7) residual material. For most elements, the sum of an element from all extractions steps correlated well with the original unleached concentration. Also, the quantitative mineralogy of the original material compared to that of the residues from two extraction steps gave insight into the effectiveness of reagents at dissolving targeted phases. The data are presented here with minimal interpretation or discussion and further analyses and interpretation will be presented elsewhere.

  17. Critique of medicinal conspicuousness of Parsley(Petroselinum crispum): a culinary herb of Mediterranean region.


    Mahmood, Sidra; Hussain, Shahzad; Malik, Farnaz


    WHO estimates, around 80% of the especially developing world is indigent on complementary and alternative medicines which are prodigiously derived from herbal material. Parsley (Petroselinum crispum) is an important culinary herb originated from the Mediterranean region. It possesses small and dark seeds with volatile oil content. Petroselinum crispum is now planted throughout the world due to its usage in food industry, perfume manufacturing, soaps, and creams. Its main constituents subsume coumarins, furanocoumarins (bergapten, imperatori), ascorbic acid, carotenoids, flavonoids, apiole, various terpenoic compounds, phenyl propanoids, phathalides, and tocopherol. Due to these constituents, it has been annunciated to possess a number of possible medicinal emblematics including, antimicrobial, antianemic, menorrhagic, anticoagulant, antihyperlipidemic, antihepatotoxic, antihypertensive, diuretic effects, hypoglycaemic, hypouricemic, anti oxidative and estrogenic activities. In Morocco, Parsley is mostly used as an elixir to treat arterial hypertension, diabetes, cardiac and renal diseases. Antioxidant and antibacterial activities of parsley, made it propitious in food systems. Its ELI17 gene has been corroborated as a particularly fast-responding gene. There is a requisite for extensive research to avail the maximal benefits of this significant medicinal plant. The aim of this review paper is to divulge the chemical constituents of parsley that are explicitly related to substantial medicinal facets.

  18. Hybridizing bacteria, crossing methods, cross-checking arguments: the transition from episomes to plasmids (1961-1969).


    Grote, Mathias


    Plasmids are non-chromosomal hereditary determinants, mostly found in prokaryotes. Whereas Joshua Lederberg coined the term "plasmid" as early as 1952, today's concept was not established until the early 1970s. In this eclipse period, the plasmid's place was taken by the episome, following the 1958 publication of Elie Wollman and François Jacob. This paper analyzes the transition from the episome to a renewed plasmid concept both on the experimental and the conceptual level. It will become clear that intergeneric transfer experiments were central to this development. These studies rely on conjugational transfer of extrachromosomal hereditary determinants between different bacterial genera. First, experimental systems employing intergeneric transfer shaped the new plasmid by enabling its representation as a species of circular DNA. Moreover, they had a destabilizing effect on the episome, leading to a crisis in the concepts of microbial genetics towards the end of the 1960s. The new plasmid then became one of the cornerstones of recombinant DNA technologies. In an historic perspective, intergeneric transfer experiments indicate a gradual transition of molecular biology from its early "analytic" to the "synthetic" phase of genetic engineering. Hence, the construction of genetic hybrids in vivo as epitomized in the studies shown here marks an intermediate state that one could designate as "recombinant DNA avant la lettre".

  19. Parametric interference effect in nonresonant spontaneous bremsstrahlung of an electron in the field of a nucleus and two pulsed laser waves

    NASA Astrophysics Data System (ADS)

    Lebed', A. A.; Padusenko, E. A.; Roshchupkin, S. P.; Dubov, V. V.


    Nonresonant spontaneous bremsstrahlung of an electron scattered by a nucleus in the field of two moderately strong pulsed waves is studied theoretically. The process is studied in detail within the interference kinematic region. This region is determined by scattering of particles in the same plane at predetermined angles, at which stimulated absorption and emission of photons of external pulsed waves by an electron occur in a correlated manner. It is shown that the probability of the partial process with correlated emission (absorption) by an electron of the equal number of photons of the both waves is of an order of the magnitude greater than the corresponding probability in any other scattering kinematics. The cross section of spontaneous bremsstrahlung in two pulsed waves may be two times greater than the cross section of a free-field process after summation over all stimulated processes of correlated emission and absorption. Obtained results may be experimentally verified, for example, by scientific facilities at sources of pulsed laser radiation (SLAC, FAIR, ELI, XCELS).

