Science.gov

Sample records for barium sulfate precipitation

  1. Barium Sulfate

    MedlinePlus

    ... uses a computer to put together x-ray images to create cross-sectional or three dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called radiopaque contrast media. It works by coating the esophagus, stomach, or ...

  2. Effects of nitrate and water on the oxygen isotopic analysis of barium sulfate precipitated from solution

    USGS Publications Warehouse

    Hannon, Janet E.; Bohlke, Johnkarl F.; Mroczkowski, Stanley J.

    2008-01-01

    BaSO4 precipitated from mixed salt solutions by common techniques for SO isotopic analysis may contain quantities of H2O and NOthat introduce errors in O isotope measurements. Experiments with synthetic solutions indicate that δ18O values of CO produced by decomposition of precipitated BaSO4 in a carbon reactor may be either too low or too high, depending on the relative concentrations of SO and NO and the δ18O values of the H2O, NO, and SO. Typical δ18O errors are of the order of 0.5 to 1‰ in many sample types, and can be larger in samples containing atmospheric NO, which can cause similar errors in δ17O and Δ17O. These errors can be reduced by (1) ion chromatographic separation of SO from NO, (2) increasing the salinity of the solutions before precipitating BaSO4 to minimize incorporation of H2O, (3) heating BaSO4 under vacuum to remove H2O, (4) preparing isotopic reference materials as aqueous samples to mimic the conditions of the samples, and (5) adjusting measured δ18O values based on amounts and isotopic compositions of coexisting H2O and NO. These procedures are demonstrated for SO isotopic reference materials, synthetic solutions with isotopically known reagents, atmospheric deposition from Shenandoah National Park, Virginia, USA, and sulfate salt deposits from the Atacama Desert, Chile, and Mojave Desert, California, USA. These results have implications for the calibration and use of O isotope data in studies of SOsources and reaction mechanisms.

  3. Effects of nitrate and water on the oxygen isotopic analysis of barium sulfate precipitated from water samples.

    PubMed

    Hannon, Janet E; Böhlke, John Karl; Mroczkowski, Stanley J

    2008-12-01

    BaSO(4) precipitated from mixed salt solutions by common techniques for SO(4) (2-) isotopic analysis may contain quantities of H(2)O and NO(3) (-) that introduce errors in O isotope measurements. Experiments with synthetic solutions indicate that delta(18)O values of CO produced by decomposition of precipitated BaSO(4) in a carbon reactor may be either too low or too high, depending on the relative concentrations of SO(4) (2-) and NO(3) (-) and the delta(18)O values of the H(2)O, NO(3) (-), and SO(4) (2-). Typical delta(18)O errors are of the order of 0.5 to 1 per thousand in many sample types, and can be larger in samples containing atmospheric NO(3) (-), which can cause similar errors in delta(17)O and Delta(17)O. These errors can be reduced by (1) ion chromatographic separation of SO(4) (2-) from NO(3) (-), (2) increasing the salinity of the solutions before precipitating BaSO(4) to minimize incorporation of H(2)O, (3) heating BaSO(4) under vacuum to remove H(2)O, (4) preparing isotopic reference materials as aqueous samples to mimic the conditions of the samples, and (5) adjusting measured delta(18)O values based on amounts and isotopic compositions of coexisting H(2)O and NO(3) (-). These procedures are demonstrated for SO(4) (2-) isotopic reference materials, synthetic solutions with isotopically known reagents, atmospheric deposition from Shenandoah National Park, Virginia, USA, and sulfate salt deposits from the Atacama Desert, Chile, and Mojave Desert, California, USA. These results have implications for the calibration and use of O isotope data in studies of SO(4) (2-) sources and reaction mechanisms.

  4. Effects of nitrate and water on the oxygen isotopic analysis of barium sulfate precipitated from water samples

    USGS Publications Warehouse

    Hannon, J.E.; Böhlke, J.K.; Mroczkowski, S.J.

    2008-01-01

    BaSO4 precipitated from mixed salt solutions by common techniques for SO42- isotopic analysis may contain quantities of H2O and NO3- that introduce errors in O isotope measurements. Experiments with synthetic solutions indicate that ??18O values of CO produced by decomposition of precipitated BaSO4 in a carbon reactor may be either too low or too high, depending on the relative concentrations of SO42- and NO3- and the ??18O values of the H2O, NO3-, and SO42-. Typical ??18O errors are of the order of 0.5 to 1??? in many sample types, and can be larger in samples containing atmospheric NO 3-, which can cause similar errors in ?? 17O and ??17O. These errors can be reduced by (1) ion chromatographic separation of SO42- from NO 3-, (2) increasing the salinity of the solutions before precipitating BaSO4 to minimize incorporation of H2O, (3) heating BaSO4 under vacuum to remove H2O, (4) preparing isotopic reference materials as aqueous samples to mimic the conditions of the samples, and (5) adjusting measured ??18O values based on amounts and isotopic compositions of coexisting H2O and NO 3-. These procedures are demonstrated for SO 42- isotopic reference materials, synthetic solutions with isotopically known reagents, atmospheric deposition from Shenandoah National Park, Virginia, USA, and sulfate salt deposits from the Atacama Desert, Chile, and Mojave Desert, California, USA. These results have implications for the calibration and use of O isotope data in studies of SO42- sources and reaction mechanisms.

  5. Sulfate removal from waste chemicals by precipitation.

    PubMed

    Benatti, Cláudia Telles; Tavares, Célia Regina Granhen; Lenzi, Ervim

    2009-01-01

    Chemical oxidation using Fenton's reagent has proven to be a viable alternative to the oxidative destruction of organic pollutants in mixed waste chemicals, but the sulfate concentration in the treated liquor was still above the acceptable limits for effluent discharge. In this paper, the feasibility of sulfate removal from complex laboratory wastewaters using barium and calcium precipitation was investigated. The process was applied to different wastewater cases (two composite samples generated in different periods) in order to study the effect of the wastewater composition on the sulfate precipitation. The experiments were performed with raw and oxidized wastewater samples, and carried out according to the following steps: (1) evaluate the pH effect upon sulfate precipitation on raw wastewaters at pH range of 2-8; (2) conduct sulfate precipitation experiments on raw and oxidized wastewaters; and (3) characterize the precipitate yielded. At a concentration of 80 g L(-1), barium precipitation achieved a sulfate removal up to 61.4% while calcium precipitation provided over 99% sulfate removal in raw and oxidized wastewaters and for both samples. Calcium precipitation was chosen to be performed after Fenton's oxidation; hence this process configuration favors the production of higher quality precipitates. The results showed that, when dried at 105 degrees C, the precipitate is composed of hemidrate and anhydrous calcium sulfate ( approximately 99.8%) and trace metals ( approximately 0.2%: Fe, Cr, Mn, Co, Ag, Mg, K, Na), what makes it suitable for reuse in innumerous processes.

  6. Hierarchically nanostructured barium sulfate fibers.

    PubMed

    Romero-Ibarra, Issis C; Rodríguez-Gattorno, Geonel; García-Sánchez, Mario F; Sánchez-Solís, Antonio; Manero, Octavio

    2010-05-18

    BaSO(4) nanostructures with controlled morphologies were successfully produced via one-step process through precipitation of BaSO(4) in aqueous and organic media. The synthesis is carried out by mixing solutions of BaCl(2) and Na(2)SO(4) in presence of EDTA (disodium ethylenediaminetetraacetic acid) at room temperature. The influence of the reaction conditions such as initial reactants concentration, pH, EDTA/[Ba(2+)] ratio and aging on the BaSO(4) nanoparticles organization is studied. Using EDTA in aqueous media, spherical secondary particles of 500 nm diameter are obtained, which are formed by 4 nm size primary particles. With dimethyl sulfoxide and small amounts of water (5%) and EDTA, the aging process allows the production of long homogeneous fibers, related to hierarchical organization of BaSO(4) nanoparticles. Direct observation of self-assembling of primary particles by HRTEM allows proposing a mechanism for fiber formation, which is based on multipolar attractions that lead to a brick-by-brick organization along a preferential orientation. Results evidence the role of EDTA as controlling agent of the morphology and primary and secondary mean particle size.

  7. Co-precipitation of radium with barium and strontium sulfate and its impact on the fate of radium during treatment of produced water from unconventional gas extraction.

    PubMed

    Zhang, Tieyuan; Gregory, Kelvin; Hammack, Richard W; Vidic, Radisav D

    2014-04-15

    Radium occurs in flowback and produced waters from hydraulic fracturing for unconventional gas extraction along with high concentrations of barium and strontium and elevated salinity. Radium is often removed from this wastewater by co-precipitation with barium or other alkaline earth metals. The distribution equation for Ra in the precipitate is derived from the equilibrium of the lattice replacement reaction (inclusion) between the Ra(2+) ion and the carrier ions (e.g., Ba(2+) and Sr(2+)) in aqueous and solid phases and is often applied to describe the fate of radium in these systems. Although the theoretical distribution coefficient for Ra-SrSO4 (Kd = 237) is much larger than that for Ra-BaSO4 (Kd = 1.54), previous studies have focused on Ra-BaSO4 equilibrium. This study evaluates the equilibria and kinetics of co-precipitation reactions in Ra-Ba-SO4 and Ra-Sr-SO4 binary systems and the Ra-Ba-Sr-SO4 ternary system under varying ionic strength (IS) conditions that are representative of brines generated during unconventional gas extraction. Results show that radium removal generally follows the theoretical distribution law in binary systems and is enhanced in the Ra-Ba-SO4 system and restrained in the Ra-Sr-SO4 system by high IS. However, the experimental distribution coefficient (Kd') varies widely and cannot be accurately described by the distribution equation, which depends on IS, kinetics of carrier precipitation and does not account for radium removal by adsorption. Radium removal in the ternary system is controlled by the co-precipitation of Ra-Ba-SO4, which is attributed to the rapid BaSO4 nucleation rate and closer ionic radii of Ra(2+) with Ba(2+) than with Sr(2+). Carrier (i.e., barite) recycling during water treatment was shown to be effective in enhancing radium removal even after co-precipitation was completed. Calculations based on experimental results show that Ra levels in the precipitate generated in centralized waste treatment facilities far

  8. Barium sulfate aspiration: Severe chemical pneumonia induced by a massive reflux of contrast medium during small bowel barium enema.

    PubMed

    Zhang, Lin; Yang, Yi; Zhang, Ji; Zhou, Xiaowei; Dong, Hongmei; Zhou, Yiwu

    2015-08-01

    Barium contrast radiography is a conventional procedure aimed at revealing lesions of the alimentary tract using barium sulfate on X-ray irradiation. Although it is widely used in clinics, adverse effects and complications are observed, such as anaphylaxis, granuloma, fecalithes, abdomen-leaking, embolism, bacterial contamination, and aspiration. We report a case of death due to a massive barium sulfate aspiration resulted from an air-barium double contrast enema radiography. A 25-year-old female patient was hospitalized with symptoms of abdominal distention, nausea, vomiting and diarrhea for three days. A progressive respiratory distress presented only 1h after a small bowel air-barium double contrast enema. The patient died 11h later. The result of autopsy revealed the cause of death to be severe chemical pneumonitis induced by gastric fluid which was aspirated into her lungs. Barium sulfate is generally recognized to be chemically inert for the respiratory system, but a mixture of barium sulfate with gastric contents is fatal. Here we intend to suggest that, when determining the potential cause of death, medical examiners should consider a patient's status quo as well as the possible adverse effects and complications caused by the barium sulfate preparation during gastrointestinal radiography.

  9. Precipitation of calcium, magnesium, strontium and barium in tissues of four Acacia species (Leguminosae: Mimosoideae).

    PubMed

    He, Honghua; Bleby, Timothy M; Veneklaas, Erik J; Lambers, Hans; Kuo, John

    2012-01-01

    Precipitation of calcium in plants is common. There are abundant studies on the uptake and content of magnesium, strontium and barium, which have similar chemical properties to calcium, in comparison with those of calcium in plants, but studies on co-precipitation of these elements with calcium in plants are rare. In this study, we compared morphologies, distributional patterns, and elemental compositions of crystals in tissues of four Acacia species grown in the field as well as in the glasshouse. A comparison was also made of field-grown plants and glasshouse-grown plants, and of phyllodes of different ages for each species. Crystals of various morphologies and distributional patterns were observed in the four Acacia species studied. Magnesium, strontium and barium were precipitated together with calcium, mainly in phyllodes of the four Acacia species, and sometimes in branchlets and primary roots. These elements were most likely precipitated in forms of oxalate and sulfate in various tissues, including epidermis, mesophyll, parenchyma, sclerenchyma (fibre cells), pith, pith ray and cortex. In most cases, precipitation of calcium, magnesium, strontium and barium was biologically induced, and elements precipitated differed between soil types, plant species, and tissues within an individual plant; the precipitation was also related to tissue age. Formation of crystals containing these elements might play a role in regulating and detoxifying these elements in plants, and protecting the plants against herbivory.

  10. Precipitation of Calcium, Magnesium, Strontium and Barium in Tissues of Four Acacia Species (Leguminosae: Mimosoideae)

    PubMed Central

    He, Honghua; Bleby, Timothy M.; Veneklaas, Erik J.; Lambers, Hans; Kuo, John

    2012-01-01

    Precipitation of calcium in plants is common. There are abundant studies on the uptake and content of magnesium, strontium and barium, which have similar chemical properties to calcium, in comparison with those of calcium in plants, but studies on co-precipitation of these elements with calcium in plants are rare. In this study, we compared morphologies, distributional patterns, and elemental compositions of crystals in tissues of four Acacia species grown in the field as well as in the glasshouse. A comparison was also made of field-grown plants and glasshouse-grown plants, and of phyllodes of different ages for each species. Crystals of various morphologies and distributional patterns were observed in the four Acacia species studied. Magnesium, strontium and barium were precipitated together with calcium, mainly in phyllodes of the four Acacia species, and sometimes in branchlets and primary roots. These elements were most likely precipitated in forms of oxalate and sulfate in various tissues, including epidermis, mesophyll, parenchyma, sclerenchyma (fibre cells), pith, pith ray and cortex. In most cases, precipitation of calcium, magnesium, strontium and barium was biologically induced, and elements precipitated differed between soil types, plant species, and tissues within an individual plant; the precipitation was also related to tissue age. Formation of crystals containing these elements might play a role in regulating and detoxifying these elements in plants, and protecting the plants against herbivory. PMID:22848528

  11. BARIUM RECOVERY PROCESS

    DOEpatents

    Blanco, R.E.

    1959-07-21

    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  12. Kubelka-Munk optical properties of a barium sulfate white reflectance standard.

    PubMed

    Patterson, E M; Shelden, C E; Stockton, B H

    1977-03-01

    We have measured the Kubelka-Munk scattering and absorption coefficients for a barium sulfate white reflectance standard. These measurements have been based on measurements of the absolute reflectance for the particular barium sulfate samples whose scattering and absorption coefficients were measured. This method gives results that are different from earlier measurements; the differences are significant for measurements of the optical properties of atmospheric aerosols.

  13. Comparison of the reflectance characteristics of polytetrafluoroethylene and barium sulfate paints

    NASA Technical Reports Server (NTRS)

    Butner, C. L.; Schutt, J. B.; Shai, M. C.

    1984-01-01

    Preliminary results are presented of the directional reflectance measurements taken on two tetrafluorethylene (TFE) paints formulated with silicone binders. Both paints are found to be more Lambertian than barium sulfate paint and pressed powder, although the pigment to binder ratios for barium sulfate and TFE paints are about 133 and 3.3 to 1, respectively. The TFE paints exhibit total visible reflectances above 90 percent and offer surfaces that are not significantly affected by water.

  14. Development and Demonstration of a Sulfate Precipitation Process for Hanford Waste Tank 241-AN-107

    SciTech Connect

    SK Fiskum; DE Kurath; BM Rapko

    2000-08-16

    A series of precipitation experiments were conducted on Hanford waste tank 241-AN-107 samples in an effort to remove sulfate from the matrix. Calcium nitrate was added directly to AN-107 sub-samples to yield several combinations of Ca:CO{sub 3} mole ratios spanning a range of 0:1 to 3:1 to remove carbonate as insoluble CaCO{sub 3}. Similarly barium nitrate was added directly to the AN-107 aliquots, or to the calcium pretreated AN-107 aliquots, giving of Ba:SO{sub 4} mole ratios spanning a range of 1:1 to 5:1 to precipitate sulfate as BaSO{sub 4}. Initial bulk carbonate removal was required for successful follow-on barium sulfate precipitation. A {ge} 1:1 mole ratio of Ca:CO{sub 3} was found to lower the carbonate concentration such that Ba would react preferentially with the sulfate. A follow-on 1:1 mole ratio of Ba:SO{sub 4} resulted in 70% sulfate removal. The experiment was scaled up with a 735-mL aliquot of AN-107 for more complete testing. Calcium carbonate and barium sulfate settling rates were determined and fates of selected cations, anions, and radionuclides were followed through the various process steps. Seventy percent of the sulfate was removed in the scale-up test while recovering 63% of the filtrate volume. Surprisingly, during the scale-up test a sub-sample of the CaCO{sub 3}/241-AN-107 slurry was found to lose fluidity upon standing for {le} 2 days. Metathesis with BaCO{sub 3} at ambient temperature was also evaluated using batch contacts at various BaCO{sub 3}:SO{sub 4} mole ratios with no measurable success.

  15. Comparison of flow-controlled calcium and barium carbonate precipitation patterns

    NASA Astrophysics Data System (ADS)

    Schuszter, G.; De Wit, A.

    2016-12-01

    Various precipitation patterns can be obtained in flow conditions when injecting a solution of sodium carbonate in a confined geometry initially filled with a solution of either barium or calcium chloride. We compare here the barium and calcium carbonate precipitate structures as a function of initial concentrations and injection flow rate. We show that, in some part of the parameter space, the patterns are similar and feature comparable properties indicating that barium and calcium behave similarly in the related flow-controlled precipitation conditions. For other values of parameters though, the precipitate structures are different indicating that the cohesive and microscopic properties of barium versus calcium carbonate are then important in shaping the pattern in flow conditions.

  16. Barium sulfate micro- and nanoparticles as bioinert reference material in particle toxicology.

    PubMed

    Loza, Kateryna; Föhring, Isabell; Bünger, Jürgen; Westphal, Götz A; Köller, Manfred; Epple, Matthias; Sengstock, Christina

    2016-12-01

    The inhalation of particles and their exposure to the bronchi and alveoli constitute a major public health risk. Chemical as well as particle-related properties are important factors for the biological response but are difficult to separate from each other. Barium sulfate is a completely inert chemical compound, therefore it is ideally suited to separate these two factors. The biological response of rat alveolar macrophages (NR8383) was analyzed after exposure to barium sulfate particles with three different diameters (40 nm, 270 nm, and 1.3 μm, respectively) for 24 h in vitro (particle concentrations from 12.5 to 200 μg mL(-)(1)). The particles were colloidally stabilized as well as fluorescently-labeled by carboxymethylcellulose, conjugated with 6-aminofluorescein. All kinds of barium sulfate particles were efficiently taken up by NR8383 cells and found inside endo-lysosomes, but never in the cell nucleus. Neither an inflammatory nor a cytotoxic response was detected by the ability of dHL-60 and NR8383 cells to migrate towards a chemotactic gradient (conditioned media of NR8383 cells) and by the release of inflammatory mediators (CCL2, TNF-α, IL-6). The particles neither caused apoptosis (up to 200 μg mL(-)(1)) nor necrosis (up to 100 μg mL(-)(1)). As only adverse reaction, necrosis was found at a concentration of 200 μg mL(-)(1) of the largest barium sulfate particles (1.3 μm). Barium sulfate particles are ideally suited as bioinert control to study size-dependent effects such as uptake mechanisms of intracellular distributions of pure particles, especially in nanotoxicology.

  17. Understanding barite and gypsum precipitation in upland acid-sulfate soils: An example from a Lufkin Series toposequence, south-central Texas, USA

    NASA Astrophysics Data System (ADS)

    Jennings, Debra S.; Driese, Steven G.

    2014-01-01

    Although low-temperature barite precipitation has been previously documented in soils and paleosols, pedogenic barite precipitation remains poorly understood. This study characterizes the micromorphology, elemental trends, and stable isotope geochemistry of sulfates in a barite-bearing soil (Lufkin Series) toposequence using optical microscopy, XRD, ICP-MS, and stable S and O isotope data. Synthesized data indicate that fluctuating redox processes and microbial activity resulting from epiaquatic and evaporative conditions lead to the precipitation of sulfates in the Lufkin soils. Stable sulfur and oxygen isotopes indicate that the primary source of sulfur is the partial dissolution of jarosite during microbial sulfate reduction. Barium-rich parent material provides adequate barium for barite precipitation. Barium is mobilized and concentrated in Btg horizons ~ 100-160 cm below the surface. The presence of humic acids in profiles lower on the landscape prevents barite precipitation and drives the precipitation of gypsum between saturated, anoxic conditions (November to May) and drier, more oxic conditions (May to November). Barite precipitation is a slow, punctuated process. Micromorphological data reveal that barite precipitates first along evacuated macropores and then in the adjacent matrix. In general, optimal conditions for pedogenic barite precipitation in upland wetland acid-sulfate soils are: 1) warm soil temperature that supports active sulfur-reducing and sulfur oxidizing microbes; 2) distinct wet/dry seasons that allow alternating redox conditions; 3) low-gradient landscape; 4) parent material that contains barium- and sulfur-rich constituents; and 5) a long-lived, stable landscape.

  18. Evaluation of gastrointestinal tract transit times using barium-impregnated polyethylene spheres and barium sulfate suspension in a domestic pigeon (Columba livia) model.

    PubMed

    Bloch, Rebecca A; Cronin, Kimberly; Hoover, John P; Pechman, Robert D; Payton, Mark E

    2010-03-01

    Barium impregnated polyethylene spheres (BIPS) are used in small animal medicine as an alternative to barium sulfate for radiographic studies of the gastrointestinal tract. To determine the usefulness of BIPS as an alternative to barium suspension in measuring gastrointestinal (GI) transit time for avian species, ventrodorsal radiographs were used to follow the passage of BIPS and 30% barium sulfate suspension through the GI tracts of domestic pigeons (Columba livia). Gastrointestinal transit times of thirty 1.5-mm BIPS administered in moistened gelatin capsules and 30% barium sulfate suspension gavaged into the crop were compared in 6 pigeons. Although the barium suspension passed out of the GI tract of all pigeons within 24 hours, the 1.5-mm BIPS remained in the ventriculus for 368.0 +/- 176.8 hours and did not clear the GI tract for 424.0 +/- 204.6 hours. Although the times for passage of BIPS and 30% barium sulfate suspension from the crop into the ventriculus were not significantly different (P = .14), the times for passage of BIPS from the ventriculus into the large intestine-cloaca and for clearance from the GI tract of the pigeons were significantly longer (P < .001) than for the 30% barium sulfate suspension. From the results of this study, we conclude that BIPS are not useful for radiographically evaluating GI transit times in pigeons and are unlikely to be useful in other avian species that have a muscular ventriculus. BIPS may or may not be useful for evaluating GI transit times in species that lack a muscular ventriculus.

  19. Micro-Computed Tomography of Fatigue Microdamage in Cortical Bone Using a Barium Sulfate Contrast Agent

    PubMed Central

    Leng, Huijie; Wang, Xiang; Ross, Ryan D.; Niebur, Glen L.; Roeder, Ryan K.

    2008-01-01

    Accumulation of microdamage during fatigue can lead to increased fracture susceptibility in bone. Current techniques for imaging microdamage in bone are inherently destructive and two-dimensional. Therefore, the objective of this study was to image the accumulation of fatigue microdamage in cortical bone using micro-computed tomography (micro-CT) with a barium sulfate (BaSO4) contrast agent. Two symmetric notches were machined on the tensile surface of bovine cortical bone beams in order to generate damage ahead of the stress concentrations during four-point bending fatigue. Specimens were loaded to a specified number of cycles or until one notch fractured, such that the other notch exhibited the accumulation of microdamage prior to fracture. Microdamage ahead of the notch was stained in vitro by precipitation of BaSO4 and imaged using micro-CT. Reconstructed images showed a distinct region of bright voxels around the notch tip or along propagating cracks due to the presence of BaSO4, which was verified by backscattered electron imaging and energy dispersive spectroscopy. The shape of the stained region ahead of the notch tip was consistent with principal strain contours calculated by finite element analysis. The relative volume of the stained region was correlated with the number of loading cycles by non-linear regression using a power-law. This study demonstrates new methods for the non-destructive and three-dimensional detection of fatigue microdamage accumulation in cortical bone in vitro, which may be useful to gain further understanding into the role of microdamage in bone fragility. PMID:18443659

  20. Co,Ti,Mn-precipitated barium hexaferrite powders

    SciTech Connect

    Michalikova, M.; Gruskova, A.; Vicen, R.; Lipka, J.; Slama, J.

    1994-03-01

    Barium ferrites substituted Co, Ti, Mn, produced by the citrate method have been studied. The substitution x in BaCo{sub x}Ti{sub x}Mn{sub y}Fe{sub 12{minus}2x{minus}y}O{sub 19} has been varied from 0.2--2.0 i./f.u. and the substitution of Mn y = 0.1 i./f.u.. Magnetic parameters were measured by the vibration magnetometer. The mechanism of hexagonal structure formation has been checked by Moessbauer spectroscopy.

  1. Precipitation of Barite by Myxococcus xanthus: Possible Implications for the Biogeochemical Cycle of Barium

    PubMed Central

    González-Muñoz, Maria Teresa; Fernández-Luque, Belén; Martínez-Ruiz, Francisca; Ben Chekroun, Kaoutar; Arias, José María; Rodríguez-Gallego, Manuel; Martínez-Cañamero, Magdalena; de Linares, Concepción; Paytan, Adina

    2003-01-01

    Bacterial precipitation of barite (BaSO4) under laboratory conditions is reported for the first time. The bacterium Myxococcus xanthus was cultivated in a solid medium with a diluted solution of barium chloride. Crystallization occurred as a result of the presence of live bacteria and the bacterial metabolic activity. A phosphorous-rich amorphous phase preceded the more crystalline barite formation. These experiments may indicate the involvement of bacteria in the barium biogeochemical cycle, which is closely related to the carbon cycle. PMID:12957970

  2. Combined influence of barium sulfate content and co-monomer concentration on properties of PMMA bone cements for vertebroplasty.

    PubMed

    Cisneros-Pineda, Olga G; Cauich-Rodríguez, Juan V; Cervantes-Uc, José M; Vázquez, Blanca; Román, Julio San

    2011-01-01

    In this work, the combined influence of barium sulfate content and co-monomer concentration on the properties of acrylic bone cement for percutaneous vertebroplasty (PVP) was investigated using a response surface methodology. Cements were prepared with methyl methacrylate (MMA) and either diethyl amino ethyl methacrylate (DEAEM) or dimethyl amino ethyl methacrylate (DMAEM) as co-monomer in the liquid phase, while variable amounts of barium sulfate were incorporated to the solid phase in order to improve the radiopacity of cements. It was found that various properties such as peak temperature, setting time, residual monomer content, mechanical properties and injectability, had an effect on the occurrence of interactions (combined effect) between the barium sulfate and DEAEM in bone cements formulations when independent variables were at their maximum.

  3. Physiologic Studies of the Pulmonary Capillary Bed after Barium Sulfate Embolization*

    PubMed Central

    Daly, Walter J.; Waldhausen, John A.

    1967-01-01

    22 anesthetized dogs were given a barium sulfate suspension intravenously in a dose sufficient to double mean pulmonary artery pressure. 10 sec breath-holding carbon monoxide diffusing capacity (DLCO10) was measured before and after this standard embolization in each dog. No post-embolic decrease in DLCO10 was observed. In the study of this apparent paradox, it was found that the potential for further increase in DLCO10 during exercise remained after embolization. During rest prolongation of breath holding to 60 sec decreased CO absorption significantly more in the embolized than in the nonembolized dogs. While DLCO10 was not affected by standard barium embolization, oxygen diffusing capacity was clearly decreased. The bronchial collateral circulation did not participate in preventing a DLCO10 decrease after embolization since surgical interruption of the bronchial circulation did not alter the response to barium. Microscopic examination of lung sections taken after standard embolization showed plugging of precapillary vessels in the 40-50 μ range. These studies suggest that acute precapillary embolic obstruction of vessels of this size interferes remarkably little with CO absorption over short periods of time, probably because of continued CO absorption in portions of the capillary net distal to the sites of impaction. The remarkable anastomotic nature of this capillary network with multiple sources of access possibly provides the anatomic basis for this observation. This study demonstrates a clear dissociation between acute changes in pulmonary vascular resistance and DLCO10—both during rest and exercise. Images PMID:6061739

  4. Reactions of calcium orthosilicate and barium zirconate with oxides and sulfates of various elements

    NASA Technical Reports Server (NTRS)

    Zaplatynsky, I.

    1979-01-01

    Calcium orthosilicate and barium zirconate were evaluated as the insulation layer of thermal barrier coatings for air cooled gas turbine components. Their reactions with various oxides and sulfates were studied at 1100 C and 1300 C for times ranging up to 400 and 200 hours, respectively. These oxides and sulfates represent potential impurities or additives in gas turbine fuels and in turbine combustion air, as well as elements of potential bond coat alloys. The phase compositions of the reaction products were determined by X-ray diffraction analysis. BaZrO3 and 2CaO-SiO2 both reacted with P2O5, V2O5, Cr2O3, Al2O3, and SiO2. In addition, 2CaO-SiO2 reacted with Na2O, BaO, MgO, and CoO and BaZrO3 reacted with Fe2O3.

  5. Selective removal of keratan sulfate in chondroitin sulfate samples by sequential precipitation with ethanol.

    PubMed

    Galeotti, Fabio; Maccari, Francesca; Volpi, Nicola

    2014-03-01

    Keratan sulfate (KS) is present as a contaminant in chondroitin sulfate (CS) mainly extracted from shark cartilage. We report a selective removal procedure of KS in CS samples by means of sequential precipitation with ethanol. Purified shark CS containing approximately 10% to 15% KS was subjected to a precipitation procedure in the presence of increasing percentages of saturated ethanol. In contrast to other solvents, 1.0 volume of ethanol was able to selectively purify CS, with a purity of approximately 100%, from KS. The current selective and simple procedure appears to be a reliable industrial preparation of CS devoid of large amounts of the residual KS.

  6. Heterogeneous Nucleation and Growth of Barium Sulfate at Organic-Water Interfaces: Interplay between Surface Hydrophobicity and Ba2+ Adsorption

    DOE PAGES

    Dai, Chong; Stack, Andrew G.; Koishi, Ayumi; ...

    2016-05-10

    Barium sulfate (BaSO4) is a common scale-forming mineral in natural and engineered systems, yet the rates and mechanisms of heterogeneous BaSO4 nucleation are not understood. To address these, we created idealized interfaces on which to study heterogeneous nucleation rates and mechanisms, which also are good models for organic–water interfaces: self-assembled thin films terminated with different functional groups (i.e., -COOH, -SH, or mixed -SH & COOH) coated on glass slides. BaSO4 precipitation on coatings from Barite-supersaturated solutions (saturation index, SI, = 1.1) was investigated using grazing-incidence small-angle X-ray scattering. After reaction for 1 h, a little amount of BaSO4 formed onmore » hydrophilic bare and -COOH coated glasses. Meanwhile, BaSO4 nucleation was significantly promoted on hydrophobic -SH and mixed -SH & COOH coatings. This is because substrate hydrophobicity likely affected the interfacial energy and hence thermodynamic favorability of heterogeneous nucleation. The heterogeneous BaSO4 nucleation and growth kinetics were found to be affected by the amount of Ba2+ adsorption onto the substrate and incipient BaSO4 nuclei. The importance of Ba2+ adsorption was further corroborated by the finding that precipitation rate increased under [Ba2+]/[SO42–] concentration ratios >1. These observations suggest that thermodynamic favorability for nucleation is governed by substrate–water interfacial energy, while given favorable thermodynamics, the rate is governed by ion attachment to substrates and incipient nuclei.« less

  7. Sulfate-reducing bacteria release barium and radium from naturally occurring radioactive material in oil-field barite

    USGS Publications Warehouse

    Phillips, E.J.P.; Landa, E.R.; Kraemer, T.; Zielinski, R.

    2001-01-01

    Scale and sludge deposits formed during oil production can contain elevated levels of Ra, often coprecipitated with barium sulfate (barite). The potential for sulfate-reducing bacteria to release 226 Ra and Ba (a Ra analog) from oil-field barite was evaluated. The concentration of dissolved Ba increased when samples containing pipe scale, tank sludge, or oil-field brine pond sediment were incubated with sulfate-reducing bacteria Desulfovibrio sp., Str LZKI, isolated from an oil-field brine pond. However, Ba release was not stoichiometric with sulfide production in oil-field samples, and <0.1% of the Ba was released. Potential for the release of 226Ra was demonstrated, and the 226 Ra release associated with sulfate-reducing activity was predictable from the amount of Ba released. As with Ba, only a fraction of the 226Ra expected from the amount of sulfide produced was released, and most of the Ra remained associated with the solid material.

  8. Fabrication and surface properties of hydrophobic barium sulfate aggregates based on sodium cocoate modification

    NASA Astrophysics Data System (ADS)

    Hu, Linna; Wang, Guangxiu; Cao, Rong; Yang, Chun; Chen, Xi

    2014-10-01

    Hydrophobic barium sulfate aggregates were fabricated by the direction of cocoate anions. At 30 °C, when the weight ratio of sodium cocoate to BaSO4 particles was 2.0 wt.%, the active ratio of the product reached 99.43% and the contact angle was greater than 120°. This method could not only simplify the complex modification process, but reduce energy consumption. The surface morphology, chemical structure and composition of BaSO4 aggregates were characterized by SEM, XRD, and FTIR. The results indicated that the as-synthesized BaSO4 particles were almond-liked and were composed of many interconnected nanoballs and that their surfaces were affected by cocoate anions. The adsorption of cocoate anions reversed the charge and weakened the surface polarity of BaSO4 particles, driving the formation of aggregates. And cocoate anions induced a change of the BaSO4 particles surface from hydrophilic to hydrophobic by a self-assembly and transformation process. Due to the self-assembled structure and the surface hydrophobicity, when adding the hydrophobic BaSO4 into PVC, the mechanical properties of PVC composite materials were significantly improved.

  9. Precipitation method for barium metaborate (BaB2O4) synthesis from borax solution

    NASA Astrophysics Data System (ADS)

    Akşener, Eymen; Figen, Aysel Kantürk; Pişkin, Sabriye

    2013-12-01

    In this study, barium metaborate (BaB2O4, BMB) synthesis from the borax solution was carried out. BMB currently is used in production of ceramic glazes, luminophors, oxide cathodes as well as additives to pigments for aqueous emulsion paints and also β-BaB2O4 single crystals are the best candidate for fabrication of solid-state UV lasers operating at a wavelength of 200 nm due to excellent nonlinear optical properties. In the present study, synthesis was carried out from the borax solution (Na2B4O7ṡ10H2O, BDH) and barium chloride (BaCI2ṡ2H2O, Ba) in the glass-batch reactor with stirring. The effect of, times (5-15 min), molar ratio [stoich.ration (1.0:2.0), 1.25:2.0, 1.5:2.0, 2.5:2:0, 3.0:2.0, 3.5:2.0,4.0:2.0, 5.0:2.0] and also crystallization time (2-6 hour) on the BMB yield (%) was investigated at 80 °C reaction temperature. It is found that, BMB precipitation synthesis with 90 % yield can be performed from 0.50 molar ration (BDH:Ba), under 80 °C, 15 minute, and 6 hours crystallization time. The structural properties of BMB powders were characterized by using XRD, FT-IR and DTA-TG instrumental analysis technique.

  10. Quantitative Analysis of Sulfate in Water by Indirect EDTA Titration

    ERIC Educational Resources Information Center

    Belle-Oudry, Deirdre

    2008-01-01

    The determination of sulfate concentration in water by indirect EDTA titration is an instructive experiment that is easily implemented in an analytical chemistry laboratory course. A water sample is treated with excess barium chloride to precipitate sulfate ions as BaSO[subscript 4](s). The unprecipitated barium ions are then titrated with EDTA.…

  11. Determination of Sulfate by Conductometric Titration: An Undergraduate Laboratory Experiment

    ERIC Educational Resources Information Center

    Garcia, Jennifer; Schultz, Linda D.

    2016-01-01

    The classic technique for sulfate analysis in an undergraduate quantitative analysis lab involves precipitation as the barium salt with barium chloride, collection of the precipitate by gravity filtration using ashless filter paper, and removal of the filter paper by charring over a Bunsen burner. The entire process is time-consuming, hazardous,…

  12. Bioabsorbable bone fixation plates for X-ray imaging diagnosis by a radiopaque layer of barium sulfate and poly(lactic-co-glycolic acid).

    PubMed

    Choi, Sung Yoon; Hur, Woojune; Kim, Byeung Kyu; Shasteen, Catherine; Kim, Myung Hun; Choi, La Mee; Lee, Seung Ho; Park, Chun Gwon; Park, Min; Min, Hye Sook; Kim, Sukwha; Choi, Tae Hyun; Choy, Young Bin

    2015-04-01

    Bone fixation systems made of biodegradable polymers are radiolucent, making post-operative diagnosis with X-ray imaging a challenge. In this study, to allow X-ray visibility, we separately prepared a radiopaque layer and attached it to a bioabsorbable bone plate approved for clinical use (Inion, Finland). We employed barium sulfate as a radiopaque material due to the high X-ray attenuation coefficient of barium (2.196 cm(2) /g). The radiopaque layer was composed of a fine powder of barium sulfate bound to a biodegradable material, poly(lactic-co-glycolic acid) (PLGA), to allow layer degradation similar to the original Inion bone plate. In this study, we varied the mass ratio of barium sulfate and PLGA in the layer between 3:1 w/w and 10:1 w/w to modulate the degree and longevity of X-ray visibility. All radiopaque plates herein were visible via X-ray, both in vitro and in vivo, for up to 40 days. For all layer types, the radio-opacity decreased with time due to the swelling and degradation of PLGA, and the change in the layer shape was more apparent for layers with a higher PLGA content. The radiopaque plates released, at most, 0.5 mg of barium sulfate every 2 days in a simulated in vitro environment, which did not appear to affect the cytotoxicity. The radiopaque plates also exhibited good biocompatibility, similar to that of the Inion plate. Therefore, we concluded that the barium sulfate-based, biodegradable plate prepared in this work has the potential to be used as a fixation device with both X-ray visibility and biocompatibility.

  13. Structural and optical properties of Er3+/Yb3+ doped barium titanate phosphor prepared by co-precipitation method.

    PubMed

    Mahata, Manoj Kumar; Kumar, Kaushal; Rai, Vineet Kumar

    2014-04-24

    In the present work we have synthesized the Er(3+)/Yb(3+) codoped barium titanate phosphor via co-precipitation method and studied its upconversion emission properties. The prepared BaTiO3 powder was found in cubic phase as a major component and having good crystallinity revealed by the XRD analysis. Optical band gap of the cubic barium titanate was calculated using the diffuse reflectance absorption spectrum. Good green upconversion emission is observed from the samples when excited by 980 nm diode laser. The variation in upconversion emission intensity is studied with the increase in excitation power as well as temperature of the sample. It is found that the emission bands centred at 524 and 548 nm are thermally coupled and can act as a temperature sensor in the 300-480 K temperature range.

  14. Controlled double-jet precipitation of uniform colloidal crystalline particles of Zr- and Sr-doped barium titanates

    SciTech Connect

    Her, Y.; Matijevic, E.; Chon, M.C.