  20. Geochemical Characterization of Mine Waste, Mine Drainage, and Stream Sediments at the Pike Hill Copper Mine Superfund Site, Orange County, Vermont

    USGS Publications Warehouse

    Piatak, Nadine M.; Seal, Robert R., II; Hammarstrom, Jane M.; Kiah, Richard G.; Deacon, Jeffrey R.; Adams, Monique; Anthony, Michael W.; Briggs, Paul H.; Jackson, John C.


    The Pike Hill Copper Mine Superfund Site in the Vermont copper belt consists of the abandoned Smith, Eureka, and Union mines, all of which exploited Besshi-type massive sulfide deposits. The site was listed on the U.S. Environmental Protection Agency (USEPA) National Priorities List in 2004 due to aquatic ecosystem impacts. This study was intended to be a precursor to a formal remedial investigation by the USEPA, and it focused on the characterization of mine waste, mine drainage, and stream sediments. A related study investigated the effects of the mine drainage on downstream surface waters. The potential for mine waste and drainage to have an adverse impact on aquatic ecosystems, on drinking- water supplies, and to human health was assessed on the basis of mineralogy, chemical concentrations, acid generation, and potential for metals to be leached from mine waste and soils. The results were compared to those from analyses of other Vermont copper belt Superfund sites, the Elizabeth Mine and Ely Copper Mine, to evaluate if the waste material at the Pike Hill Copper Mine was sufficiently similar to that of the other mine sites that USEPA can streamline the evaluation of remediation technologies. Mine-waste samples consisted of oxidized and unoxidized sulfidic ore and waste rock, and flotation-mill tailings. These samples contained as much as 16 weight percent sulfides that included chalcopyrite, pyrite, pyrrhotite, and sphalerite. During oxidation, sulfides weather and may release potentially toxic trace elements and may produce acid. In addition, soluble efflorescent sulfate salts were identified at the mines; during rain events, the dissolution of these salts contributes acid and metals to receiving waters. Mine waste contained concentrations of cadmium, copper, and iron that exceeded USEPA Preliminary Remediation Goals. The concentrations of selenium in mine waste were higher than the average composition of eastern United States soils. Most mine waste was

  1. Toxic effects of the Fe2O3 nanoparticles on the liver and lung tissue.


    Sadeghi, L; Yousefi Babadi, V; Espanani, H R


    Iron oxide nanoparticles are magnetic nanoparticles which have widespread application in MRI and heat therapy of cancer as contrast elements. They are also used effectively for drug and gene delivery because of effective penetrating to the cells and tissues. However, these features cause Fe2O3 nanoparticles have toxic effects that are not completely understood yet. In this study, effects of iron oxide nanoparticles on lung tissue in adult male Wistar rats were studied. We used pulmonary inhalation method for nanoparticle administration and used ether as a helper. Our results showed administered nanoparticles penetrated to the circulation and rapidly reached to liver and created serious inflammation in lung and liver tissues. This study used two different nanoparticle doses (20 and 40 mg/kg) and two exposing numbers (7 and 14 times). Results showed significant enhancement of free radicals and reduction of the GSH in lung tissue. Histological studies showed nanoparticle treatment of rats caused pulmonary emphysema, interstitial hyperemia and inflammation in lungs. By increasing the administrated dose lung tissue showed all of the mentioned symptoms with increased intensity. Nanoparticle exposition causes presence of neutrophils, lymphocytes and eosinophils in the lung tissue that confirmed there is a serious pathologic condition. Hepatic cells injuries cause penetration of the hepatic enzymes in to the blood serum (Tab. 2, Fig. 4, Ref. 32). Text in PDF

  2. Deformation Behavior and Microstructure of Ti6Al4V Manufactured by SLM

    NASA Astrophysics Data System (ADS)

    Krakhmalev, P.; Fredriksson, G.; Yadroitsava, I.; Kazantseva, N.; Plessis, A. du; Yadroitsev, I.