    1996-12-01

    The synthesis of uniform colloidal crystalline particles of Zr- and Sr-doped barium titanates at a low temperature of 85{degree}C by the controlled double-jet precipitation (CDJP) technique is described. The stoichiometry of the powders can be precisely controlled by adjusting the compositions of the starting reactant solutions. Barium titanate with 20{percent} Zr substitution, sintered at 1275{degree}C, satisfied the requirements for the Y5V multilayer capacitors application. The grain sizes are uniform and small, ranging from 1 to 3 {mu}m. Solids with an extremely sharp change in the dielectric constant as a function of temperature, which are suitable for thermal IR detectors application, can be obtained when both Sr and Zr are incorporated as dopants. {copyright} {ital 1996 Materials Research Society.}

  15. The effects of sulfate content on crystalline phase, microstructure, and chemical durability of zirconolite-barium borosilicate glass-ceramics

    NASA Astrophysics Data System (ADS)

    Wu, Lang; Wang, Xin; Li, Huidong; Teng, Yuancheng; Peng, Long

    2016-09-01

    The effects of sulfate content on structure and chemical durability of barium borosilicate glass-ceramics were studied. The results show that the glass-ceramics with 0-1.10 mol% SO3 possess mainly CaZrTi2O7-2M phase along with a small amount of CaZrTi2O7-3T and ZrO2 phases. The hexagonal CaZrTi2O7-3T crystals crystallize on the surface of glass-ceramics. For the samples with 1.24-1.55 mol% SO3, the main crystalline phases are CaTiSiO5 and CaZrTi2O7-2M in the bulk, while a separate sulfate layer containing Na2SO4 and BaSO4 is observed on the surface. X-ray fluorescence analysis indicates that about 2/3 of the SO3 originally added has been lost by volatility. The normalized mass loss (NLi) for Na, B, Ca elements remains almost unchanged (∼10-2 g/m2) after 7 days for the samples with 0-1.10 mol% SO3. The NLi for both Na and B increases gradually after 7 days when the SO3 content is 1.24 mol%.

  16. Heterogeneous Nucleation and Growth of Barium Sulfate at Organic-Water Interfaces: Interplay between Surface Hydrophobicity and Ba2+ Adsorption

    SciTech Connect

    Dai, Chong; Stack, Andrew G.; Koishi, Ayumi; Fernandez-Martinez, Alejandro; Lee, Sang Soo; Hu, Yandi

    2016-05-10

    Barium sulfate (BaSO4) is a common scale-forming mineral in natural and engineered systems, yet the rates and mechanisms of heterogeneous BaSO4 nucleation are not understood. To address these, we created idealized interfaces on which to study heterogeneous nucleation rates and mechanisms, which also are good models for organic–water interfaces: self-assembled thin films terminated with different functional groups (i.e., -COOH, -SH, or mixed -SH & COOH) coated on glass slides. BaSO4 precipitation on coatings from Barite-supersaturated solutions (saturation index, SI, = 1.1) was investigated using grazing-incidence small-angle X-ray scattering. After reaction for 1 h, a little amount of BaSO4 formed on hydrophilic bare and -COOH coated glasses. Meanwhile, BaSO4 nucleation was significantly promoted on hydrophobic -SH and mixed -SH & COOH coatings. This is because substrate hydrophobicity likely affected the interfacial energy and hence thermodynamic favorability of heterogeneous nucleation. The heterogeneous BaSO4 nucleation and growth kinetics were found to be affected by the amount of Ba2+ adsorption onto the substrate and incipient BaSO4 nuclei. The importance of Ba2+ adsorption was further corroborated by the finding that precipitation rate increased under [Ba2+]/[SO42–] concentration ratios >1. These observations suggest that thermodynamic favorability for nucleation is governed by substrate–water interfacial energy, while given favorable thermodynamics, the rate is governed by ion attachment to substrates and incipient nuclei.

  17. Heterogeneous Nucleation and Growth of Barium Sulfate at Organic–Water Interfaces: Interplay between Surface Hydrophobicity and Ba 2+ Adsorption

    SciTech Connect

    Dai, Chong; Stack, Andrew G.; Koishi, Ayumi; Fernandez-Martinez, Alejandro; Lee, Sang Soo; Hu, Yandi

    2016-05-31

    Barium sulfate (BaSO4) is a common scale-forming mineral in natural and engineered systems, yet the rates and mechanisms of heterogeneous BaSO4 nucleation are not understood. To address these, we created idealized interfaces on which to study heterogeneous nucleation rates and mechanisms, which also are good models for organic–water interfaces: self-assembled thin films terminated with different functional groups (i.e., -COOH, -SH, or mixed -SH & COOH) coated on glass slides. BaSO4 precipitation on coatings from Barite-supersaturated solutions (saturation index, SI, = 1.1) was investigated using grazing-incidence small-angle X-ray scattering. After reaction for 1 h, a little amount of BaSO4 formed on hydrophilic bare and -COOH coated glasses. Meanwhile, BaSO4 nucleation was significantly promoted on hydrophobic -SH and mixed -SH & COOH coatings. This is because substrate hydrophobicity likely affected the interfacial energy and hence thermodynamic favorability of heterogeneous nucleation. The heterogeneous BaSO4 nucleation and growth kinetics were found to be affected by the amount of Ba2+ adsorption onto the substrate and incipient BaSO4 nuclei. The importance of Ba2+ adsorption was further corroborated by the finding that precipitation rate increased under [Ba2+]/[SO42–] concentration ratios >1. These observations suggest that thermodynamic favorability for nucleation is governed by substrate–water interfacial energy, while given favorable thermodynamics, the rate is governed by ion attachment to substrates and incipient nuclei.

  18. Precipitation of phenyl and phenoxypenicillin from solutions using ammonium sulfate.

    PubMed

    Luengo, J M

    1985-09-01

    An easy, rapid, and available method for separating 6-aminopenicillanic acid (6-APA), benzylpenicillin (penicillin G), and other related molecules from aqueous solutions or complex industrial broths is described. A high concentration of ammonium sulphate induces partially or totally the precipitation of the penicillin present in the solutions, while 6-APA, phenylacetic, and phenoxyacetic acid always remain in the supernatant. The filtration through No. 4 Pyrex glass-fiber filter or Whatman 3MM paper permits the separation of the compounds present in the supernatant from the other ones precipitated. The precipitated product was identified, in all cases, as ammonium penicillin. This method is described here for the first time.

  19. Preparation of immunoglobulin Y from egg yolk using ammonium sulfate precipitation and ion exchange chromatography.

    PubMed

    Ko, K Y; Ahn, D U

    2007-02-01

    The objective of this study was to develop an economical, simple, and large-scale separation method for IgY from egg yolk. Egg yolk diluted with 9 volumes of cold water was centrifuged after adjusting the pH to 5.0. The supernatant was added with 0.01% charcoal or 0.01% carrageenan and centrifuged at 2,800 x g for 30 min. The supernatant was filtered through a Whatman no. 1 filter paper and then the filtrate was concentrated to 20% original volume using ultrafiltration. The concentrated solution was further purified using either cation exchange chromatography or ammonium sulfate precipitation. For the cation exchange chromatography method, the concentrated sample was loaded onto a column equilibrated with 20 mM citrate-phosphate buffer at pH 4.8 and eluted with 200 mM citrate-phosphate buffer at pH 6.4. For the ammonium sulfate precipitation method, the concentrated sample was twice precipitated with 40% ammonium sulfate solution at pH 9.0. The yield and purity of IgY were determined by ELISA and electrophoresis. The yield of IgY from the cation exchange chromatography method was 30 to 40%, whereas that of the ammonium sulfate precipitation was 70 to 80%. The purity of IgY from the ammonium sulfate method was higher than that of the cation exchange chromatography. The cation exchange chromatography could handle only a small amount of samples, whereas the ammonium sulfate precipitation could handle a large volume of samples. This suggests that ammonium sulfate precipitation was a more efficient and useful purification method than cation exchange chromatography for the large-scale preparation of IgY from egg yolk.

  20. Influence of barium sulfate X-ray imaging contrast material on properties of floating drug delivery tablets.

    PubMed

    Diós, Péter; Szigeti, Krisztián; Budán, Ferenc; Pócsik, Márta; Veres, Dániel S; Máthé, Domokos; Pál, Szilárd; Dévay, Attila; Nagy, Sándor

    2016-12-01

    The objective of the study was to reveal the influence of necessarily added barium sulfate (BaSO4) X-ray contrast material on floating drug delivery tablets. Based on literature survey, a chosen floating tablet composition was determined containing HPMC and carbopol 943P as matrix polymers. One-factor factorial design with five levels was created for evaluation of BaSO4 (X1) effects on experimental parameters of tablets including: floating lag time, total floating time, swelling-, erosion-, dissolution-, release kinetics parameters and X-ray detected volume changes of tablets. Applied concentrations of BaSO4 were between 0 and 20.0% resulting in remarkable alteration of experimental parameters related especially to flotation. Drastic deterioration of floating lag time and total floating time could be observed above 15.0% BaSO4. Furthermore, BaSO4 showed to increase the integrity of tablet matrix by reducing eroding properties. A novel evaluation of dissolutions from floating drug delivery systems was introduced, which could assess the quantity of drug dissolved from dosage form in floating state. In the cases of tablets containing 20.0% BaSO4, only the 40% of total API amount could be dissolved in floating state. In vitro fine resolution X-ray CT imagings were performed to study the volume change and the voxel distributions as a function of HU attenuations by histogram analysis of the images. X-ray detected relative volume change results did not show significant difference between samples. After 24h, all tablets containing BaSO4 could be segmented, which highlighted the fact that enough BaSO4 remained in the tablets for their identification.

  1. Chromium determination in pharmaceutical grade barium sulfate by solid sampling electrothermal atomic absorption spectrometry with Zeeman-effect background correction.

    PubMed

    Bolzan, Rodrigo Cordeiro; Rodrigues, Luis Frederico; Mattos, Júlio Cezar Paz de; Dressler, Valderi Luiz; Flores, Erico Marlon de Moraes

    2007-11-15

    A procedure for chromium (Cr) determination in pharmaceutical grade barium sulfate by direct solid sampling electrothermal atomic absorption spectrometry (DSS-ET AAS) with Zeeman-effect background correction was developed. Operational conditions for the proposed procedure and the use of citric acid, ammonium phosphate, palladium and magnesium nitrate as chemical modifiers were evaluated. Pyrolysis and atomization temperatures were set at 1500 and 2400 degrees C, respectively and the use of matrix modifiers did not improve these conditions. Graphite platform presented high degradation rate, but minima changes were observed in the sensitivity or signal profile. Samples (0.3-1 mg) were weighted and introduced into the furnace using a manual solid sampling system. The linear concentration range of the calibration curve was from 100 to 1800 pg (R(2)>0.995). The characteristic mass was 7.7 pg and the limit of detection was 2.4 pg. Chromium concentration in commercial samples ranged from 0.45 to 1.06 microg g(-1) and these results were confirmed by standard addition method. The mean reproducibility was 12% (n=20 in a 3-day period) and repeatability was less than 9%. Results obtained using inductively coupled plasma optical emission spectrometry and conventional electrothermal atomic absorption spectrometry after extraction with HNO3 were around 20% lower than those obtained by the proposed procedure. It was assumed that the low results were due to incomplete extraction even using hard conditions related to temperature and pressure. The proposed procedure by DSS-ET AAS provided some advantages related to recommended pharmacopoeias methodology, as lower risks of contamination and analyte losses, higher specificity, accuracy and sensitivity, no toxic or unstable reagents are required, and calibration with aqueous standards was feasible.

  2. Salting out of proteins using ammonium sulfate precipitation.

    PubMed

    Duong-Ly, Krisna C; Gabelli, Sandra B

    2014-01-01

    Protein solubility is affected by ions. At low ion concentrations (<0.5 M), protein solubility increases along with ionic strength. Ions in the solution shield protein molecules from the charge of other protein molecules in what is known as 'salting-in'. At a very high ionic strength, protein solubility decreases as ionic strength increases in the process known as 'salting-out'. Thus, salting out can be used to separate proteins based on their solubility in the presence of a high concentration of salt. In this protocol, ammonium sulfate will be added incrementally to an E. coli cell lysate to isolate a recombinantly over-expressed protein of 20 kDa containing no cysteine residues or tags.

  3. Selective precipitation and purification of monovalent proteins using oligovalent ligands and ammonium sulfate.

    PubMed

    Mirica, Katherine A; Lockett, Matthew R; Snyder, Phillip W; Shapiro, Nathan D; Mack, Eric T; Nam, Sarah; Whitesides, George M

    2012-02-15

    This paper describes a method for the selective precipitation and purification of a monovalent protein (carbonic anhydrase is used as a demonstration) from cellular lysate using ammonium sulfate and oligovalent ligands. The oligovalent ligands induce the formation of protein-ligand aggregates, and at an appropriate concentration of dissolved ammonium sulfate, these complexes precipitate. The purification involves three steps: (i) the removal of high-molecular-weight impurities through the addition of ammonium sulfate to the crude cell lysate; (ii) the introduction of an oligovalent ligand and the selective precipitation of the target protein-ligand aggregates from solution; and (iii) the removal of the oligovalent ligand from the precipitate by dialysis to release the target protein. The increase of mass and volume of the proteins upon aggregate formation reduces their solubility, and results in the selective precipitation of these aggregates. We recovered human carbonic anhydrase, from crude cellular lysate, in 82% yield and 95% purity with a trivalent benzene sulfonamide ligand. This method provides a chromatography-free strategy of purifying monovalent proteins--for which appropriate oligovalent ligands can be synthesized--and combines the selectivity of affinity-based purification with the convenience of salt-induced precipitation.

  4. Selective Precipitation and Purification of Monovalent Proteins Using Oligovalent Ligands and Ammonium Sulfate

    PubMed Central

    Mirica, Katherine A.; Lockett, Matthew R.; Snyder, Phillip W.; Shapiro, Nathan D.; Mack, Eric T.; Nam, Sarah; Whitesides, George M.

    2012-01-01

    This paper describes a method for the selective precipitation and purification of a monovalent protein (carbonic anhydrase is used as a demonstration) from cellular lysate using ammonium sulfate and oligovalent ligands. The oligovalent ligands induce the formation of protein-ligand aggregates, and at an appropriate concentration of dissolved ammonium sulfate, these complexes precipitate. The purification involves three steps: i) the removal of high-molecular weight impurities through the addition of ammonium sulfate to the crude cell lysate; ii) the introduction of an oligovalent ligand and the selective precipitation of the target protein-ligand aggregates from solution; and iii) the removal of the oligovalent ligand from the precipitate by dialysis to release the target protein. The increase of mass and volume of the proteins upon aggregate formation reduces their solubility, and results in the selective precipitation of these aggregates. We recovered human carbonic anhydrase, from crude cellular lysate, in 82% yield and 95% purity with a trivalent benzene sulfonamide ligand. This method provides a chromatography-free strategy of purifying monovalent proteins—for which appropriate oligovalent ligands can be synthesized—and combines the selectivity of affinity-based purification with the convenience of salt-induced precipitation. PMID:22188202

  5. Formulation of radiographically detectable gastrointestinal contrast agents for magnetic resonance imaging: effects of a barium sulfate additive on MR contrast agent effectiveness.

    PubMed

    Rubin, D L; Muller, H H; Young, S W

    1992-01-01

    Complete and homogeneous distribution of gastrointestinal (GI) contrast media are important factors for their effective use in computed tomography as well as in magnetic resonance (MR) imaging. A radiographic method (using fluoroscopy or spot films) could be effective for monitoring intestinal filling with GI contrast agents for MR imaging (GICMR), but it would require the addition of a radiopaque agent to most GICMR. This study was conducted to determine the minimum amount of barium additive necessary to be radiographically visible and to evaluate whether this additive influences the signal characteristics of the GICMR. A variety of barium sulfate preparations (3-12% wt/vol) were tested in dogs to determine the minimum quantity needed to make the administered agent visible during fluoroscopy and on abdominal radiographs. Solutions of 10 different potential GI contrast agents (Gd-DTPA, ferric ammonium citrate, Mn-DPDP, chromium-EDTA, gadolinium-oxalate, ferrite particles, water, mineral oil, lipid emulsion, and methylcellulose) were prepared without ("nondoped") and with ("doped") the barium sulfate additive. MR images of the solutions in tubes were obtained at 0.38 T using 10 different spin-echo pulse sequences. Region of interest (ROI) measurements of contrast agent signal intensity (SI) were made. In addition, for the paramagnetic contrast media, the longitudinal and transverse relaxivity (R1 and R2) were measured. A 6% wt/vol suspension of barium was the smallest concentration yielding adequate radiopacity in the GI tract. Except for gadolinium-oxalate, there was no statistically significant difference in SI for doped and non-doped solutions with most pulse sequences used. In addition, the doped and nondoped solutions yielded R1 and R2 values which were comparable. We conclude that barium sulfate 6% wt/vol added to MR contrast agents produces a suspension with sufficient radiodensity to be viewed radiographically, and it does not cause significant alteration in

  6. Precipitation method for barium metaborate (BaB{sub 2}O{sub 4}) synthesis from borax solution

    SciTech Connect

    Akşener, Eymen; Figen, Aysel Kantürk; Pişkin, Sabriye

    2013-12-16

    In this study, barium metaborate (BaB{sub 2}O{sub 4}, BMB) synthesis from the borax solution was carried out. BMB currently is used in production of ceramic glazes, luminophors, oxide cathodes as well as additives to pigments for aqueous emulsion paints and also β−BaB{sub 2}O{sub 4} single crystals are the best candidate for fabrication of solid-state UV lasers operating at a wavelength of 200 nm due to excellent nonlinear optical properties. In the present study, synthesis was carried out from the borax solution (Na{sub 2}B{sub 4}O{sub 7⋅}10H{sub 2}O, BDH) and barium chloride (BaCI{sub 2⋅}2H{sub 2}O, Ba) in the glass-batch reactor with stirring. The effect of, times (5-15 min), molar ratio [stoich.ration (1.0:2.0), 1.25:2.0, 1.5:2.0, 2.5:2:0, 3.0:2.0, 3.5:2.0,4.0:2.0, 5.0:2.0] and also crystallization time (2-6 hour) on the BMB yield (%) was investigated at 80 °C reaction temperature. It is found that, BMB precipitation synthesis with 90 % yield can be performed from 0.50 molar ration (BDH:Ba), under 80 °C, 15 minute, and 6 hours crystallization time. The structural properties of BMB powders were characterized by using XRD, FT-IR and DTA-TG instrumental analysis technique.

  7. PROCESS USING POTASSIUM LANTHANUM SULFATE FOR FORMING A CARRIER PRECIPITATE FOR PLUTONIUM VALUES

    DOEpatents

    Angerman, A.A.

    1958-10-21

    A process is presented for recovering plutonium values in an oxidation state not greater than +4 from fluoride-soluble fission products. The process consists of adding to an aqueous acidic solution of such plutonium values a crystalline potassium lanthanum sulfate precipitate which carries the plutonium values from the solution.

  8. Reduction and precipitation of neptunium(V) by sulfate-reducing bacteria.

    SciTech Connect

    Banaszak, J. E.; Rittmann, B. E.; Reed, D. T.

    1999-10-21

    Migration of neptunium, as NpO{sub 2}{sup +}, has been identified as a potentially important pathway for actinide release at nuclear waste repositories and existing sites of subsurface contamination. Reduction of Np(V) to Np(IV) will likely reduce its volubility, resulting in lowered subsurface migration. The ability of sulfate-reducing bacteria (SRB) to utilize Np(V) as an electron acceptor was investigated, because these bacteria are active in many anaerobic aquifers and are known to facilitate the reduction of metals and radionuclides. Pure and mixed cultures of SRB were able to precipitate neptunium during utilization of pyruvate, lactate, and hydrogen as electron donors in the presence and absence of sulfate. The neptunium in the precipitate was identified as Np(IV) using X-ray absorption near edge spectroscopy (XANES) analysis. In mixed-culture studies, the addition of hydrogen to consortia grown by pyruvate fermentation stimulated neptunium reduction and precipitation. Experiments with pure cultures of Desulfovibrio vulgaris, growing by lactate fermentation in the absence of sulfate or by sulfate reduction, confirm that the organism is active in neptunium reduction and precipitation. Based on our results, the activity of SRB in the subsurface may have a significant, and potentially beneficial, impact on actinide mobility by reducing neptunium volubility.

  9. Optimization of tetanus toxoid ammonium sulfate precipitation process using response surface methodology.

    PubMed

    Brgles, Marija; Prebeg, Pero; Kurtović, Tihana; Ranić, Jelena; Marchetti-Deschmann, Martina; Allmaier, Günter; Halassy, Beata

    2016-10-02

    Tetanus toxoid (TTd) is a highly immunogenic, detoxified form of tetanus toxin, a causative agent of tetanus disease, produced by Clostridium tetani. Since tetanus disease cannot be eradicated but is easily prevented by vaccination, the need for the tetanus vaccine is permanent. The aim of this work was to investigate the possibility of optimizing TTd purification, i.e., ammonium sulfate precipitation process. The influence of the percentage of ammonium sulfate, starting amount of TTd, buffer type, pH, temperature, and starting purity of TTd on the purification process were investigated using optimal design for response surface models. Responses measured for evaluation of the ammonium sulfate precipitation process were TTd amount (Lf/mL) and total protein content. These two parameters were used to calculate purity (Lf/mgPN) and the yield of the process. Results indicate that citrate buffer, lower temperature, and lower starting amount of TTd result in higher purities of precipitates. Gel electrophoresis combined with matrix-assisted laser desorption ionization-mass spectrometric analysis of precipitates revealed that there are no inter-protein cross-links and that all contaminating proteins have pIs similar to TTd, so this is most probably the reason for the limited success of purification by precipitation.

  10. Sulfate reduction and copper precipitation by a Citrobacter sp. isolated from a mining area.

    PubMed

    Qiu, Rongliang; Zhao, Benliang; Liu, Jinling; Huang, Xiongfei; Li, Qingfei; Brewer, Eric; Wang, Shizhong; Shi, Ning

    2009-05-30

    A strain of sulfate-reducing bacteria, designated strain 'DBM', was isolated from sediments of a mining area. Phylogenetic analysis of the 16S rRNA gene sequence of the isolate revealed that it was related to members of the genus Citrobacter, with C. AzoR-4, C. freundii, C. braakii and C. werkmanii being the most closely related species (sequence similarity up to 98%). Few studies have been done on sulfate reduction ability in Citrobacter. Electron microscopy studies showed that the morphology of the strain DBM was rod-shaped. Strain DBM reduced 10mM of sulfate completely to sulfide within 7d, and it recovered its sulfate reduction ability after 7d of aerobic growth. Furthermore, strain DBM effectively precipitated 0.40 mM copper during its growth. Elemental composition of the resulting microbial precipitate was studied using electro-dispersive X-ray spectroscopy, and it was found that the ratio of S:Cu was 1.07. The result was consistent with the formation of copper sulfide. Heavy metal precipitation by Citrobacter sp. strain DBM was a phenomenon that may be useful in the bioremediation of acid mine drainage.

  11. Novel sulfated glucomannan-barium-alginate microcapsules in islet transplantation: significantly decreased the secretion of monocyte chemotactic protein 1 and improved the activity of islet in rats.

    PubMed

    Chen, X; Zhang, L; Qi, Z; Guo, B; Zhong, L; Shen, B; Yan, Z; Zhang, J

    2009-12-01

    The sulfated glucomannan can be used to filter the heparin-binding properties of cytokines. In this study, novel sulfated glucomannan-barium-alginate (SGA) microcapsules were prepared to encapsulate islets with barium-alginate (ABa) and calcium alginate-poly-l-lysine (APA) microcapsules as controls. SD rat islets were purified as donor cells to Lewis rats that had been treated with streptozotocin. Intraperitoneal transplantation was performed with about 3000 islet equivalent (IEQ) rat. At week three after transplantation, the concentrations of monocyte chemotactic protein-1 (MCP-1), interleukin (IL)-1 beta, interferon (IFN)-gamma, and tumor necrosis factor (TNF)-alpha in intraperitoneal fluid were determined using ELISA. At week 8, the islet cell mass in the abdominal microcapsules was excised to test insulin release. The EB-FDA fluorescence staining method was used to observe the functional activity of the islet cells. Compared with ABa and APA microcapsules, SGA microcapsules showed significantly decreased MCP-1 secretion by beta-cells. Also, the concentrations of cytokines IL-1beta, IFN-gamma, and TNF-alpha were decreased significantly. The activity of the transplanted islets was significantly improved in SGA microcapsules, which shielded against cytokines better than ABa or APA microcapsules and may serve as novel method.

  12. Synthesis and properties of single domain sphere-shaped barium hexa-ferrite nano powders via an ultrasonic-assisted co-precipitation route.

    PubMed

    Liu, Junliang; Liu, Ping; Zhang, Xingkai; Pan, Dongjun; Zhang, Peng; Zhang, Ming

    2015-03-01

    To synthesize high quality barium hexa-ferrite nano powders, an ultrasonic-assisted co-precipitation method has been used and the influences of the ultrasonic technique on the particle morphologies and magnetic properties of the synthesized barium hexa-ferrite nano powders have been investigated. The results indicated that the introduction of ultrasonic energy into the co-precipitation process promoted the composition homogeneities of the co-precipitated precursors, minished their particle sizes, and exerted the additional surface barriers between the particles, which influenced both the phase formation and particle growth-up processes during the subsequent heating treatment and altered the particle sizes, size distributions and particle shapes of the final synthesized powders. The average particle sizes of the synthesized nano powders dramatically decreased from 210 nm to about 100 nm as the inputting ultrasonic power increased, while the size distribution became increasingly uniform except for a few of large particles existed as the inputting power approached to a high value. The magnetization at 1.4 T of the as-synthesized barium hexa-ferrite dramatically increased and approached to the highest value of 57.9 emu/g due to the elimination of multi-domain particles, the alleviation of particle adhesion and the evolution of particle shape from flake to quasi-sphere as well as the uniform particle size distribution as the ultrasonic assistance was employed, and slightly decreased because of the coarsening in particle sizes.

  13. Barium isotope fractionation during witherite (BaCO3) dissolution, precipitation and at equilibrium

    NASA Astrophysics Data System (ADS)

    Mavromatis, Vasileios; van Zuilen, Kirsten; Purgstaller, Bettina; Baldermann, Andre; Nägler, Thomas F.; Dietzel, Martin

    2016-10-01

    This study examines the behavior of Ba isotope fractionation between witherite and fluid during mineral dissolution, precipitation and at chemical equilibrium. Experiments were performed in batch reactors at 25 °C in 10-2 M NaCl solution where the pH was adjusted by continuous bubbling of a water saturated gas phase of CO2 or atmospheric air. During witherite dissolution no Ba isotope fractionation was observed between solid and fluid. In contrast, during witherite precipitation, caused by a pH increase, a preferential uptake of the lighter 134Ba isotopomer in the solid phase was observed. In this case, the isotope fractionation factor αwitherite-fluid is calculated to be 0.99993 ± 0.00004 (or Δ137/134Bawitherite-fluid ≈ -0.07 ± 0.04‰, 2 sd). The most interesting feature of this study, however, is that after the attainment of chemical equilibrium, the Ba isotope composition of the aqueous phase is progressively becoming lighter, indicating a continuous exchange of Ba2+ ions between witherite and fluid. Mass balance calculations indicate that the detachment of Ba from the solid is not only restricted to the outer surface layer of the solid, but affects several (∼7 unit cells) subsurface layers of the crystal. This observation comes in excellent agreement with the concept of a dynamic system at chemical equilibrium in a mineral-fluid system, denoting that the time required for the achievement of isotopic equilibrium in the witherite-fluid system is longer compared to that observed for chemical equilibrium. Overall, these results indicate that the isotopic composition of Ba bearing carbonates in natural environments may be altered due to changes in fluid composition without a net dissolution/precipitation to be observed.

  14. Removal of antimony (Sb(V)) from Sb mine drainage: biological sulfate reduction and sulfide oxidation-precipitation.

    PubMed

    Wang, Huawei; Chen, Fulong; Mu, Shuyong; Zhang, Daoyong; Pan, Xiangliang; Lee, Duu-Jong; Chang, Jo-Shu

    2013-10-01

    Antimony (Sb(V)) in Sb mine drainage has adverse effects on the receiving water environments. This study for the first time demonstrated the feasibility of using sulfate-reducing bacteria (SRB) to convert sulfate ions in SMD into sulfides that reduce Sb(V) to Sb(III) and to form complex with Sb(III) as precipitate. The principal compound in the precipitate was stibnite (Sb2S3) at pH 7 and pH 9. The Sb(V) removal mechanism is sulfate-reduction and sulfide oxidization-precipitation, different from the conventional SRB-precipitation processes for heavy metals. The Sb(V)/sulfate ratio is noted an essential parameter affecting the Sb removal efficiency from SMD.

  15. Linked redox precipitation of sulfur and selenium under anaerobic conditions by sulfate-reducing bacterial biofilms.

    PubMed

    Hockin, Simon L; Gadd, Geoffrey M

    2003-12-01

    A biofilm-forming strain of sulfate-reducing bacteria (SRB), isolated from a naturally occurring mixed biofilm and identified by 16S rDNA analysis as a strain of Desulfomicrobium norvegicum, rapidly removed 200 micro M selenite from solution during growth on lactate and sulfate. Elemental selenium and elemental sulfur were precipitated outside SRB cells. Precipitation occurred by an abiotic reaction with bacterially generated sulfide. This appears to be a generalized ability among SRB, arising from dissimilatory sulfide biogenesis, and can take place under low redox conditions and in the dark. The reaction represents a new means for the deposition of elemental sulfur by SRB under such conditions. A combination of transmission electron microscopy, environmental scanning electron microscopy, and cryostage field emission scanning electron microscopy were used to reveal the hydrated nature of SRB biofilms and to investigate the location of deposited sulfur-selenium in relation to biofilm elements. When pregrown SRB biofilms were exposed to a selenite-containing medium, nanometer-sized selenium-sulfur granules were precipitated within the biofilm matrix. Selenite was therefore shown to pass through the biofilm matrix before reacting with bacterially generated sulfide. This constitutes an efficient method for the removal of toxic concentrations of selenite from solution. Implications for environmental cycling and the fate of sulfur and selenium are discussed, and a general model for the potential action of SRB in selenium transformations is presented.

  16. Radiographic anatomy and barium sulfate contrast transit time of the gastrointestinal tract of bearded dragons (Pogona vitticeps).

    PubMed

    Grosset, Claire; Daniaux, Lise; Guzman, David Sanchez-Migallon; Weber, Ernest Scott; Zwingenberger, Allison; Paul-Murphy, Joanne

    2014-01-01

    The positive contrast gastrointestinal study is a common non-invasive diagnostic technique that does not require anesthesia and enables good visualization of the digestive tract. Radiographic anatomy and reference intervals for gastrointestinal contrast transit time in inland bearded dragons (Pogona vitticeps) were established using seven animals administered 15 ml/kg of a 35% w/v suspension of barium by esophageal gavage. Dorso-ventral and lateral radiographic views were performed at 0, 15, 30 min, 1, 2, 4, 6, 8, 12 h, and then every 12 h up to 96 h after barium administration. Gastric emptying was complete at a median time of 10 h (range 4-24 h). Median jejunum and small intestinal emptying times were 1 h (range 30 min-2 h) and 29 h (range 24-48 h), respectively. Median transit time for cecum was 10 h (range 8-12 h). Median time for contrast to reach the colon was 31 h (range 12-72 h) after administration. Results were compared to those obtained in other reptilian species. This technique appeared safe in fasted bearded dragons and would be clinically applicable in other lizard species.

  17. Depletion of abundant plant RuBisCO protein using the protamine sulfate precipitation method.

    PubMed

    Kim, Yu Ji; Lee, Hye Min; Wang, Yiming; Wu, Jingni; Kim, Sang Gon; Kang, Kyu Young; Park, Ki Hun; Kim, Yong Chul; Choi, In Soo; Agrawal, Ganesh Kumar; Rakwal, Randeep; Kim, Sun Tae

    2013-07-01

    Ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO) is the most abundant plant leaf protein, hampering deep analysis of the leaf proteome. Here, we describe a novel protamine sulfate precipitation (PSP) method for the depletion of RuBisCO. For this purpose, soybean leaf total proteins were extracted using Tris-Mg/NP-40 extraction buffer. Obtained clear supernatant was subjected to the PSP method, followed by 13% SDS-PAGE analysis of total, PS-supernatant and -precipitation derived protein samples. In a dose-dependent experiment, 0.1% w/v PS was found to be sufficient for precipitating RuBisCO large and small subunits (LSU and SSU). Western blot analysis confirmed no detection of RuBisCO LSU in the PS-supernatant proteins. Application of this method to Arabidopsis, rice, and maize leaf proteins revealed results similar to soybean. Furthermore, 2DE analyses of PS-treated soybean leaf displayed enriched protein profile for the protein sample derived from the PS-supernatant than total proteins. Some enriched 2D spots were subjected to MALDI-TOF-TOF analysis and were successfully assigned for their protein identity. Hence, the PSP method is: (i) simple, fast, economical, and reproducible for RuBisCO precipitation from the plant leaf sample; (ii) applicable to both dicot and monocot plants; and (iii) suitable for downstream proteomics analysis.

  18. Kinetics of sulfate reduction and sulfide precipitation rates in sediments of a bar-built estuary (Pescadero, California).

    PubMed

    Richards, Chandra M; Pallud, Céline

    2016-05-01

    The bar-built Pescadero Estuary in Northern California is a major fish rearing habitat, though recently threatened by near-annual fish kill events, which occur when the estuary transitions from closed to open state. The direct and indirect effects of hydrogen sulfide are suspected to play a role in these mortalities, but the spatial variability of hydrogen sulfide production and its link to fish kills remains poorly understood. Using flow-through reactors containing intact littoral sediment slices, we measured potential sulfate reduction rates, kinetic parameters of microbial sulfate reduction (Rmax, the maximum sulfate reduction rate, and Km, the half-saturation constant for sulfate), potential sulfide precipitation rates, and potential hydrogen sulfide export rates to water at four sites in the closed and open states. At all sites, the Michaelis-Menten kinetic rate equation adequately describes the utilization of sulfate by the complex resident microbial communities. We estimate that 94-96% of hydrogen sulfide produced through sulfate reduction precipitates in the sediment and that only 4-6% is exported to water, suggesting that elevated sulfide concentrations in water, which would affect fish through toxicity and oxygen consumption, cannot be responsible for fish deaths. However, the indirect effects of sulfide precipitates, which chemically deplete, contaminate, and acidify the water column during sediment re-suspension and re-oxidation in the transition from closed to open state, can be implicated in fish mortalities at Pescadero Estuary.

  19. Barium enema

    MedlinePlus

    Lower gastrointestinal series; Lower GI series; Colorectal cancer - lower GI series; Colorectal cancer - barium enema; Crohn disease - lower GI series; Crohn disease - barium enema; Intestinal blockage - lower GI series; Intestinal blockage - ...

  20. Tantalum oxide and barium sulfate as radiopacifiers in injectable calcium phosphate-poly(lactic-co-glycolic acid) cements for monitoring in vivo degradation.

    PubMed

    Hoekstra, Jan Willem M; van den Beucken, Jeroen J J P; Leeuwenburgh, Sander C G; Bronkhorst, Ewald M; Meijer, Gert J; Jansen, John A

    2014-01-01

    Monitoring the degradation of calcium phosphate-based bone substitute materials in vivo by means of noninvasive techniques (e.g., radiography) is often a problem due to the chemical resemblance of those substitutes with the mineral phase of bone. In the view of that, the present study aimed at enhancing the radiopacity of calcium phosphate cement enriched with poly(lactic-co-glycolic acid) (CPC-PLGA) microspheres, by adding tantalum oxide (Ta2O5) or the more traditional radiopacifier barium sulfate (BaSO4). The radiopacifying capacity of these radiopacifiers was first evaluated in vitro by microcomputed tomography (μCT). Thereafter, both radiopacifiers were tested in vivo using a distal femoral condyle model in rabbits, with subsequent ex vivo μCT analysis in parallel with histomorphometry. Addition of either one of the radiopacifiers proved to enhance radiopacity of CPC-PLGA in vitro. The in vivo experiment showed that both radiopacifiers did not induce alterations in biological performance compared to plain CPC-PLGA, hence both radiopacifiers can be considered safe and biocompatible. The histomorphometrical assessment of cement degradation and bone formation showed similar values for the three experimental groups. Interestingly, μCT analysis showed that monitoring cement degradation becomes feasible upon incorporation of either type of radiopacifier, albeit that BaSO4 showed more accuracy compared to Ta2O5.

  1. Influence of semi-batch operation on the precipitation of natrojarosite particles from sulfate solutions

    NASA Astrophysics Data System (ADS)

    Sandré, Anne-Laure; Gaunand, Alain

    2012-03-01

    The precipitation of natrojarosite from iron sodium sulfate solutions has been investigated at temperatures close to the atmospheric boiling point, in batch and semi-batch conditions. Semi-batch conditions make it possible to maintain a weaker iron concentration in the stirred reactor, leading to lower supersaturations, closer to those in continuous and possibly seeded MSMPRs or tanks—in series units. In these reactors, primary and secondary nucleations are few, allowing the growth of pure mono-crystalline particles of controlled size and size dispersion. Both modi operandi lead to agglomerates made of crystals of cubic habit. The surface of cauliflower-like particles from the batch modus operandi displays overlaying crystals, of size between 100 and 400 nm. The particles from the semi-batch mode, with moderate iron addition, are rougher and show bigger intergrown constitutive crystals of size up to a few microns, which denotes lesser secondary nucleation and more growth. A model is developed to characterize iron(III) and sulfate speciation with non-ideal behavior in the mother solution. It is used to compare the variations of supersaturation in the reactor between the batch and the semi-batch conditions. During the first 500 min, the supersaturation resulting from a moderate addition of iron is 10,000-10 times lower than during batch kinetics, which agrees with the reduction of secondary nucleation suggested by scanning electron micrographs. The semi-batch technique, which can be combined with the addition of support particles, is worth further work, aiming to reduce secondary nucleation and to determine the crystallite growth rate expression of natrojarosite as a function of supersaturation, using the model of solution developed in this work.

  2. NMR chemical shift pattern changed by ammonium sulfate precipitation in cyanobacterial phytochrome Cph1

    PubMed Central

    Song, Chen; Lang, Christina; Kopycki, Jakub; Hughes, Jon; Matysik, Jörg

    2015-01-01

    Phytochromes are dimeric biliprotein photoreceptors exhibiting characteristic red/far-red photocycles. Full-length cyanobacterial phytochrome Cph1 from Synechocystis 6803 is soluble initially but tends to aggregate in a concentration-dependent manner, hampering attempts to solve the structure using NMR and crystallization methods. Otherwise, the Cph1 sensory module (Cph1Δ2), photochemically indistinguishable from the native protein and used extensively in structural and other studies, can be purified to homogeneity in >10 mg amounts at mM concentrations quite easily. Bulk precipitation of full-length Cph1 by ammonium sulfate (AmS) was expected to allow us to produce samples for solid-state magic-angle spinning (MAS) NMR from dilute solutions before significant aggregation began. It was not clear, however, what effects the process of partial dehydration might have on the molecular structure. Here we test this by running solid-state MAS NMR experiments on AmS-precipitated Cph1Δ2 in its red-absorbing Pr state carrying uniformly 13C/15N-labeled phycocyanobilin (PCB) chromophore. 2D 13C–13C correlation experiments allowed a complete assignment of 13C responses of the chromophore. Upon precipitation, 13C chemical shifts for most of PCB carbons move upfield, in which we found major changes for C4 and C6 atoms associated with the A-ring positioning. Further, the broad spectral lines seen in the AmS 13C spectrum reflect primarily the extensive inhomogeneous broadening presumably due to an increase in the distribution of conformational states in the protein, in which less free water is available to partake in the hydration shells. Our data suggest that the effect of dehydration process indeed leads to changes of electronic structure of the bilin chromophore and a decrease in its mobility within the binding pocket, but not restricted to the protein surface. The extent of the changes induced differs from the freezing process of the solution samples routinely used in

  3. Acid-Sulfate Alteration at Gusev Crater and Across Mars: High-SiO2 Residues and Ferric Sulfate Precipitates

    NASA Technical Reports Server (NTRS)

    Morris, R. V.; Catalano, J. G.; Klingelhoefer, G.; Schroeder, C.; Gellert, R.; Clark, B. C.; Ming, D. W.; Yen, A. S.; Arvidson, R. E.; Cohen, B. A.; Fleischer, I.; McCoy, T. J.; Mittlefehldt, D. W.; Squyres, S. W.

    2017-01-01

    The Mars Exploration Rover Spirit ended its mission in Gusev crater on sol 2210 after it had become stuck in a deposit of fined-grained and sulfate rich soil with dust covered solar panels unfavorably pointed toward the sun. Final analysis of remaining data from Spirit's Moessbauer spectrometer (Fe redox and mineralogy) for sols 1529 through 2071 is now complete. We focus here on chemical (APXS) and MB data for targets having high-SiO2 or high-SO3 and process link the targets through mixing and geochemical modelling to an acid-sulfate system centered at Home Plate, which is considered to be a hydrovolcanic complex.

  4. Variation of Strontium (Sr) in the Ferroelectric Material Barium Strontium Titanate (Ba1-xSrxTiO3) by Co precipitation Method

    NASA Astrophysics Data System (ADS)

    Subarwanti, Y.; Safitri, R. D.; Supriyanto, A.; Iriani, Y.; Jamaludin, A.

    2017-02-01

    Barium Strontium Titanate (BST) have been made with variation strontium (Sr) 10%, 30% and 50% by co-precipitation method. This study aims to determine influence addition Sr against the crystal structure, crystallite size, lattice parameter, grain size and dielectric constant. Samples have been made by co-precipitation method and then the samples were sintered by furnace at 1100°C with holding time 4 hours. Characterization of BST use X-Ray Diffraction instrument, Scanning Electron Microscopy and Resistance Capacitance Inductance (RCL meter). Based on result obtained, the larger Sr content cause the diffraction angle shift to the right (the greater) and crystallinity increasing. But, the value of dielectric constant, crystallite size and grain size decreasing with additional Sr content. Measurement of dielectric constant (K) performed in the frequency range 1 kHz to 100 kHz and the highest value at Sr content 0.1 i.e. 258.35. The addition of Sr content 30% and 50% change the crystal structure from tetragonal to cubic which has paraelectric phase.

  5. Biodegradation of BTEX and Other Petroleum Hydrocarbons by Enhanced and Controlled Sulfate Reduction

    SciTech Connect

    Song Jin

    2007-07-01

    High concentrations of sulfide in the groundwater at a field site near South Lovedale, OK, were inhibiting sulfate reducing bacteria (SRB) that are known to degrade contaminants including benzene, toluene, ethylbenzene, and m+p-xylenes (BTEX). Microcosms were established in the laboratory using groundwater and sediment collected from the field site and amended with various nutrient, substrate, and inhibitor treatments. All microcosms were initially amended with FeCl{sub 2} to induce FeS precipitation and, thereby, reduce sulfide concentrations. Complete removal of BTEX was observed within 39 days in treatments with various combinations of nutrient and substrate amendments. Results indicate that elevated concentration of sulfide is a limiting factor to BTEX biodegradation at this site, and that treating the groundwater with FeCl{sub 2} is an effective remedy to facilitate and enhance BTEX degradation by the indigenous SRB population. On another site in Moore, OK, studies were conducted to investigate barium in the groundwater. BTEX biodegradation by SRB is suspected to mobilize barium from its precipitants in groundwater. Data from microcosms demonstrated instantaneous precipitation of barium when sulfate was added; however, barium was detected redissolving for a short period and precipitating eventually, when active sulfate reduction was occurring and BTEX was degraded through the process. SEM elemental spectra of the evolved show that sulfur was not present, which may exclude BaSO{sub 4} and BaS as a possible precipitates. The XRD analysis suggests that barium probably ended in BaS complexing with other amorphous species. Results from this study suggest that SRB may be able to use the sulfate from barite (BaSO{sub 4}) as an electron acceptor, resulting in the release of free barium ions (Ba{sup 2+}), and re-precipitate it in BaS, which exposes more toxicity to human and ecological health.

  6. Influence of sodium dodecyl sulfate and static magnetic field on the properties of freshly precipitated calcium carbonate.

    PubMed

    Chibowski, Emil; Szczes, Aleksandra; Holysz, Lucyna

    2005-08-30

    Properties of calcium carbonate precipitated from aqueous solutions of CaCl(2) and Na(2)CO(3) in the presence of sodium dodecyl sulfate (SDS) and S-S 0.1 T magnetic field (MF) were studied. The nucleation and precipitation processes of CaCO(3) were investigated by pH and zeta potential measurements at 20 +/- 1 degrees C up to 2 h after mixing the solutions. Also the amounts of calcium carbonate deposited on the glass surfaces and its structure were examined. It was found that SDS influences the kinetics of precipitation, crystallographic forms, and crystal size of CaCO(3). The SDS effects are more pronounced in MF presence. A small amount of SDS accelerates transformation of vaterite into calcite, whereas increasing surfactant concentration moderates such a transformation. On the other hand, in all the systems, MF in the presence of SDS causes a slower transformation of vaterite into calcite. These effects are reflected in pH and zeta potential changes, although there is no clear dependence between the SDS amount present during the precipitation and changes of the parameters investigated. It seems that MF effect is most significant at a defined optimal SDS concentration. The results, however, do not allow suggestion of any detailed mechanism of the field interaction.

  7. Characterization of a Marine Microbial Community Used for Enhanced Sulfate Reduction and Copper Precipitation in a Two-Step Process.

    PubMed

    García-Depraect, Octavio; Guerrero-Barajas, Claudia; Jan-Roblero, Janet; Ordaz, Alberto

    2016-11-23

    Marine microorganisms that are obtained from hydrothermal vent sediments present a great metabolic potential for applications in environmental biotechnology. However, the work done regarding their applications in engineered systems is still scarce. Hence, in this work, the sulfate reduction process carried out by a marine microbial community in an upflow anaerobic sludge blanket (UASB) reactor was investigated for 190 days under sequential batch mode. The effects of 1000 to 5500 mg L(-1) of SO4(-2) and the chemical oxygen demand (COD)/SO4(-2) ratio were studied along with a kinetic characterization with lactate as the electron donor. Also, the feasibility of using the sulfide produced in the UASB for copper precipitation in a second column was studied under continuous mode. The system presented here is an alternative to sulfidogenesis, particularly when it is necessary to avoid toxicity to sulfide and competition with methanogens. The bioreactor performed better with relatively low concentrations of sulfate (up to 1100 mg L(-1)) and COD/SO4(-2) ratios between 1.4 and 3.6. Under the continuous regime, the biogenic sulfide was sufficient to precipitate copper at a removal rate of 234 mg L(-1) day(-1). Finally, the identification of the microorganisms in the sludge was carried out; some genera of microorganisms identified were Desulfitobacterium and Clostridium.

  8. Metal and acidity fluxes controlled by precipitation/dissolution cycles of sulfate salts in an anthropogenic mine aquifer

    NASA Astrophysics Data System (ADS)

    Cánovas, C. R.; Macías, F.; Pérez-López, R.

    2016-05-01

    Underground mine drainages are extremely difficult to study due to the lack of information about the flow path and source proximity in relation to the outflow adit. Geochemical processes controlling metals and acidity fluxes in a complex anthropogenic mine aquifer in SW Spain during the dry and rainy season were investigated by geochemical and statistical tools. High concentrations of acidity, sulfate, metals and metalloids (e.g. Fe, Cu, Zn, As, Cd, Ni, Co) were observed due to intense sulfide oxidation processes. The high residence time inside the anthropogenic aquifer, around 40 days, caused the release of significant quantities of metals linked to host rocks (e.g. Al, Ca, Ge, Li, Mg, REE). The most outstanding characteristic of the acid mine drainage (AMD) outflows is the existence of higher Fe/SO4 molar ratios than those theoretical of pyrite (0.50) during most of the monitored period, due to a fire which occurred in 1949 and remained active for decades. Permanent and temporal retention mechanisms of acidity and metals were observed in the galleries. Once released from sulfide oxidation, Pb and As are sorbed on Fe oxyhydroxysulfate or precipitated as low solubility minerals (i.e. anglesite) inside the galleries. The precipitation of evaporitic sulfate salts during the dry season and the subsequent re-dissolution after rainfall control the fluxes of acidity and main metals (i.e. Fe, Mg, Al) from this anthropogenic aquifer. Some elements, such as Cd, Cu, Ni, REE and Zn, are retained in highly soluble sulfate salts while other elements, such as Ge, Pb and Sc, have a lower response to washout processes due to its incorporation in less soluble sulfate salts. In this way, metal concentration during the washout processes would be controlled by the proportion and solubility of each type of evaporitic sulfate salt stored during the dry season. The recovery of metals of economic interest contained in the AMD could help to self-finance the remediation of these waters in

  9. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.

    PubMed

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly

    2013-01-01

    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping.

  10. Barium cyanide

    Integrated Risk Information System (IRIS)

    Barium cyanide ; CASRN 542 - 62 - 1 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic Ef

  11. [Serodiagnosis of schistosomiasis mansoni using an egg extract semi-purified by precipitation with ammonium sulfate].

    PubMed

    Ouattara, S A; Sauneron, M F; Tribouley-Duret, J; Tribouley, J

    1986-01-01

    Fifty one sera from bilharziosis patients and thirty control sera were examined with a Schistosoma mansoni egg antigen purified by precipitation with ammonium sulphate at 50% saturation. Sensitivity and specificity were good and showed a good correlation with results obtained by MSA1 antigen, but antigen tested is far more easier to prepare than MSA1.

  12. Biologically-Induced Precipitation of Minerals in a Medium with Zinc Under Sulfate-Reducing Conditions.

    PubMed

    Wolicka, Dorota; Borkowski, Andrzej; Jankiewicz, Urszula; Stępień, Wojciech; Kowalczyk, Paweł

    2015-01-01

    Sulfate-reducing microbial communities were enriched from soils collected in areas with crude-oil exploitation. Cultures were grown in modified Postgate C medium and minimal medium, with ethanol or lactate as an electron donor. The batch cultures were grown with addition of zinc in concentrations of 100-700 mg/l. A lack of increased protein concentration in the solutions compared with the control batch, was noted in cultures containing over 200 mg Zn2+/l. The 16S rRNA method was applied to determine the specific composition of the selected microorganism communities. The analysis indicated the presence of Desulfovibrio spp., Desulfobulbus spp. and Desulfotomaculum spp. in the communities. Diffractometric analysis indicated the presence of biogenic sphalerite in cultures with 100 and 200 mg Zn2+/l and elemental sulfur in cultures with 200 mg Zn2+/l. Other post culture sediments (300-700 mg Zn2+/l) contained only hopeite [Zn3(PO4)2·4H2O] formed abiotically during the experiment, which was confirmed by studies of the activity of sulfate-reducing microbial communities.

  13. Selectivity in biomineralization of barium and strontium.

    PubMed

    Krejci, Minna R; Wasserman, Brian; Finney, Lydia; McNulty, Ian; Legnini, Daniel; Vogt, Stefan; Joester, Derk

    2011-11-01

    The desmid green alga Closterium moniliferum belongs to a small number of organisms that form barite (BaSO(4)) or celestite (SrSO(4)) biominerals. The ability to sequester Sr in the presence of an excess of Ca is of considerable interest for the remediation of (90)Sr from the environment and nuclear waste. While most cells dynamically regulate the concentration of the second messenger Ca(2+) in the cytosol and various organelles, transport proteins rarely discriminate strongly between Ca, Sr, and Ba. Herein, we investigate how these ions are trafficked in C. moniliferum and how precipitation of (Ba,Sr)SO(4) crystals occurs in the terminal vacuoles. Towards this goal, we simultaneously visualize intracellular dynamics of multiple elements using X-ray fluorescence microscopy (XFM) of cryo-fixed/freeze-dried samples. We correlate the resulting elemental maps with ultrastructural information gleaned from freeze-fracture cryo-SEM of frozen-hydrated cells and use micro X-ray absorption near edge structure (micro-XANES) to determine sulfur speciation. We find that the kinetics of Sr uptake and efflux depend on external Ca concentrations, and Sr, Ba, and Ca show similar intracellular localization. A highly ion-selective cross-membrane transport step is not evident. Based on elevated levels of sulfate detected in the terminal vacuoles, we propose a "sulfate trap" model, where the presence of dissolved barium leads to preferential precipitation of (Ba,Sr)SO(4) due to its low solubility relative to SrSO(4) and CaSO(4). Engineering the sulfate concentration in the vacuole may thus be the most direct way to increase the Sr sequestered per cell, an important consideration in using desmids for phytoremediation of (90)Sr.

  14. Dissolution-precipitation processes in tank experiments for testing numerical models for reactive transport calculations: Experiments and modelling

    NASA Astrophysics Data System (ADS)

    Poonoosamy, Jenna; Kosakowski, Georg; Van Loon, Luc R.; Mäder, Urs

    2015-06-01

    In the context of testing reactive transport codes and their underlying conceptual models, a simple 2D reactive transport experiment was developed. The aim was to use simple chemistry and design a reproducible and fast to conduct experiment, which is flexible enough to include several process couplings: advective-diffusive transport of solutes, effect of liquid phase density on advective transport, and kinetically controlled dissolution/precipitation reactions causing porosity changes. A small tank was filled with a reactive layer of strontium sulfate (SrSO4) of two different grain sizes, sandwiched between two layers of essentially non-reacting quartz sand (SiO2). A highly concentrated solution of barium chloride was injected to create an asymmetric flow field. Once the barium chloride reached the reactive layer, it forced the transformation of strontium sulfate into barium sulfate (BaSO4). Due to the higher molar volume of barium sulfate, its precipitation caused a decrease of porosity and lowered the permeability. Changes in the flow field were observed with help of dye tracer tests. The experiments were modelled using the reactive transport code OpenGeosys-GEM. Tests with non-reactive tracers performed prior to barium chloride injection, as well as the density-driven flow (due to the high concentration of barium chloride solution), could be well reproduced by the numerical model. To reproduce the mineral bulk transformation with time, two populations of strontium sulfate grains with different kinetic rates of dissolution were applied. However, a default porosity permeability relationship was unable to account for measured pressure changes. Post mortem analysis of the strontium sulfate reactive medium provided useful information on the chemical and structural changes occurring at the pore scale at the interface that were considered in our model to reproduce the pressure evolution with time.

  15. Dissolution-precipitation processes in tank experiments for testing numerical models for reactive transport calculations: Experiments and modelling.

    PubMed

    Poonoosamy, Jenna; Kosakowski, Georg; Van Loon, Luc R; Mäder, Urs

    2015-01-01

    In the context of testing reactive transport codes and their underlying conceptual models, a simple 2D reactive transport experiment was developed. The aim was to use simple chemistry and design a reproducible and fast to conduct experiment, which is flexible enough to include several process couplings: advective-diffusive transport of solutes, effect of liquid phase density on advective transport, and kinetically controlled dissolution/precipitation reactions causing porosity changes. A small tank was filled with a reactive layer of strontium sulfate (SrSO4) of two different grain sizes, sandwiched between two layers of essentially non-reacting quartz sand (SiO2). A highly concentrated solution of barium chloride was injected to create an asymmetric flow field. Once the barium chloride reached the reactive layer, it forced the transformation of strontium sulfate into barium sulfate (BaSO4). Due to the higher molar volume of barium sulfate, its precipitation caused a decrease of porosity and lowered the permeability. Changes in the flow field were observed with help of dye tracer tests. The experiments were modelled using the reactive transport code OpenGeosys-GEM. Tests with non-reactive tracers performed prior to barium chloride injection, as well as the density-driven flow (due to the high concentration of barium chloride solution), could be well reproduced by the numerical model. To reproduce the mineral bulk transformation with time, two populations of strontium sulfate grains with different kinetic rates of dissolution were applied. However, a default porosity permeability relationship was unable to account for measured pressure changes. Post mortem analysis of the strontium sulfate reactive medium provided useful information on the chemical and structural changes occurring at the pore scale at the interface that were considered in our model to reproduce the pressure evolution with time.

  16. Low-Sulfate Seawater Injection into Oil Reservoir to Avoid Scaling Problem

    NASA Astrophysics Data System (ADS)

    Merdhah, Amer Badr Bin; Mohd Yassin, Abu Azam

    This study presents the results of laboratory experiments carried out to investigate the formation of calcium, strontium and barium sulfates from mixing Angsi seawater or low sulfate seawater with the following sulfate contents (75, 50, 25, 5 and 1%) and formation water contain high concentration of calcium, strontium and barium ions at various temperatures (40-90°C) and atmospheric pressure. The knowledge of solubility of common oil field scale formation and how their solubilities are affected by changes in salinity and temperatures is also studied. Results show a large of precipitation occurred in all jars containing seawater while the amount of precipitation decreased when the low sulfate seawater was used. At higher temperatures the mass of precipitation of CaSO4 and SrSO4 scales increases and the mass of precipitation of BaSO4 scale decreases since the solubilities of CaSO4 and SrSO4 scales decreases and the solubility of BaSO4 increases with increasing temperature. It can be concluded that even at sulfate content of 1% there may still be a scaling problem.

  17. Experimental analysis of arsenic precipitation during microbial sulfate and iron reduction in model aquifer sediment reactors

    NASA Astrophysics Data System (ADS)

    Kirk, Matthew F.; Roden, Eric E.; Crossey, Laura J.; Brealey, Adrian J.; Spilde, Michael N.

    2010-05-01

    Microbial SO 42- reduction limits accumulation of aqueous As in reducing aquifers where the sulfide that is produced forms minerals that sequester As. We examined the potential for As partitioning into As- and Fe-sulfide minerals in anaerobic, semi-continuous flow bioreactors inoculated with 0.5% (g mL -1) fine-grained alluvial aquifer sediment. A fluid residence time of three weeks was maintained over a ca. 300-d incubation period by replacing one-third of the aqueous phase volume of the reactors with fresh medium every seven days. The medium had a composition comparable to natural As-contaminated groundwater with slightly basic pH (7.3) and 7.5 μM aqueous As(V) and also contained 0.8 mM acetate to stimulate microbial activity. Medium was delivered to a reactor system with and without 10 mmol L -1 synthetic goethite (α-FeOOH). In both reactors, influent As(V) was almost completely reduced to As(III). Pure As-sulfide minerals did not form in the Fe-limited reactor. Realgar (As 4S 4) and As 2S 3(am) were undersaturated throughout the experiment. Orpiment (As 2S 3) was saturated while sulfide content was low (˜50 to 150 μM), but precipitation was likely limited by slow kinetics. Reaction-path modeling suggests that, even if these minerals had formed, the dissolved As content of the reactor would have remained at hazardous levels. Mackinawite (Fe 1 + xS; x ⩽ 0.07) formed readily in the Fe-bearing reactor and held dissolved sulfide at levels below saturation for orpiment and realgar. The mackinawite sequestered little As (<0.1 wt.%), however, and aqueous As accumulated to levels above the influent concentration as microbial Fe(III) reduction consumed goethite and mobilized adsorbed As. A relatively small amount of pyrite (FeS 2) and greigite (Fe 3S 4) formed in the Fe-bearing reactor when we injected a polysulfide solution (Na 2S 4) to a final concentration of 0.5 mM after 216, 230, 279, and 286 days. The pyrite, and to a lesser extent the greigite, that formed

  18. Barium enema (image)

    MedlinePlus

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  19. Experimental and numerical analysis of parallel reactant flow and transverse mixing with mineral precipitation in homogeneous and heterogeneous porous media

    SciTech Connect

    Fox, Don T.; Guo, Luanjing; Fujita, Yoshiko; Huang, Hai; Redden, George

    2015-12-17

    Formation of mineral precipitates in the mixing interface between two reactant solutions flowing in parallel in porous media is governed by reactant mixing by diffusion and dispersion and is coupled to changes in porosity/permeability due to precipitation. The spatial and temporal distribution of mixing-dependent precipitation of barium sulfate in porous media was investigated with side-by-side injection of barium chloride and sodium sulfate solutions in thin rectangular flow cells packed with quartz sand. The results for homogeneous sand beds were compared to beds with higher or lower permeability inclusions positioned in the path of the mixing zone. In the homogeneous and high permeability inclusion experiments, BaSO4 precipitate (barite) formed in a narrow deposit along the length and in the center of the solution–solution mixing zone even though dispersion was enhanced within, and downstream of, the high permeability inclusion. In the low permeability inclusion experiment, the deflected BaSO4 precipitation zone broadened around one side and downstream of the inclusion and was observed to migrate laterally toward the sulfate solution. A continuum-scale fully coupled reactive transport model that simultaneously solves the nonlinear governing equations for fluid flow, transport of reactants and geochemical reactions was used to simulate the experiments and provide insight into mechanisms underlying the experimental observations. Lastly, migration of the precipitation zone in the low permeability inclusion experiment could be explained by the coupling effects among fluid flow, reactant transport and localized mineral precipitation reaction.

  20. [The role of cellular mediators in the development of the phenomenon of inhibition induced by barium sulfate luminol-dependent chemiluminescence of blood under the influence of non-steroidal anti-inflammatory drugs in patients with intolerance to these drugs].

    PubMed

    Chausova, S V; Gurevich, K G; Bondareva, G P; Filatov, O Ju; Malyshev, I Y

    2015-01-01

    We investigated contribution mediator mechanism in the development of the phenomenon of inhibition induced by barium sulfate luminol-dependent chemiluminescence (SLCHL) of blood under the influence of nonsteroidal anti-inflammatory drugs (NSAIDs) in patients with intolerance to these drugs. It was found that the phenomenon of suppression SLCHL blood under the influence of NSAIDs in patients with intolerance is mediated by the participation of mediators, and the contribution of H1--and H2--histamine receptors, 5-HT2 serotonin receptors and Cys-leukotriene receptors in the development of that phenomenon depends on the chemical nature of NSAIDs and the clinical manifestations of intolerance.

  1. Low sulfate seawater mitigates barite scale

    SciTech Connect

    Hardy, J.A.; Simm, I.

    1996-12-09

    Low-sulfate seawater (LSSW) technology provides operational and economic benefits for desulfating seawater to control barium sulfate (BaSO{sub 4}) and strontium sulfate (SrSO{sub 4}) scale. This concluding article in a three part series describes, from a scale control perspective, the membrane technology deployed in the North Sea Brae fields.

  2. Stabilization of arsenic- and barium-rich glass manufacturing waste

    SciTech Connect

    Fuessle, R.W.; Taylor, M.A.

    2000-03-01

    Effective solidification/stabilization (S/S) of arsenic- and barium-containing D004/D005 waste was accomplished by using a binder of cement with 40% class C fly ash and either ferrous sulfate or ferric sulfate as an additive. Addition of iron salts improves arsenic solidification/stabilization (S/S). Barium may be encapsulated within the stabilized matrix as barium sulfate. Recommended mole ratios for iron/arsenic and barium/sulfate are at least 6 and 1.2, respectively. A binder/waste ratio of 0.15 is volume efficient, but the mix design must be carefully controlled to achieve adequate S/S. In practice, the heterogeneity of waste and large-scale mix operations may preclude close control of reagent dosages, so a binder/waste ratio of 0.40 is preferable. Ferrous sulfate additive is preferable for arsenic S/S because it is effective over a wider range of mix designs and over a long-term curing period. Toxicity characteristic leaching procedure results degraded with long curing time for some mix designs with ferric sulfate additive.

  3. Bacterial sulfate reduction is the driving force for dolomite precipitation: New insights from CAS contents and δ34SCAS signatures of sedimentary dolomites

    NASA Astrophysics Data System (ADS)

    Baldermann, Andre; Mavromatis, Vasileios; Strauss, Harald; Dietzel, Martin

    2016-04-01

    Recent advances in the understanding of the underlying reaction pathways and environmental controls inducing the precipitation of dolomite in mostly marine and early diagenetic sedimentary environments suggest that bacterial activity and bacterial sulfate reduction are key processes during the dolomitization of magnesian CaCO3 precursors at ambient temperatures [1]. However, in evaporitic and marine-anoxic, organic-rich sediments the precipitating dolomite is usually non-stoichiometric, highly disordered and metastable and is thus often referred to as (proto)dolomite. Subsequent multiple recrystallization of the (proto)dolomite during burial diagenesis is currently suggested to result in a more stable (stoichiometric and ordered) type of dolomite. On the basis of (micro)textural and (isotope)geochemical signatures of pure dolostone and partly dolomitized platform carbonates exposed in the Upper Jurassic rock succession at Oker (Northern German Basin), we highlight here the important role of bacterial sulfate reduction on the formation of sedimentary dolomite. Our results indicate that the Oker dolomite has been formed by the early diagenetic replacement of pre-existing magnesian calcite and aragonite precursors through reaction with pristine-marine to slightly evaporitic and reducing seawater at temperatures between 26 °C and 37 °C. The elevated δ34SCAS values, from +17.9 to +19.7 ‰ (V-CDT), of the Oker dolomite, relative to the ambient Upper Jurassic seawater, indicate that bacterial sulfate reduction was active during dolomite precipitation. Moreover, the linear anti-correlation (R² = 0.98) between decreasing CAS content (~1000-2000 ppm) in dolomite and increasing degree of cation order (~0.35 to 0.50) of the dolomite lattice structure suggests that, besides temperature and diagenetically driven recrystallization events, incorporation of CAS during co-precipitation of dolomite significantly affects the composition, structure and stability of modern and

  4. Extraction and characterization of lignin from oil palm biomass via ionic liquid dissolution and non-toxic aluminium potassium sulfate dodecahydrate precipitation processes.

    PubMed

    Mohtar, S S; Tengku Malim Busu, T N Z; Md Noor, A M; Shaari, N; Yusoff, N A; Bustam Khalil, M A; Abdul Mutalib, M I; Mat, H B

    2015-09-01

    The objective of this study is to extract and characterize lignin from oil palm biomass (OPB) by dissolution in 1-butyl-3-methylimidazolium chloride ([bmim][Cl]), followed by the lignin extraction through the CO2 gas purging prior to addition of aluminum potassium sulfate dodecahydrate (AlK(SO4)2 · 12H2O). The lignin yield, Y(L) (%wt.) was found to be dependent of the types of OPB observed for all precipitation methods used. The lignin recovery, RL (%wt.) obtained from CO2-AlK(SO4)2 · 12H2O precipitation was, however dependent on the types of OPB, which contradicted to that of the acidified H2SO4 and HCl solutions of pH 0.7 and 2 precipitations. Only about 54% of lignin was recovered from the OPB. The FTIR results indicate that the monodispersed lignin was successfully extracted from the OPT, OPF and OPEFB having a molecular weight (MW) of 1331, 1263 and 1473 g/mol, and degradation temperature of 215, 207.5 and 272 °C, respectively.

  5. HDL cholesterol quantitation by phosphotungstate-Mg2+ and by dextran sulfate-Mn2+-polyethylene glycol precipitation, both with enzymic cholesterol assay compared with the lipid research method.

    PubMed

    Warnick, G R; Mayfield, C; Benderson, J; Chen, J S; Albers, J J

    1982-11-01

    Two methods using commercial kits for high density lipoprotein (HDL) cholesterol quantitation were compared with the Lipid Research Clinics (LRC) procedures. HDL cholesterol quantitations on 50 patient specimens by the Lancer HDL cholesterol Rapid Stat Kit (Lancer) with phosphotungstate-Mg2+ precipitation and enzymic cholesterol assay averaged 424 mg/L, and by a method with dextran sulfate-Mn2+-polyethylene glycol (dextran sulfate) precipitation and enzymic cholesterol assay averaged 474 mg/L. By comparison, the LRC method (heparin-Mn2+ precipitation combined with a Liebermann-Burchard reagent cholesterol assay) averaged 478 mg/L. Supernates obtained by the three precipitation methods had similar cholesterol values when analyzed by the LRC assay, suggesting that the observed differences were primarily due to differences between the cholesterol assays. Results were consistent with underestimation by the enzymic assay of cholesterol in the supernates, offset by a positive interference of Mn2+ in the dextran sulfate-produced supernates. Among-day CVs of 4-5% were observed for the Lancer method, and 6-7% for the dextran sulfate method. Sedimentation of precipitates in hypertriglyceridemic specimens was excellent by both methods.

  6. Skid-mounted sodium sulfide/ferrous sulfate metal precipitation project. Phase 1. Final report, June 1991-October 1992

    SciTech Connect

    Harrington-Baker, M.A.; Wikoff, P.M.; Rademacher, E.J.; Suiciu, D.; Prescott, D.

    1995-06-01

    The objective of this Phase I research project was to develop the data and design criteria necessary to design and test the skid-mounted sodium sulfide/ferrous sulfate process for small point-source wastewater generators throughout the Air Force. The work done included a paper survey of three Air Logistics Centers (ALCs) Columbus AFB, MS, and Wright-Patterson AFB, OH; laboratory testing of two Columbus AFB wastestreams; and design and construction of the mobile wastetreatment unit. Results from Columbus AFB show the process is capable of removing heavy metals from the tested wastestream to discharge standards. However, there were organic constituents in the Columbus AFB wastestream that this process would not remove and therefore would prevent discharge.The mobile unit was not tested; testing is planned for Phase II.

  7. Barium bright and heavy

    NASA Astrophysics Data System (ADS)

    Fromm, Katharina M.

    2013-02-01

    Katharina M. Fromm relates how barium and its ores went from a magical, glowing species that attracted witches and alchemists to components in a variety of compounds that are key parts of modern life.

  8. Optimized Photorefractive Barium Titanate

    DTIC Science & Technology

    1992-03-11

    potassium dihydrogen phosphate (KDP), 6 and barium sodium niobate Ba2 NaNbsO%1 ,7 were examined. Unfortu- nately, the high optical intensities required for...Phys. Lett., 15, 210 (1969) 14. J. J. Amodei. D. L. Staebler. and A. W. Stephens, "Holographic Storage in Doped Barium Sodium Niobate ". Appl. Phys...equipped with precise computer control of the pulling and rotation system. The cylindrical furnace was found to be susceptible to cracking due to

  9. An in situ XAS study of ferric iron hydrolysis and precipitation in the presence of perchlorate, nitrate, chloride and sulfate

    NASA Astrophysics Data System (ADS)

    Collins, Richard N.; Rosso, Kevin M.; Rose, Andrew L.; Glover, Chris J.; David Waite, T.

    2016-03-01

    Using a novel combination of in situ potentiometric experiments and quick-scanning XAS we present Fe K-edge XAS spectra (to k = 12 Å-1) during FeIII hydrolysis and precipitation in 0.33 M Fe(ClO4)3, Fe(NO3)3, FeCl3 and Fe2(SO4)3 solutions up to pH 4.8. Edge-sharing FeIII polymers appeared almost immediately upon hydrolysis with strong evidence for a μ-oxo dimer species forming in the Fe(ClO4)3, Fe(NO3)3 and FeCl3 solutions. The effects of SO4 on hydrolysis and polymerization pathways included inhibition of both the formation of the μ-oxo dimer and double corner FeIII bonding, ultimately resulting in the precipitation of schwertmannite. As such, under these experimental conditions, double corner FeIII bonding appears to be critical to the formation of ferrihydrite. The spectral trends indicated that the decomposition/transformation of the dimer was sudden and broadly coincident with shortening average Fe-O bond distances, increased Fe neighbors at ∼3.43 Å and a pre-edge energy transformation suggestive of decreased ligand field strength as well as increasing proportions of tetrahedral FeIII. This result suggests that the incorporation of tetrahedral FeIII into ferrihydrite occurs only at the latter stages of extended polymerization.

  10. Production of a Pseudomonas lipase in n-alkane substrate and its isolation using an improved ammonium sulfate precipitation technique.

    PubMed

    Kanwar, Lambit; Gogoi, Binod Kumar; Goswami, Pranab

    2002-09-01

    Among the various lipidic and non-lipidic substances, normal alkanes within the chain lengths of C-12 to C-20 served as the best carbon substrates for the production of extracellular lipase by Pseudomonas species G6. Maximum lipase production of 25 U/ml of the culture broth was obtained by using n-hexadecane as the sole carbon substrate. The optimum pH of 8 and temperature of 34 + 1 degrees C were demonstrated for the production of lipase in n-hexadecane substrate. The optimum concentration of iron, which played a critical role on the lipase production, was found to be 0.25 mg/l. Lipase production could be enhanced to nearly 2.4-fold by using tributyrin at a concentration of 0.05% (v/v) in the culture medium. High recovery of the lipase protein (83%) from the culture broth was achieved by treating the culture supernatant with Silicone 21 Defoamer followed by ammonium sulfate (60% saturation) fractionation.

  11. Precipitation and Characterization of Arsenate Phases from Calcium-Copper-Iron-Arsenic Oxide-Sulfate Hydrothermal Systems

    NASA Astrophysics Data System (ADS)

    Gomez, Mario Alberto

    The scope of this thesis is the study of three Fe(III)-As(V) hydrothermal systems. The first one is the Fe(III)-AsO4-SO 4 system and crystalline phases that are produced under high temperature (150-225°C); this was studied to clear up previous contradicting information on this system in relation to industrial arsenic products that are formed during the autoclave processing of arsenical sulphide gold feedstocks and asses their arsenic stability. The second system studied was Cu(II)-Fe(III)-AsO 4-SO4 system at 150°C; this was investigated due to its relevance to industrial pressure leaching of copper concentrates. This system was studied in order to examine the possible effect of copper on the precipitation of scorodite. Finally, the structural and molecular examination of two members of the Ca(II)-Fe(III)-AsO4 system, namely yukonite (synthetic and natural and arseniosiderite was undertaken due to their relatively unknown nature and the potential role play in controlling arsenic release in tailings.

  12. Observed Barium Emission Rates

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.

    1993-01-01

    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  13. Radioactive mineral spring precipitates, their analytical and statistical data and the uranium connection

    USGS Publications Warehouse

    Cadigan, R.A.; Felmlee, J.K.

    1982-01-01

    Major radioactive mineral springs are probably related to deep zones of active metamorphism in areas of orogenic tectonism. The most common precipitate is travertine, a chemically precipitated rock composed chiefly of calcium carbonate, but also containing other minerals. The mineral springs are surface manifestations of hydrothermal conduit systems which extend downward many kilometers to hot source rocks. Conduits are kept open by fluid pressure exerted by carbon dioxide-charged waters rising to the surface propelled by heat and gas (CO2 and steam) pressure. On reaching the surface, the dissolved carbon dioxide is released from solution, and calcium carbonate is precipitated. Springs also contain sulfur species (for example, H2S and HS-), and radon, helium and methane as entrained or dissolved gases. The HS- ion can react to form hydrogen sulfide gas, sulfate salts, and native sulfur. Chemical salts and native sulfur precipitate at the surface. The sulfur may partly oxidize to produce detectable sulfur dioxide gas. Radioactivity is due to the presence of radium-226, radon-222, radium-228, and radon-220, and other daughter products of uranium-238 and thorium-232. Uranium and thorium are not present in economically significant amounts in most radioactive spring precipitates. Most radium is coprecipitated at the surface with barite. Barite (barium sulfate) forms in the barium-containing spring water as a product of the oxidation of sulfur species to sulfate ions. The relatively insoluble barium sulfate precipitates and removes much of the radium from solution. Radium coprecipitates to a lesser extent with manganese-barium- and iron-oxy hydroxides. R-mode factor analysis of abundances of elements suggests that 65 percent of the variance of the different elements is affected by seven factors interpreted as follows: (1) Silica and silicate contamination and precipitation; (2) Carbonate travertine precipitation; (3) Radium coprecipitation; (4) Evaporite precipitation

  14. Radium and barium removal through blending hydraulic fracturing fluids with acid mine drainage.

    PubMed

    Kondash, Andrew J; Warner, Nathaniel R; Lahav, Ori; Vengosh, Avner

    2014-01-21

    Wastewaters generated during hydraulic fracturing of the Marcellus Shale typically contain high concentrations of salts, naturally occurring radioactive material (NORM), and metals, such as barium, that pose environmental and public health risks upon inadequate treatment and disposal. In addition, fresh water scarcity in dry regions or during periods of drought could limit shale gas development. This paper explores the possibility of using alternative water sources and their impact on NORM levels through blending acid mine drainage (AMD) effluent with recycled hydraulic fracturing flowback fluids (HFFFs). We conducted a series of laboratory experiments in which the chemistry and NORM of different mix proportions of AMD and HFFF were examined after reacting for 48 h. The experimental data combined with geochemical modeling and X-ray diffraction analysis suggest that several ions, including sulfate, iron, barium, strontium, and a large portion of radium (60-100%), precipitated into newly formed solids composed mainly of Sr barite within the first ∼ 10 h of mixing. The results imply that blending AMD and HFFF could be an effective management practice for both remediation of the high NORM in the Marcellus HFFF wastewater and beneficial utilization of AMD that is currently contaminating waterways in northeastern U.S.A.

  15. Glucosamine sulfate

    MedlinePlus

    ... Glucosamine Sulphate KCl, Glucosamine-6-Phosphate, GS, Mono-Sulfated Saccharide, Poly-(1->3)-N-Acetyl-2-Amino- ... Sulfate de Glucosamine, Sulfate de Glucosamine 2KCl, SG, Sulfated Monosaccharide, Sulfated Saccharide, Sulfato de Glucosamina. Glucosamine Hydrochloride ...

  16. Validation of an in situ solidification/stabilization technique for hazardous barium and cyanide waste for safe disposal into a secured landfill.

    PubMed

    Vaidya, Rucha; Kodam, Kisan; Ghole, Vikram; Surya Mohan Rao, K

    2010-09-01

    The aim of the present study was to devise and validate an appropriate treatment process for disposal of hazardous barium and cyanide waste into a landfill at a Common Hazardous Waste Treatment Storage Disposal Facility (CHWTSDF). The waste was generated during the process of hardening of steel components and contains cyanide (reactive) and barium (toxic) as major contaminants. In the present study chemical fixation of the contaminants was carried out. The cyanide was treated by alkali chlorination with calcium hypochlorite and barium by precipitation with sodium sulfate as barium sulfate. The pretreated mixture was then solidified and stabilized by binding with a combination of slag cement, ordinary Portland cement and fly ash, molded into blocks (5 x 5 x 5 cm) and cured for a period of 3, 7 and 28 days. The final experiments were conducted with 18 recipe mixtures of waste + additive:binder (W:B) ratios. The W:B ratios were taken as 80:20, 70:30 and 50:50. The optimum proportions of additives and binders were finalized on the basis of the criteria of unconfined compressive strength and leachability. The leachability studies were conducted using the Toxicity Characteristic Leaching Procedure. The blocks were analyzed for various physical and leachable chemical parameters at the end of each curing period. Based on the results of the analysis, two recipe mixtures, with compositions - 50% of [waste + (120 g Ca(OCl)(2) + 290 g Na(2)SO(4)) kg(-1) of waste] + 50% of binders, were validated for in situ stabilization into a secured landfill of CHWTSDF.

  17. Barium and Compounds

    Integrated Risk Information System (IRIS)

    EPA / 635 / R - 05 / 001 www.epa.gov / iris TOXICOLOGICAL REVIEW OF BARIUM AND COMPOUNDS ( CAS No . 7440 - 39 - 3 ) In Support of Summary Information on the Integrated Risk Information System ( IRIS ) March 1998 Minor revisions January 1999 Reference dose revised June 2005 U.S . Environmental Protec

  18. Experimental and numerical analysis of parallel reactant flow and transverse mixing with mineral precipitation in homogeneous and heterogeneous porous media

    DOE PAGES

    Fox, Don T.; Guo, Luanjing; Fujita, Yoshiko; ...