    Mechanical properties, porosity, and microstructure of Ti6Al4V (ELI) material produced by Selective Laser Melting (SLM) under controlled oxygen content were analyzed. Fully martensitic α'structure with high dislocation density and stacking faults was observed in both as-built and stress relieved samples by means of XRD and TEM. Tensile {101 ̅2} twinning was identified by TEM and electron diffraction. Accommodation of thermal stresses during manufacturing was suggested as a possible reason for twinning. Computed tomography of pores was carried out. Pores in the specimens were evenly distributed and mostly had an elongated shape. Defect analysis by micro CT scans in pre-strained samples confirmed that the pore coalescence was the main crack formation mechanism in the final fracture with typical cup-and-cone fracture morphology. Additionally, typical dimples and quasi-cleavage were revealed. Mechanical properties of the samples after stress relieving heat treatment at 650°C for 3 h are complied with the international standard for Ti alloys for biomedical applications.

  3. Ketamine: stimulating antidepressant treatment?

    PubMed Central

    Byrow, Yulisha; Cassidy, Frederick; Cipriani, Andrea; Demyttenaere, Koen; Frye, Mark A.; Gitlin, Michael; Kennedy, Sidney H.; Ketter, Terence A.; Lam, Raymond W.; McShane, Rupert; Mitchell, Alex J.; Ostacher, Michael J.; Rizvi, Sakina J.; Thase, Michael E.; Tohen, Mauricio


    Summary The appeal of ketamine – in promptly ameliorating depressive symptoms even in those with non-response – has led to a dramatic increase in its off-label use. Initial promising results await robust corroboration and key questions remain, particularly concerning its long-term administration. It is, therefore, timely to review the opinions of mood disorder experts worldwide pertaining to ketamine’s potential as an option for treating depression and provide a synthesis of perspectives – derived from evidence and clinical experience – and to consider strategies for future investigations. Declaration of interests G.S.M. Grant/research support: National Health Medical Research Council, NSW Health, Ramsay Health, American Foundation for Suicide Prevention, AstraZeneca, Eli Lilly & Co, Organon, Pfizer, Servier, and Wyeth; has been a speaker for Abbott, AstraZeneca, Eli Lilly & Co, Janssen Cilag, Lundbeck, Pfizer, Ranbaxy, Servier, and Wyeth; consultant: AstraZeneca, Eli Lilly & Co, Janssen Cilag, Lundbeck, and Servier. M.A.F. Grant support: AssureRx, Janssen Research & Development, Mayo Foundation, Myriad, National Institute of Alcohol Abuse and Alcoholism (NIAAA), National Institute of Mental Health (NIMH), Pfizer. Consultant (Mayo): Janssen Research & Development, LLC, Mitsubishi Tanabe Pharma Corporation, Myriad Genetics, Neuralstem Inc., Sunovion, Supernus Pharmaceuticals, Teva Pharmaceuticals. CME/travel support: American Physician Institute, CME Outfitters. Financial interest/Mayo Clinic 2016: AssureRx. S.H.K. Grant/research support: Brain Canada, Bristol Meyer Squibb, CIHR, Janssen, Johnson & Johnson, Lundbeck, Ontario Brain Institute, Pfizer, Servier, St. Jude Medical, Sunovion. T.A.K. Grant/research support (through Stanford University): Sunovion Pharmaceuticals and Merck & Co., Inc.; consultant/advisory board bember: Allergan, Inc., Janssen Pharmaceuticals, Myriad Genetic Laboratories, Inc., and Sunovion Pharmaceuticals; lecture honoraria (not

  4. Operation of a fast diamond γ-ray detector at the HIγS facility

    NASA Astrophysics Data System (ADS)

    Williams, T.; N'Diaye, C.; Breton, D.; Cassou, K.; Dupraz, K.; Favier, P.; Jehanno, D.; Kubytskyi, V.; Liu, X.; Maalmi, J.; Martens, A.; Peinaud, Y.; Stocchi, A.; Zomer, F.; Griesmayer, E.; Kavrigin, P.; Ahmed, M. W.; Sikora, M.; Weller, H. R.