    2015-12-17

    Formation of mineral precipitates in the mixing interface between two reactant solutions flowing in parallel in porous media is governed by reactant mixing by diffusion and dispersion and is coupled to changes in porosity/permeability due to precipitation. The spatial and temporal distribution of mixing-dependent precipitation of barium sulfate in porous media was investigated with side-by-side injection of barium chloride and sodium sulfate solutions in thin rectangular flow cells packed with quartz sand. The results for homogeneous sand beds were compared to beds with higher or lower permeability inclusions positioned in the path of the mixing zone. In the homogeneous andmore » high permeability inclusion experiments, BaSO4 precipitate (barite) formed in a narrow deposit along the length and in the center of the solution–solution mixing zone even though dispersion was enhanced within, and downstream of, the high permeability inclusion. In the low permeability inclusion experiment, the deflected BaSO4 precipitation zone broadened around one side and downstream of the inclusion and was observed to migrate laterally toward the sulfate solution. A continuum-scale fully coupled reactive transport model that simultaneously solves the nonlinear governing equations for fluid flow, transport of reactants and geochemical reactions was used to simulate the experiments and provide insight into mechanisms underlying the experimental observations. Lastly, migration of the precipitation zone in the low permeability inclusion experiment could be explained by the coupling effects among fluid flow, reactant transport and localized mineral precipitation reaction.« less

  19. Long term performance of an AMD treatment bioreactor using chemolithoautotrophic sulfate reduction and ferrous iron precipitation under in situ groundwater conditions.

    PubMed

    Bilek, F; Wagner, S

    2012-01-01

    Chemolithoautotrophic sulfate reduction (CSR) was tested to treat natural acid mine drainage influenced groundwaters. The long term behavior was studied for more than 3 years under groundwater conditions (10 °C, autochthonous sulfate reducing bacteria (SRB)) without biomass replenishment in a 190 L bench scale reactor. The process produces water with alkalinity >10 mM. pH can be controlled by p(CO(2)) for all expectable water qualities. SRB were immobilized using an expanded clay bed. After 1.3 years of operation, a constant biomass content and sulfate reduction rate of 0.25-0.30 mmol(so)₄(Lh)⁻¹ were established. The sulfate reduction rate was limited by biomass content. Most of the electrons were used for sulfate reduction (98%). The hydrogen turn over in competing processes like methanogenesis and homoacetogenesis was successfully suppressed by adjusting the sulfate concentration to be >2 mM in the runoff.

  20. Sulfate scale dissolution

    SciTech Connect

    Morris, R.L.; Paul, J.M.

    1992-01-28

    This patent describes a method for removing barium sulfate scale. It comprises contacting the scale with an aqueous solution having a pH of about 8 to about 14 and consisting essentially of a chelating agent comprising a polyaminopolycarboxylic acid or salt of such an acid in a concentration of 0.1 to 1.0 M, and anions of a monocarboxylic acid selected form mercaptoacetic acid, hydroxyacetic acid, aminoacetic acid, or salicyclic acid in a concentration of 0.1 to 1.0 M and which is soluble in the solution under the selected pH conditions, to dissolve the scale.

  1. Methods for producing monodispersed particles of barium titanate

    DOEpatents

    Hu, Zhong-Cheng

    2001-01-01

    The present invention is a low-temperature controlled method for producing high-quality, ultrafine monodispersed nanocrystalline microsphere powders of barium titanate and other pure or composite oxide materials having particles ranging from nanosized to micronsized particles. The method of the subject invention comprises a two-stage process. The first stage produces high quality monodispersed hydrous titania microsphere particles prepared by homogeneous precipitation via dielectric tuning in alcohol-water mixed solutions of inorganic salts. Titanium tetrachloride is used as an inorganic salt precursor material. The second stage converts the pure hydrous titania microsphere particles into crystalline barium titanate microsphere powders via low-temperature, hydrothermal reactions.

  2. Barium uranyl diphosphonates

    SciTech Connect

    Nelson, Anna-Gay D.; Alekseev, Evgeny V.; Ewing, Rodney C.; Albrecht-Schmitt, Thomas E.

    2012-08-15

    Three Ba{sup 2+}/UO{sub 2}{sup 2+} methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 Degree-Sign C. These compounds, Ba[UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{center_dot}1.4H{sub 2}O (Ba-1), Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2}F{sub 6}]{center_dot}6H{sub 2}O (Ba-2), and Ba{sub 2}[(UO{sub 2}){sub 2}(CH{sub 2}(PO{sub 3}){sub 2})F{sub 4}]{center_dot}5.75H{sub 2}O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO{sub 5}F{sub 2} pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{sup 2-} sheets. The interlayer space of the structures is occupied by Ba{sup 2+}, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance. - Graphical abstract: Illustration of the stacking of the layers in Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2})F{sub 6}]{center_dot}6H{sub 2}O viewed along the c-axis. The structure is constructed from UO{sub 7} pentagonal bipyramidal units, U(1)O{sub 7}=gray, U(2)O{sub 7}=yellow, barium=blue, phosphorus=magenta, fluorine=green, oxygen=red, carbon=black, and hydrogen=light peach. Highlights: Black-Right-Pointing-Pointer The polymerization of the UO{sub 2}{sup 2+} sites to form uranyl dimers leads to structural variations in compounds. Black-Right-Pointing-Pointer Barium cations stitch uranyl diphosphonate anionic layers together, and help mediate structure formation. Black-Right-Pointing-Pointer HF acts as both a

  3. Yielding Unexpected Results: Precipitation of Ba[subscript3](PO[subscript4])[subscript2] and Implications for Teaching Solubility Principles in the General Chemistry Curriculum

    ERIC Educational Resources Information Center

    Hazen, Jeffery L.; Cleary, David A.

    2014-01-01

    Precipitation of barium phosphate from aqueous solutions of a barium salt and a phosphate salt forms the basis for a number of conclusions drawn in general chemistry. For example, the formation of a solid white precipitate is offered as evidence that barium phosphate is insoluble. Furthermore, analysis of the supernatant is used to illustrate the…

  4. On Barium Oxide Solubility in Barium-Containing Chloride Melts

    NASA Astrophysics Data System (ADS)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V.

    2016-08-01

    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl2-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl2-MCl systems.

  5. Dissolution of [²²⁶Ra]BaSO₄ and partial separation of ²²⁶Ra from radium/barium sulfate: A new treatment method for NORM waste from petroleum industry.

    PubMed

    Al Abdullah, Jamal; Al Masri, M S; Amin, Yusr

    2016-01-01

    Complete dissolution of [(226)Ra]BaSO4 precipitate was successfully performed using NaNO2 as a reducing agent in acidic solution at room temperature. Results showed a significant effect of acid and NaNO2 concentrations and temperature on the dissolution efficiency. The method was successfully used for separation of radium from NORM scale samples from the petroleum industry; sufficient volume reduction of NORM waste was achieved. The obtained (226)Ra solution was purified using two separation methods. The dissolution method can be of great interest in the development of radiochemical analysis of radium isotopes.

  6. Simultaneous chemical oxygen demand removal, methane production and heavy metal precipitation in the biological treatment of landfill leachate using acid mine drainage as sulfate resource.

    PubMed

    Li, Yu-Long; Wang, Jin; Yue, Zheng-Bo; Tao, Wei; Yang, Hai-Bin; Zhou, Yue-Fei; Chen, Tian-Hu

    2017-03-06

    Biological treatment played an important role in the treatment of landfill leachate. In the current study, acid mine drainage (AMD) was used as a source of sulfate to strengthen the anaerobic treatment of landfill leachate. Effects of chemical oxygen demand (COD) and SO4(2-) mass concentration ratio on the decomposition of organic matter, methane production and sulfate reduction were investigated and the microbial community was analyzed using the high throughout methods. Results showed that high removal efficiency of COD, methane production and heavy metal removal was achieved when the initial COD/SO4(2-) ratio (based on mass) was set at 3.0. The relative abundance of anaerobic hydrogen-producing bacteria (Candidatus Cloacamonas) in the experimental group with the addition of AMD was significantly increased compared to the control. Abundance of hydrogenotrophic methanogens of Methanosarcina and Methanomassiliicoccus was increased. Results confirmed that AMD could be used as sulfate resource to strengthen the biological treatment of landfill leachate.

  7. Chondroitin sulfate

    MedlinePlus

    ... in combination with glucosamine sulfate, shark cartilage, and camphor. Some people also inject chondroitin sulfate into the ... in combination with glucosamine sulfate, shark cartilage, and camphor seems to reduce arthritis symptoms. However, any symptom ...

  8. Abundance analysis of barium and mild barium stars

    NASA Astrophysics Data System (ADS)

    Smiljanic, R.; Porto de Mello, G. F.; da Silva, L.

    2007-06-01

    Aims:We compare and discuss abundances and trends in normal giants, mild barium, and barium stars, searching for differences and similarities between barium and mild barium stars that could help shed some light on the origin of these similar objects. Also, we search for nucleosynthetic effects possibly related to the s-process that were observed in the literature for elements like Cu in other types of s-process enriched stars. Methods: High signal to noise, high resolution spectra were obtained for a sample of normal, mild barium, and barium giants. Atmospheric parameters were determined from the Fe i and Fe ii lines. Abundances for Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Sr, Y, Zr, Ba, La, Ce, Nd, Sm, Eu, and Gd, were determined from equivalent widths and model atmospheres in a differential analysis, with the red giant ɛ Vir as the standard star. Results: The different levels of s-process overabundances of barium and mild barium stars were earlier suggested to be related to the stellar metallicity. Contrary to this suggestion, we found in this work no evidence of barium and mild barium having a different range in metallicity. However, comparing the ratio of abundances of heavy to light s-process elements, we found some evidence that they do not share the same neutron exposure parameter. The exact mechanism controlling this difference is still not clear. As a by-product of this analysis we identify two normal red giants misclassified as mild barium stars. The relevance of this finding is discussed. Concerning the suggested nucleosynthetic effects possibly related to the s-process, for elements like Cu, Mn, V and Sc, we found no evidence for an anomalous behavior in any of the s-process enriched stars analyzed here. However, further work is still needed since a clear [Cu/Fe] vs. [Ba/Fe] anticorrelation exists for other s-process enriched objects. Observations collected at ESO, La Silla, Chile, within the ON/ESO agreements. Tables 8-10 are only

  9. Isotopic Zonation Within Sulfate Evaporite Mineral Crystals Reveal Quantitative Paleoenvironment Details

    NASA Astrophysics Data System (ADS)

    Coleman, M.; Rhorssen, M.; Mielke, R. E.

    2008-12-01

    Isotopic variations measured within a single crystal of hydrated magnesium sulfate are greater than 30 permil for delta 2-H, almost 10 permil for δ18O in water of hydration; and greater than 3 permil in sulfate oxygen. These results are interpreted to indicate the relative humidity of the system during evaporation (15 to 20 percent in this test case) and constrain the volume of water involved. The theoretical basis of this system is the isotopic fractionation between the species in solution and those precipitated as evaporite salts. Precipitation preferentially accumulates more of the heavy isotopes of sulfur and oxygen in mineral sulfate, relative to sulfate in solution. During the course of mineral growth this leads to successive depletion of the respective heavier isotopes in the residual brine reflected in a parallel trend in successive precipitates or even in successive zones within a single crystal. The change in isotopic composition at any one time during the process, relative to the initial value, can be described by an isotopic version of the Rayleigh Fractionation equation, depending only on the extent of the completion of the process and the relevant fractionation factor. Evaporation preferentially removes isotopically lighter hydrogen and oxygen leading to successive extents of enrichment in the respective heavier isotopes in the residual water. However, the relative effects on hydrogen and oxygen isotopes differs as function of relative humidity [1]. ALL OF THESE CHANGES ARE PRESERVED IN THE MINERAL ISOTOPE COMPOSITIONS. We precipitated barium sulfate from epsomite or gypsum samples, which was reduced at 1450°C in the presence of graphite and glassy carbon in a Finnigan TC/EA to produce CO for O isotopic analysis in a Finnigan 253 mass spectrometer, while a separate subsample was oxidized to SO2 in a Costech Elemental Analyzer. However, to make progress with this approach we needed to make a large number of measurements of hydration water and so we

  10. Redox processes in highly yttrium-doped barium titanate

    NASA Astrophysics Data System (ADS)

    Belous, Anatolii; V'yunov, Oleg; Kovalenko, Leonid; Makovec, Darko

    2005-05-01

    The changes of microstructure occurring during oxidation of the reduced form of yttrium-doped barium titanate (BaYxrad Ti1-x4+Tix3+O) have been studied. Samples were sintered under reduction conditions at P=10 Pa and oxidized by annealing at high temperatures (1150 and 1350 °C) in air. Depending on yttrium concentration, the oxidation of the reduced form of the yttrium-doped BaTiO 3 caused precipitation of the phase Ba 6Ti 17O 40 or the phases Ba 6Ti 17O 40 and Y 2Ti 2O 7. The precipitates had well-defined orientational relationships with the perovskite matrix. Oxidation of the reduced form of doped barium titanate results in formation of the phase BaYxrad Ti1-x/44+(VTi⁗)O responsible for increase in the resistance of outer grain layers, which lie between grain boundaries and grain.

  11. CH Stars and Barium Stars

    NASA Astrophysics Data System (ADS)

    Bond, H.; Sion, E.; Murdin, P.

    2000-11-01

    The classical barium (or `Ba II') stars are RED GIANT STARS whose spectra show strong absorption lines of barium, strontium and certain other heavy elements, as well as strong features due to carbon molecules. Together with the related class of CH stars, the Ba II stars were crucial in establishing the existence of neutron-capture reactions in stellar interiors that are responsible for the synt...

  12. Comparing the relationship between precipitation and river geochemistry

    NASA Astrophysics Data System (ADS)

    Epp, A.; Luymes, R.; Bennett, M.; DaSilva, J.; Marsh, S. J.; Gillies, S. L.; Peucker-Ehrenbrink, B.; Voss, B.

    2013-12-01

    The geochemistry of precipitation affects the geochemistry of river water. Ideally, studies of river biogeochemistry should therefore include collection and analyses of dry and wet deposition. The Global Rivers Observatory has studied the Fraser River near Vancouver since the summer of 2009 at roughly bi-weekly resolution. The interpretation of this temporal record of river biogeochemistry, particularly the various sources of solutes, could be improved with a better understanding of atmospheric contributions. In this study precipitation and river water will be analysed from the Fraser River basin for nutrients as well as major and select trace ion concentrations. The nutrients analyzed will include ammonium (NH4), nitrate and nitrate (NO3-NO2), phosphate (PO4) and silicate (SiO4). Major ions include sodium (Na), potassium (K), calcium (Ca), magnesium (Mg), chloride (Cl), and sulfate (SO4). Trace elements may include molybdenum, strontium, barium, uranium, rubidium, manganese and iron. Samples will be collected using the bulk method which collects both wet and dry deposition . Correlating precipitation chemistry with data on wind direction may help elucidate sources of nutrients and major ions. For instance, westerly sources may transport pollution from the City of Vancouver and agricultural lands in the Fraser delta. Such pollutants may increase the acidity of precipitation and imprint the water chemistry with a unique chemical signature . The results of this study will be helpful in correcting Fraser River water data for contributions from atmospheric deposition.

  13. Barium light source method and apparatus

    NASA Technical Reports Server (NTRS)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)

    2002-01-01

    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  14. Mössbauer study and magnetic properties of M-type barium hexaferrite doped with Co + Ti and Bi + Ti ions.

    PubMed

    Belous, A G; V'yunov, O I; Pashkova, E V; Ivanitskii, V P; Gavrilenko, O N

    2006-12-28

    Using X-ray powder diffractions, Mössbauer spectroscopy, and magnetic measurements, the effect of complex dopants (Co2+ + Ti4+) and (Bi3+ + Ti4+) on the fine structure and magnetic properties of M-type barium hexaferrite prepared by hydroxide and carbonate precipitations has been studied. The distribution of cations over five nonequivalent positions of barium hexaferrite with magnetoplumbite structure is discussed. It has been shown that doped barium hexaferrite can be used for high-coercitivity data storage media.

  15. Ca2+-mediated association of human serum amyloid P component with heparan sulfate and dermatan sulfate.

    PubMed

    Hamazaki, H

    1987-02-05

    The serum amyloid P component (SAP) is a precursor glycoprotein of amyloid P component found in all types of amyloid deposits. The binding of human SAP to heparan sulfate and dermatan sulfate was studied using Sepharose-immobilized SAP. The apparent dissociation constants of heparan sulfate and dermatan sulfate for immobilized-SAP were estimated to be approximately 2 X 10(-7) M in the presence of 2 mM CaCl2 at neutral pH and physiological ionic strength. Both the binding affinity of SAP for these glycosaminoglycans and the numbers of binding sites of SAP depended on calcium concentration. Cadmium partially substituted for calcium as an activator of glycosaminoglycan binding to SAP. No binding occurs in the absence of added metal, or in the presence of barium, copper, magnesium, manganese, and strontium. The calcium-dependent binding of [3H]heparan sulfate and [3H]dermatan sulfate to SAP was strongly inhibited by heparan sulfate, heparin, and dermatan sulfate. Chondroitin 6-sulfate was a moderate inhibitor, whereas hyaluronic acid, chondroitin 4-sulfate, and keratan sulfate were not potent inhibitors. The calcium-dependent binding of amyloid P component to heparan sulfate and/or dermatan sulfate may be a cause of the coexistence of the particular glycoprotein and these glycosaminoglycans in amyloid tissues.

  16. Interaction between Barium Oxide and Barium Containing Chloride Melt

    NASA Astrophysics Data System (ADS)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Korzun, Iraida V.; Bovet, Andrey L.; Antonov, Boris D.

    2015-05-01

    Thermal analysis was applied to determine the liquidus temperatures in the NaCl-KCl-BaCl2-BaO system, with BaO concentration varied from 0 to 6 mole%. The temperature dependence of the BaO solubility in the NaCl-KCl-BaCl2 eutectic melt was investigated; the thermodynamic parameters of BaO dissolution were calculated. The caloric effects of melting of the NaCl-KCl-BaCl2 eutectic with barium oxide and barium oxychloride additions were studied. The type, morphology, and composition of oxychloride ionic groupings in the melt were determined in situ using Raman spectroscopy.

  17. 75 FR 33824 - Barium Chloride From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-06-15

    ... COMMISSION Barium Chloride From China Determination On the basis of the record\\1\\ developed in the subject... order on barium chloride from China would be likely to lead to continuation or recurrence of material... Barium Chloride from China: Investigation No. 731-TA-149 (Third Review). By order of the...

  18. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough*,**

    PubMed Central

    Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno

    2013-01-01

    OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough. METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons. RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6%) of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6%) of the patients, whereas the treatment was ineffective in 1 (8.4%). We observed no complications related to barium swallow, such as contrast aspiration. CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies. PMID:24473762

  19. Akaganéite (β-FeOOH) precipitation in inland acid sulfate soils of south-western New South Wales (NSW), Australia

    NASA Astrophysics Data System (ADS)

    Bibi, Irshad; Singh, Balwant; Silvester, Ewen

    2011-11-01

    The prevalence of sulphidic sediments in inland wetlands has been only recently recognized in many parts of the world, including Australia. The exposure of sulphidic sediments in these wetlands due to natural and human induced drying events has resulted in the oxidation of iron sulfide minerals, the formation of secondary iron minerals characteristic of acid sulfate soils and the release of highly acidic solutions. The objective of this study was to determine the mineralogy and morphology of sediments collected from the oxidized surface horizon (0-5 cm) of an inland acid sulfate soil located in south-western New South Wales (NSW), Australia. Random powder X-ray diffraction (XRD), transmission electron microscopy (TEM) and scanning transmission electron microscopy combined with energy dispersive X-ray spectroscopy (STEM-EDS) techniques were used to characterize the minerals present in these sediments. Akaganéite was identified as the major mineral phase in the sediments; K-jarosite was also determined in small amounts in some sediments. The XRD patterns of sequentially washed (E-pure® water-0.01 M HCl-0.01 M EDTA) sediment samples showed all akaganéite peaks; the Rietveld refinement of these patterns also revealed a predominance of akaganéite. The chemical analyses of the original and washed sediments using STEM-EDS clearly showed the presence of akaganéite as a pure mineral phase with an average Fe/Cl mole ratio of 6.7 and a structural formula of Fe 8O 8(OH) 6.8(Cl) 1.2. These findings show that the extreme saline-acidic solutions (pH ˜ 2, EC = 216 dS/m) at the Bottle Bend lagoon provide ideal conditions for the crystallization of this rarely forming mineral.

  20. Sources of sulfate supporting anaerobic metabolism in a contaminated aquifer

    USGS Publications Warehouse

    Ulrich, G.A.; Breit, G.N.; Cozzarelli, I.M.; Suflita, J.M.

    2003-01-01

    Field and laboratory techniques were used to identify the biogeochemical factors affecting sulfate reduction in a shallow, unconsolidated alluvial aquifer contaminated with landfill leachate. Depth profiles of 35S-sulfate reduction rates in aquifer sediments were positively correlated with the concentration of dissolved sulfate. Manipulation of the sulfate concentration in samples revealed a Michaelis-Menten-like relationship with an apparent Km and Vmax of approximately 80 and 0.83 ??M SO4-2??day-1, respectively. The concentration of sulfate in the core of the leachate plume was well below 20 ??M and coincided with very low reduction rates. Thus, the concentration and availability of this anion could limit in situ sulfate-reducing activity. Three sulfate sources were identified, including iron sulfide oxidation, barite dissolution, and advective flux of sulfate. The relative importance of these sources varied with depth in the alluvium. The relatively high concentration of dissolved sulfate at the water table is attributed to the microbial oxidation of iron sulfides in response to fluctuations of the water table. At intermediate depths, barite dissolves in undersaturated pore water containing relatively high concentrations of dissolved barium (???100 ??M) and low concentrations of sulfate. Dissolution is consistent with the surface texture of detrital barite grains in contact with leachate. Laboratory incubations of unamended and barite-amended aquifer slurries supported the field observation of increasing concentrations of barium in solution when sulfate reached low levels. At a deeper highly permeable interval just above the confining bottom layer of the aquifer, sulfate reduction rates were markedly higher than rates at intermediate depths. Sulfate is supplied to this deeper zone by advection of uncontaminated groundwater beneath the landfill. The measured rates of sulfate reduction in the aquifer also correlated with the abundance of accumulated iron sulfide

  1. An inhibitor of the δPKC interaction with the d subunit of F1Fo ATP synthase reduces cardiac troponin I release from ischemic rat hearts: utility of a novel ammonium sulfate precipitation technique.

    PubMed

    Ogbi, Mourad; Obi, Ijeoma; Johnson, John A

    2013-01-01

    We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n=5) percentage of maximal cTnI release was 30 ± 7 and 60 ± 17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60-150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts.

  2. An Inhibitor of the δPKC Interaction with the d Subunit of F1Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique

    PubMed Central

    Ogbi, Mourad; Obi, Ijeoma; Johnson, John A.

    2013-01-01

    We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F1Fo ATPase (dF1Fo) interaction inhibitor [NH2-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demonstrate the partitioning of this peptide to the inner membrane and matrix of mitochondria when it is perfused into isolated rat hearts. We also used ammonium sulfate ((NH4)2SO4) and chloroform/methanol precipitation of heart effluents to demonstrate reduced card-iac troponin I (cTnI) release from ischemic rat hearts perfused with this inhibitor. 50% (NH4)2SO4 saturation of perfusates collected from Langendorff rat heart preparations optimally precipitated cTnI, allowing its detection in Western blots. In hearts receiving 20 min of ischemia followed by 30, or 60 min of reperfusion, the Mean±S.E. (n = 5) percentage of maximal cTnI release was 30±7 and 60±17, respectively, with additional cTnI release occurring after 150 min of reperfusion. Perfusion of hearts with the δPKC-dF1Fo interaction inhibitor, prior to 20 min of ischemia and 60–150 min of reperfusion, reduced cTnI release by 80%. Additionally, we found that when soybean trypsin inhibitor (SBTI), was added to rat heart effluents, it could also be precipitated using (NH4)2SO4 and detected in western blots. This provided a convenient method for normalizing protein recoveries between groups. Our results support the further development of the δPKC-dF1Fo inhibitor as a potential therapeutic for combating cardiac ischemic injury. In addition, we have developed an improved method for the detection of cTnI release from perfused rat hearts. PMID:23936451

  3. Observation and theory of the barium releases from the CRRES satellite

    NASA Technical Reports Server (NTRS)

    Bernhardt, P. A.; Huba, J. D.; Scales, W. A.; Wescott, E. M.; Stenbaek-Nielsen, H. C.

    1992-01-01

    The relationship between releases of barium from the NASA Combined Release and Radiation Effects Satellite (CRRES) and enhanced auroral activity is discussed with reference to observational data. Barium releases were conducted at a variety of altitudes and injection velocities, and plasma irregularities are reported as a result of the interactions. Auroral activity increased within 5 min of each release, and references are made to the effects on diamagnetic cavities, bulk ion motion, and stimulated electron and ion precipitation. Artificially created structured diamagnetic cavities are noted for each release, plasma waves are generated by the high-speed ion clouds, and enhanced ionization is found in the critical ionization-velocity process. Barium releases are effective in stimulating electron precipitation, and the observed irregularities are related to cycloid bunching of the initial ion distributions.

  4. Membranes solve North Sea waterflood sulfate problems

    SciTech Connect

    Davis, R.; Lomax, I.; Plummer, M.

    1996-11-25

    To prevent barium sulfate scale from forming in the North Sea Brae field producing wells, Marathon Oil Co. UK Ltd. is successfully employing thin-film composite (nanofiltration) membranes for removing sulfate from injected seawater. In the early 1980s, FilmTec Corp., a Dow Chemical Co. subsidiary, first developed these composite membranes, which now are in their third generation. Marathon Oil Co. holds the patent for the specific nanofiltration membrane process for mitigating scale formation and deleterious reservoir effects. This first article in a three-part series describes membrane technology. The remaining articles detail specific membrane performance characteristics and field experiences in the Brae fields.

  5. Barium hexaferrite (M-phase) exhibiting superstructure

    SciTech Connect

    Ganapathi, L.; Gopalakrishnan, J.; Rao, C.N.R.

    1984-05-01

    Barium hexaferrite (M-phase) prepared by the flux method is found to exhibit a ..sqrt..3a x ..sqrt..3a superstructure similar to barium hexaaluminate. Morgan and Shaw as well as Iyi et al have recently reported the formation of a barium-rich phase of barium hexaaluminate possessing a ..sqrt..3a x ..sqrt..3a superstructure of the magnetoplumbite structure. In view of the similarities between the layer structures of ..beta..-aluminas and the corresponding ferrites the authors have been carrying out electron microscopic investigations of potassium ..beta..-alumina and BaA1/sub 12/O/sub 19/ along with ferrites of similar compositions. They have obtained electron diffraction patterns of barium hexaaluminate identical to those obtained by Morgan and Shaw and Iyi et al, but more interestingly, they have found a phase of barium hexaferrite (M-phase) exhibiting the ..sqrt..3a x ..sqrt..3a superstructure.

  6. Distribution and source of barium in ground water at Cattaraugus Indian Reservation, southwestern New York

    USGS Publications Warehouse

    Moore, R.B.; Staubitz, W.W.

    1984-01-01

    High concentrations of dissolved barium have been found in ground water from bedrock wells on the Seneca Nation of Indians Reservation on Cattaraugus Creek in southwestern New York. Concentrations in 1982 were as high as 23.0 milligrams per liter , the highest found reported from any natural ground-water system in the world. The highest concentrations are in a bedrock aquifer and in small lenses of saturated gravel between bedrock and the overlying till. The bedrock aquifer is partly confined by silt, clay, and till. The high barium concentrations are attributed to dissolution of the mineral barite (BaSO4), which is present in the bedrock and possibly in overlying silt, clay, or till. The dissolution of barite seems to be controlled by action of sulfate-reducing bacteria, which alter the BaSO4 equilibrium by removing sulfate ions and permitting additional barite to dissolve. Ground water from the surficial, unconsolidated deposits and surface water in streams contain little or no barium. Because barium is chemically similar to calcium, it probably could be removed by cation exchange or treatments similar to those used for water softening. (USGS)

  7. Barium in planktonic foraminifera

    SciTech Connect

    Lea, D.W.; Boyle, E.A. )

    1991-11-01

    Reconstructions of Ba distributions in ancient oceanic surface waters could provide new insight into paleoceanographic change. Calcite shells of planktonic foraminifera potentially provide a means of reconstructing such paleo-Ba distributions if lattice-bound Ba can be determined on shells recovered from deep-sea cores. Planktonic foraminifera shells from a series of cores were purified of non-lattice-bound Ba associated with organic or sedimentary phases by a combination of physical agitation, oxidative-reductive steps, acid leaches, and a novel alkaline-DTPA step to dissolve barite. A sequential dissolution of a large sample of cleaned shells of the planktonic foraminifer Globigerinoides conglobatus indicates homogeneous distribution of Ba in the shell material. Comparison of shells from sediments, sediment traps, and plankton tows indicates no significant differences in the Ba content of the purified shells. Variation in foraminiferal Ba contents between the Pacific, Atlantic, and Mediterranean Sea is consistent with the trend in surface seawater Ba. The calculated distribution coefficient for Ba incorporation in five species based on these data is 0.19 {plus minus} 0.05. Several species of the non-spinose planktonic foraminifera Globorotalia have Ba/Ca ratios ranging from 2 to 13 {mu}mol; these high Ba contents might be explained by differences in the way these foraminifera precipitate their shells. A temporal record of Ba/Ca in samples of Globigerinoides and Orbulina from a core in the northwest Atlantic suggests that the Ba concentration of surface waters at this site has not changed by more than 20% over the last 14 kyr.

  8. The problem of the barium stars

    NASA Technical Reports Server (NTRS)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.

    1984-01-01

    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  9. Barium Depletion in Hollow Cathode Emitters

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2009-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  10. Processing science of barium titanate

    NASA Astrophysics Data System (ADS)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  11. Barium granuloma of the transverse colon.

    PubMed Central

    McKee, P. H.; Cameron, C. H.

    1978-01-01

    A case of barium sulphate granuloma of the transverse colon following gunshot wounds to the abdomen has been described. Scanning electron microscopy with electron probe microanalysis was used to confirm the presence of barium sulphate and the absence of lead or other elements related to the gunshot wounds. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:740599

  12. Removal of Sulfate Ion From AN-107 by Evaporation

    SciTech Connect

    GJ Lumetta; GS Klinger; DE Kurath; RL Sell; LP Darnell; LR Greenwood; CZ Soderquist; MJ Steele; MW Urie; JJ Wagner

    2000-08-02

    Hanford low-activity waste solutions contain sulfate, which can cause accelerated corrosion of the vitrification melter and unacceptable operating conditions. A method is needed to selectively separate sulfate from the waste. An experiment was conducted to evaluate evaporation for removing sulfate ion from Tank AN-107 low-activity waste. Two evaporation steps were performed. In the first step, the volume was reduced by 55% while in the second step, the liquid volume was reduced another 22%. Analysis of the solids precipitated during these evaporations revealed that large amounts of sodium nitrate and nitrite co-precipitated with sodium sulfate. Many other waste components precipitated as well. It can be concluded that sulfate removal by precipitation is not selective, and thus, evaporation is not a viable option for removing sulfate from the AN-107 liquid.

  13. Radium/Barium Waste Project

    SciTech Connect

    McDowell, Allen K.; Ellefson, Mark D.; McDonald, Kent M.

    2015-06-25

    The treatment, shipping, and disposal of a highly radioactive radium/barium waste stream have presented a complex set of challenges requiring several years of effort. The project illustrates the difficulty and high cost of managing even small quantities of highly radioactive Resource Conservation and Recovery Act (RCRA)-regulated waste. Pacific Northwest National Laboratory (PNNL) research activities produced a Type B quantity of radium chloride low-level mixed waste (LLMW) in a number of small vials in a facility hot cell. The resulting waste management project involved a mock-up RCRA stabilization treatment, a failed in-cell treatment, a second, alternative RCRA treatment approach, coordinated regulatory variances and authorizations, alternative transportation authorizations, additional disposal facility approvals, and a final radiological stabilization process.

  14. Diethyl sulfate

    Integrated Risk Information System (IRIS)

    Diethyl sulfate ; CASRN 64 - 67 - 5 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic Ef

  15. Dimethyl sulfate

    Integrated Risk Information System (IRIS)

    Dimethyl sulfate ; CASRN 77 - 78 - 1 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic E

  16. 75 FR 20625 - Barium Chloride From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-04-20

    ... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject review. DATES: Effective Date: April 9, 2010. FOR FURTHER INFORMATION CONTACT:...

  17. Acute barium nitrate intoxication treated by hemodialysis.

    PubMed

    Bahlmann, H; Lindwall, R; Persson, H

    2005-01-01

    A 22-year-old male was admitted to hospital with diarrhea and vomiting, cardiac arrhythmias, severe hypokalemia and gradual onset of muscular weakness. A potassium infusion was started, but for several hours serum potassium remained low. Evidence of toxic ingestion was initially lacking. When it became clear -- after a considerable delay -- that the patient had ingested barium nitrate, hemodialysis was started. This resulted in rapid clinical improvement with correction of hypokalemia and restored muscular function. Intoxication with barium causes hypokalemia, arrhythmias, muscular weakness and paralysis, often requiring respiratory support. This patient presented with symptoms typical of severe barium intoxication, non-responsive to potassium supplementation. There are few published reports on the use of hemodialysis in barium poisoning. This case confirms the possible benefit of hemodialysis in severe cases, where potassium supplementation alone is insufficient.

  18. Barium Isotopes in Single Presolar Grains

    NASA Technical Reports Server (NTRS)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.

    2001-01-01

    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  19. Centrifugal precipitation chromatography.

    PubMed

    Ito, Yoichiro; Qi, Lin

    2010-01-15

    Centrifugal precipitation chromatography separates analytes according their solubility in ammonium sulfate (AS) solution and other precipitants. The separation column is made from a pair of long spiral channels partitioned with a semipermeable membrane. In a typical separation, concentrated ammonium sulfate is eluted through one channel while water is eluted through the other channel in the opposite direction. This countercurrent process forms an exponential AS concentration gradient through the water channel. Consequently, protein samples injected into the water channel is subjected to a steadily increasing AS concentration and at the critical AS concentration they are precipitated and deposited in the channel bed by the centrifugal force. Then the chromatographic separation is started by gradually reducing the AS concentration in the AS channel which lowers the AS gradient concentration in the water channel. This results in dissolution of deposited proteins which are again precipitated at an advanced critical point as they move through the channel. Consequently, proteins repeat precipitation and dissolution through a long channel and finally eluted out from the column in the order of their solubility in the AS solution. The present method has been successfully applied to a number of analytes including human serum proteins, recombinant ketosteroid isomerase, carotenoid cleavage enzymes, plasmid DNA, polysaccharide, polymerized pigments, PEG-protein conjugates, etc. The method is capable to single out the target species of proteins by affinity ligand or immunoaffinity separation.

  20. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    NASA Technical Reports Server (NTRS)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  1. Chemical abundances and kinematics of barium stars

    NASA Astrophysics Data System (ADS)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.

    2016-07-01

    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  2. Pulsating aurora induced by upper atmospheric barium releases

    NASA Technical Reports Server (NTRS)

    Deehr, C.; Romick, G.

    1977-01-01

    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  3. Geophysical disturbance environment during the NASA/MPE barium release at 5 earth radii on September 21, 1971.

    NASA Technical Reports Server (NTRS)

    Davis, T. N.; Stanley, G. M.; Boyd, J. S.

    1973-01-01

    The geophysical disturbance environment was quiet during the NASA/MPE barium release at 5 earth radii on September 21, 1971. At the time of the release, the magnetosphere was in the late recovery phase of a principal magnetic storm, the provisional Dst value was -13 gammas, and the local horizontal disturbance at Great Whale River was near zero. Riometer and other observations indicated low-level widespread precipitation of high-energy electrons at Great Whale River before, during, and after the release. Cloudy sky at this station prevented optical observation of aurora. No magnetic or ionospheric effects attributable to the barium release were detected at Great Whale River.

  4. Constraining the oceanic barium cycle with stable barium isotopes

    NASA Astrophysics Data System (ADS)

    Cao, Zhimian; Siebert, Christopher; Hathorne, Ed C.; Dai, Minhan; Frank, Martin

    2016-01-01

    The distribution of barium (Ba) concentrations in seawater resembles that of nutrients and Ba has been widely used as a proxy of paleoproductivity. However, the exact mechanisms controlling the nutrient-like behavior, and thus the fundamentals of Ba chemistry in the ocean, have not been fully resolved. Here we present a set of full water column dissolved Ba (DBa) isotope (δ137BaDBa) profiles from the South China Sea and the East China Sea that receives large freshwater inputs from the Changjiang (Yangtze River). We find pronounced and systematic horizontal and depth dependent δ137BaDBa gradients. Beyond the river influence characterized by generally light signatures (0.0 to + 0.3 ‰), the δ137BaDBa values in the upper water column are significantly higher (+ 0.9 ‰) than those in the deep waters (+ 0.5 ‰). Moreover, δ137BaDBa signatures are essentially constant in the entire upper 100 m, in which dissolved silicon isotopes are fractionated during diatom growth resulting in the heaviest isotopic compositions in the very surface waters. Combined with the decoupling of DBa concentrations and δ137BaDBa from the concentrations of nitrate and phosphate this implies that the apparent nutrient-like fractionation of Ba isotopes in seawater is primarily induced by preferential adsorption of the lighter isotopes onto biogenic particles rather than by biological utilization. The subsurface δ137BaDBa distribution is dominated by water mass mixing. The application of stable Ba isotopes as a proxy for nutrient cycling should therefore be considered with caution and both biological and physical processes need to be considered. Clearly, however, Ba isotopes show great potential as a new tracer for land-sea interactions and ocean mixing processes.

  5. Preparation and characterization of uniform particles of flufenamic acid and its calcium and barium salts.

    PubMed

    Mohamed, Amr Ali; Matijević, Egon

    2012-09-01

    Uniform fully dispersed particles of flufenamic acid, a widely used anti-inflammatory drug, were prepared by two different methods. In the first one, the drug solution in organic solvents was added to a non-solvent (water or aqueous solutions of stabilizers); while in the second procedure the drug was precipitated by acidifying its basic aqueous solutions. In addition calcium and barium salts of uniform spherical particles were obtained by precipitation in aqueous basic solutions of the drug. These salts are supposed to improve the drug reactivity. The prepared dispersions of the drug and its salts were examined by scanning electron microscopy, X-ray diffractometry and electrophoresis.

  6. Assessment of Barium Sulphate Formation and Inhibition at Surfaces with Synchrotron X-ray Diffraction (SXRD)

    SciTech Connect

    E Mavredaki; A Neville; K Sorbie

    2011-12-31

    The precipitation of barium sulphate from aqueous supersaturated solutions is a well-known problem in the oil industry often referred to as 'scaling'. The formation and growth of barite on surfaces during the oil extraction process can result in malfunctions within the oil facilities and serious damage to the equipment. The formation of barium sulphate at surfaces remains an important topic of research with the focus being on understanding the mechanisms of formation and means of control. In situ synchrotron X-ray diffraction (SXRD) was used to investigate the formation of barium sulphate on a stainless steel surface. The effect of Poly-phosphinocarboxylic acid (PPCA) and Diethylenetriamine-penta-methylenephosphonic acid (DETPMP) which are two commercial inhibitors for barium sulphate was examined. The in situ SXRD measurements allowed the identification of the crystal faces of the deposited barite in the absence and presence of the two inhibitors. The preferential effect of the inhibitors on some crystal planes is reported and the practical significance discussed.

  7. Plasmid-encoded copper resistance and precipitation by Mycobacterium scrofulaceum.

    PubMed Central

    Erardi, F X; Failla, M L; Falkinham, J O

    1987-01-01

    A copper-tolerant Mycobacterium scrofulaceum strain was able to remove copper from culture medium by sulfate-dependent precipitation as copper sulfide. Such precipitation of copper sulfide was not observed in a derivative that lacks a 173-kilobase plasmid. In addition, the plasmid-carrying strain has a sulfate-independent copper resistance mechanism. PMID:3662522

  8. Barium iodide single-crystal scintillator detectors

    NASA Astrophysics Data System (ADS)

    Cherepy, Nerine J.; Hull, Giulia; Niedermayr, Thomas R.; Drobshoff, Alexander; Payne, Stephen A.; Roy, Utpal N.; Cui, Yunlong; Bhattacharaya, Ajanta; Harrison, Melissa; Guo, Mingsheng; Groza, Michael; Burger, Arnold

    2007-09-01

    We find that the high-Z crystal Barium Iodide is readily growable by the Bridgman growth technique and is less prone to crack compared to Lanthanum Halides. We have grown Barium Iodide crystals: undoped, doped with Ce 3+, and doped with Eu 2+. Radioluminescence spectra and time-resolved decay were measured. BaI II(Eu) exhibits luminescence from both Eu 2+ at 420 nm (~450 ns decay), and a broad band at 550 nm (~3 μs decay) that we assign to a trapped exciton. The 550 nm luminescence decreases relative to the Eu 2+ luminescence when the Barium Iodide is zone refined prior to crystal growth. We also describe the performance of BaI II(Eu) crystals in experimental scintillator detectors.

  9. Improved spectrophotometric analysis of barium styphnate

    SciTech Connect

    Brown, N E; Blasi, J A

    1983-01-01

    A spectrophotometric procedure to determine the purity of barium styphnate monohydrate based upon the absorbance of the styphnate ion at 326 and 413.3 nm has been developed. The purity is determined by comparing the absorbance of the styphnate ion in barium styphnate and in styphnic acid. Our investigation has shown that the molar absorptivity and lambda maxima of the styphnate ion are quite pH dependent; therefore, the pH is buffered to 6.8 to 7.0 with ammonium acetate. Under these conditions the molar absorptivity is 1.6 x 10/sup 4/ L/mol-cm. Analyses following the procedure in the Navy specification WS13444A using water were found to give low molar absorptivities (1.3 x 10/sup 4/ L/mol-cm) for the styphnic acid calibration resulting in erroneous values for barium styphnate purity.

  10. Surface treatment of barium gallogermanate laser glass

    NASA Astrophysics Data System (ADS)

    Yang, Gang; Qian, Qi; Yang, Zhongmin

    2011-01-01

    The surface of barium gallogermanate glass is modified through HCl solution etching to remove the surface defects and contaminations. The etching process and mechanism for barium gallogermanate glass in hydrochloric acid are investigated, and its optimum conditions are determined. However, the HCl etching induces the insoluble etch product containing minute crystal particles on glass surface. By heating BGG glass at the optical fiber drawing temperature, the deposited surface layer turned to be amorphous again and results in the increase of the transmittance of glass. The results indicated that the HCl etching combined with subsequent high-temperature heat treatment is an effective approach to improve the surface quality of barium gallogermanate glass, which would reduce the optical loss of the final optical fiber.

  11. Barium isotope fractionation during experimental formation of the double carbonate BaMn[CO3](2) at ambient temperature.

    PubMed

    Böttcher, Michael E; Geprägs, Patrizia; Neubert, Nadja; von Allmen, Katja; Pretet, Chloé; Samankassou, Elias; Nägler, Thomas F

    2012-09-01

    In this study, we present the first experimental results for stable barium (Ba) isotope ((137)Ba/(134)Ba) fractionation during low-temperature formation of the anhydrous double carbonate BaMn[CO(3)](2). This investigation is part of an ongoing work on Ba fractionation in the natural barium cycle. Precipitation at a temperature of 21±1°C leads to an enrichment of the lighter Ba isotope described by an enrichment factor of-0.11±0.06‰ in the double carbonate than in an aqueous barium-manganese(II) chloride/sodium bicarbonate solution, which is within the range of previous reports for synthetic pure BaCO (3) (witherite) formation.

  12. New barium paste mixture for helical (slip-ring) CT evaluation of the esophagus.

    PubMed

    Noda, Y; Ogawa, Y; Nishioka, A; Inomata, T; Yoshida, S; Toki, T; Ogoshi, S; Ma, J

    1996-01-01

    Successful opacification of the lumen of the esophagus with cancer or paraesophageal diseases has not yet been fully achieved. Therefore, we have recently adopted a new method for complete and continuous opacification of the whole thoracic esophagus using our newly developed oral contrast agent with a helical (slip-ring) CT scanner. The agent consists of 3.6 (wt/vol)% carboxy-methyl cellulose sodium paste containing 2 (wt/vol)% barium sulfate. The results indicate that almost complete and continuous opacification of esophageal lumen was achieved. Our new method of esophageal CT is easy to perform and was well tolerated by patients, being therefore ideal for routine examinations.

  13. Kinetics of photoplasma of dense barium vapour

    SciTech Connect

    Kosarev, N I

    2015-03-31

    Barium vapour ionisation under laser photoexcitation of the resonance line at a wavelength of λ = 553.5 nm is studied numerically. Seed electrons, arising due to the associative ionisation of atoms, gain energy in superelastic collisions and lead to electron avalanche ionisation of the medium. The influence of radiative transfer in a cylindrical gas volume on the excitation kinetics of barium atoms, absorption dynamics of laser radiation and oscillation of ionisation-brightening wave under competition between ionising and quenching collisions of electrons with excited atoms is studied. (interaction of laser radiation with matter)

  14. Calibration of Productivity Proxy Based on Fish Tooth Flux and Biogenic Barium in Pacific Deep-Sea Sediments

    NASA Astrophysics Data System (ADS)

    Vincent, K.

    2015-12-01

    Biological production is a key variable in paleoceanography, yet most measures reflect the detailed responses of specific biological communities—opal for biosiliceous producters, alkenones for some coccolithophorids, and percent carbonate for a heterogeneous mixture of calcareous phytoplankton and zooplankton, among others. We are developing a new method for extracting biogenic barite and fish teeth from deep-sea sediments and calibrating the fluxes of both components to satellite-derived ocean productivity. Both fish teeth and barite capture major components of biological production in the ocean. Teeth capture dynamics of high trophic level communities who depend upon lower level production in mostly short food chains. Barite reflects export flux of marine particulate carbon, and hence records the major producers of marine snow. Our methods digest sediments to remove carbonates, and concentrate teeth with heavy liquid separation. Barite is also concentrated by acid dissolution of carbonate, but then we dissolve barite, collect the sulfate in solution, and re-precipitate barite rather than use the time consuming and dangerous methods that are currently the industry standard. Counting the number of fish teeth present in the sample and extracting the amount of biogenic barium will discover two different proxies of productivity. The sample sites range throughout the Pacific Ocean, giving a wide scope of variability along with satellite productivity levels. The results between the amount of fish teeth as well as the biogenic barite levels will hopefully be at a similar level, indicating that this method is a new tried and true proxy for productivity in the future.

  15. 75 FR 19657 - Barium Chloride From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-04-15

    ... Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of Commission... China. SUMMARY: The Commission hereby gives notice that it will proceed with a full review pursuant to... antidumping duty order on barium chloride from China would be likely to lead to continuation or recurrence...

  16. Barium Transport Process in Impregnated Dispenser Cathodes.

    DTIC Science & Technology

    1982-01-25

    Distribution of Autoelectronic Emission from Single Crystal Metal Points. II. The Adsorption, Migration and Evaporation of Thorium, Barium, and Sodium on...1966, Alkaline Earth Tungstate : Equilibrium Instability in the M-W-O Systems, J. Am. Ceram. Soc. 49, p. 385. 26 LABORAT)RY OPIRATI JS The Labratory

  17. Mössbauer and X-ray diffraction study of Co2+-Si4+ substituted M-type barium hexaferrite BaFe12-2хСохSiхO19±γ

    NASA Astrophysics Data System (ADS)

    Solovyova, E. D.; Pashkova, E. V.; Ivanitski, V. P.; V‧yunov, O. I.; Belous, A. G.

    2013-03-01

    Using X-ray powder diffractions, Mössbauer spectroscopy, and magnetic measurements, the effect of dopants (Co2++Si4+) on the fine structure and magnetic properties of M-type barium hexaferrite prepared by hydroxide and carbonate precipitations has been studied. It has been shown that the magnetic properties of M-type barium hexaferrite can be controlled by heterovalent substitution 2Fe3+→Со2++Sі4+.

  18. Novel Thermally Stable Poly (vinyl chloride) Composites for Sulfate Removal

    EPA Science Inventory

    BaCO3 dispersed PVC composites were prepared through a polymer re-precipitation method. The composites were tested for sulfate removal using rapid small scale column test (RSSCT) and found to significantly reduce sulfate concentration. The method was extended to synthe...

  19. Microcapsules with intrinsic barium radiopacity for immunoprotection and X-ray/CT imaging of pancreatic islet cells.

    PubMed

    Arifin, Dian R; Manek, Sameer; Call, Emma; Arepally, Aravind; Bulte, Jeff W M

    2012-06-01

    Microencapsulation is a commonly used technique for immunoprotection of engrafted therapeutic cells. We investigated a library of capsule formulations to determine the most optimal formulation for pancreatic beta islet cell transplantation, using barium as the gelating ion and clinical-grade protamine sulfate (PS) as a new cationic capsule cross-linker. Barium-gelated alginate/PS/alginate microcapsules (APSA, diameter = 444 ± 21 μm) proved to be mechanically stronger and supported a higher cell viability as compared to conventional alginate/poly-l-lysine/alginate (APLLA) capsules. Human pancreatic islets encapsulated inside APSA capsules, gelated with 20 mm barium as optimal concentration, exhibited a sustained morphological integrity, viability, and functionality for at least 3-4 weeks in vitro, with secreted human C-peptide levels of 0.2-160 pg/ml/islet. Unlike APLLA capsules that are gelled with calcium, barium-APSA capsules are intrinsically radiopaque and, when engrafted into mice, could be readily imaged in vivo with micro-computed tomography (CT). Without the need of adding contrast agents, these capsules offer a clinically applicable alternative for simultaneous immunoprotection and real-time, non-invasive X-ray/CT monitoring of engrafted cells during and after in vivo administration.

  20. A detailed analysis of five barium stars

    NASA Astrophysics Data System (ADS)

    Kovacs, N.

    1985-09-01

    A model-atmosphere analysis of five barium stars is carried out, and a previous analysis of two others extended. The sample comprises types Ba 1, Ba 2, Ba 3, and Ba 5. High-resolution Reticon spectra recorded with the ESO Coude Echelle Spectrometer serve to determine abundances relative to the sun for typically 16 elements. The use of Reticon spectra improves the accuracy compared to previous analyses. Enhancements of s-process elements relative to iron by factors of 2 (HD 139195) to 30 (HD 92626) are found; neutron exposures span at least the range tau of about 0.06-0.6/mb. In the more extreme barium stars the C/O ratio is enhanced with respect to normal red giants by a factor 2.5 to 30.

  1. A relict sulfate-methane transition zone in the mid-Devonian Marcellus Shale

    NASA Astrophysics Data System (ADS)

    Niu, Danielle; Renock, Devon; Whitehouse, Martin; Leone, James; Rowe, Harry; Landis, Joshua; Hamren, Keith; Symcox, Carl W.; Sharma, Mukul

    2016-06-01

    A barium-enriched interval of Marcellus Shale (Middle Devonian Oatka Creek Formation) from a core in Chenango County, NY contains ∼100 μm diameter ellipsoidal grains with variable mineralogical compositions between pure barite and pure pyrite endmembers. Petrographic characterization and in-situ sulfur isotope analysis by Secondary Ion Mass Spectrometry (SIMS) was performed to better understand the diagenetic conditions under which these grains form and are preserved in the shale. Textural relationships suggest partial to complete pseudomorphic replacement of ellipsoidal barite by pyrite. Spatially, the ellipsoidal grains are concentrated in discrete layers parallel to original bedding and intervals within these layers often contain grains with similar degrees of replacement. The fraction of barite replaced by pyrite between these intervals can vary significantly, which is remarkable considering these intervals are separated by stratigraphic distances on the order of mm to cm in the shale (depths equivalent to deposition over 10's-1000's of years). The mean δ34S of barite and pyrite in ellipsoidal grains is 63.3 ± 3.6‰ and 2.2 ± 3.0‰, respectively, indicating that the grains are authigenic. Mass balance calculations based on density and stoichiometric differences between barite and pyrite indicate that reduction of sulfate from barite alone cannot be the sole source of sulfur in the replaced grains: only ∼23% of sulfur in pyrite comes from the dissolution of barite while the remainder derives from an additional source with δ34S = -17.6 ± 1.3‰. We suggest that pseudomorphic replacement of barite led first to the formation of greigite (Fe3S4), where one mole of sulfur was provided by barite and the other three moles of sulfur were contributed by FeS(aq); the latter formed by reaction of Fe2 + with sulfide from microbial sulfate reduction. Transformation of greigite to pyrite occurred via the sulfur addition and/or iron loss pathways. These

  2. Barium hexaferrite suspensions for electrophoretic deposition.

    PubMed

    Ovtar, Simona; Lisjak, Darja; Drofenik, Miha

    2009-09-15

    In this investigation we have looked at the preparation of barium hexaferrite suspensions, with the stability of the magnetic barium hexaferrite particles being increased by the addition of a surfactant, dodecylbenzylsulfonic acid (DBSA). The influence of the solubility DBSA in different solvents and its adsorption onto the surfaces of particles with different sizes were determined from zeta-potential measurements. The most suitable and stable suspensions of barium hexaferrite particles, regardless of their sizes, were obtained in 1-butanol, and these were then used for a subsequent electrophoretic deposition. The microstructures of the deposits were examined with electron microscopy. The thickness and density of the deposits as a function of the electric field, the zeta-potential, the particle size, and the separation distance between the electrodes were investigated. The thickness of the deposits was found to increase with the increasing zeta-potential of the suspension and with the increasing separation distance between the electrodes. Denser deposits were obtained from the suspensions of smaller particles that had narrower particle size distributions.

  3. Creating unstable velocity-space distributions with barium injections

    NASA Technical Reports Server (NTRS)

    Pongratz, M. B.

    1983-01-01

    Ion velocity-space distributions resulting from barium injections from orbiting spacecraft and shaped charges are discussed. Active experiments confirm that anomalous ionization processes may operate, but photoionization accounts for the production of the bulk of the barium ions. Pitch-angle diffusion and/or velocity-space diffusion may occur, but observations of barium ions moving upwards against gravity suggests that the ions retain a significant enough fraction of their initial perpendicular velocity to provide a mirror force. The barium ion plasmas should have a range of Alfven Mach numbers and plasma betas. Because the initial conditions can be predicted these active experiments should permit testing plasma instability hypotheses.

  4. Lanthanide doped strontium-barium cesium halide scintillators

    DOEpatents

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  5. Microbial Sulfate Reduction at Cold Seeps Based on Analysis of Carbonate Associated Sulfate

    NASA Astrophysics Data System (ADS)

    Feng, D.; Peng, Y.

    2014-12-01

    Microbial sulfate reduction and coupled anaerobic oxidation of methane (AOM) are the dominant biogeochemical processes occurring at cold seeps in marine settings. These processes not only support the growth of chemosynthetic communities but also promote the precipitation of authigenic carbonates. However, investigations of microbial sulfate reduction have been conducted only using porewaters or seep-related barites. The fact is that many seeps are either inactive or do not precipitate any barite minerals. Thus, little is known about the microbial sulfate reduction at these seep environments. The occurrence of authigenic carbonate has been documented at almost all cold seep sites, which provide a unique opportunity to investigate the microbial sulfate reduction using such carbonate. The presentation is focused on the concentrations and isotopic signatures of carbonate associated sulfate (CAS). The aim of the project is to determine the role of sulfate and sulfate reduction during carbonate precipitation at cold seeps. The CAS concentrations are 67-537 ppm in high-Mg calcite, 51-181 ppm in low-Mg calcite, and 116-565 in aragonite. The δ34SCAS and δ18OCAS also vary considerably, ranging from 21.9‰ to 56.2‰ (V-CDT) and from 10.1‰ to 24.8‰ (V-SMOW), respectively. On δ34SCAS versus δ18OCAS plots, both aragonite and calcite show linear trends that project down toward those of open seawater sulfate. The trends suggest that sulfate has been isotopically modified to various degrees in pore fluids before being incorporated into carbonate lattice. The much narrower δ34SCAS and δ18OCAS ranges for aragonite than for calcite suggests a much "pickier" condition for aragonite formation during early diagenesis. Our results suggest that concentration and isotopic composition of CAS in seep carbonates may be controlled by the supply of pore-water sulfate during carbonate precipitation. The reliability of CAS in carbonate of early diagenetic origin as a proxy of

  6. Ferrous Sulfate (Iron)

    MedlinePlus

    Ferrous sulfate provides the iron needed by the body to produce red blood cells. It is used to ... Ferrous sulfate comes as regular, coated, and extended-release (long-acting) tablets; regular and extended-release capsules; and ...

  7. Precipitation Recycling

    NASA Technical Reports Server (NTRS)

    Eltahir, Elfatih A. B.; Bras, Rafael L.

    1996-01-01

    The water cycle regulates and reflects natural variability in climate at the regional and global scales. Large-scale human activities that involve changes in land cover, such as tropical deforestation, are likely to modify climate through changes in the water cycle. In order to understand, and hopefully be able to predict, the extent of these potential global and regional changes, we need first to understand how the water cycle works. In the past, most of the research in hydrology focused on the land branch of the water cycle, with little attention given to the atmospheric branch. The study of precipitation recycling which is defined as the contribution of local evaporation to local precipitation, aims at understanding hydrologic processes in the atmospheric branch of the water cycle. Simply stated, any study on precipitation recycling is about how the atmospheric branch of the water cycle works, namely, what happens to water vapor molecules after they evaporate from the surface, and where will they precipitate?

  8. Crystallization of Chicken Egg White Lysozyme from Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth; Pusey, Marc

    1998-01-01

    It has been "known" that chicken egg white lysozyme does not crystallize from sulfate, particularly ammonium sulfate, salts, but instead gives amorphous precipitates. This has been the basis of several studies using lysozyme comparing macromolecule crystal nucleation and amorphous precipitation. Recently Ries-Kautt et al (Acta Cryst D50, (1994) 366) have shown that purified isoionic CEWL could be crystallized from low concentrations of sulfate at basic pH, and we subsequently showed that in fact CEWL could be purified in both the tetragonal and orthorhombic forms using ammonium sulfate over the pH range 4.0 to 7.8 (Acta Cryst D53, (1997) 795). We have now extended these observations to include a range of common sulfate salts, specifically sodium, potassium, rubidium, magnesium, and manganese sulfates. In all cases but the manganese sulfates both the familiar tetragonal and orthorhombic forms were obtained, with unit cell dimensions close to those known for the "classic" sodium chloride crystallized forms. Manganese sulfate has only yielded orthorhombic crystals to date. All crystallizations were carried out using low (typically less than or equal to 6 M) salt and high (greater than approximately 90 mg/ml) protein concentrations. As with ammonium sulfate, the tetragonal - orthorhombic phase shift appears to be a function of both the temperature and the protein concentration, with higher temperatures and concentrations favoring the orthorhombic and lower the tetragonal form. The phase change range is somewhat reduced for the sulfate salts, depending upon conditions being typically between approximately 15 - 20 C. Both the magnesium and manganese sulfates gave crystals at salt concentrations over 0.6 M as well, with magnesium sulfate giving a very slowly nucleating and growing hexagonal form. A triclinic crystal form, characterized by aggressively small crystals (typically 0.1 mm in size) has been occasionally obtained from ammonium sulfate. Finally, preliminary spot

  9. STRONTIUM PRECIPITATION

    DOEpatents

    McKenzie, T.R.

    1960-09-13

    A process is given for improving the precipitation of strontium from an aqueous phosphoric-acid-containing solution with nickel or cobalt ferrocyanide by simultaneously precipitating strontium or calcium phosphate. This is accomplished by adding to the ferrocyanide-containing solution calcium or strontium nitrate in a quantity to yield a concentration of from 0.004 to 0.03 and adjusting the pH of the solution to a value of above 8.

  10. Binding and leakage of barium in alginate microbeads.

    PubMed

    Mørch, Yrr A; Qi, Meirigeng; Gundersen, Per Ole M; Formo, Kjetil; Lacik, Igor; Skjåk-Braek, Gudmund; Oberholzer, Jose; Strand, Berit L

    2012-11-01

    Microbeads of alginate crosslinked with Ca(2+) and/or Ba(2+) are popular matrices in cell-based therapy. The aim of this study was to quantify the binding of barium in alginate microbeads and its leakage under in vitro and accumulation under in vivo conditions. Low concentrations of barium (1 mM) in combination with calcium (50 mM) and high concentrations of barium (20 mM) in gelling solutions were used for preparation of microbeads made of high-G and high-M alginates. High-G microbeads accumulated barium from gelling solution and contained higher concentrations of divalent ions for both low- and high-Ba exposure compared with high-G microbeads exposed to calcium solely and to high-M microbeads for all gelling conditions. Although most of the unbound divalent ions were removed during the wash and culture steps, leakage of barium was still detected during storage. Barium accumulation in blood and femur bone of mice implanted with high-G beads was found to be dose-dependent. Estimated barium leakage relevant to transplantation to diabetic patients with islets in alginate microbeads showed that the leakage was 2.5 times lower than the tolerable intake value given by WHO for high-G microbeads made using low barium concentration. The similar estimate gave 1.5 times higher than is the tolerable intake value for the high-G microbeads made using high barium concentration. To reduce the risk of barium accumulation that may be of safety concern, the microbeads made of high-G alginate gelled with a combination of calcium and low concentration of barium ions is recommended for islet transplantation.

  11. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    SciTech Connect

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-15

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to {approx}2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to {approx}80 m{sup 2}/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions. - Graphical abstract: Surface fractal dimension of amorphous sulfated zirconia and specific surface area and catalytic activity of crystalline sulfated zirconia as a function of precipitation pH. Highlights: Black-Right-Pointing-Pointer Structural transformation of amorphous hydrous zirconia into sulfated zirconia is studied. Black-Right-Pointing-Pointer Precipitation pH controls surface fractal dimension of amorphous zirconia gels. Black-Right-Pointing-Pointer Precipitation pH is the key factor governing properties of sulfated zirconia.

  12. Hydrometallurgical process for recovering iron sulfate and zinc sulfate from baghouse dust

    DOEpatents

    Zaromb, S.; Lawson, D.B.

    1994-02-15

    A process for recovering zinc-rich and iron-rich fractions from the baghouse dust that is generated in various metallurgical operations, especially in steel-making and other iron-making plants, comprises the steps of leaching the dust by hot concentrated sulfuric acid so as to generate dissolved zinc sulfate and a precipitate of iron sulfate, separating the precipitate from the acid by filtration and washing with a volatile liquid, such as methanol or acetone, and collecting the filtered acid and the washings into a filtrate fraction. The volatile liquid may be recovered by distillation, and the zinc may be removed from the filtrate by alternative methods, one of which involves addition of a sufficient amount of water to precipitate hydrated zinc sulfate at 10 C, separation of the precipitate from sulfuric acid by filtration, and evaporation of water to regenerate concentrated sulfuric acid. The recovery of iron may also be effected in alternative ways, one of which involves roasting the ferric sulfate to yield ferric oxide and sulfur trioxide, which can be reconverted to concentrated sulfuric acid by hydration. The overall process should not generate any significant waste stream. 1 figure.

  13. Hydrometallurgical process for recovering iron sulfate and zinc sulfate from baghouse dust

    DOEpatents

    Zaromb, Solomon; Lawson, Daniel B.

    1994-01-01

    A process for recovering zinc/rich and iron-rich fractions from the baghouse dust that is generated in various metallurgical operations, especially in steel-making and other iron-making plants, comprises the steps of leaching the dust by hot concentrated sulfuric acid so as to generate dissolved zinc sulfate and a precipitate of iron sulfate, separating the precipitate from the acid by filtration and washing with a volatile liquid, such as methanol or acetone, and collecting the filtered acid and the washings into a filtrate fraction. The volatile liquid may be recovered distillation, and the zinc may be removed from the filtrate by alternative methods, one of which involves addition of a sufficient amount of water to precipitate hydrated zinc sulfate at 10.degree. C., separation of the precipitate from sulfuric acid by filtration, and evaporation of water to regenerate concentrated sulfuric acid. The recovery of iron may also be effected in alternative ways, one of which involves roasting the ferric sulfate to yield ferric oxide and sulfur trioxide, which can be reconverted to concentrated sulfuric acid by hydration. The overall process should not generate any significant waste stream.

  14. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance... manganese strontium oxide (PMN P-00-1124; CAS No. 359427-90-0) is subject to reporting under this...

  15. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance... manganese strontium oxide (PMN P-00-1124; CAS No. 359427-90-0) is subject to reporting under this...

  16. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance... manganese strontium oxide (PMN P-00-1124; CAS No. 359427-90-0) is subject to reporting under this...

  17. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance... manganese strontium oxide (PMN P-00-1124; CAS No. 359427-90-0) is subject to reporting under this...

  18. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance... manganese strontium oxide (PMN P-00-1124; CAS No. 359427-90-0) is subject to reporting under this...

  19. Europium-doped barium bromide iodide

    SciTech Connect

    Gundiah, Gautam; Hanrahan, Stephen M.; Hollander, Fredrick J.; Bourret-Courchesne, Edith D.

    2009-10-21

    Single crystals of Ba0.96Eu0.04BrI (barium europium bromide iodide) were grown by the Bridgman technique. The title compound adopts the ordered PbCl2 structure [Braekken (1932). Z. Kristallogr. 83, 222-282]. All atoms occupy the fourfold special positions (4c, site symmetry m) of the space group Pnma with a statistical distribution of Ba and Eu. They lie on the mirror planes, perpendicular to the b axis at y = +-0.25. Each cation is coordinated by nine anions in a tricapped trigonal prismatic arrangement.

  20. Short-cavity squeezing in barium

    NASA Technical Reports Server (NTRS)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.

    1992-01-01

    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  1. Vacancy ordering in reduced barium titanate

    NASA Astrophysics Data System (ADS)

    Woodward, David I.; Reaney, Ian M.; Yang, Gaiying Y.; Dickey, Elizabeth C.; Randall, Clive A.

    2004-06-01

    A crystal structure is proposed for reduced barium titanate, BaTiO3-δ, δ≈0.33, formed during the degradation of Ni-BaTiO3 X7R multilayer ceramic capacitors. High-resolution transmission electron microscopy and selected-area electron diffraction have been used in combination with computer simulations to show that oxygen vacancies accrete on every third pseudocubic {111} plane, resulting in a cell with space group P3m1. Additionally, from electron energy loss spectroscopy, it is proposed that Ti4+ is reduced to Ti3+ as a mechanism of charge compensation within oxygen-deficient octahedra.

  2. The first barium tin(II) bromide fluoride

    NASA Astrophysics Data System (ADS)

    Dénès, Georges; Merazig, Hocine; Muntasar, Abdualhafeed; Porterfield, Robyn

    2014-04-01

    In an effort to prepare barium tin(II) bromide fluorides for the first time, possibly similar to the chloride fluorides obtained earlier in our laboratory, precipitation reactions were carried out by mixing aqueous solutions of SnF2 and of BaBr2.2H2O. In contrast with the chloride fluoride system, a single powdered phase was obtained throughout the SnF2 - BaBr2 system, with the yield being maximum at X ≈ 0.25, where X is the molar fraction of barium bromide in the reaction mixture. Phase identification with the JCPDS database failed to produce a match, confirming that a new phase had been produced. The exact chemical composition of the new compound has not been obtained yet. Based on the X value for the maximum yield, the Sn/Ba ratio is likely to be 3/1 or 2/1. The Mössbauer spectrum at ambient conditions shows that bonding to tin(II) is covalent, therefore with the tin lone pair being stereoactive. The Mössbauer parameters ( δ = 3.68 mm/s, Δ = 0.99 mm/s) are similar to those of SnBrF and of Sn2BrF5, thereby showing that tin is bonded to both fluorine and bromine. The larger isomer shift and lower quadrupole splitting than in tin(II) fluorides show that the stereoactivity of the tin lone pair is lower than in the fluorides. The Mössbauer parameters fit well the linear correlation of the quadrupole splitting versus the isomer shift" that has been shown to be present in other series of tin(II) compounds. The linear decrease on this correlation shows that the contribution of non-spherical orbitals ( p and d) to the lone pair is a much larger contributor to the quadrupole splitting than lattice distortions. The structure is likely made of Ba2+ cations and tin(II) fluoride bromide polyatomic anions, with covalent bonding withinthe anions.

  3. Degradation process of lead chromate in paintings by Vincent van Gogh studied by means of spectromicroscopic methods. 4. Artificial aging of model samples of co-precipitates of lead chromate and lead sulfate.

    PubMed

    Monico, Letizia; Janssens, Koen; Miliani, Costanza; Van der Snickt, Geert; Brunetti, Brunetto Giovanni; Cestelli Guidi, Mariangela; Radepont, Marie; Cotte, Marine

    2013-01-15

    Previous investigations about the darkening of chrome yellow pigments revealed that this form of alteration is attributable to a reduction of the original Cr(VI) to Cr(III), and that the presence of sulfur-containing compounds, most often sulfates, plays a key role during this process. We recently demonstrated that different crystal forms of chrome yellow pigments (PbCrO(4) and PbCr(1-x)S(x)O(4)) are present in paintings by Vincent van Gogh. In the present work, we show how both the chemical composition and the crystalline structure of lead chromate-based pigments influence their stability. For this purpose, oil model samples made with in-house synthesized powders of PbCrO(4) and PbCr(1-x)S(x)O(4) were artificially aged and characterized. We observed a profound darkening only for those paint models made with PbCr(1-x)S(x)O(4), rich in SO(4)(2-) (x ≥ 0.4), and orthorhombic phases (>30 wt %). Cr and S K-edge micro X-ray absorption near edge structure investigations revealed in an unequivocal manner the formation of up to about 60% of Cr(III)-species in the outer layer of the most altered samples; conversely, independent of the paint models' chemical composition, no change in the S-oxidation state was observed. Analyses employing UV-visible diffuse reflectance and Fourier transform infrared spectroscopy were performed on unaged and aged model samples in order to obtain additional information on the physicochemical changes induced by the aging treatment.

  4. PRECIPITATION METHOD OF SEPARATING PLUTONIUM FROM CONTAMINATING ELEMENTS

    DOEpatents

    Duffield, R.B.

    1959-02-24

    S>A method is described for separating plutonium, in a valence state of less than five, from an aqueous solution in which it is dissolved. The niethod consists in adding potassium and sulfate ions to such a solution while maintaining the solution at a pH of less than 7.1, and isolating the precipitate of potassium plutonium sulfate thus formed.

  5. Barium appendicitis: A single institution review in Japan

    PubMed Central

    Katagiri, Hideki; Lefor, Alan Kawarai; Kubota, Tadao; Mizokami, Ken

    2016-01-01

    AIM To review clinical experience with barium appendicitis at a single institution. METHODS A retrospective review of patients admitted with a diagnosis of acute appendicitis, from January 1, 2013 to December 31, 2015 was performed. Age, gender, computed tomography (CT) scan findings if available, past history of barium studies, pathology, and the presence of perforation or the development of complications were reviewed. If the CT scan revealed high density material in the appendix, the maximum CT scan radiodensity of the material is measured in Hounsfield units (HU). Barium appendicitis is defined as: (1) patients diagnosed with acute appendicitis; (2) the patient has a history of a prior barium study; and (3) the CT scan shows high density material in the appendix. Patients who meet all three criteria are considered to have barium appendicitis. RESULTS In total, 396 patients were admitted with the diagnosis of acute appendicitis in the study period. Of these, 12 patients (3.0%) met the definition of barium appendicitis. Of these 12 patients, the median CT scan radiodensity of material in the appendix was 10000.8 HU, ranging from 3066 to 23423 HU (± 6288.2). In contrast, the median CT scan radiodensity of fecaliths in the appendix, excluding patients with barium appendicitis, was 393.1 HU, ranging from 98 to 2151 HU (± 382.0). The CT scan radiodensity of material in the appendices of patients with barium appendicitis was significantly higher than in patients with nonbarium fecaliths (P < 0.01). CONCLUSION Barium appendicitis is not rare in Japan. Measurement of the CT scan radiodensity of material in the appendix may differentiate barium appendicitis from routine appendicitis. PMID:27721929

  6. On the suppression of superconducting phase formation in YBCO materials by templated synthesis in the presence of a sulfated biopolymer

    NASA Astrophysics Data System (ADS)

    Smith, Elliott; Schnepp, Zoe; Wimbush, Stuart C.; Hall, Simon R.

    2008-11-01

    The use of biopolymers as templates to control superconductor crystallization is a recent phenomenon and is generating a lot of interest both from the superconductor community and in materials chemistry circles. This work represents a critical finding in the use of such biopolymers, in particular the contraindicatory nature of sulfur when attempting to affect a morphologically controlled synthesis. Synthesis of superconducting nanoparticles was attempted using carrageenan as a morphological template. Reactive sulfate groups on the biopolymer prevent this, producing instead significant quantities of barium sulfate nanotapes. By substituting the biopolymer for structurally analogous, non-sulfated agar, we show that superconducting nanoparticles could be successfully synthesized.

  7. Barium toxicity effects in soybean plants.

    PubMed

    Suwa, Ryuichi; Jayachandran, Krish; Nguyen, Nguyen Tran; Boulenouar, Abdellah; Fujita, Kounosuke; Saneoka, Hirofumi

    2008-10-01

    Barium (Ba)-induced phytotoxicity at 100, 1000, or 5000 microM Ba in soybean plants (Glycine max) was investigated under hydroponic culture conditions. Soybean growth and leaf photosynthetic activity were significantly inhibited by all three levels of Ba treatments. In the case of photosynthetic activity, 5000 microM Ba treatment shutdown stomatal opening and perturbed carbon fixation metabolism and translocation. However, 100 and 1000 microM Ba treatments shut down stomatal opening and inhibited carbon fixation, but without perturbation of leaf carbon fixation-related metabolism. Potassium (K) absorption by soybean roots was also reduced in all three Ba treatments. This decreased K absorption reduced K localization at guard cells. Barium accumulation in guard cells also inhibited K transport from epidermal cells to guard cells. This lack of K in guard cells resulted in stomatal closure. As a result of inhibition of K transport into guard cells and stomatal shutdown, photosynthetic activity and plant productivity were inhibited. Our experiment indicates that Ba has phytotoxic effects on soybean plants by inhibiting photosynthesis.

  8. Sulfate in fetal development.

    PubMed

    Dawson, Paul A

    2011-08-01

    Sulfate (SO(4)(2-)) is an important nutrient for human growth and development, and is obtained from the diet and the intra-cellular metabolism of sulfur-containing amino acids, including methionine and cysteine. During pregnancy, fetal tissues have a limited capacity to produce sulfate, and rely on sulfate obtained from the maternal circulation. Sulfate enters and exits placental and fetal cells via transporters on the plasma membrane, which maintain a sufficient intracellular supply of sulfate and its universal sulfonate donor 3'-phosphoadenosine 5'-phosphosulfate (PAPS) for sulfate conjugation (sulfonation) reactions to function effectively. Sulfotransferases mediate sulfonation of numerous endogenous compounds, including proteins and steroids, which biotransforms their biological activities. In addition, sulfonation of proteoglycans is important for maintaining normal structure and development of tissues, as shown for reduced sulfonation of cartilage proteoglycans that leads to developmental dwarfism disorders and four different osteochondrodysplasias (diastrophic dysplasia, atelosteogenesis type II, achondrogenesis type IB and multiple epiphyseal dysplasia). The removal of sulfate via sulfatases is an important step in proteoglycan degradation, and defects in several sulfatases are linked to perturbed fetal bone development, including mesomelia-synostoses syndrome and chondrodysplasia punctata 1. In recent years, interest in sulfate and its role in developmental biology has expanded following the characterisation of sulfate transporters, sulfotransferases and sulfatases and their involvement in fetal growth. This review will focus on the physiological roles of sulfate in fetal development, with links to human and animal pathophysiologies.

  9. Immunoaffinity centrifugal precipitation chromatography.

    PubMed

    Qi, Lin; Ito, Yoichiro

    2007-06-01

    Purification of proteins based on immunoaffinity has been performed using a solid support coated with antibody against the target proteins. The method requires immobilizing the antibody onto the solid support using protein A or G, and has a risk of adsorptive loss of target proteins onto the solid support. Centrifugal precipitation chromatography has been successfully used to purify enzymes, such as ketosteroid isomerase and hyaluronidase without the use of solid support. The purpose of this study is to demonstrate that immunoaffinity centrifugal precipitation chromatography is capable of isolating an antigen by exploiting antigen-antibody binding. The separation was initiated by filling both channels with 40% saturated ammonium sulfate (AS) of pH 4-4.5 followed by loading 20 microl of human plasma (National Institutes of Health blood bank) mixed with 2 mg of rabbit anti-HSA (human serum protein) antibody (Sigma). Then, the sample channel was eluted with water at 0.03 ml/min and AS channel with 40% AS solution of pH 4-4.5 at 1 ml/min until all non-binding components were eluted. Then, the releasing reagent (50% AS solution containing 0.5 M glycine and 10% ammonium hydroxide at pH 10) was introduced through the AS channel to release the target protein (HSA). The retained antibody was recovered by eluting the sample channel with water at 1 ml/min. A hollow fiber membrane device at the outlet (MicroKros, Spectrum, New Brunswick, NJ, USA) was provided on-line dialysis of the eluent before fractions were collected, so that the fractions could be analyzed by SDS-PAGE (sodium dodecyl sulfate - polyacrylamide gel electrophoresis) without further dialysis. The current method does not require immobilizing the antibody onto a matrix, which is used by the conventional immunoaffinity chromatography. This method ensures full recovery of the antigen and antibody, and it may be applied to purification of other proteins.

  10. Precipitation Matters

    ERIC Educational Resources Information Center

    McDuffie, Thomas

    2007-01-01

    Although weather, including its role in the water cycle, is included in most elementary science programs, any further examination of raindrops and snowflakes is rare. Together rain and snow make up most of the precipitation that replenishes Earth's life-sustaining fresh water supply. When viewed individually, raindrops and snowflakes are quite…

  11. Methods for sulfate removal in liquid-phase catalytic hydrothermal gasification of biomass

    DOEpatents

    Elliott, Douglas C; Oyler, James R

    2014-11-04

    Processing of wet biomass feedstock by liquid-phase catalytic hydrothermal gasification must address catalyst fouling and poisoning. One solution can involve heating the wet biomass with a heating unit to a pre-treatment temperature sufficient for organic constituents in the feedstock to decompose, for precipitates of inorganic wastes to form, for preheating the wet feedstock in preparation for subsequent removal of soluble sulfate contaminants, or combinations thereof. Processing further includes reacting the soluble sulfate contaminants with cations present in the feedstock material to yield a sulfate-containing precipitate and separating the inorganic precipitates and/or the sulfate-containing precipitates out of the wet feedstock. Having removed much of the inorganic wastes and the sulfate contaminants that can cause poisoning and fouling, the wet biomass feedstock can be exposed to the heterogeneous catalyst for gasification.

  12. Methods for sulfate removal in liquid-phase catalytic hydrothermal gasification of biomass

    DOEpatents

    Elliott, Douglas C; Oyler, James

    2013-12-17

    Processing of wet biomass feedstock by liquid-phase catalytic hydrothermal gasification must address catalyst fouling and poisoning. One solution can involve heating the wet biomass with a heating unit to a pre-treatment temperature sufficient for organic constituents in the feedstock to decompose, for precipitates of inorganic wastes to form, for preheating the wet feedstock in preparation for subsequent removal of soluble sulfate contaminants, or combinations thereof. Processing further includes reacting the soluble sulfate contaminants with cations present in the feedstock material to yield a sulfate-containing precipitate and separating the inorganic precipitates and/or the sulfate-containing precipitates out of the wet feedstock. Having removed much of the inorganic wastes and the sulfate contaminants that can cause poisoning and fouling, the wet biomass feedstock can be exposed to the heterogenous catalyst for gasification.