    Operations of a diamond sensor placed in a high average-intensity beam of photons with energies of a few MeV are reported. Data was taken at the HIγS facility of TUNL in parasitic mode while nuclear-physics experiments were taking place. The energies of the photons during data taking were 2, 3 and 7 MeV with circular and linear polarisations of the photon beam. The collected charge appears to be constant at these energies, which is consistent with simulations. A dedicated run with bunches of photons separated by 16 ns shows that they are unambiguously distinguished. This is possible thanks to a FWHM of the pulses measured to be about 6 ns. The results indicate that the tested apparatus fulfils the requirements for a fast monitoring detector for the ELI-NP source currently under construction, which motivates this work, and demonstrates for the first time the capabilities of such detectors in high average-intensity photon beams.

  5. Chemically defined media modifications to lower tryptophan oxidation of biopharmaceuticals.


    Hazeltine, Laurie B; Knueven, Kristine M; Zhang, Yan; Lian, Zhirui; Olson, Donald J; Ouyang, Anli


    Oxidation of biopharmaceuticals is a major product quality issue with potential impacts on activity and immunogenicity. At Eli Lilly and Company, high tryptophan oxidation was observed for two biopharmaceuticals in development produced in Chinese hamster ovary cells. A switch from historical hydrolysate-containing media to chemically defined media with a reformulated basal powder was thought to be responsible, so mitigation efforts focused on media modification. Shake flask studies identified that increasing tryptophan, copper, and manganese and decreasing cysteine concentrations were individual approaches to lower tryptophan oxidation. When amino acid and metal changes were combined, the modified formulation had a synergistic impact that led to substantially less tryptophan oxidation for both biopharmaceuticals. Similar results were achieved in shake flasks and benchtop bioreactors, demonstrating the potential to implement these modifications at manufacturing scale. The modified formulation did not negatively impact cell growth and viability, product titer, purity, charge variants, or glycan profile. A potential mechanism of action is presented for each amino acid or metal factor based on its role in oxidation chemistry. This work served not only to mitigate the tryptophan oxidation issue in two Lilly biopharmaceuticals in development, but also to increase our knowledge and appreciation for the impact of media components on product quality.

  6. SINC, a type III secreted protein of Chlamydia psittaci, targets the inner nuclear membrane of infected cells and uninfected neighbors

    PubMed Central

    Mojica, Sergio A.; Hovis, Kelley M.; Frieman, Matthew B.; Tran, Bao; Hsia, Ru-ching; Ravel, Jacques; Jenkins-Houk, Clifton; Wilson, Katherine L.; Bavoil, Patrik M.


    SINC, a new type III secreted protein of the avian and human pathogen Chlamydia psittaci, uniquely targets the nuclear envelope of C. psittaci–infected cells and uninfected neighboring cells. Digitonin-permeabilization studies of SINC-GFP–transfected HeLa cells indicate that SINC targets the inner nuclear membrane. SINC localization at the nuclear envelope was blocked by importazole, confirming SINC import into the nucleus. Candidate partners were identified by proximity to biotin ligase-fused SINC in HEK293 cells and mass spectrometry (BioID). This strategy identified 22 candidates with high confidence, including the nucleoporin ELYS, lamin B1, and four proteins (emerin, MAN1, LAP1, and LBR) of the inner nuclear membrane, suggesting that SINC interacts with host proteins that control nuclear structure, signaling, chromatin organization, and gene silencing. GFP-SINC association with the native LEM-domain protein emerin, a conserved component of nuclear “lamina” structure, or with a complex containing emerin was confirmed by GFP pull down. Our findings identify SINC as a novel bacterial protein that targets the nuclear envelope with the capability of globally altering nuclear envelope functions in the infected host cell and neighboring uninfected cells. These properties may contribute to the aggressive virulence of C. psittaci. PMID:25788290

  7. Paleogeography and evolution of the Ordovician/Silurian (Whiterockian-Llandoverian) continental margin in central Nevada

    SciTech Connect

    Britt, L.W. )


    In central Nevada, stratigraphic successions of Whiterockian-Llandoverian lithofacies, transitional with autochthonous platform/shelf carbonates to the east, occur in isolated windows in outer slope to basinal lithotopes of the Roberts Mountains allochthon. Petrologic, chronostratigraphic and lithostratigraphic, and paleontologic comparison of those successions with platform/shelf facies to the east is integral for reconstruction of Ordovician-Silurian platform margin paleogeography and pre-Antler genesis of the western North American continental margin. Numerous facies changes and/or stratigraphic omissions in central Nevada can be related to sea level fluctuation and aggradation/progradation of the carbonate platform to the east, and not to a postulated, offshore geanticline (i.e., the Toiyabe Ridge). Stratigraphic omission of the Eureka Quartzite above Pogonip equivalents in transitional successions of the Toquima Range and the presence of correlative quartzite in outer slope/basinal parautochthonous facies of the Toiyabe Range suggest development of a possible bypass-margin during the Middle Ordovician. Deposition of Late Ordovician platform margin dolostones (Ely Springs Dolostone) and upper ramp limestones (Hanson Creek Formation and Martin Ridge strata) followed Late Ordovician transgression that drowned the margin and reestablished the carbonate factory. Glacioeustatic drawdown of Late Ordovician-earliest Silurian seas due to the Gondwanan glacial fluctuation can be recognized in strata along the platform margin and upper ramp. Rapid, Early Silurian transgression produced dark-gray carbonates and may have induced marginal flexure and regional, massive slope failure in central Nevada, generating stratigraphic hiatuses west of the platform margin.

  8. Fatigue performance and cyto-toxicity of low rigidity titanium alloy, Ti-29Nb-13Ta-4.6Zr.


    Niinomi, Mitsuo


    A beta type titanium alloy, Ti-29Nb-13Ta-4.6Zr, was newly designed and developed for biomedical applications. The new alloy contains non-toxic elements such as Nb, Ta, and Zr. In the present study, phases that appeared in the new alloy through various aging treatments were characterized by hardness tests and microstructural observations in order to identify the phase transformation. Fatigue properties of the new alloy were investigated. Young's modulus and cyto-toxicity of the new alloy were also evaluated. Precipitated phases distribute homogeneously over the whole specimen, and they are alpha phase, a small amount of omega phase, and beta phase when the new alloys are subjected to aging treatment at 673K for 259.2ks after solution treatment at 1063K for 3.6ks. The fatigue strength of the new alloy subjected to aging at 673K for 259.2ks after solution treatment at 1063K for 3.6ks is much better than when subjected to other aging treatments. In this case, the fatigue limit is around 700MPa. Young's modulus of the new alloy is much smaller than that of Ti-6Al-4V ELI. The cyto-toxicity of the new alloy is equivalent to that of pure Ti. Therefore, it is proposed that the new alloy, Ti-29Nb-13Ta-4.6Zr, will be of considerable use in biomedical applications.

  9. An automated Dengue virus microneutralization plaque assay performed in human Fc{gamma} receptor-expressing CV-1 cells.


    Rodrigo, W W Shanaka I; Alcena, Danielle C; Rose, Robert C; Jin, Xia; Schlesinger, Jacob J


    We describe microneutralization assays that used automated 96-well enzyme-linked immunospot (ELI-SPOT) readout instrumentation to measure human anti-dengue virus (DENV) antibodies in CV-1 cells that were stably transfected to express human FcgammaRIIA (CD32) using conventional Vero cells as a comparator. Classic plaque reduction neutralization test (PRNT) end-point titers were determined by probit analysis. Neutralization titers against DENV measured in CV-1 transfectants were expressed in terms of both conventional 50% to 90% PRNT end-point titers and differential infectivity of antibody-treated virus in control and CD32-expressing CV-1 cells. Significantly reduced PRNT titers and strikingly heightened infectivity (up to 100-fold) of antibody-treated DENV was observed in CV-1 CD32 transfectants compared with that observed in control CV-1 or Vero cells. Because DENVs may preferentially replicate in CD32-expressing monocytes/macrophages and dendritic cells, in vivo, it is possible that CD32 introduced into a conventional DENV neutralization assay might provide results that better correlate with protection.