  13. APPLICATION OF NONINVASIVE PREGNANCY DIAGNOSIS IN BACTRIAN CAMELS (CAMELUS BACTRIANUS) USING CUBONI REACTION AND BARIUM CHLORIDE TEST.

    PubMed

    Fedorova, Tamara; Brandlová, Karolína; Lukešová, Daniela

    2015-06-01

    Pregnancy diagnoses in half-tamed animals are often very complicated. This study aimed to examine the alternative noninvasive and cheap methods of pregnancy diagnosis from urine in domestic Bactrian camels (Camelus bactrianus). Urine from 14 female camels kept in four European zoologic gardens was collected and tested by two chemical tests--Cuboni reaction and barium chloride test. The Cuboni reaction was significantly (P<0.01) affected by the pregnancy status of female camels. The total accuracy of the Cuboni reaction was 70.5% but it increased significantly (P<0.05) in the time leading up to parturition. The accuracy was 100% in the 3rd third of pregnancy. Urine of nonpregnant females did not react with a solution of barium chloride while, contrary to other studies, white precipitates formed mostly (80 to 100%) in urine of pregnant females. This study concluded that the Cuboni reaction is applicable for pregnancy diagnosis in camels.

  14. Sol-gel synthesis of macroporous barium zirconate monoliths from ionic precursors via a phase separation route

    NASA Astrophysics Data System (ADS)

    Guo, Xingzhong; Wang, Zichen; Song, Jie; Yang, Hui

    2017-03-01

    Monolithic macroporous barium zirconate derived from ionic precursors has been successfully prepared via a phase separation route in the presence of poly(ethylene oxide) (PEO) and propyleneoxide (PO). Poly(ethylene oxide) (PEO) acts as a phase separation inducer, while propyleneoxide (PO) acts as a gelation accelerant in the sol-gel process. Appropriate choice of poly(ethylene oxide) (PEO) and propyleneoxide (PO) allows the production of continuous macroporous monolithic gel with a porosity of ca. 63% and a macropore size of 1.8 μm. Some BaCl2 recrystallizes in the dried gel, and subsequently tetragonal ZrO2 phase precipitates after heat-treated at 800 °C. The crystalline phase barium zirconate forms after heat treatment at 1100 °C in air, while the macroporous structure is preserved with a slight increase of porosity and a decrease of macropore size.

  15. Sulfation pathways in plants.

    PubMed

    Koprivova, Anna; Kopriva, Stanislav

    2016-11-25

    Plants take up sulfur in the form of sulfate. Sulfate is activated to adenosine 5'-phosphosulfate (APS) and reduced to sulfite and then to sulfide when it is assimilated into amino acid cysteine. Alternatively, APS is phosphorylated to 3'-phosphoadenosine 5'-phosphosulfate (PAPS), and sulfate from PAPS is transferred onto diverse metabolites in its oxidized form. Traditionally, these pathways are referred to as primary and secondary sulfate metabolism, respectively. However, the synthesis of PAPS is essential for plants and even its reduced provision leads to dwarfism. Here the current knowledge of enzymes involved in sulfation pathways of plants will be summarized, the similarities and differences between different kingdoms will be highlighted, and major open questions in the research of plant sulfation will be formulated.

  16. Do all barium stars have a white dwarf companion?

    NASA Technical Reports Server (NTRS)

    Dominy, J. F.; Lambert, D. L.

    1983-01-01

    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  17. Heparan Sulfate Proteoglycans

    PubMed Central

    Sarrazin, Stephane; Lamanna, William C.; Esko, Jeffrey D.

    2011-01-01

    Heparan sulfate proteoglycans are found at the cell surface and in the extracellular matrix, where they interact with a plethora of ligands. Over the last decade, new insights have emerged regarding the mechanism and biological significance of these interactions. Here, we discuss changing views on the specificity of protein–heparan sulfate binding and the activity of HSPGs as receptors and coreceptors. Although few in number, heparan sulfate proteoglycans have profound effects at the cellular, tissue, and organismal level. PMID:21690215

  18. Response of Ned Wilson Lake watershed, Colorado, to changes in atmospheric deposition of sulfate

    SciTech Connect

    Campbell, D.H.; Turk, J.T.; Spahr, N.E. )

    1991-08-01

    The Ned Wilson Lake watershed responds directly and rapidly to changes in precipitation inputs of sulfate, which has important implications for effect of acid deposition on the aquatic system. Chemistry at three precipitation collection sites and three watershed sites (a pond, a lake, and a spring) has been monitored in and near the Flattops Wilderness Area in northwestern Colorado beginning in 1981-1983. Bulk snowpack concentration of sulfate in the watershed and volume-weighted annual mean concentration of sulfate in precipitation at two nearby sites generally decreased from 1981 to 1985, were small through 1987, and increased in 1988-1989. Changes in concentration of sulfate at the watershed sites are controlled by precipitation inputs. Responsiveness of the individual sites was dependent on their position along the hydrologic flow path. The fastest response was in the pond, which has a hydrologic residence time of less than 1 year; over 90% of the variance in concentration of sulfate in the pond was explained by changes in concentration in precipitation. The lake has a hydrologic residence time of 1 to 4 years; a regression model of the concentration of sulfate in the lake, as a function of the concentration in the lake during the previous year and the concentration in precipitation, explained 87% of the variance in concentration of sulfate in the lake. The hydrologic response time of the spring is unknown; it was not responsive to changes in concentration of sulfate in precipitation. The recent increase of sulfate concentration in precipitation and in the pond and lake is evidence for a rapid rather than a delayed response, which could not be determined when only a decreasing trend in sulfate concentration was reported in 1982-1987.

  19. Microstructure and magnetism in barium strontium titanate (BSTO)-barium hexaferrite (BaM) multilayers

    SciTech Connect

    Frey, N.A.; Heindl, R.; Srinath, S.; Srikanth, H. . E-mail: sharihar@cas.usf.edu; Dudney, N.J.

    2005-08-11

    High quality multilayers of barium ferrite (BaM) and barium strontium titanate (BSTO) were grown in optimized conditions on thermally oxidized Si(1 0 0) and Al{sub 2}O{sub 3} substrates using magnetron sputtering. As-grown films were amorphous and different annealing procedures were explored to stabilize crystalline phases. BSTO and BaM phases were identified using X-ray diffraction and cross-sectional scanning electron micrographs showed sharp interfaces between BSTO and BaM layers. Magnetic hysteresis loops obtained at various temperatures and field orientations showed a large coercivity ({approx}2500 Oe) consistent with the hard magnetic hexaferrite component. Hysteresis loops also revealed the distinct influence of magnetocrystalline and shape anisotropies at different temperature ranges.

  20. Impact of glacial/interglacial changes in water column geochemistry on the diagenetic cycling of barium in Black Sea sediments

    NASA Astrophysics Data System (ADS)

    Kasten, S.; Henkel, S.; Mogollón, J. M.; Nöthen, K.; Franke, C.; Bogus, K.; Robin, E.; Bahr, A.; Blumenberg, M.; Pape, T.; Seifert, R.; Marz, C.; De Lange, G. J.

    2012-12-01

    Changes in depositional conditions and redox environment over time affect biogeochemical processes in the seabed and in this way control the variable and selective preservation, alteration and formation of various sediment constituents and attributes - including particulate organic matter, mineral assemblages and magnetic properties. As many of these solid-phase compounds are used as paleo-environmental tracers or stratigraphic tools an assessment of diagenetic influences on the sedimentary record is crucial for accurate environmental reconstructions. We present an integrated approach of pore-water and solid-phase geochemistry as well as transport reaction modeling for sediments of the Black Sea to assess the biogeochemical history of these deposits with particular emphasis on post-depositional redistribution of barium as a consequence of changes in water column geochemistry and redox (Henkel et al., 2012). High-resolution sedimentary records of major and minor elements (Al, Ba, Ca, Sr, Ti), total organic carbon (TOC), and profiles of pore-water constituents (SO42-, CH4, Ca2+, Ba2+, Mg2+, alkalinity) were obtained for two gravity cores (core 755, 501 m water depth and core 214, 1686 m water depth) from the northwestern Black Sea. The records were examined in order to gain insight into the cycling of Ba in anoxic marine sediments characterized by a shallow sulfate-methane transition (SMT) as well as the applicability of barite as a primary productivity proxy in such a setting. The Ba records are strongly overprinted by diagenetic barite (BaSO4) remobilization and precipitation; authigenic Ba enrichments were found at both sites at and slightly above the current SMT. Transport reaction modeling was applied to simulate the migration of the SMT during the changing geochemical conditions after the Holocene seawater intrusion into the Black Sea. Based on this, sediment intervals affected by diagenetic Ba redistribution were identified. Results reveal that the intense

  1. Proton conductivity of potassium doped barium zirconates

    SciTech Connect

    Xu Xiaoxiang; Tao Shanwen; Irvine, John T.S.

    2010-01-15

    Potassium doped barium zirconates have been synthesized by solid state reactions. It was found that the solubility limit of potassium on A-sites is between 5% and 10%. Introducing extra potassium leads to the formation of second phase or YSZ impurities. The water uptake of barium zirconates was increased even with 5% doping of potassium at the A-site. The sintering conditions and conductivity can be improved significantly by adding 1 wt% ZnO during material synthesis. The maximum solubility for yttrium at B-sites is around 15 at% after introducing 1 wt% zinc. The conductivity of Ba{sub 0.95}K{sub 0.05}Zr{sub 0.85}Y{sub 0.11}Zn{sub 0.04}O{sub 3-{delta}} at 600 deg. C is 2.2x10{sup -3} S/cm in wet 5% H{sub 2}. The activation energies for bulk and grain boundary are 0.29(2), 0.79(2) eV in wet 5% H{sub 2} and 0.31(1), 0.74(3) eV in dry 5% H{sub 2}. A power density of 7.7 mW/cm{sup 2} at 718 deg. C was observed when a 1 mm thick Ba{sub 0.95}K{sub 0.05}Zr{sub 0.85}Y{sub 0.11}Zn{sub 0.04}O{sub 3-{delta}} pellet was used as electrolyte and platinum electrodes. - Graphical abstract: Potassium doped barium zirconates have been synthesized by solid state reactions. It was found that the solubility limit of potassium on A-sites is between 5% and 10 %. The sintering conditions and conductivity can be improved significantly by adding 1 wt% ZnO during material synthesis. Five percent doping of potassium at A-site can double the total conductivity.

  2. A high-altitude barium radial injection experiment

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Deehr, C. S.; Romick, G. J.; Olson, J. V.; Roederer, J. G.; Sydora, R.

    1980-01-01

    A rocket launched from Poker Flat, Alaska, carried a new type of high-explosive barium shaped charge to 571 km, where detonation injected a thin disk of barium vapor with high velocity nearly perpendicular to the magnetic field. The TV images of the injection are spectacular, revealing three major regimes of expanding plasma which showed early instabilities in the neutral gas. The most unusual effect of the injection is a peculiar rayed barium-ion structure lying in the injection plane and centered on a 5 km 'black hole' surrounding the injection point. Preliminary electrostatic computer simulations show a similar rayed development.

  3. Acidic precipitation

    SciTech Connect

    Martin, H.C.

    1987-01-01

    At the International Symposium on Acidic Precipitation, over 400 papers were presented, and nearly 200 of them are included here. They provide an overview of the present state of the art of acid rain research. The Conference focused on atmospheric science (monitoring, source-receptor relationships), aquatic effects (marine eutrophication, lake acidification, impacts on plant and fish populations), and terrestrial effects (forest decline, soil acidification, etc.).

  4. Barium carbonate catalysis of carbon gasification

    SciTech Connect

    Ersolmaz, C.; Falconer, J.L.

    1985-01-01

    The interaction of barium carbonate with carbon black was studied to understand catalyzed CO/sub 2/ gasification of carbon. Temperature-programmed reaction with isotopic labeling of the carbonate and the carbon showed that carbon dramatically accelerated with rate of BaCO/sub 3/ decomposition to form BaO and CO/sub 2/, which rapidly gasified carbon to form CO. Pure BaCO/sub 3/ was observed to exchange carbon dioxide with the gas-phase, and the exchange rate was significantly increased by carbon at higher temperatures, due to formation of a carbon-carbonate complex. The interaction of BaCO/sub 3/ and C to form a complex occurred well below gasification temperatures, and BaCO/sub 3/ did not decompose until after gasification began and the gas phase CO/sub 2/ concentration was low.

  5. A triangular heterometallic siloxide containing barium

    SciTech Connect

    Coan, P.S.; Streib, W.E.; Caulton, K.G. )

    1991-12-25

    Reaction of KOSiPh[sub 3] with Ba[sub 3](OSiPh[sub 3])[sub 6](THF) in THF displaces barium from the triangular reagent to yield a colorless solid. Recrystallization in the presence of MeOC[sub 2]H[sub 4]OMe(DME) yields KBa[sub 2](OSiPh[sub 3])[sub 5](DME)[sub 2], characterized by [sup 1]H and [sup 29]Si NMR spectroscopy and X-ray diffraction. The molecule contains a triangular KBa[sub 2]([mu][sub 3]-OSiPh[sub 3])[sub 2]([mu][sub 2]-OSiPh[sub 3])[sub 3] core with [eta][sup 1] and [eta][sup 2]-DME ligation on each barium. The benzene-soluble molecule is fluxional in solution at both the OSiPh[sub 3] and the DME groups. At -70C in CH[sub 2]Cl[sub 2]/C[sub 6]D[sub 6], both [eta][sup 1]-DME/[eta][sup 2]-DME site exchange and intramolecular siloxide migration have been slowed, and the spectra are in agreement with retention of the solid-state structure in solution. Crystallographic data for KBa[sub 2](OSiPh[sub 3])[sub 5](DME)[sub 2] (-159C): a = 15.474 (3) [angstrom], b = 26.466 (6) [angstrom], c = 23.783 (5) [angstrom], [beta] = 99.80 (1)[degree] with Z = 4 in space group P2[sub 1]/n.

  6. Calculated emission rates for barium releases in space

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.

    1989-01-01

    The optical emissions from barium releases in space are caused by resonance and fluorescent scattering of sunlight. Emission rates for the dominant ion and neutral lines are calculated assuming the release to be optically thin and the barium to be in radiative equilibrium with the solar radiation. The solar spectrum has deep Fraunhofer absorption lines at the primary barium ion resonances. A velocity component toward or away from the sun will Doppler shift the emission lines relative to the absorption lines and the emission rates will increase many-fold over the rest value. The Doppler brightening is important in shaped charge or satellite releases where the barium is injected at high velocities. Emission rates as a function of velocity are calculated for the 4554, 4934, 5854, 6142 and 6497 A ion emission lines and the dominant neutral line at 5535 A. Results are presented for injection parallel to the ambient magnetic field, B, and for injection at an angle to B.

  7. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    PubMed Central

    Gupta, Pankaj; Debi, Uma; Sinha, Saroj Kant; Prasad, Kaushal Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract (GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence, a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities. PMID:25170399

  8. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1983-01-01

    The feasibility of making non-volatile digital memory devices of barium titanate, BaTiO3, that are integrated onto a silicon substrate with the required ferroelectric film produced by processing, compatible with silicon technology was examined.

  9. Acidic Fluids Across Mars: Detections of Magnesium-Nickel Sulfates

    NASA Technical Reports Server (NTRS)

    Yen, A. S.; Ming, D. W.; Gellert, R.; Mittlefehldt, D. W.; Rampe, E. B.; Vaniman, D. T.; Thompson, L. M.; Morris, R. V.; Clark, B. C.; VanBommel, S. J.

    2017-01-01

    Calcium, magnesium and ferric iron sulfates have been detected by the instrument suites on the Mars rovers. A subset of the magnesium sulfates show clear associations with nickel. These associations indicate Ni(2+) co-precipitation with or substitution for Mg(2+) from sulfate-saturated solutions. Nickel is ex-tracted from primary rocks almost exclusively at pH values less than 6, constraining the formation of these Mg-Ni sulfates to mildly to strongly acidic conditions. There is clear evidence for aqueous alteration at the rim of Endeavour Crater (Meridiani Planum), in the Murray formation mudstone (Gale Crater), and near Home Plate (Gusev Crater). The discovery of Mg-Ni sulfates at these locations indicates a history of fluid-rock interactions at low pH.

  10. Micro-SHINE Uranyl Sulfate Irradiations at the Linac

    SciTech Connect

    Youker, Amanda J.; Kalensky, Michael; Chemerisov, Sergey; Schneider, John; Byrnes, James; Vandegrift, George F.

    2016-08-01

    Peroxide formation due to water radiolysis in a uranyl sulfate solution is a concern for the SHINE Medical Technologies process in which Mo-99 is generated from the fission of dissolved low enriched uranium. To investigate the effects of power density and fission on peroxide formation and uranyl-peroxide precipitation, uranyl sulfate solutions were irradiated using a 50-MeV electron linac as part of the micro-SHINE experimental setup. Results are given for uranyl sulfate solutions with both high and low enriched uranium irradiated at different linac powers.

  11. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    SciTech Connect

    Xu, Jing; Hu, Chenguo; Xi, Yi; Peng, Chen; Wan, Buyong; He, Xiaoshan

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  12. Effect of antiscalants on precipitation of an RO concentrate: metals precipitated and particle characteristics for several water compositions.

    PubMed

    Greenlee, Lauren F; Testa, Fabrice; Lawler, Desmond F; Freeman, Benny D; Moulin, Philippe

    2010-04-01

    Inland brackish water reverse osmosis (RO) is economically and technically limited by the large volume of salty waste (concentrate) produced. The use of a controlled precipitation step, followed by solid/liquid separation (filtration), has emerged as a promising side-stream treatment process to treat reverse osmosis concentrate and increase overall system recovery. The addition of antiscalants to the RO feed prevents precipitation within the membrane system but might have a deleterious effect on a concentrate treatment process that uses precipitation to remove problematic precipitates. The effects of antiscalant type and concentration on salt precipitation and precipitate particle morphology were evaluated for several water compositions. The primary precipitate for the synthetic brackish waters tested was calcium carbonate; the presence of magnesium, sulfate, minor ions, and antiscalant compounds affected the amount of calcium precipitated, as well as the phases of calcium carbonate formed during precipitation. Addition of antiscalant decreased calcium precipitation but increased incorporation of magnesium and sulfate into precipitating calcium carbonate. Antiscalants prevented the growth of nucleated precipitates, resulting in the formation of small (100-200 nm diameter) particles, as well as larger (6-10 microm) particles. Elemental analysis revealed changes in composition and calcium carbonate polymorph with antiscalant addition and antiscalant type. Results indicate that the presence of antiscalants does reduce the extent of calcium precipitation and can worsen subsequent filtration performance.

  13. A search for technetium (Tc II) in barium stars

    NASA Technical Reports Server (NTRS)

    Little-Marenin, Irene R.; Little, Stephen J.

    1987-01-01

    The authors searched without success for the lines of Tc II at 2647.02, 2610.00 and 2543.24 A in IUE spectra of the barium stars HR 5058, Omicron Vir, and Zeta Cap. The lack of Tc II implies that the observed s-process enhancements were produced more than half a million years ago and supports the suggestion that the spectral peculiarities of barium stars are probably related to the binary nature of the stars.

  14. 'Skidding' of the CRRES G-9 barium release

    NASA Technical Reports Server (NTRS)

    Huba, J. D.; Mitchell, H. G.; Fedder, J. A.; Bernhardt, P. A.

    1992-01-01

    A simulation study and experimental data of the CRRES G-9 ionospheric barium release are presented. The simulation study is based on a 2D electrostatic code that incorporates time-dependent coupling to the background plasma. It is shown that the densest portion of the barium ion cloud 'skids' about 15 km within the first three seconds following the release, consistent with the optical data analyses.

  15. Anastomotic stenosis of the descending colon caused by barium granuloma formation following barium peritonitis: report of a case.

    PubMed

    Kitajima, Toshihiro; Tomizawa, Kenji; Hanaoka, Yutaka; Toda, Shigeo; Matoba, Shuichiro; Kuroyanagi, Hiroya; Oota, Yasunori

    2014-11-01

    Anastomotic stricture reportedly often recurs following barium peritonitis, regardless of whether the anastomotic diameter is initially sufficient. However, the causes of repetitive stricture have not been clarified. We report a case that suggests the pathophysiology of recurrent anastomotic strictures following barium peritonitis. The patient was a 39-year-old Japanese man with idiopathic perforation of the descending colon after undergoing an upper gastrointestinal barium contrast study. After emergency peritoneal lavage and diverting colostomy, created using the perforated region, the patient recovered uneventfully and 3 months later, the colostomy was closed and the perforated colon was resected. However, 7 months after colostomy closure, abdominal distention gradually developed, and colonoscopy revealed an anastomotic stricture. The patient was referred to our hospital where he underwent resection of the anastomotic stricture. The surgical specimen exhibited barium granulomas not only in the subserosa of the entire specimen, but also in the submucosa and lamina propria localized in the anastomotic site. These findings suggest that barium was embedded in the submucosa and lamina propria with manipulation of the stapled anastomosis and that the barium trapped in the anastomotic site caused persistent inflammation, resulting in an anastomotic stricture.

  16. Incorporation of /sup 35/S-sulfate and /sup 3/H-glucosamine into heparan and chondroitin sulfates during the cell cycle of B16-F10 cells

    SciTech Connect

    Blair, O.C.; Sartorelli, A.C.

    1984-05-01

    Changes in glycosaminoglycan composition occurring during the cell cycle were determined in B16-F10 cells sorted flow cytometrically with respect to DNA content. Incorporation of /sup 35/S-sulfate into heparan sulfate and chondroitin sulfate of unsorted and G1,S, and G2 +M sorted cells was determined following chondroitinase ABC or nitrous acid treatment; the incorporation into surface material was measured as the difference between the radioactivity of control and trypsin-treated cells. Incorporation of /sup 35/S-sulfate and /sup 3/H-glucosamine into cetyl pyridinium chloride (CPC)-precipitable material was characterized before and after chondroitinase or nitrous acid treatment by Sephadex G50 chromatography. Long-term (48 h) and short-term (1 h) labeling studies demonstrate that (a) the amount of total cellular chondroitin sulfate is greater than that of heparan sulfate, with larger amounts of unsulfated heparan than chondroitin being present; (b) the rate of turnover of heparan sulfate is greater than that of chondroitin sulfate; (c) greatest short-term incorporation of 3H-glucosamine into CPC-precipitable material occurs during S phase; and (d) the rate of turnover of both heparan sulfate and chondroitin sulfate is decreased in S phase relative to G1 and G2 + M.

  17. Influence of the preparation methods on the structure and magnetic properties of nanosized Al-substituted barium hexaferrite powders

    NASA Astrophysics Data System (ADS)

    Peneva, P.; Koutzarova, T.; Kolev, S.; Ghelev, Ch.; Vertruyen, B.; Henrist, C.; Closet, R.; Cloots, R.; Zaleski, A.

    2016-03-01

    We report studies on the correlation between the method of preparation, microstructure and magnetic properties of nanosized monodomain Al-substituted barium hexaferrite (BaAlFe11O19) powders. The powders were obtained by the co-precipitation and single microemulsion methods. The particles in the samples had a size between 80 nm and 135 nm depending on the synthesis conditions. The value of the saturation magnetization Ms measured was very high, namely, 66.12 emu/g. The hysteresis loop was very narrow, with the coercivity Hc being 163 Oe, which indicated that the particles were in a near-superparamagnetic state.

  18. Uranium Immobilization by Sulfate-reducing Biofilms

    SciTech Connect

    Beyenal, Haluk; Sani, Rajesh K.; Peyton, Brent M.; Dohnalkova, Alice; Amonette, James E.; Lewandowski, Zbigniew

    2004-04-01

    Hexavalent uranium [U(VI)] was immobilized using biofilms of the sulfate-reducing bacterium (SRB) Desulfovibrio desulfuricans G20. The biofilms were grown in flat-plate continuous-flow reactors using lactate as the electron donor and sulfate as the electron acceptor. U(VI) was continuously fed into the reactor for 32 weeks at a concentration of 126 íM. During this time, the soluble U(VI) was removed (between 88 and 96% of feed) from solution and immobilized in the biofilms. The dynamics of U immobilization in the sulfate-reducing biofilms were quantified by estimating: (1) microbial activity in the SRB biofilm, defined as the hydrogen sulfide (H2S) production rate and estimated from the H2S concentration profiles measured using microelectrodes across the biofilms; (2) concentration of dissolved U in the solution; and (3) the mass of U precipitated in the biofilm. Results suggest that U was immobilized in the biofilms as a result of two processes: (1) enzymatically and (2) chemically, by reacting with microbially generated H2S. Visual inspection showed that the dissolved sulfide species reacted with U(VI) to produce a black precipitate. Synchrotron-based U L3-edge X-ray absorption near edge structure (XANES) spectroscopy analysis of U precipitated abiotically by sodium sulfide indicated that U(VI) had been reduced to U(IV). Selected-area electron diffraction pattern and crystallographic analysis of transmission electron microscope lattice-fringe images confirmed the structure of precipitated U as being that of uraninite.

  19. Barium determination in gastric contents, blood and urine by inductively coupled plasma mass spectrometry in the case of oral barium chloride poisoning.

    PubMed

    Łukasik-Głębocka, Magdalena; Sommerfeld, Karina; Hanć, Anetta; Grzegorowski, Adam; Barałkiewicz, Danuta; Gaca, Michał; Zielińska-Psuja, Barbara

    2014-01-01

    A serious case of barium intoxication from suicidal ingestion is reported. Oral barium chloride poisoning with hypokalemia, neuromuscular and cardiac toxicity, treated with intravenous potassium supplementation and hemodialysis, was confirmed by the determination of barium concentrations in gastric contents, blood, serum and urine using the inductively coupled plasma mass spectrometry method. Barium concentrations in the analyzed specimens were 20.45 µg/L in serum, 150 µg/L in blood, 10,500 µg/L in urine and 63,500 µg/L in gastric contents. Results were compared with barium levels obtained from a non-intoxicated person.

  20. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-01

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to ˜2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to ˜80 m2/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions.

  1. Mineralogy and autoradiography of selected mineral-spring precipitates in the Western United States

    USGS Publications Warehouse

    Bove, Dana; Felmlee, J.K.

    1982-01-01

    X-ray diffaction analysis of 236 precipitate or sediment samples from 97 mineral-spring sites in nine Western States showed the presence of 25 minerals, some precipitated and some detrital. Calcite and (or) aragonite are the most common of all the precipitated minerals. Gypsum and (or) anhydrite, as well as barite and native sulfur, are less common but are also believed to be precipitated minerals. Precipitated manganese and iron oxides, including romanechite, manganite, pyrolusite, goethite, and hematite, were found in some of the samples. Various salts of sodium, including halite and thenardite, were also identified. Dolomite and an unknown type of siliceous material are present in some of the samples and were possibly precipitated at the spring sites. Quartz, feldspar, and mica are present in many of the samples and are believed to be detrital contaminants. An autoradiographic and thin section study of 11 samples from nine of the most radioactive spring sites showed the radioactivity, which is due primarily to radium, to be directly associated with mineral phases containing barium, manganese, iron, and (or) calcium as major constituents. Furthermore, the radioactivity has an exclusive affinity for the manganese-bearing minerals, which in these samples contain a substantial amount of barium, even if calcite or iron oxides are present. Where calcite predominates and manganese- and barium-bearing minerals are absent, the radioactivity shows a close association with the iron oxides present, especially hematite, but also shows a moderate association with the calcite and (or) aragonite cementing phases. In other samples composed predominantly of calcite but lacking iron oxides, the radioactivity is preferentially associated with an early stage of calcite development and is considerably lower in the later cementing stages. The radioactivity observed in all these samples is believed to be caused by radium substituting for barium in mineral lattices, filling

  2. High H- ionic conductivity in barium hydride

    NASA Astrophysics Data System (ADS)

    Verbraeken, Maarten C.; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T. S.

    2015-01-01

    With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H-) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm-1 at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on.

  3. High pressure FAST of nanocrystalline barium titanate

    DOE PAGES

    Fraga, Martin B.; Delplanque, Jean -Pierre; Yang, Nancy; ...

    2016-06-01

    Here, this work studies the microstructural evolution of nanocrystalline (<1 µm) barium titanate (BaTiO3), and presents high pressure in field-assisted sintering (FAST) as a robust methodology to obtain >100 nm BaTiO3 compacts. Using FAST, two commercial ~50 nm powders were consolidated into compacts of varying densities and grain sizes. Microstructural inhomogeneities were investigated for each case, and an interpretation is developed using a modified Monte Carlo Potts (MCP) simulation. Two recurrent microstructural inhomogeneities are highlighted, heterogeneous grain growth and low-density regions, both ubiqutously present in all samples to varying degrees. In the worst cases, HGG presents an area coverage ofmore » 52%. Because HGG is sporadic but homogenous throughout a sample, the catalyst (e.g., the local segregation of species) must be, correspondingly, distributed in a homogenous manner. MCP demonstrates that in such a case, a large distance between nucleating abnormal grains is required—otherwise abnormal grains prematurely impinge on each other, and their size is not distinguishable from that of normal grains. Compacts sintered with a pressure of 300 MPa and temperatures of 900 °C, were 99.5% dense and had a grain size of 90±24 nm. These are unprecedented results for commercial BaTiO3 powders or any starting powder of 50 nm particle size—other authors have used 16 nm lab-produced powder to obtain similar results.« less

  4. High pressure FAST of nanocrystalline barium titanate

    SciTech Connect

    Fraga, Martin B.; Delplanque, Jean -Pierre; Yang, Nancy; Lavernia, Enrique J.; Monson, Todd C.

    2016-06-01

    Here, this work studies the microstructural evolution of nanocrystalline (<1 µm) barium titanate (BaTiO3), and presents high pressure in field-assisted sintering (FAST) as a robust methodology to obtain >100 nm BaTiO3 compacts. Using FAST, two commercial ~50 nm powders were consolidated into compacts of varying densities and grain sizes. Microstructural inhomogeneities were investigated for each case, and an interpretation is developed using a modified Monte Carlo Potts (MCP) simulation. Two recurrent microstructural inhomogeneities are highlighted, heterogeneous grain growth and low-density regions, both ubiqutously present in all samples to varying degrees. In the worst cases, HGG presents an area coverage of 52%. Because HGG is sporadic but homogenous throughout a sample, the catalyst (e.g., the local segregation of species) must be, correspondingly, distributed in a homogenous manner. MCP demonstrates that in such a case, a large distance between nucleating abnormal grains is required—otherwise abnormal grains prematurely impinge on each other, and their size is not distinguishable from that of normal grains. Compacts sintered with a pressure of 300 MPa and temperatures of 900 °C, were 99.5% dense and had a grain size of 90±24 nm. These are unprecedented results for commercial BaTiO3 powders or any starting powder of 50 nm particle size—other authors have used 16 nm lab-produced powder to obtain similar results.

  5. Study of electrical properties of W-type barium hexaferrite for high frequency application

    NASA Astrophysics Data System (ADS)

    Sharma, Parul; Thakur, Atul; Thakur, Preeti

    2016-05-01

    Hexaplana W-type barium ferrite of nominal composition BaZn1.5Co0.5Fe16O27 was prepared by a co-precipitation method. The structural and electrical properties were studied at different sintering temperatures. The average crystallite size was found to be in the range 46 ‒ 57 nm calculated by Scherrer formula, which means crystallite size increases with an increase in sintering temperature. Fourier transform spectroscopy reveals the ferrite peaks in the range 577.19 cm-1 ‒ 595.48 cm-1 confirming the hexagonal structure of ferrites. Metal-Semiconductor transition temperature was found to be decrease as the sintering temperature increases, whereas the trend for activation energy was found to be increasing.

  6. Selective total encapsulation of the sulfate anion by neutral nano-jars.

    PubMed

    Fernando, Isurika R; Surmann, Stuart A; Urech, Alexander A; Poulsen, Alexander M; Mezei, Gellert

    2012-07-11

    Nano-sized toroidal copper(II)-hydroxide/pyrazolate assemblies, lined by H-bond donors on the inside and hydrophobic on the outside, selectively extract sulfate from mixtures with nitrate or perchlorate. Tetrabutylammonium "lids" seal the "nano-jars" and render the encapsulated sulfate anion completely buried and inaccessible, so that it is not precipitated by Ba(2+) ions.

  7. Barium recovery by crystallization in a fluidized-bed reactor: effects of pH, Ba/P molar ratio and seed.

    PubMed

    Su, Chia-Chi; Reano, Resmond L; Dalida, Maria Lourdes P; Lu, Ming-Chun

    2014-06-01

    The effects of process conditions, including upward velocity inside the column, the amount of added seed and seed size, the pH value of the precipitant or the phosphate stream and the Ba/P molar ratio in a fluidized-bed reactor (FBR) were studied with a view to producing BaHPO₄ crystals of significant size and maximize the removal of barium. XRD were used to identify the products that were collected from the FBR. Experimental results show that an upward velocity of 48 cmmin(-1) produced the largest BaHPO₄ crystals with a size of around 0.84-1.0mm. The addition of seed crystals has no effect on barium removal. The use of a seed of a size in the ranges unseeded<0.149-0.29 mm<0.149 mm<0.29-0.42 mm produced increasing amounts of increasingly large crystals. The largest BaHPO₄ crystals were obtained at pH 8.4-8.8 with a Ba/P molar ratio of 1.0. In the homogeneous and heterogeneous processes, around 98% of barium was removed at pH 8.4-8.6 and [Ba]/[P]=1.0. The XRD results show that a significant amount of barium phosphate (Ba₃(PO₄)₂) was obtained at pH 11. The compounds BaHPO₄ and BaO were present at a pH of below 10.

  8. Precipitation chemistry in central Amazonia

    NASA Technical Reports Server (NTRS)

    Andreae, M. O.; Talbot, R. W.; Berresheim, H.; Beecher, K. M.

    1990-01-01

    Rain samples from three sites in central Amazonia were collected over a period of 6 weeks during the 1987 wet season and analyzed for ionic species and dissolved organic carbon. A continuous record of precipitation chemistry and amount was obtained at two of these sites, which were free from local or regional pollution, for a time period of over 1 month. The volume-weighted mean concentrations of most species were found to be about a factor of 5 lower during the wet season compared with previous results from the dry season. Only sodium, potassium, and chloride showed similar concentrations in both seasons. When the seasonal difference in rainfall amount is taken into consideration, the deposition fluxes are only slightly lower for most species during the wet season than during the dry season, again with the exception of chloride, potassium, and sodium. Sodium and chloride are present in the same ratio as in sea salt; rapid advection of air masses of marine origin to the central Amazon Basin during the wet season may be responsible for the observed higher deposition flux of these species. Statistical analysis suggests that sulfate is, to a large extent, of marine (sea salt and biogenic) origin, but that long-range transport of combustion-derived aerosols also makes a significant contribution to sulfate and nitrate levels in Amazonian rain. Organic acid concentrations in rain were responsible for a large fraction of the observed precipitation acidity; their concentration was strongly influenced by gas/liquid interactions.

  9. Acceleration of barium ions near 8000 km above an aurora

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Wescott, E. M.; Foeppl, H.

    1984-01-01

    A barium shaped charge, named Limerick, was released from a rocket launched from Poker Flat Research Range, Alaska, on March 30, 1982, at 1033 UT. The release took place in a small auroral breakup. The jet of ionized barium reached an altitude of 8100 km 14.5 min after release, indicating that there were no parallel electric fields below this altitude. At 8100 km the jet appeared to stop. Analysis shows that the barium at this altitude was effectively removed from the tip. It is concluded that the barium was actually accelerated upward, resulting in a large decrease in the line-of-sight density and hence the optical intensity. The parallel electric potential in the acceleration region must have been greater than 1 kV over an altitude interval of less than 200 km. The acceleration region, although presumably auroral in origin, did not seem to be related to individual auroral structures, but appeared to be a large-scale horizontal structure. The perpendicular electric field below, as deduced from the drift of the barium, was temporally and spatially very uniform and showed no variation related to individual auroral structures passing through.

  10. Preparation of barium hexaferrite powders using oxidized steel scales waste

    NASA Astrophysics Data System (ADS)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony

    2016-02-01

    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  11. Remediation of Acid Mine Drainage with Sulfate Reducing Bacteria

    ERIC Educational Resources Information Center

    Hauri, James F.; Schaider, Laurel A.

    2009-01-01

    Sulfate reducing bacteria have been shown to be effective at treating acid mine drainage through sulfide production and subsequent precipitation of metal sulfides. In this laboratory experiment for undergraduate environmental chemistry courses, students design and implement a set of bioreactors to remediate acid mine drainage and explain observed…

  12. Rocket having barium release system to create ion clouds in the upper atmosphere

    NASA Technical Reports Server (NTRS)

    Lewis, B. W.; Stokes, C. S.; Smith, E. W.; Murphy, W. J. (Inventor)

    1974-01-01

    A chemical system for releasing a good yield of free barium atoms and barium ions to create ion clouds in the upper atmosphere and interplanetary space for the study of the geophysical properties of the medium is presented.

  13. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2010-01-01

    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  14. Barium Levels in Soils and Centella asiatica

    PubMed Central

    Ong, Ghim Hock; Yap, Chee Kong; Mahmood, Maziah; Tan, Soon Guan; Hamzah, Suhaimi

    2013-01-01

    In this study, Centella asiatica and surface soils were collected from 12 sampling sites in Peninsular Malaysia, and the barium (Ba) concentrations were determined. The Ba concentration [μg/g dry weight (dw)] was 63.72 to 382.01 μg/g in soils while in C. asiatica, Ba concentrations ranged from 5.05 to 21.88 μg/g for roots, 3.31 to 11.22 μg/g for leaves and 2.37 to 6.14 μg/g for stems. In C. asiatica, Ba accumulation was found to be the highest in roots followed by leaves and stems. The correlation coefficients (r) of Ba between plants and soils were found to be significantly positively correlated, with the highest correlation being between roots-soils (r=0.922, p<005), followed by leaves-soils (r=0.890, p<005) and stems-soils (r=0.848, p<005). This indicates that these three parts of C. asiatica are good biomonitors of Ba pollution. For the transplantation study, four sites were selected as unpolluted [(Universiti Putra Malaysia (UPM)], semi-polluted (Seri Kembangan and Balakong) and polluted sites (Juru). Based on the transplantation study under experimental field and laboratory conditions, Ba concentrations in C. asiatica were significantly (p<0.05) higher after three weeks of exposure at Seri Kembangan, Balakong and Juru. Thus, these experimental findings confirm that the leaves, stems and roots of C. asiatica can reflect the Ba levels in the soils where this plant is found. Three weeks after back transplantation to clean soils, the Ba levels in C. asiatica were still higher than the initial Ba level even though Ba elimination occurred. In conclusion, the leaves, stems and roots of C. asiatica are good biomonitors of Ba pollution. PMID:24575242

  15. Growth rate controlled barium partitioning in calcite and aragonite

    NASA Astrophysics Data System (ADS)

    Goetschl, Katja Elisabeth; Mavromatis, Vasileios; Baldermann, Andre; Purgstaller, Bettina; Dietzel, Martin

    2016-04-01

    The barium (Ba) content and the Ba/Ca molar ratios in biogenic and abiotic carbonates have been widely used from the scientific community as a geochemical proxy especially in marine and early diagenetic settings. The Ba content of carbonate minerals has been earlier associated to changes in oceanic circulation that may have been caused by upwelling, changes in weathering regimes and river-runoff as well as melt water discharge. The physicochemical controls of Ba ion incorporation in the two most abundant CaCO3 polymorphs found in Earth's surface environments, i.e. calcite and aragonite, have adequately been studied only for calcite. These earlier studies (i.e. [1]) suggest that at increasing growth rate, Ba partitioning in calcite is increasing as well. In contrast, to date the effect of growth rate on the partitioning of Ba in aragonite remains questionable, despite the fact that this mineral phase is the predominant carbonate-forming polymorph in shallow marine environments. To shed light on the mechanisms controlling Ba ion uptake in carbonates in this study we performed steady-state Ba co-precipitation experiments with calcite and aragonite at 25°C. The obtained results for the partitioning of Ba in calcite are in good agreement with those reported earlier by [1], whereas those for aragonite indicate a reduction of Ba partitioning at elevated aragonite growth rates, with the partitioning coefficient value between solid and fluid to be approaching the unity. This finding is good agreement with the formation of a solid solution in the aragonite-witherite system, owing to the isostructural crystallography of the two mineral phases. Moreover, our data set provides new insights that are required for reconstructing the evolution of the Ba content of pristine marine versus diagenetically altered carbonate minerals commonly occurring in marine subfloor settings, as the thermodynamically less stable aragonite will transform to calcite enriched in Ba, whilst affecting

  16. Electro-optical polycrystalline barium lanthanum titanium niobate

    SciTech Connect

    Mehrotra, A.K.