  10. Environmental tracer analysis of winter profile development in two basins of Shagawa Lake, Minnesota

    NASA Astrophysics Data System (ADS)

    Stauffer, Robert E.


    Winter profile development was studied comparatively in two basins ( zmax = 14 m) separated by a 6 m sill in Shagawa Lake, Minnesota. Based on physical arguments and profile measurements, heat and solutes released from shelf sediments in the western basin cause convective instability at 8-11 m. After a mid-winter interval of instability, radon profiles indicate very low rates of vertical mixing in the benthic boundary layers following their stabilization by ferrous iron. Because of hydrographic features, two types of plunging inflows sometimes enter the western basin in late winter; one anthropogenic inflow alters the lower profiles by adding sodium, radon, and oxygen; the second modifies the mid-depth region by adding 'weathering tracers' (especially calcium and silicon) derived from the Ely greenstone. The oxidation of Fe 2+ diffusing upward and laterally from the sediment-water interface is accompanied by near-complete coprecipitation of phosphorus. The oxidation of Fe 2+ has only a minor effect on silicic acid, probably because of unfavorably large Si:P and preferential association of Fe(III) with phosphorus. Despite low pH and temperature, detectable amounts of Mn 2+ oxidize and precipitate above iron in the water column. Solute profiles differentially register the complex effects of hydrodynamic vs. geochemical processes, and as a consequence, affect the estimation of solute budgets in ice-covered lakes.

  11. The way to her heart? Response to romantic cues is dependent on hunger state and dieting history: An fMRI pilot study.


    Ely, Alice V; Childress, Anna Rose; Jagannathan, Kanchana; Lowe, Michael R


    Normal weight historical dieters (HDs) are prone to future weight gain, and show higher levels of brain activation in reward-related regions after having eaten than nondieters (NDs) in response to food stimuli (Ely, Childress, Jagannathan, & Lowe, 2014), a similar pattern to that seen in obesity. We hypothesized that HDs are differentially sensitive after eating to rewards in general, and thus extended prior findings by comparing the same groups' brain activation when viewing romantic pictures compared to neutral stimuli while being scanned in a blood oxygenation level-dependent (BOLD) fMRI paradigm in a fasted and fed state. Results show that 1) in fed relative to fasted conditions, both HDs and NDs were more responsive in areas related to reward and 2) in HDs, greater fed versus fasted activation extended to areas linked to perception and goal-directed behavior. HDs relative to NDs were more responsive to romantic cues in the superior frontal gyrus when fasted and the middle temporal gyrus when fed. This pattern of response is similar to HDs' activation when viewing highly palatable food cues, and is consistent with research showing overlapping brain-based responses to sex, drugs and food.

  12. Jewish immigrant encounters with Canada's Native Peoples: Yiddish writings on Tekahionwake.


    Margolis, Rebecca


    During the mass Jewish immigration of Eastern-European Jews to Canada in the first decades of the twentieth century, Yiddish publications offered a primary forum for a group of local writers to negotiate with their new identities as Canadian Jews. Within this wider process, Montreal writers H.M. Caiserman and B.G. Sack authored studies of Canadian literature in the early 1920s centred on Mohawk-English writer E. Pauline Johnson (Tekahionwake). What these essays show is that, despite the long-standing association of Canada's Jewish population with the country's dominant English culture, their status as "other" impelled leading members of the local Yiddish cultural milieu to seek out literary models among other historically marginalized groups. For Caiserman and Sack, Johnson's Native heritage offered a model for resistance to assimilation into Canada's dominant culture. In contrast, the advent of literature responding to the Nazi Holocaust by A.M. Klein and Eli Mandel, Native peoples became a symbol of loss and vanished landscapes.

  13. [Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice].


    Lan, Jiaming; Lu, Shuai; Deng, Yao; Wen, Bo; Chen, Hong; Wang, Wen; Tan, Wenjie


    Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine. PMID:27295887

  14. Nuclear photofission studies with monochromatic {gamma} ray beams

    SciTech Connect

    Csige, L.; Gulyas, J.; Habs, D.; Krasznahorkay, A.; Thirolf, P. G.; Tornyi, T. G.