    1991-02-19

    This patent describes a transparent electro-optic article. It comprises: of a barium lanthanum titanium niobate wherein substantially all grains are of a grain size between about 2 and about 20 micron, the article has a pore volume of less than about 1 percent, and the article has a grain size of between about 2 and about 20 microns. This patent also describes a method of forming transparent electro-optical barium lanthanum titanium niobate. It comprises: providing particles of barium carbonate, lanthanum oxide, titanium oxide, and niobium oxide, calcining the particles, sintering the calcined particles at a temperature of between about 1200{degrees} C and 1300{degrees} C. and a vacuum of between about 10{sup {minus}3} and 10{sup {minus}4} torr while under pressure to form a sintered mass, cooling the sintered mass, slicing the mass to form wafers, heating the wafers in an oxidizing atmosphere.

  17. Multiphoton laser ionization for energy conversion in barium vapor

    NASA Astrophysics Data System (ADS)

    Makdisi, Y.; Kokaj, J.; Afrousheh, K.; Mathew, J.; Nair, R.; Pichler, G.

    2013-03-01

    We have studied the ion detection of barium atoms in special heated ovens with a tungsten rod in the middle of the stainless steel tube. The tungsten rod was heated indirectly by the oven body heaters. A bias voltage between the cell body and the tungsten rod of 9 V was used to collect electrons, after the barium ions had been created. However, we could collect the electrons even without the bias voltage, although with ten times less efficiency. We studied the conditions for the successful bias-less thermionic signal detection using excimer/dye laser two-photon excitation of Rydberg states below and above the first ionization limit (two-photon wavelength at 475.79 nm). We employed a hot-pipe oven and heat-pipe oven (with inserted mesh) in order to generate different barium vapor distributions inside the oven. The thermionic signal increased by a factor of two under heat-pipe oven conditions.

  18. Prompt ionization in the CRIT II barium releases

    NASA Astrophysics Data System (ADS)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.

    1992-05-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  19. Barium-borate-flyash glasses: As radiation shielding materials

    NASA Astrophysics Data System (ADS)

    Singh, Sukhpal; Kumar, Ashok; Singh, Devinder; Thind, Kulwant Singh; Mudahar, Gurmel S.

    2008-01-01

    The attenuation coefficients of barium-borate-flyash glasses have been measured for γ-ray photon energies of 356, 662, 1173 and 1332 keV using narrow beam transmission geometry. The photon beam was highly collimated and overall scatter acceptance angle was less than 3°. Our results have an uncertainty of less than 3%. These coefficients were then used to obtain the values of mean free path (mfp), effective atomic number and electron density. Good agreements have been observed between experimental and theoretical values of these parameters. From the studies of the obtained results it is reported here that from the shielding point of view the barium-borate-flyash glasses are better shields to γ-radiations in comparison to the standard radiation shielding concretes and also to the ordinary barium-borate glasses.

  20. Sulfate Transport and Release in Technogenic Soil Substrates: Experiments and Numerical Modeling

    NASA Astrophysics Data System (ADS)

    Schonsky, H.; Peters, A.; Lang, F.; Mekiffer, B.; Wessolek, G.

    2012-04-01

    In Berlin and many other cities technogenic soil substrates from World War II and building and construction debris in general play an important role for soil formation and solute transport in the vadose zone. The largest debris landfill in Berlin is the Teufelsberg. Sulfate release from the landfill poses threats for groundwater quality. The scope of this study is to determine the processes controlling sulfate release from soils containing rubble. Column leaching experiments were conducted to analyze sulfate mobilization from Teufelsberg topsoil material. Flow interruptions of one and seven days were introduced. Sulfate release was modeled using a geochemical simulation tool (HP1). The model considered water flux, solute transport and precipitation/dissolution with first order kinetics. Sulfate release increased after flow interruptions, although bromide breakthrough indicated physical equilibrium of transport processes. The model was applicable for qualitative description of our experimental results. The estimated equilibrium concentrations of sulfate were one to two orders of magnitude smaller than expected according to the equilibrium constant of gypsum. It is assumed that the mobilization of sulfate from calcite/gypsum co-precipitates determines the sulfate concentrations in the soil solution of the studied soils. If Sulfate release and transport from soils containing debris is modeled with literature values, sulfate concentrations will be overestimated by one to two orders of magnitude.

  1. Phenotypic and behavioral defects caused by barium exposure in nematode Caenorhabditis elegans.

    PubMed

    Wang, D-Y; Wang, Y

    2008-04-01

    To examine the possible phenotypic defects from barium exposure, a model organism, Caenorhabditis elegans, was chosen to analyze the multiple toxicities in barium-exposed animals. Endpoints of life span, body size, brood size, generation time, head thrash, and body bend were selected for the assessment of barium toxicity. High concentrations (75 microM and 200 microM) of barium exposure caused severe life-span defects. Body sizes of exposed animals were markedly reduced compared to the controls, and high concentrations of barium exposure (75 microM and 200 microM) caused the appearance of vulva abnormality. In addition, barium exposure resulted in severe defects in reproductive capacity and reproductive speed. Body bends and head thrashes were also severely impaired after barium exposure. Furthermore, the stress responses to barium exposure suggest severe barium toxicity. The observed severe locomotion behavior and life-span defects in nematodes might be largely due to the deposition of barium toxicity in the muscle and intestine systems, respectively. Our data suggest that barium exposure could cause multiple biological defects by affecting the life span, development, reproduction, and locomotion behaviors. These multiple biological defects provide a new evaluation system to monitor the toxicity from barium exposure.

  2. Volatile Barium Beta-Diketonate Polyether Adducts. Synthesis, Characterization and Metalorganic Chemical Vapor Deposition

    DTIC Science & Technology

    1991-05-31

    Volatile Barium 13- Diketonate Polyether Adducts.... Synthesis , Characterization and Metalorganic Chemical Vapor Deposition by Robin A. Gardiner...has been approved for public release and sale: its distribution is unlimited. Volatile, Barium B- Diketonate Polyether Adducts. Synthesis ...NO. NO. INO. ACCESSION NO. Arlington, VA 22217 II 11. TITLE (include Security Classification) Volatile Barium B- Diketonate Polyether Adducts

  3. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  4. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  5. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  6. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  7. Measurement of Elastic Modulus of Alumina and Barium Strontium Titanate Wafers Produced by Tape Casting Method

    DTIC Science & Technology

    2014-02-01

    UNCLASSIFIED AD-E403 481 Technical Report ARMET-TR-12039 MEASUREMENT OF ELASTIC MODULUS OF ALUMINA AND BARIUM STRONTIUM ...DATES COVERED (From – To) 4. TITLE AND SUBTITLE MEASUREMENT OF ELASTIC MODULUS OF ALUMINA AND BARIUM STRONTIUM TITANATE WAFERS PRODUCED BY...configuration testing method. Samples of barium strontium titanate (BST) were made using a regular powder pressing, sintering, pelletizing, and

  8. Compact pulse forming line using barium titanate ceramic material

    NASA Astrophysics Data System (ADS)

    Kumar Sharma, Surender; Deb, P.; Shukla, R.; Prabaharan, T.; Shyam, A.

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO3) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber.

  9. PRECIPITATION METHOD OF SEPARATION OF NEPTUNIUM

    DOEpatents

    Magnusson, L.B.

    1958-07-01

    A process is described for the separation of neptunium from plutonium in an aqueous solution containing neptunium ions in a valence state not greater than +4, plutonium ioms in a valence state not greater than +4, and sulfate ions. The Process consists of adding hypochlorite ions to said solution in order to preferentially oxidize the neptunium and then adding lanthanum ions and fluoride ions to form a precipitate of LaF/sub 3/ carrying the plutonium, and thereafter separating the supernatant solution from the precipitate.

  10. Sulfate attack expansion mechanisms

    SciTech Connect

    Müllauer, Wolfram Beddoe, Robin E.; Heinz, Detlef

    2013-10-15

    A specially constructed stress cell was used to measure the stress generated in thin-walled Portland cement mortar cylinders caused by external sulfate attack. The effects of sulfate concentration of the storage solution and C{sub 3}A content of the cement were studied. Changes in mineralogical composition and pore size distribution were investigated by X-ray diffraction and mercury intrusion porosimetry, respectively. Damage is due to the formation of ettringite in small pores (10–50 nm) which generates stresses up to 8 MPa exceeding the tensile strength of the binder matrix. Higher sulfate concentrations and C{sub 3}A contents result in higher stresses. The results can be understood in terms of the effect of crystal surface energy and size on supersaturation and crystal growth pressure.

  11. Ionization and expansion of barium clouds in the ionosphere

    NASA Technical Reports Server (NTRS)

    Ma, T.-Z.; Schunk, R. W.

    1993-01-01

    A recently envelope 3D model is used here to study the motion of the barium clouds released in the ionosphere, including the ionization stage. The ionization and the expansion of the barium clouds and the interaction between the clouds and the background ions are investigated using three simulations: a cloud without a directional velocity, a cloud with an initial velocity of 5 km/s across the B field, and a cloud with initial velocity components of 2 km/s both along and across the B field.

  12. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1981-01-01

    The photoelectric effect in structures consisting of metal deposited barium titanate film silicon is described. A radio frequency sputtering technique is used to deposit ferroelectric barium titantate films on silicon and quartz. Film properties are measured and correlated with the photoelectric effect characteristics of the films. It was found that to obtain good quality pin hole free films, it is necessary to reduce the substrate temperature during the last part of the deposition. The switching ability of the device with internal applied voltage is improved when applied with a ferroelectric memory device.

  13. Ferroelastic domains in lead-free barium zirconate titanate - barium calcium titanate piezoceramics

    NASA Astrophysics Data System (ADS)

    Ehmke, Matthias Claudius

    Piezoelectricity was first discovered by Pierre and Jaque Curie in the year 1880. Nowadays, piezoelectric materials are used in many application such as high voltage generation in gas igniters, actuation in micro-positioning devices, generation and detection of acoustic waves, emitters and receivers for sonar technology, ultrasonic cleaning, ultrasound medical therapy, and micropumps for ink-jet printers. The most commonly used piezoelectric material since the 1950's is the solid solution system lead zirconate titanate (PZT) that offers high piezoelectric performance under a large range of operating conditions. However, the toxicity of lead requires the replacement of PZT. The studied lead-free alternatives are commonly based on potassium sodium niobate (KNN) and bismuth sodium titanate (BNT), and more recently zirconium and calcium substituted barium titanate (BZT-BCT). The BZT-BCT system exhibits large piezoelectric coefficients that can exceed even those of most PZT compositions under certain conditions. Piezoelectricity was first discovered by Pierre and Jaque Curie in the year 1880. Nowadays, piezoelectric materials are used in many application such as high voltage generation in gas igniters, actuation in micro-positioning devices, generation and detection of acoustic waves, emitters and receivers for sonar technology, ultrasonic cleaning, ultrasound medical therapy, and micropumps for ink-jet printers. The most commonly used piezoelectric material since the 1950's is the solid solution system lead zirconate titanate (PZT) that offers high piezoelectric performance under a large range of operating conditions. However, the toxicity of lead requires the replacement of PZT. The studied lead-free alternatives are commonly based on potassium sodium niobate (KNN) and bismuth sodium titanate (BNT), and more recently zirconium and calcium substituted barium titanate (BZT-BCT). The BZT-BCT system exhibits large piezoelectric coefficients that can exceed even those of

  14. A "liver" antigen associated with avian erythroblastosis: binding by bentonite and precipitation with sodium dodecyl sulphate.

    PubMed Central

    Darcel, C L

    1982-01-01

    The properties of a complement fixing antigen, EbAg, extracted from erythroblastosis-affected chicken livers are described. The antigen in extracts freed of structural protein is strongly bound by bentonite, but not by barium sulphate. Strongly alkaline solutions of sodium dodecyl sulphate are required to release the antigen from bentonite. Acidification of the detergent solution precipitates the active solution precipitates the active protein. Extraction of heme from the acidified detergent precipitate by methyl-ethyl ketone further purifies the antigen. This acid detergent treatment eliminates the need to use bentonite as a purification step. PMID:6280825

  15. Status of barium studies in the present era of oncology: Are they a history?

    PubMed Central

    Mahajan, Abhishek; Desai, Subash; Sable, Nilesh Pandurang; Thakur, Meenakshi Haresh

    2016-01-01

    With the advent of the modern imaging technologies, the present era of oncology is seeing steady decline in requests for barium studies due to the many reasons. It is prudent to mention here, that, barium examinations cannot be made obsolete! Our aim to preserve the age old technique of barium studies not only to keep it going on but also for the betterment and appropriate management of the patient. Our goal is not to “save” barium studies simply to keep this technology alive, per se, but rather to preserve barium radiology for the quality in patient care. PMID:28144086

  16. Aluminum Sulfate 18 Hydrate

    ERIC Educational Resources Information Center

    Young, Jay A.

    2004-01-01

    A chemical laboratory information profile (CLIP) of the chemical, aluminum sulfate 18 hydrate, is presented. The profile lists physical and harmful properties, exposure limits, reactivity risks, and symptoms of major exposure for the benefit of teachers and students using the chemical in the laboratory.

  17. Hydrazine/Hydrazine sulfate

    Integrated Risk Information System (IRIS)

    Hydrazine / Hydrazine sulfate ; CASRN 302 - 01 - 2 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Non

  18. Sulfates and phyllosilicates in Aureum Chaos, Mars

    NASA Astrophysics Data System (ADS)

    Sowe, M.; Wendt, L.; McGuire, P. C.; Neukum, G.

    2012-12-01

    observations concerning the potential anhydrous cap rock. Groundwater would have penetrated into a pre-existing sulfate-free ILD whose permeability and porosity would have defined the rate of water absorption and sulfate precipitation that finally lead to its cementation. The surface ages of chaotic terrain (late Hesperian) and mantling deposits (mid to late Amazonian) further constrain the ILD age and potentially the emplacement of sulfates. We suggest that phyllosilicates in the mantling are allochthonous. In contrast, determining the deposition of in-situ phyllosilicates is theoretical; they could be Noachian (excavated material, following the 'phyllosian' era), or instead late Hesperian or even younger (syn- or post-chaotic). Alternatives, as known from Australian saline lakes, combine groundwater alteration with the observed mineralogy. There, close spatial and temporal associations of both mineral groups are explained by vertically separated geochemical environments (phyllosilicates in deep-, sulfates in shallow evaporitic facies). The preservation of nontronite, HFS and MHS displays that since their deposition a relatively dry environment with intermittent aqueous activity must have prevailed.

  19. Heavy ion recoil spectrometry of barium strontium titanate films

    NASA Astrophysics Data System (ADS)

    Stannard, W. B.; Johnston, P. N.; Walker, S. R.; Bubb, I. F.; Scott, J. F.; Cohen, D. D.; Dytlewski, N.; Martin, J. W.

    1995-05-01

    Thin films of barium strontium titanate have been analysed using heavy ion recoil spectrometry with 77 and 98 MeV 127I ions at the new heavy ion recoil facility at ANSTO, Lucas Heights. New calibration procedures have been developed for quantitative analysis. Energy spectra for each of the elements present reveal interdiffusion that was not previously known.

  20. Synthesis of phase pure praseodymium barium copper iron oxide.

    PubMed

    Konne, Joshua L; Davis, Sean A; Glatzel, Stefan; Hall, Simon R

    2013-06-18

    The control of crystallization of praseodymium barium copper iron oxide, an intermediate temperature solid oxide fuel cell cathode material, has been demonstrated for the first time using a biotemplated sol-gel synthesis technique. The results obtained showed significant improvement in purity, synthesis time, surface area and simplicity over that previously reported.

  1. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS

    EPA Science Inventory

    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  2. Dynamics of a barium release in the magnetospheric tail

    NASA Technical Reports Server (NTRS)

    Mende, S. B.; Swenson, G. R.; Geller, S. P.; Doolittle, J. H.; Haerendel, G.

    1989-01-01

    The late time behavior of the May 13, 1985 magnetotail barium cloud is examined. The bulk dynamics of the cloud are studied based on triangulated data and data from Fabry-Perot Doppler velocity measurements. The changes in cloud morphology in relation to the in situ measurements made by the Ion Release Module satellite are discussed.

  3. Effects of light exposure on irradiated barium fluoride crystals

    SciTech Connect

    Wuest, C.R.; Mauger, G.J.

    1993-04-20

    Small barium fluoride crystals have been irradiated using cobalt-60 gamma rays under various illumination conditions to establish the effect of photo-bleaching of the radiation-induced color centers. This paper describes results of a few different experiments conducted at LLNL over the past few weeks.

  4. SEPARATION OF BARIUM VALUES FROM URANYL NITRATE SOLUTIONS

    DOEpatents

    Tompkins, E.R.

    1959-02-24

    The separation of radioactive barium values from a uranyl nitrate solution of neutron-irradiated uranium is described. The 10 to 20% uranyl nitrate solution is passed through a flrst column of a cation exchange resin under conditions favoring the adsorption of barium and certain other cations. The loaded resin is first washed with dilute sulfuric acid to remove a portion of the other cations, and then wash with a citric acid solution at pH of 5 to 7 to recover the barium along with a lesser amount of the other cations. The PH of the resulting eluate is adjusted to about 2.3 to 3.5 and diluted prior to passing through a smaller second column of exchange resin. The loaded resin is first washed with a citric acid solution at a pH of 3 to elute undesired cations and then with citric acid solution at a pH of 6 to eluts the barium, which is substantially free of undesired cations.

  5. Dose audit and evaluation of work practices during barium procedures using digital radiography techniques.

    PubMed

    Livingstone, Roshan S; Augustine, Philomina; Aparna, I; Raj, D Victor

    2004-10-01

    Effective dose and organ doses during barium procedures performed using digital radiography machines were estimated and the related work practices were evaluated. Measured values of dose area product (DAP) were used for the calculation of effective doses. One hundred and thirty eight patients undergoing barium procedures were included in the study. The use of additional 0.2 mm copper filter during barium procedures effectively reduced patient doses. The effective dose during barium swallow procedure varied from 0.03 mSv to 3.5 mSv; during barium meal it varied from 0.18 mSv to 2.62 mSv; and during barium enema it varied from 0.56 mSv to 4.24 mSv. Dose auditing was done on the basis of patient doses, imaging techniques and image quality. Selection of optimized exposure factors imparted lower dose to patients during barium procedures.

  6. Response of Ned Wilson Lake Watershed, Colorado, to changes in atmospheric deposition of sulfate

    USGS Publications Warehouse

    Campbell, Donald H.; Turk, John T.; Spahr, Norman E.

    1991-01-01

    The Ned Wilson Lake watershed responds directly and rapidly to changes in precipitation inputs of sulfate, which has important implications for effects of acid deposition on the aquatic system. Chemistry at three precipitation collection sites and three watershed sites (a pond, a lake, and a spring) has been monitored in and near the Flattops Wilderness Area in northwestern Colorado beginning in 1981–1983. Bulk snowpack concentration of sulfate in the watershed and volume-weighted annual mean concentration of sulfate in precipitation at two nearby sites generally decreased from 1981 to 1985, were small through 1987, and increased in 1988–1989. Changes in concentration of sulfate at the watershed sites are controlled by precipitation inputs. Responsiveness of the individual sites was dependent on their position along the hydrologic flow path. The fastest response was in the pond, which has a hydrologic residence time of less than 1 year; over 90% of the variance in concentration of sulfate in the pond was explained by changes in concentration in precipitation. The lake has a hydrologic residence time of 1 to 4 years; a regression model of the concentration of sulfate in the lake, as a function of the concentration in the lake during the previous year and the concentration in precipitation, explained 87% of the variance in concentration of sulfate in the lake. The hydrologic response time of the spring is unknown; it was not responsive to changes in concentration of sulfate in precipitation. The recent increase of sulfate concentration in precipitation and in the pond and lake is evidence for a rapid rather than a delayed response, which could not be determined when only a decreasing trend in sulfate concentration was reported in 1982–1987. Watersheds of this type are sensitive to acidification (acid-neutralizing capacity less than 60 μeq L−1), and these results indicate conservative behavior of sulfate. This is important in predicting effects of future

  7. Could binary mixture of Nd-Ni ions control the electrical behavior of strontium-barium M-type hexaferrite nanoparticles?

    SciTech Connect

    Iqbal, Muhammad Javed; Farooq, Saima

    2011-05-15

    Research highlights: {yields} Strontium-barium hexaferrites (Sr{sub 0.5}Ba{sub 0.5}Fe{sub 12}O{sub 19}) in single magnetoplumbite phase solid structure are synthesized by the co-precipitation method. {yields} Structural and electrical properties of Nd-Ni substituted ferrites are investigated. {yields} These ferrite materials possess high electrical resistivity (108 {Omega} cm) that is essential to curb the eddy current loss, which is pre-requisite for surface mount devices. -- Abstract: Cationic substitution in M-type hexaferrites is considered to be an important tool for modification of their electrical properties. This work is part of our comprehensive study on the synthesis and characterization of Nd-Ni doped strontium-barium hexaferrite nanomaterials of nominal composition Sr{sub 0.5}Ba{sub 0.5-x}Nd{sub x}Fe{sub 12-y}Ni{sub y}O{sub 19} (x = 0.00-0.10; y = 0.00-1.00). Doping with this binary mixture modulates the physical and electrical properties of strontium-barium hexaferrite nanoparticles. Structural and electrical properties of the co-precipitated ferrites are investigated using state-of-the-art techniques. The results of X-ray diffraction analysis reveal that the lattice parameters and cell volume are inversely related to the dopant content. Temperature dependent DC-electrical resistivity measurements infer that resistivity of strontium-barium hexaferrites decreases from 1.8 x 10{sup 10} to 2.0 x 10{sup 8} {Omega} cm whereas the drift mobility, dielectric constant and dielectric loss tangent are directly related to the Nd-Ni content. The results of the study demonstrate a relationship between the modulation of electrical properties of substituted ferrites and nature of cations and their lattice site occupancy.

  8. Localized sulfate-reducing zones in a coastal plain aquifer

    USGS Publications Warehouse

    Brown, C.J.; Coates, J.D.; Schoonen, M.A.A.

    1999-01-01

    High concentrations of dissolved iron in ground water of coastal plain or alluvial aquifers contribute to the biofouling of public supply wells for which treatment and remediation is costly. Many of these aquifers, however, contain zones in which microbial sulfate reduction and the associated precipitation of iron-sulfide minerals decreases iron mobility. The principal water-bearing aquifer (Magothy Aquifer of Cretaceous age) in Suffolk County, New York, contains localized sulfate-reducing zones in and near lignite deposits, which generally are associated with clay lenses. Microbial analyses of core samples amended with [14C]-acetate indicate that microbial sulfate reduction is the predominant terminal-electron-accepting process (TEAP) in poorly permeable, lignite-rich sediments at shallow depths and near the ground water divide. The sulfate-reducing zones are characterized by abundant lignite and iron-sulfide minerals, low concentrations of Fe(III) oxyhydroxides, and by proximity to clay lenses that contain pore water with relatively high concentrations of sulfate and dissolved organic carbon. The low permeability of these zones and, hence, the long residence time of ground water within them, permit the preservation and (or) allow the formation of iron-sulfide minerals, including pyrite and marcasite. Both sulfate-reducing bacteria (SRB) and iron-reducing bacteria (IRB) are present beneath and beyond the shallow sulfate-reducing zones. A unique Fe(III)-reducing organism, MD-612, was found in core sediments from a depth of 187 m near the southern shore of Long Island. The distribution of poorly permeable, lignite-rich, sulfate-reducing zones with decreased iron concentration is varied within the principal aquifer and accounts for the observed distribution of dissolved sulfate, iron, and iron sulfides in the aquifer. Locating such zones for the placement of production wells would be difficult, however, because these zones are of limited aerial extent.

  9. Preliminary study of the CRRES magnetospheric barium releases

    NASA Technical Reports Server (NTRS)

    Huba, J. D.; Bernhardt, P. A.; Lyon, J. G.

    1992-01-01

    Preliminary theoretical and computational analyses of the Combined Release and Radiation Effects Satellite (CRRES) magnetospheric barium releases are presented. The focus of the studies is on the evolution of the diamagnetic cavity which is formed by the barium ions as they expand outward, and on the structuring of the density and magnetic field during the expansion phase of the releases. Two sets of simulation studies are discussed. The first set is based upon a 2D ideal MHD code and provides estimates of the time and length scales associated with the formation and collapse of the diamagnetic cavity. The second set uses a nonideal MHD code; specifically, the Hall term is included. This additional term is critical to the dynamics of sub-Alfvenic plasma expansions, such as the CRRES barium releases, because it leads to instability of the expanding plasma. Detailed simulations of the G4 and G10 releases were performed. In both cases the expanding plasma rapidly structured: the G4 release structured at time t less than about 3 s and developed scale sizes of about 1-2 km, while the G10 release structured at time t less than about 22 s and developed scale sizes of about 10-15 km. It is also found that the diamagnetic cavity size is reduced from those obtained from the ideal MHD results because of the structure. On the other hand, the structuring allows the formation of plasma blobs which appear to free stream across the magnetic field; thus, the barium plasma can propagate to larger distances traverse to the magnetic field than the case where no structuring occurs. Finally, a new normal mode of the system was discovered which may be excited at the leading edge of the expanding barium plasma.

  10. Calcium sulfate crystallization along citrus root channels in a Florida soil exhibiting acid sulfate properties

    SciTech Connect

    Syslo, S.K.; Myhre, D.L.; Harris, W.G.

    1988-02-01

    The authors observed euhedral crystals in Manatee soil in a citrus grove in St. Lucie County, Florida. The material was identified as gypsum (CaSO/sub 4/ /times/ 2H/sub 2/O) using x-ray diffraction and infrared spectra. Photomicrography and scanning electron microscopy revealed that gypsum accumulated both in old root channels and within citrus root tissue of the Btg horizon. The subsurface horizons had elevated sulfate levels, a low initial pH, a drop (0.5 unit) in pH upon air-drying. Electrical conductivity paralleled the concentration of water-soluble sulfate. High levels of calcium and sulfate occurred for horizons above the water table. This accumulation is attributed to groundwater bearing these ions and subsequently discharging them to the overlying soil. Dead citrus roots appear to act as wicks to aid water transfer from lower to higher horizons. The roots and their empty channels provide spaces in which the gypsum can precipitate if the concentrations of calcium and sulfate in the evaporating groundwater exceed the solubility product of gypsum.

  11. PRECIPITATION OF PLUTONOUS PEROXIDE

    DOEpatents

    Barrick, J.G.; Manion, J.P.

    1961-08-15

    A precipitation process for recovering plutonium values contained in an aqueous solution is described. In the process for precipitating plutonium as plutonous peroxide, hydroxylamine or hydrazine is added to the plutoniumcontaining solution prior to the addition of peroxide to precipitate plutonium. The addition of hydroxylamine or hydrazine increases the amount of plutonium precipitated as plutonous peroxide. (AEC)

  12. Off limits: sulfate below the sulfate-methane transition

    NASA Astrophysics Data System (ADS)

    Brunner, Benjamin; Arnold, Gail; Røy, Hans; Müller, Inigo; Jørgensen, Bo

    2016-07-01

    One of the most intriguing recent discoveries in biogeochemistry is the ubiquity of cryptic sulfur cycling. From subglacial lakes to marine oxygen minimum zones, and in marine sediments, cryptic sulfur cycling - the simultaneous sulfate consumption and production - has been observed. Though this process does not leave an imprint in the sulfur budget of the ambient environment - thus the term cryptic - it may have a massive impact on other element cycles and fundamentally change our understanding of biogeochemical processes in the subsurface. Classically, the sulfate-methane transition (SMT) in marine sediments is considered to be the boundary that delimits sulfate reduction from methanogenesis as the predominant terminal pathway of organic matter mineralization. Two sediment cores from Aarhus Bay, Denmark reveal the constant presence of sulfate (generally 0.1 to 0.2 mM) below the SMT. The sulfur and oxygen isotope signature of this deep sulfate (34S = 18.9‰, 18O = 7.7‰) was close to the isotope signature of bottom-seawater collected from the sampling site (34S = 19.8‰, 18O = 7.3‰). In one of the cores, oxygen isotope values of sulfate at the transition from the base of the SMT to the deep sulfate pool (18O = 4.5‰ to 6.8‰) were distinctly lighter than the deep sulfate pool. Our findings are consistent with a scenario where sulfate enriched in 34S and 18O is removed at the base of the SMT and replaced with isotopically light sulfate below. Here, we explore scenarios that explain this observation, ranging from sampling artifacts, such as contamination with seawater or auto-oxidation of sulfide - to the potential of sulfate generation in a section of the sediment column where sulfate is expected to be absent which enables reductive sulfur cycling, creating the conditions under which sulfate respiration can persist in the methanic zone.

  13. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    NASA Technical Reports Server (NTRS)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  14. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode

    NASA Technical Reports Server (NTRS)

    Forman, R.

    1976-01-01

    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  15. METHOD OF IMPROVING THE CARRIER PRECIPITATION OF PLUTONIUM

    DOEpatents

    Kamack, H.J.; Balthis, J.H.

    1958-12-01

    Plutonium values can be recovered from acidic solutlons by adding lead nitrate, hydrogen fluoride, lantha num nitrate, and sulfurlc acid to the solution to form a carrler preclpitate. The lead sulfate formed improves the separatlon characteristics of the lanthanum fluoride carrier precipitate,

  16. Sulfated modification promotes the immunomodulatory bioactivities of Lyciumbarbarum polysaccharides in vitro

    PubMed Central

    Wang, Junmin; Ge, Beilei; Du, Chunyan; Xue, Jingli; Zhuang, Yuwei; Xue, Kun

    2015-01-01

    Three kinds of purified Lyciumbarbarum polysaccharides (LBPSs), LBPS30, LBPS70 and total LBPS (LBPSt), were modified using chlorosulfonic acid-pyridine method based on the previous experiment, forming three sulfated LBPS (sLBPS), sLBPSt, sLBPS30 and sLBPS70 respectively. They were characterized by ultrasonic-acidic barium chromate spectrophotometry, infrared (FT-IR) and high performance gel permeation chromatography (HPGPC). The immunomodulatory activity of each kind of LBPSs and sLBPSs was further examined to determine the relationship between the structure and bioactivity, and the sLBPS with the highest activity was selected. The results showed that sulfate contents were 390.67, 542.75 and 291.71 mg/g respectively, with different molecular masses. The appearance of two new characteristic absorption bands at near 1230 and 855, 853 or 808 cm-1 in FT-IR spectra revealed the success of sulfation. sLBPSt with high molecular weight and moderate sulfate content exhibited the best immunomodulatory activity by promoting lymphopoiesis and T lymphocyte differentiation as well as increasing IL-2, IL-6, IFN-γ and TFN-α production in vitro compared with the inartificial polysaccharides. These results indicated that sulfated modification could be considered as an effective way to enhance immune activity of LBPSs. Furthermore, sLBPSt showed the best performances and would be expected as a new source of immunopotentiator. PMID:26884954

  17. Acid Sulfate Alteration in Gusev Crater, Mars

    NASA Technical Reports Server (NTRS)

    Morris, R. V.; Ming, D. W.; Catalano, J. G.

    2016-01-01

    dust. The Moessbauer parameters are not definitive for mineralogical speciation (other than octahedrally-coordinated Fe(3+) but are consistent with a schwertmannite-like phase (i.e., a nanophase ferric oxide). The high oxidation state and values of Moessbauer parameters (center shift and quadrupole splitting) for the high-SO3 samples imply ferric sulfate (i.e., oxidized sulfur), although the hydration state cannot be constrained. In no case is there an excess of SO3 over available cations (i.e., no evidence for elemental sulfur), and Fe sulfide (pyrite) has been detected in only one Gusev sample. The presence of both high-SiO2 (and low total iron and SO3) and high SO3 (and high total iron as ferric sulfate) can be accommodated by a two-step geochemical model developed with the Geochemist's Workbench. (1) Step 1 is anoxic acid sulfate leaching of Martian basalt at high water-to rock ratios (greater than 70). The result is a high-SiO2 residue0, and anoxic conditions are required to solubilize Fe as Fe(2+). (2) Step 2 is the oxic precipitation of sulfate salts from the leachate. Oxic conditions are required to produce the high concentrations of ferric sulfate with minor Mg-sulfates and no detectable Fe(2+)-sulfates.

  18. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    NASA Astrophysics Data System (ADS)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  19. Numerical simulation of a radially injected barium cloud

    NASA Technical Reports Server (NTRS)

    Swift, D. W.; Wescott, E. M.

    1981-01-01

    Electrostatic two-dimensional numerical simulations of a radially symmetric barium injection experiment demonstrate that ions created by solar UV irradiation are electrostatically bound to the electrons which remain tied to the field lines on which they are created. Two possible instabilities are identified, but neither of them causes the barium plasma cloud to polarize in a way that would permit the plasma to keep up with the neutrals. In a second model, the velocity of the neutrals is allowed to be a function of the azimuthal angle. Here, a portion of the cloud does polarize in a way that allows a portion of the plasma to detach and move outward at the approximate speed of the neutrals. No rapid detachment is found when only the density of the neutrals is given an azimuthal asymmetry.

  20. Observations and theory of the AMPTE magnetotail barium releases

    NASA Technical Reports Server (NTRS)

    Bernhardt, P. A.; Roussel-Dupre, R. A.; Pongratz, M. B.; Haerendel, G.; Valenzuela, A.

    1987-01-01

    The barium releases in the magnetotail during the Active Magnetospheric Particle Tracer Explorers (AMPTE) operation were monitored by ground-based imagers and by instruments on the Ion Release Module. After each release, the data show the formation of a structured diamagnetic cavity. The cavity grows until the dynamic pressure of the expanding ions balances the magnetic pressure on its surface. The magnetic field inside the cavity is zero. The barium ions collect on the surface of the cavity, producing a shell. Plasma irregularities form along magnetic field lines draped over the surface of the cavity. The scale size of the irregularities is nearly equal to the thickness of the shell. The evolution and structuring of the diamagnetic cavity are modeled using magnetohydrodynamics theory.

  1. The Skylab barium plasma injection experiments. I - Convection observations

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Davis, T. N.; Peek, H. M.

    1976-01-01

    Two barium-plasma injection experiments were carried out during magnetically active periods in conjunction with the Skylab 3 mission. The high-explosive shaped charges were launched near dawn on November 27 and December 4, 1973, UT. In both cases, the AE index was near 400 gammas, and extensive pulsating auroras covered the sky. The first experiment, Skylab Alpha, occurred in the waning phase of a 1000-gamma substorm, and the second, Skylab Beta, occurred in the expansive phase of an 800-gamma substorm. In both, the convection was generally magnetically eastward, with 100-km-level electric fields near 40 mV/m. However, in the Alpha experiment the observed orientation of the barium flux tube fit theoretical field lines having no parallel current, but the Beta flux-tube orientation indicated a substantial upward parallel sheet current.

  2. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1982-01-01

    Ferroelectric films of barium titanate were synthesized on silicon and quartz substrates, and the photoelectric effect in the structure consisting of metal deposited ferroelectric barium titanate film silicon was studied. A photovoltage with polarity that depends on the direction of the remanent polarization was observed. The deposition of BaTiO3 on silicon and fused quartz substrates was accomplished by an rf sputtering technique. A series of experiments to study the growth of ferroelectric BaTiO3 films on single crystal silicon and fused quartz substrates were conducted. The ferroelectric character in these films was found on the basis of evidence from the polarization electric field hysteresis loops, capacitance voltage and capacitance temperature techniques and from X-ray diffraction studies.

  3. NASA/Max Planck Institute Barium Ion Cloud Project.

    NASA Technical Reports Server (NTRS)

    Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.

    1973-01-01

    NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.

  4. Dielectric function for doped graphene layer with barium titanate

    NASA Astrophysics Data System (ADS)

    Martinez Ramos, Manuel; Garces Garcia, Eric; Magana, Fernado; Vazquez Fonseca, Gerardo Jorge

    2015-03-01

    The aim of our study is to calculate the dielectric function for a system formed with a graphene layer doped with barium titanate. Density functional theory, within the local density approximation, plane-waves and pseudopotentials scheme as implemented in Quantum Espresso suite of programs was used. We considered 128 carbon atoms with a barium titanate cluster of 11 molecules as unit cell with periodic conditions. The geometry optimization is achieved. Optimization of structural configuration is performed by relaxation of all atomic positions to minimize their total energies. Band structure, density of states and linear optical response (the imaginary part of dielectric tensor) were calculated. We thank Dirección General de Asuntos del Personal Académico de la Universidad Nacional Autónoma de México, partial financial support by Grant IN-106514 and we also thank Miztli Super-Computing center the technical assistance.

  5. Crystal structure of tris-(piperidinium) hydrogen sulfate sulfate.

    PubMed

    Lukianova, Tamara J; Kinzhybalo, Vasyl; Pietraszko, Adam

    2015-12-01

    In the title molecular salt, 3C5H12N(+)·HSO4 (-)·SO4 (2-), each cation adopts a chair conformation. In the crystal, the hydrogen sulfate ion is connected to the sulfate ion by a strong O-H⋯O hydrogen bond. The packing also features a number of N-H⋯O hydrogen bonds, which lead to a three-dimensional network structure. The hydrogen sulfate anion accepts four hydrogen bonds from two cations, whereas the sulfate ion, as an acceptor, binds to five separate piperidinium cations, forming seven hydrogen bonds.

  6. Synthesis and characterization of barium ferrite–silica nanocomposites

    SciTech Connect

    Aguilar-González, M.A.; Mendoza-Suárez, G.; Padmasree, K.P.

    2013-10-15

    In this work, we prepared barium ferrite-silica (BaM-SiO{sub 2}) nanocomposites of different molar ratios by high-energy ball milling, followed by heat-treatment at different temperatures. The microstructure, morphology and magnetic properties were characterized for different synthesis conditions by using X-ray diffraction (XRD), scanning electron microscopy (SEM) and vibrating sample magnetometry (VSM). The results indicate that 15 h of milling was enough to avoid the generation of hematite phase and to get a good dispersion of barium ferrite particles in the ceramic matrix. For milling periods beyond 15 h and heat treatment above 900 °C, the XRD patterns showed the presence of hematite phase caused by the decomposition of BaM. The agglomerate size observed through SEM analysis was around 150 nm with a good BaM dispersion into the SiO{sub 2} matrix. The highest saturation magnetization (Ms) value obtained was 43 emu/g and the corresponding coercivity (Hc) value of 3.4 kOe for the composition 60BaM-40SiO{sub 2} milled for 15 h and heat treated at 900 °C. This coercivity value is acceptable for the application in magnetic recording media. Highlights: • Barium ferrite–silica nanocomposites were prepared by high energy ball milling. • Optimal processing time is 15 h milling and heat treatment at 900 °C. • This is enough to avoid the generation of hematite phase. • Obtain good dispersion of barium ferrite particles in the ceramic matrix • Above this processing time shows the presence of increased amount of hematite.