    Two new research facilities will be ready for operation very soon (MEGa-Ray at Liver-more National Laboratory) or start construction (ELI-Nuclear Physics in Bucharest), both providing highly brilliant {gamma} beams with so far unprecedented properties via Compton backscattering of laser photons from a high-quality, relativistic electron beam. With these intense, monochromatic {gamma} beams, a new era of photonuclear physics will be enabled. A new research campaign is proposed to exploit the unprecedented properties of these highly-brilliant, novel {gamma} beams on highly-selective studies of extremely deformed nuclei in the multiple-humped potential energy landscape of the actinides via photofission. With the unique {gamma} beam bandwidth of {Delta}E/E = 10{sup -3}, we can aim at resolving individual resonances which could never be achieved so far due to the limited {gamma} bandwidth of bremsstrahlung beams. Exploratory, non-bremsstrahlung photofission experiments are going to be performed very soon at the HI{gamma}S facility (Duke University, USA) to investigate the fine structure of the sub-barrier transmission resonances of the actinides.

  15. Influence of surface modification on corrosion and biocompatibility of titanium alloys

    NASA Astrophysics Data System (ADS)

    Rahman, Zia Ur

    Titanium alloys are playing a vital role in the field of biomaterials due to their excellent corrosion resistance and biocompatibility. These alloys enhance the quality and longevity of human life by replacing or treating various parts of the body. However, as these materials are in constant contact with the aggressive body fluids, corrosion leads to metal ions dissolution. These ions leach to the adjacent tissues and causes adverse reactions. Surface modifications are used to improve corrosion resistance and biological activity without changing their bulk properties. In this investigation, electropolishing, magnetoelectropolishing, titanium coating and hydroxiapatitecoating were carried out on commercially pure titanium (CPTi), Ti6Al4V and Ti6Al4V-ELI (Extra Low Interstitials). These surface modifications are known to effect surface charge, chemistry, morphology; wettability, corrosion resistance and biocompatibility of these materials. In vitro cyclic potentiodynamic polarization tests were conducted in phosphate buffer saline in compliance with ASTM standard. The surface morphology, roughness and wettability of these alloys were studied using scanning electron microscope, atomic force microscope and contact angle meter, respectively. Moreover, biocompatibility of titanium alloys was assessed by growing MC3T3 pre-osteoblast cells on their surfaces

  16. Influence of Electropolishing and Magnetoelectropolishing on Corrosion and Biocompatibility of Titanium Implants

    NASA Astrophysics Data System (ADS)

    Rahman, Zia ur; Pompa, Luis; Haider, Waseem


    Titanium alloys are playing a vital role in the field of biomaterials due to their excellent corrosion resistance and biocompatibility. These alloys enhance the quality and longevity of human life by replacing or treating various parts of the body. However, as these materials are in constant contact with the aggressive body fluids, corrosion of these alloys leads to metal ions release. These ions leach to the adjacent tissues and result in adverse biological reactions and mechanical failure of implant. Surface modifications are used to improve corrosion resistance and biological activity without changing their bulk properties. In this investigation, electropolishing and magnetoelectropolishing were carried out on commercially pure titanium, Ti6Al4V, and Ti6Al4V-ELI. These surface modifications are known to effect surface charge, chemistry, morphology; wettability, corrosion resistance, and biocompatibility of these materials. In vitro cyclic potentiodynamic polarization tests were conducted in phosphate buffer saline in compliance with ASTM standard F-2129-12. The surface morphology, roughness, and wettability of these alloys were studied using scanning electron microscope, atomic force microscope, and contact angle meter, respectively. Moreover, biocompatibility of titanium alloys was assessed by growing MC3T3 pre-osteoblast cells on them.

  17. Beyond computer validation - a new role for quality assurance in systems development.


    Thompson, C A; Kramer, L A; Usher, R W


    The Quality Assurance Unit (QAU) at Eli Lilly and Company is involved in the development of a new clinical pathology computer system in conjunction with the information systems area and the user area. This is the first time that the QAU had the opportunity to build our requirements into a new computer system. This is a new role for QA and includes both auditing and validation personnel who offer QA insights into issues. Benefits of QA involvement in the developmental process include saving time by building quality checks into the system, thus eliminating the need for manual review later in the process. Early resolution of issues leads to significant financial savings. Other benefits include improved communication among the three functional areas and a better understanding of the requirements and work processes. The team approach to the development of a new computer system results in a high-quality final product which meets all user and regulatory requirements, while also providing additional benefits to our organization.

  18. Energy gain and spectral tailoring of ion beams using ultra-high intensity laser beams

    NASA Astrophysics Data System (ADS)

    Prasad, Rajendra; Swantusch, Marco; Cerchez, Mirela; Spickermann, Sven; Auorand, Bastian; Wowra, Thomas; Boeker, Juergen; Willi, Oswald


    The field of laser driven ion acceleration over the past decade has produced a huge amount of research. Nowadays, several multi-beam facilities with high rep rate system, e.g. ELI, are being developed across the world for different kinds of experiments. The study of interaction dynamics of multiple beams possessing ultra-high intensity and ultra-short pulse duration is of vital importance. Here, we present the first experimental results on ion acceleration using two ultra-high intensity beams. Thanks to the unique capability of Arcturus laser at HHU Düsseldorf, two almost identical, independent beams in laser parameters such as intensity (>1020 W/cm2), pulse duration (30 fs) and contrast (>1010), could be accessed. Both beams are focused onto a 5 μm thin Ti target. While ensuring spatial overlap of the two beams, at relative temporal delay of ~ 50 ps (optimum delay), the proton and carbon ion energies were enhanced by factor of 1.5. Moreover, strong modulation in C4+ions near the high energy cut-off is observed later than the optimum delay for the proton enhancement. This offers controlled tailoring of the spectral content of heavy ions.

  19. Contrasting siliceous replacement mineralization, east-central Nevada

    SciTech Connect

    Barton, M.D.; Ilchik, R.P. . Dept. of Geosciences); Seedorff, C.E. )


    Fine-grained siliceous replacement of carbonate-bearing rocks (jasperoid) occurs in most mineral districts in east-central Nevada. In most of these occurrences, jasperoid contains Au and(or) Ag and little or no base metals, although concentrations and ratios vary significantly. Broadly, two end-members are distinguished: (1) silicification as an intermediate- to late-stage part of complex alteration associated with igneous centers, and (2) jasperoids lacking other associated alteration and having few or no associated igneous rocks. Within this region, siliceous replacements are found with all metallic ([+-] magmatic) suites. No single factor in these occurrences relates the distribution, metal contents, fluid geochemistry, igneous rocks and associated alteration. Summarizing these characteristics: geochemical and fluid inclusion evidence shows that fluids in igneous-related jasperoids can be high-salinity magmatic (Ely), low-salinity magmatic (McCullough Butte), or metoric (Ward). Fluids in igneous-poor systems are low-salinity, exchanged meteoric waters from which a minor magmatic component can not be excluded. At this level of detail, the best predictor of Ag:Au are the district-scale alteration characteristics. Siliceous replacement takes place in many kinds systems and probably requires no more than a cooling, mildly acidic hydrothermal fluid. Metal suites, other fluid characteristics, and geological environment all need to be considered in evaluating the significance of any jasperoid.


    PubMed Central

    Barreda, Daniel R.; Neely, Harold R.; Flajnik, Martin F.


    In 1882, Elie Metchnikoff identified myeloid-like cells from starfish larvae responding to the invasion by a foreign body (rose thorn). This marked the origins of the study of innate immunity, and an appreciation that cellular immunity is already well established in these “primitive” organisms. This chapter focuses on these myeloid cells as well as the newest members of this family, the dendritic cells (DC), and explores their evolutionary origins. Our goal is to provide evolutionary context for the development of the multilayered immune system of mammals, where myeloid cells now serve as central effectors of innate immunity and regulators of adaptive immunity. Overall, we find that core contributions of myeloid cells to the regulation of inflammation are based on mechanisms that have been honed over hundreds of millions of years of evolution. Using phagocytosis as a platform, we show how fairly simple beginnings have offered a robust foundation onto which additional control features have been integrated, resulting in central regulatory nodes that now manage multi-factorial aspects of homeostasis and immunity. PMID:27337471