  7. Barium borohydride chlorides: synthesis, crystal structures and thermal properties.

    PubMed

    Grube, Elisabeth; Olesen, Cathrine H; Ravnsbæk, Dorthe B; Jensen, Torben R

    2016-05-10

    Here we report the synthesis, mechanism of formation, characterization and thermal decomposition of new barium borohydride chlorides prepared by mechanochemistry and thermal treatment of MBH4-BaCl2, M = Li, Na or K in ratios 1 : 1 and 1 : 2. Initially, orthorhombic barium chloride, o-BaCl2 transforms into o-Ba(BH4)xCl2-x, x ∼ 0.15. Excess LiBH4 leads to continued anion substitution and a phase transformation into hexagonal barium borohydride chloride h-Ba(BH4)xCl2-x, which accommodates higher amounts of borohydride, possibly x ∼ 0.85 and resembles h-BaCl2. Thus, two solid solutions are in equilibrium during mechano-chemical treatment of LiBH4-BaCl2 (1 : 1) whereas LiBH4-BaCl2 (2 : 1) converts to h-Ba(BH4)0.85Cl1.15. Upon thermal treatment at T > ∼200 °C, h-Ba(BH4)0.85Cl1.15 transforms into another orthorhombic barium borohydride chloride compound, o-Ba(BH4)0.85Cl1.15, which is structurally similar to o-BaBr2. The samples with M = Na and K have lower reactivity and form o-Ba(BH4)xCl2-x, x ∼ 0.1 and a solid solution of sodium chloride dissolved in solid sodium borohydride, Na(BH4)1-xClx, x = 0.07. The new compounds and reaction mechanisms are investigated by in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR) and simultaneous thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), mass spectroscopy (MS) and temperature programmed photographic analysis (TPPA).

  8. Complex Impedance Studies of Optically Excited Strontium Barium Niobate

    DTIC Science & Technology

    2007-11-02

    has a tetragonal tungsten - bronze structure. The unit cell for this structure, illustrated below in Fig. 2.1, consists of ten oxygen octahedra joined...4 Kittel, pp. 373-374. 5 P. B. Jamieson, et al, “Ferroelectric Tungsten Bronze -Type Crystal Structures. I. Barium Strontium Niobate...Oxford, 1987). 2. C. Kittel, Introduction to Solid State Physics, (Wiley, New York, 1986). 3. P. B. Jamieson, et al, “Ferroelectric Tungsten

  9. Barium isotopes in chondritic meteorites: implications for planetary reservoir models.

    PubMed

    Ranen, Michael C; Jacobsen, Stein B

    2006-11-03

    High-precision barium isotope measurements yielded differences of up to 25 parts per million in the 137Ba/136Ba ratio and 60 parts per million in the 138Ba/136Ba ratio between chondrites and Earth. These differences probably arose from incomplete mixing of nucleosynthetic material in the solar nebula. Chondritic meteorites have a slight excess of supernova-derived material as compared to Earth, demonstrating that the solar nebula was not perfectly homogenized upon formation.

  10. Acute barium intoxication following ingestion of soap water solution.

    PubMed

    Joshi, Nandita; Sharma, Chhavi Sarabpreert; Sai; Sharma, Jai Prakash

    2012-10-01

    We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels.

  11. Acute barium intoxication following ingestion of soap water solution

    PubMed Central

    Joshi, Nandita; Sharma, Chhavi Sarabpreert; Sai; Sharma, Jai Prakash

    2012-01-01

    We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels. PMID:23559738

  12. Barium hexaferrite based on the waste products from electroplating processes

    SciTech Connect

    Vlasov, A.S.; Stepanchikova, I.G.; Makarov, S.V.; Zaitsev, V.A.; Danilov, A.S.

    1987-11-01

    The authors assess the possibility of simultaneously treating and using waste electroplating slurries containing large amounts of iron hydroxides for obtaining barium hexaferrite ceramics. Differential thermal analysis was employed to determine the processing and recovery parameters and the resulting hexaferrites were tested, mechanically and by x-ray diffraction, for their mechanical and magnetic properties as well as for their phase composition and structure. The consequences of the process on pollution abatement are also evaluated.

  13. Texture and Microstructural Development in Gelcast Barium Hexaferrite

    SciTech Connect

    Hovis, David B.; Faber, Katherine T.; Kenik, Edward A

    2008-01-01

    The development of texture in barium hexaferrite by templated grain growth was studied as a function of the Fe2O3/BaCO3 ratio, B2O3 additions in the starting materials, and sintering temperature. A magnetic field was used to orient the template particles during the gelcasting process. Excess BaCO3 resulted in abnormal grain growth and maximized texture, while B2O3 additions promoted coarsening, but no abnormal grain growth.

  14. Ion Exchange Studies for Removal of Sulfate from Hanford Tank Waste Envelope C (241-AN-107) Using SuperLig 655 Resin

    SciTech Connect

    DE Kurath; JR Bontha; DL Blanchard; SK Fiskum; BM Rapko

    2000-08-23

    BNFL Inc. is evaluating various pretreatment technologies to mitigate the impacts of sulfate on the LAW vitrification system. One pretreatment technology for separating sulfate from LAW solutions involves the use of SuperLig{reg_sign} 655 (SL-655), a proprietary ion exchange material developed and supplied by IBC Advanced Technologies, Inc., American Fork, UT. This report describes testing of SL-655 with diluted ([Na] {approximately} 5 M) waste from Hanford Tank 241-AN-107 at Battelle, Pacific Northwest Division. Batch contact studies were conducted from 4 to 96 hours to determine the sulfate distribution coefficient and reaction kinetics. A small-scale ion exchange column test was conducted to evaluate sulfate removal, loading, breakthrough, and elution from the SL-655. In all of these tests, an archived 241-AN-107 tank waste sample (pretreated to remove Cs, Sr, and transuranics elements) was used. The experimental details and results are described in this report. Under the test conditions, SL-655 was found to have no significant ion exchange affinity for sulfate in this matrix. The batch contact study resulted in no measurable difference in the aqueous sulfate concentration following resin contact (K{sub d} {approximately} 0). The column test also demonstrated SL-655 had no practical affinity for sulfate in the tested matrix. Within experimental error, the sulfate concentration in the column effluent was equal to the concentration in the feed after passing 3 bed volumes of sample through the columns. Furthermore, some, if not all, of the decreased sulfate concentration in these first three column volumes of effluent can be ascribed to mixing and dilution of the 241-AN-107 feed with the interstitial liquid present in the column at the start of the loading cycle. Finally, ICP-AES measurements on the eluate solutions showed the presence of barium as soon as contact with the feed solution is completed. Barium is a metal not detected in the feed solution. Should the

  15. In-situ transmission electron microscopy crystallization studies of sol-gel-derived barium titanate thin films

    SciTech Connect

    Gust, M.C.; Mecartney, M.L.; Evans, N.D.; Momoda, L.A.

    1997-11-01

    Barium titanate (BaTiO{sub 3}) thin films that were derived from methoxypropoxide precursors were deposited onto (100) Si, Pt/Ti/SiO{sub 2}/(100) Si, and molecular-beam-epitaxy-grown (MBE-grown) (100) BaTiO{sub 3} on (100) Si substrates by spin coating. The crystallization behavior of the amorphous-gel films was characterized using in-situ transmission electron microscopy heating experiments, glancing-angle X-ray diffraction, and differential thermal analysis/thermogravimetric analysis. Amorphous-gel films crystallized at a temperature of {approximately}600 C to an intermediate nanoscale (5--10 nm) barium titanium carbonate phase, presumably BaTiO{sub 2}CO{sub 3}, that subsequently transformed to nanocrystalline (20--50 nm) BaTiO{sub 3}. Random nucleation in the bulk of the gel film was observed on all substrates. In addition, oriented growth of BaTiO{sub 3} was concurrently observed on MBE-grown BaTiO{sub 3} on (100) Si. High-temperature decomposition of the intermediate carbonate phase contributed to nanometer-scale residual porosity in the films. High concentrations of water of hydrolysis inhibited the formation of the intermediate carbonate phase; however, these sols precipitated and were not suitable for spin coating.

  16. Precipitation Climate Data Records

    NASA Astrophysics Data System (ADS)

    Nelson, B. R.; Prat, O.; Vasquez, L.

    2015-12-01

    Five precipitation CDRs are now or soon will be transitioned to NOAA's CDR program. These include the PERSIANN data set, which is a 30-year record of daily adjusted global precipitation based on retrievals from satellite microwave data using artificial neural networks. The AMSU-A/B/Hydrobundle is an 11-year record of precipitable water, cloud water, ice water, and other variables. CMORPH (the NOAA Climate Prediction Center Morphing Technique) is a 17-year record of daily and sub-daily adjusted global precipitation measured from passive microwave and infrared data at high spatial and temporal resolution. GPCP (the Global Precipitation Climatology Project) is an approximately 30-year record of monthly and pentad adjusted global precipitation and a 17-year record of daily adjusted global precipitation. The NEXRAD Reanalysis is a 10-year record of high resolution NEXRAD radar based adjusted CONUS-wide hourly and daily precipitation. This study provides an assessment of the existing and transitioned long term precipitation CDRs and includes the verification of the five precipitation CDRs using various methods including comparison with in-situ data sets and trend analysis. As all of the precipitation related CDRs are transitioned, long term analyses can be performed. Comparisons at varying scales (hourly, daily and longer) of the precipitation CDRs with in-situ data sets are provided as well as a first look at what could be an ensemble long term precipitation data record.

  17. Life Model of Hollow Cathodes Using a Barium Calcium Aluminate Impregnated Tungsten Emitter

    NASA Technical Reports Server (NTRS)

    Kovaleski, S. D.; Burke, Tom (Technical Monitor)

    2001-01-01

    Hollow cathodes with barium calcium aluminate impregnated tungsten emitters for thermionic emission are widely used in electric propulsion. These high current, low power cathodes are employed in ion thrusters, Hall thrusters, and on the International Space Station in plasma contactors. The requirements on hollow cathode life are growing more stringent with the increasing use of electric propulsion technology. The life limiting mechanism that determines the entitlement lifetime of a barium impregnated thermionic emission cathode is the evolution and transport of barium away from the emitter surface. A model is being developed to study the process of barium transport and loss from the emitter insert in hollow cathodes. The model accounts for the production of barium through analysis of the relevant impregnate chemistry. Transport of barium through the approximately static gas is also being treated. Finally, the effect of temperature gradients within the cathode are considered.

  18. Toward remote ion-ion entanglement with barium

    NASA Astrophysics Data System (ADS)

    Noel, Thomas W.; Auchter, Carolyn; Chou, Chen-Kuan; Blinov, Boris B.

    2015-03-01

    We present work toward remote entanglement of barium ions in traps separated by a few meters. A new version of an ion trap specialized for remote entanglement is introduced. The new trap allows for highly efficient collection of ion fluorescence while simultaneously minimizing ion micromotion and aligning the trap position precisely to the focus of an in-vacuum parabolic mirror by using a set of bias electrodes and a piezoelectric micro-positioning system. The success rate of the remote entanglement procedure depends strongly on the efficiency with which ion fluorescence can be coupled into an optical fiber. Characterization of our system in terms of ion fluorescence collection and fiber coupling efficiency is presented. Results demonstrating entanglement between a single barium ion and single spontaneously emitted photons are shown. The entanglement fidelity of the ion-photon state is measured to be 0.84(1) and a CHSH Bell signal of 2.303(36) finds violation of the CHSH version of the Bell inequality by over eight standard deviations. Barium's relatively long wavelength transitions make it an ideal candidate for our longer term goal of remote entanglement of ions separated by a kilometer or more. Such long distance remote entanglement should allow for a loophole-free verification of the violation of the Bell inequality.

  19. Barium as a potential indicator of phosphorus in agricultural runoff.

    PubMed

    Ahlgren, Joakim; Djodjic, Faruk; Wallin, Mats

    2012-01-01

    In many catchments, anthropogenic input of contaminants, and in particular phosphorus (P), into surface water is a mixture of agricultural and sewage runoff. Knowledge about the relative contribution from each of these sources is vital for mitigation of major environmental problems such as eutrophication. In this study, we investigated whether the distribution of trace elements in surface waters can be used to trace the contamination source. Water from three groups of streams was investigated: streams influenced only by agricultural runoff, streams influenced mainly by sewage runoff, and reference streams. Samples were collected at different flow regimes and times of year and analyzed for 62 elements using ICP-MS. Our results show that there are significant differences between the anthropogenic sources affecting the streams in terms of total element composition and individual elements, indicating that the method has the potential to trace anthropogenic impact on surface waters. The elements that show significant differences between sources are strontium (p < 0.001), calcium (p < 0.004), potassium (p < 0.001), magnesium (p < 0.001), boron (p < 0.001), rhodium (p = 0.001), and barium (p < 0.001). According to this study, barium shows the greatest potential as a tracer for an individual source of anthropogenic input to surface waters. We observed a strong relationship between barium and total P in the investigated samples (R(2) = 0.78), which could potentially be used to apportion anthropogenic sources of P and thereby facilitate targeting of mitigation practices.

  20. The Tordo 1 polar cusp barium plasma injection experiment

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Davis, T. N.; Jeffries, R. A.; Roach, W. H.

    1978-01-01

    In January 1975, two barium plasma injection experiments were carried out with rockets launched into the upper atmosphere where field lines from the dayside cusp region intersect the ionosphere. The Tordo 1 experiment took place near the beginning of a worldwide magnetic storm. It became a polar cap experiment almost immediately as convection perpendicular to the magnetic field moved the fluorescent plasma jet away from the cusp across the polar cap in an antisunward direction. Convection across the polar cap with an average velocity of more than 1 km/s was observed for nearly 40 min until the barium flux tubes encountered large electron fields associated with a poleward bulge of the auroral oval near Greenland. Prior to the encounter with the aurora near Greenland there is evidence of upward acceleration of the barium ions while they were in the polar cap. The three-dimensional observations of the plasma orientation and motion give an insight into convection from the cusp region across the polar cap, the orientation of the polar cap magnetic field lines out to several earth radii, the causes of polar cap magnetic perturbations, and parallel acceleration processes.

  1. Barium thiolates and selenolates: syntheses and structural principles.

    PubMed

    Ruhlandt-Senge, K; Englich, U

    2000-11-17

    The synthesis and structural characterization of a family of barium thiolates and selenolates is described. The thiolates were synthesized by metallation of thiols, the selenolates by reductive insertion of the metal into the selenium-selenium bond of diorganodiselenides. Both reaction sequences were carried out by using barium metal dissolved in ammonia; this afforded barium thiolates and selenolates in good yield and purity. The structural principles displayed in the target compounds span a wide range of solid-state formulations, including monomeric and dimeric species, and separated ion triples, namely [Ba(thf)4(SMes*)2] (1; Mes* = 2,4,6-tBU3C6H2), [Ba(thf)4(SeMes*)2] (2), [Ba([18]crown-6)(hmpa)2][(SeMes*)2] (3), the dimeric [(Ba(py)3(thf)(SeTrip)2)2] (4; py = pyridine, Trip = 2,4.6-iPr3C6H2), and [Ba([18]crown-6)(SeTrip)2] (5). The full range of association modes is completed by [Ba([18]crown-6)(hmpa)SMes*][SMes*] (6) communicated earlier by this group. In the solid state, this compound displays an intermediate ion coordination mode: one anion is bound to the metal, while the second one is unassociated. Together these compounds provide structural information about all three different association modes for alkaline earth metal derivatives. This collection of structural data allows important conclusions about the influence of solvation and ligation on structural trends.

  2. Determination of trace elements in triglycine sulfate solutions

    NASA Technical Reports Server (NTRS)

    Tadros, Shawky H.

    1993-01-01

    Ten elements were divided into 2 groups. The elements in the first group included iron, nickel, chromium, manganese, copper, and gold. The elements in the second group included zinc, cobalt, lead, cadmium, and gold. Five ppm of each element in each group was spiked in a 1 percent triglycine sulfate (TGS) solution. Glycine was removed with 1-naphthyl isocyanate in ether medium. The glycine derivative 1-naphthyl isocyanate glycine was removed by filtration, and the filtrates were analyzed for the different elements. Analysis of these elements was performed by using the 5100 Perkin-Elmer Atomic Absorption Spectrophotometer. The result of these experiments was the observation that there was a decrease in the concentration of chromium and gold, which was interpreted to be due to the chelation of these elements by the derivative 1-naphthyl isocyanate glycine. Further research is needed to determine the concentration of other elements in triglycine sulfate (TGS) solutions. These elements will include lithium, sodium, rubidium, magnesium, calcium, strontium, barium, aluminum, and silicon. These are the most likely elements to be found in the sulfuric acid used in manufacturing the TGS crystal. Moreover, we will extend our research to investigate the structural formula of the violet colored chelated compounds, which had been formed by interaction of the derivative 1-naphthyl isocyanate glycine with the different elements, such as gold, chromium.

  3. Glucosamine and chondroitin sulfate.

    PubMed

    Miller, Karla L; Clegg, Daniel O

    2011-02-01

    Glucosamine and chondroitin sulfate, components of normal cartilage that are marketed as dietary supplements in the United States, have been evaluated for their potential role in the treatment of osteoarthritis. Due to claims of efficacy, increased prevalence of osteoarthritis, and a lack of other effective therapies, there has been substantial interest in using these dietary supplements as therapeutic agents for osteoarthritis. Though pharmacokinetic and bioavailability data are limited, use of these supplements has been evaluated for management of osteoarthritis symptoms and modification of disease progression. Relevant clinical trial efficacy and safety data are reviewed and summarized.

  4. Ferric sulfates on Mars

    NASA Technical Reports Server (NTRS)

    Burns, Roger G.

    1987-01-01

    Evidence is presented for the possible existence of ferric sulfato complexes and hydroxo ferric sulfate minerals in the permafrost of Mars. A sequential combination of ten unique conditions during the cooling history of Mars is suggested which is believed to have generated an environment within Martian permafrost that has stabilized Fe(3+)-SO4(2-)-bearing species. It is argued that minerals belonging to the jarosite and copiapite groups could be present in Martian regolith analyzed in the Viking XRF measurements at Chryse and Utopia, and that maghemite suspected to be coating the Viking magnet arrays is a hydrolysate of dissolved ferric sulfato complexes from exposed Martian permafrost.

  5. Relation of precipitation quality to storm type, and deposition of dissolved chemical constituents from precipitation in Massachusetts, 1983-85

    USGS Publications Warehouse

    Gay, F.B.; Melching, C.S.

    1995-01-01

    Precipitation samples were collected for 83 storms at a rural inland site in Princeton, Mass., and 73 storms at a rural coastal site in Truro, Mass., to examine the quality of precipitation from storms and relate quality to three storm types (oceanic cyclone, continental cyclone, and cold front). At the inland site, Princeton, ranked-means of precipitation depth, storm duration, specific conductance, and concentrations and loads of hydrogen, sulfate, aluminum, bromide, and copper ions were affected by storm type. At the coastal site, Truro, ranked means of precipitation depth, storm duration, and concentrations and loads of calcium, chloride, magnesium, potassium, and sodium ions were affected by storm type. Precipitation chemistry at the coastal site was 85 percent oceanic in orgin, whereas precipitation 72 kilometers inland was 60 percent hydrogen, nitrate, and sulfate ions, reflecting fossil-fuel combustion. Concentrations and loads for specific conductance and 9 chemical constituents on an annual and seasonal basis were determined from National Atmospheric Deposition Program data for spring 1983 through winter 1985 at Quabbin (rural, inland), Waltham (suburban, inland) and Truro (rural, coastal), Massachusetts. Concentrations of magnesium, potassium, sodium, and chloride concentrations were highest at the coast and much lower inland, with very little difference between Waltham and Quabbin. Loads of ammonium, nitrate, sulfate, and hydrogen are highest at Quabbin and are about equal at Waltham and Truro. About twice as much nitrate and hydrogen and about 35 percent more sulfate is deposited at Quabbin than at Waltham or Truro; this pattern indicates that the interior of Massachusetts receives more acidic precipitation than do the eastern or the coastal areas of Massachusetts.

  6. Coral barium incorporation: implications for proxy applications

    NASA Astrophysics Data System (ADS)

    Gonneea, M. E.; Cohen, A. L.; Charette, M. A.

    2012-12-01

    Coral Ba/Ca ratios have been proposed as proxies for various environmental variables including sediment loading, upwelling and groundwater input. Two assumptions that underpin the application of Ba/Ca ratios as an environmental proxy is 2) that corals take up Ba/Ca in concentrations proportional to seawater concentrations and 1) that the specified forcing mechanism influences seawater [Ba]. Here we present data from laboratory experiments that demonstrates corals reared in a range of seawater [Ba] linearly incorporate this signature in their skeletal Ba/Ca ratios. Observed coral Ba/Ca perturbations above baseline typically range from 5-15 μmol/mol which is ~100-500% increase over baseline. Other factors known to influence coral Ba/Ca include the temperature dependence on the partition coefficient and mass fraction aragonite precipitated by the coral which may be linked to calcification rate. In our experiments, calcification rate increased with temperature, thus the observed coral partition coefficient is the net effect of temperature (Ba/Ca increase at lower temperature) and calcification rate (Ba/Ca increase at higher temperature). We observed that the partition coefficient for reared coral Ba/Ca increased 20% 27.7 to 22.5 C, much less than observed Ba/Ca perturbations. Thus we predict that seawater [Ba] drives coral Ba/Ca signals in many locations. We present a model framework to calculate the expected contribution from sediment input, upwelling and groundwater discharge that is needed to produce this signature in corals growing in receiving waters. Finally we apply this model to a coral record from the Yucatan Peninsula, Mexico, recording groundwater discharge to the coastal ocean.

  7. Atomic force microscopy studies of twins in yttrium-doped barium titanate

    NASA Astrophysics Data System (ADS)

    Gheno, Simoni Maria; Hasegawa, Haroldo Lhou; Filho, Pedro Iris Paulin

    2006-11-01

    Barium titanate is the main constituent of PTC materials and their electric properties are sensitive to microstructure and defects, in atomic scale, that are significantly affected by processing parameters. The microstructure of barium titanate doped with yttrium was investigated using topographic images obtained by AFM in contact mode. The AFM images of barium titanate doped with yttrium showed the effect of large grains with double twins at different (1 1 1) planes.

  8. Remediation of acid mine drainage with sulfate reducing bacteria

    SciTech Connect

    Hauri, J.F.; Schaider, L.A.

    2009-02-15

    Sulfate reducing bacteria have been shown to be effective at treating acid mine drainage through sulfide production and subsequent precipitation of metal sulfides. In this laboratory experiment for undergraduate environmental chemistry courses, students design and implement a set of bioreactors to remediate acid mine drainage and explain observed changes in dissolved metal concentrations and pH. Using synthetic acid mine drainage and combinations of inputs, students monitor their bioreactors for decreases in dissolved copper and iron concentrations.

  9. Radiation losses in microwave Ku region by conducting pyrrole/barium titanate and barium hexaferrite based nanocomposites

    NASA Astrophysics Data System (ADS)

    Kaur, Talwinder; Kumar, Sachin; Narang, S. B.; Srivastava, A. K.

    2016-12-01

    Nanocomposites of substituted barium hexaferrite and barium titanate embedded in a polymer were synthesized via emulsion polymerization. The study was performed by using X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, electron spin resonance spectroscopy, a vibrating sample magnetometer and a vector network analyzer. It is found that maximum radiation loss occur at 16.09 GHz (-14.23 dB) frequency owing to the combined effect of conducting polymer, suitable dielectric and magnetic material. This suggests that prepared material is suitable for radiation losses. Micro structural study reveals the presence of all the phases of the compounds comprises composite. Benzene ring absorption band (at 1183 cm-1) in FT-IR spectra illustrates the presence of polymer. Surface morphology reveals the presence of array of particles encapsulated by the polymer.

  10. Electric field tunable 60 GHz ferromagnetic resonance response in barium ferrite-barium strontium titanate multiferroic heterostructures

    NASA Astrophysics Data System (ADS)

    Song, Young-Yeal; Das, Jaydip; Krivosik, Pavol; Mo, Nan; Patton, Carl E.

    2009-05-01

    A magnetic-ferroelectric film heterostructure with a large electric field tuning of the ferromagnetic resonance (FMR) mode was fabricated. Pulse laser deposited 30 nm thick Pt electrodes and 3 μm thick barium strontium titanate films on Nb-doped strontium titanate substrates were capped with an unbonded 200 μm thick single crystal in-plane c-axis barium hexaferrite slab. The structure gives a 60 GHz FMR frequency shift of 16 MHz at a bias of 29 V, for an average response of 0.55 MHz/V. The maximum incremental tuning response at 29 V was 1.3 MHz/V. This is a hundredfold improvement over previous results.

  11. Characterization, antioxidant and cytotoxic activity of sulfated derivatives of a water-insoluble polysaccharides from Dictyophora indusiata.

    PubMed

    Deng, Chao; Xu, Jingjing; Fu, Haitian; Chen, Jinghua; Xu, Xin

    2015-04-01

    The present study described the characterization and biological properties of water‑soluble sulfated polysaccharides prepared from water‑insoluble polysaccharide (DIP), which were extracted from Dictyophora indusiata. The sulfation of DIP was performed using the chlorosulfonic acid‑pyridine method. The water solubilities of the sulfated derivatives were measured at room temperature according to the Chinese Pharmacopoeia. The scavenging activity of hydroxyl radicals and 1,1‑diphenyl‑2‑picrylhydrazyl (DPPH) as determined, together with the reduction ability of the sulfated polysaccharides. The cytotoxic and antiproliferative effects of DIP and the sulfated derivatives on MCF‑7 and B16 cells were then determined using an MTT assay. The substitution degrees of the sulfated polysaccharides were 0.584 (S1‑DIP), 0.989 (S2‑DIP) and 1.549 (S3‑DIP) according to barium chloride‑gelatin nephelometry. Infrared spectroscopy and 13C‑nuclear magnetic resonance indicated that the substitution of S‑DIP occurred mainly at the C‑6 position, followed by the C‑4 and C‑2 positions. A significant increase was noted in the antioxidant activity of the sulfated derivatives compared with that of DIP. In addition, the S‑DIPs exhibited a more marked reducing capacity and clearing activity of hydroxyl radicals and DPPH. This indicated that the antioxidant capacity of the polysaccharides was significantly higher following sulfation. Furthermore, in in vitro cell investigations, DIP exhibited no inhibitory effects on the growth of the B16 or MCF‑7 tumor cells. However, the sulfated derivatives exerted marked inhibitory effects on these cell lines. Sulfate modification may therefore contribute to an improvement in water solubility and in the antioxidant and antitumor activities of natural DIP.

  12. Sulfur Isotopes as Indicators of Bacterial Sulfate Reduction Processes Influencing Field Scale Uranium Bioremediation

    NASA Astrophysics Data System (ADS)

    Druhan, J. L.; Conrad, M. E.; Williams, K. H.; N'guessan, L.; Long, P. E.; Hubbard, S. S.

    2007-12-01

    An in-situ acetate amendment at a DOE Uranium Mill Tailings Remedial Action (UMTRA) site near Rifle, CO demonstrated successful reduction of aqueous U(VI), to less soluble U(IV) through stimulated microbial activity. U(VI) reduction rates were highest during iron reduction and decreased with the onset of sulfate reduction. However, sustained U(IV) attenuation was observed following subsequent termination of the acetate amendment. These findings illustrate the importance of the transition between iron and sulfate reducing conditions in stimulating bioreduction of uranium. The sulfur isotope compositions of sulfate and sulfide were measured through this transition in order to explore the utility of these data in tracking the extent of microbial sulfate reduction and to assess the stability of sulfide precipitates. Samples for isotopic analyses and aqueous measurements of sulfate, ferrous iron, U(VI) and acetate were collected in one background well and three monitoring wells down-gradient of the acetate injection. Results show an increase of up to 7‰ in the δ34S of sulfate at the onset of sulfate reduction, followed by a return to background δ34S values of -8‰ following cessation of the acetate amendment. The δ34S values of sulfide increased from roughly -20‰ at the onset of sulfate reduction to a maximum of -0.8‰ during peak sulfate removal, followed by a gradual return to values of roughly -28‰ upon cessation of the acetate amendment. These data present a unique perspective on the processes governing the bioreduction experiment in that the sulfate isotopes are a function of both transport and mixing processes, whereas the sulfide isotopes represent biogenic sulfide that is rapidly removed from the aqueous phase. Thus a comparable enrichment in sulfate isotopic data noted in the closest and furthest wells from the injection gallery suggest bioreduction in both of these locations, while a larger increase in sulfide isotopic values in the closest well

  13. Sponge-associated bacteria mineralize arsenic and barium on intracellular vesicles

    PubMed Central

    Keren, Ray; Mayzel, Boaz; Lavy, Adi; Polishchuk, Iryna; Levy, Davide; Fakra, Sirine C.; Pokroy, Boaz; Ilan, Micha

    2017-01-01

    Arsenic and barium are ubiquitous environmental toxins that accumulate in higher trophic-level organisms. Whereas metazoans have detoxifying organs to cope with toxic metals, sponges lack organs but harbour a symbiotic microbiome performing various functions. Here we examine the potential roles of microorganisms in arsenic and barium cycles in the sponge Theonella swinhoei, known to accumulate high levels of these metals. We show that a single sponge symbiotic bacterium, Entotheonella sp., constitutes the arsenic- and barium-accumulating entity within the host. These bacteria mineralize both arsenic and barium on intracellular vesicles. Our results indicate that Entotheonella sp. may act as a detoxifying organ for its host. PMID:28233852

  14. Synthesis, structural characterization and antibacterial activity of cotton fabric modified with a hydrogel containing barium hexaferrite nanoparticles

    NASA Astrophysics Data System (ADS)

    Staneva, Desislava; Koutzarova, Tatyana; Vertruyen, Benedicte; Vasileva-Tonkova, Evgenia; Grabchev, Ivo

    2017-01-01

    Barium hexaferrite nanoparticles were synthesized by co-precipitation of Ba2+ and Fe3+ cations with NaOH under of high-power ultrasound. The nanoparticles were dispersed in an aqueous solution of the hydrogel precursors. This solution was used to impregnate the cotton fabric dyed with a photoinitiator. The composite material BaFe12O19 nanoparticles-hydrogel-cotton fabric was prepared by surface initiate photopolymerization under visible light. The modification of the cotton fabric and uniform distribution of the nanoparticles in the structure of the hydrogel were analyzed by scanning electron microscopy (SEM), IR spectroscopy, X-ray diffraction analysis (XRD), fluorescence and colourimetric analyses. The antibacterial efficacy of the material was evaluated against Gram-negative Escherichia coli and Pseudomonas aeruginosa.

  15. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ferrous sulfate. 184.1315 Section 184.1315 Food... GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II) sulfate heptahydrate, Fe... pale, bluish-green crystals or granules. Progressive heating of ferrous sulfate heptahydrate...

  16. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ferrous sulfate. 184.1315 Section 184.1315 Food and... Substances Affirmed as GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II) sulfate... as pale, bluish-green crystals or granules. Progressive heating of ferrous sulfate...

  17. Natural or anthropogenic? On the origin of atmospheric sulfate deposition in the Andes of southeastern Ecuador

    NASA Astrophysics Data System (ADS)

    Makowski Giannoni, S.; Rollenbeck, R.; Trachte, K.; Bendix, J.

    2014-05-01

    Atmospheric sulfur deposition above certain limits can represent a threat to tropical forests, causing nutrient imbalances and mobilizing toxic elements that impact biodiversity and forest productivity. Atmospheric sources of sulfur deposited by precipitation have being roughly identified in only a few lowland tropical forests. Even scarcer are these type of studies in tropical mountain forests, many of them megadiversity hotspots and especially vulnerable to acidic deposition. Here, the topographic complexity and related streamflow condition the origin, type, and intensity of deposition. Furthermore, in regions with a variety of natural and anthropogenic sulfur sources, like active volcanoes and biomass-burning, no source-emission data has been used for determining the contribution of each of them to the deposition. The main goal of the current study is to evaluate sulfate (SO4-) deposition by rain and occult precipitation at two topographic locations in a tropical mountain forest of southern Ecuador, and to trace back the deposition to possible emission sources applying back trajectory modeling. To link upwind natural (volcanic) and anthropogenic (urban/industrial and biomass-burning) sulfur emissions and observed sulfate deposition, we employed state of the art inventory and satellite data, including volcanic passive degassing as well. We conclude that biomass-burning sources generally dominate sulfate deposition at the evaluated sites. Minor sulfate transport occurs during the shifting of the predominant winds to the north and west. Occult precipitation sulfate deposition and likely rain sulfate deposition are mainly linked to biomass-burning emissions from the Amazon lowlands. Volcanic and anthropogenic emissions from the north and west contribute to occult precipitation sulfate deposition at the mountain crest Cerro del Consuelo meteorological station and to rain-deposited sulfate at the upriver mountain-pass El Tiro meteorological station.

  18. Natural or anthropogenic? On the origin of atmospheric sulfate deposition in the Andes of southeastern Ecuador

    NASA Astrophysics Data System (ADS)

    Makowski Giannoni, S.; Rollenbeck, R.; Trachte, K.; Bendix, J.

    2014-10-01

    Atmospheric sulfur deposition above certain limits can represent a threat to tropical forests, causing nutrient imbalances and mobilizing toxic elements that impact biodiversity and forest productivity. Atmospheric sources of sulfur deposited by precipitation have been roughly identified in only a few lowland tropical forests. Even scarcer are studies of this type in tropical mountain forests, many of them mega-diversity hotspots and especially vulnerable to acidic deposition. In these places, the topographic complexity and related streamflow conditions affect the origin, type, and intensity of deposition. Furthermore, in regions with a variety of natural and anthropogenic sulfur sources, like active volcanoes and biomass burning, no source emission data has been used for determining the contribution of each source to the deposition. The main goal of the current study is to evaluate sulfate (SO4- deposition by rain and occult precipitation at two topographic locations in a tropical mountain forest of southern Ecuador, and to trace back the deposition to possible emission sources applying back-trajectory modeling. To link upwind natural (volcanic) and anthropogenic (urban/industrial and biomass-burning) sulfur emissions and observed sulfate deposition, we employed state-of-the-art inventory and satellite data, including volcanic passive degassing as well. We conclude that biomass-burning sources generally dominate sulfate deposition at the evaluated sites. Minor sulfate transport occurs during the shifting of the predominant winds to the north and west. Occult precipitation sulfate deposition and likely rain sulfate deposition are mainly linked to biomass-burning emissions from the Amazon lowlands. Volcanic and anthropogenic emissions from the north and west contribute to occult precipitation sulfate deposition at the mountain crest Cerro del Consuelo meteorological station and to rain-deposited sulfate at the upriver mountain pass El Tiro meteorological station.

  19. A review of the health impacts of barium from natural and anthropogenic exposure.

    PubMed

    Kravchenko, Julia; Darrah, Thomas H; Miller, Richard K; Lyerly, H Kim; Vengosh, Avner

    2014-08-01

    There is an increasing public awareness of the relatively new and expanded industrial barium uses which are potential sources of human exposure (e.g., a shale gas development that causes an increased awareness of environmental exposures to barium). However, absorption of barium in exposed humans and a full spectrum of its health effects, especially among chronically exposed to moderate and low doses of barium populations, remain unclear. We suggest a systematic literature review (from 1875 to 2014) on environmental distribution of barium, its bioaccumulation, and potential and proven health impacts (in animal models and humans) to provide the information that can be used for optimization of future experimental and epidemiological studies and developing of mitigative and preventive strategies to minimize negative health effects in exposed populations. The potential health effects of barium exposure are largely based on animal studies, while epidemiological data for humans, specifically for chronic low-level exposures, are sparse. The reported health effects include cardiovascular and kidney diseases, metabolic, neurological, and mental disorders. Age, race, dietary patterns, behavioral risks (e.g., smoking), use of medications (those that interfere with absorbed barium in human organism), and specific physiological status (e.g., pregnancy) can modify barium effects on human health. Identifying, evaluating, and predicting the health effects of chronic low-level and moderate-level barium exposures in humans is challenging: Future research is needed to develop an understanding of barium bioaccumulation in order to mitigate its potential health impacts in various exposured populations. Further, while occupationally exposed at-risk populations exist, it is also important to identify potentially vulnerable subgroups among non-occupationally exposed populations (e.g., elderly, pregnant women, children) who are at higher risk of barium exposure from drinking water and food.

  20. Crystallization behavior of a barium titanate tellurite glass doped with Eu3+ and Er3+

    NASA Astrophysics Data System (ADS)

    Ferreira, Elivelton Alves; Cassanjes, Fábia Castro; Poirier, Gael

    2013-04-01

    The main objective of this work has been to investigate the crystallization behavior of the glass composition 70TeO2-15BaO-15TiO2 doped with Eu3+ and Er3+ in order to check the possibility of obtaining transparent glass-ceramics containing rare earth-doped BaTiO3 nanocrystals. Glass samples with the ternary composition 70TeO2-15BaO-15TiO2 were synthesized by the melt-quenching method and doped with 0.1% of Eu3+ and Er3+. Thermal properties were investigated by DTA and heat-treatments were applied between Tg and Tx to induce the controlled crystallization of these glasses. One-step and two-step heat treatments were tested and the final glass-ceramics characterized by X-ray diffraction and UV-Vis absorption. It has been shown that transparent glass-ceramics can be obtained after heat-treatment but barium titanate BaTiO3 is hardly precipitated without coprecipitation of another crystalline phase identified as an isostructure of lanthanum tellurate. In addition, the crystalline volume fraction is relatively small in these transparent samples. Finally, Gold doping has been shown to be very effective to promote a volume nucleation and preferential crystallization of BaTiO3 over the other crystalline phases.

  1. 21 CFR 184.1307 - Ferric sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... Substances Affirmed as GRAS § 184.1307 Ferric sulfate. (a) Ferric sulfate (iron (III) sulfate, Fe2(SO4)3 CAS... treating ferric oxide or ferric hydroxide with sulfuric acid. (b) The ingredient must be of a...

  2. 21 CFR 184.1307 - Ferric sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... Substances Affirmed as GRAS § 184.1307 Ferric sulfate. (a) Ferric sulfate (iron (III) sulfate, Fe2(SO4)3 CAS... treating ferric oxide or ferric hydroxide with sulfuric acid. (b) The ingredient must be of a...

  3. Sulfation of von Willebrand factor

    SciTech Connect

    Carew, J.A.; Browning, P.J.; Lynch, D.C. )

    1990-12-15

    von Willebrand factor (vWF) is a multimeric adhesive glycoprotein essential for normal hemostasis. We have discovered that cultured human umbilical vein endothelial cells incorporate inorganic sulfate into vWF. Following immunoisolation and analysis by polyacrylamide or agarose gel electrophoresis, metabolically labeled vWF was found to have incorporated (35S)-sulfate into all secreted multimer species. The time course of incorporation shows that sulfation occurs late in the biosynthesis of vWF, near the point at which multimerization occurs. Quantitative analysis suggests the presence, on average, of one molecule of sulfate per mature vWF subunit. Virtually all the detectable sulfate is released from the mature vWF subunit by treatment with endoglycosidases that remove asparagine-linked carbohydrates. Sulfated carbohydrate was localized first to the N-terminal half of the mature subunit (amino acids 1 through 1,365) by partial proteolytic digestion with protease V8; and subsequently to a smaller fragment within this region (amino acids 273 through 511) by sequential digestions with protease V8 and trypsin. Thus, the carbohydrate at asparagine 384 and/or 468 appears to be the site of sulfate modification. Sodium chlorate, an inhibitor of adenosine triphosphate-sulfurylase, blocks sulfation of vWF without affecting either the ability of vWF to assemble into high molecular weight multimers or the ability of vWF multimers to enter Weible-Palade bodies. The stability of vWF multimers in the presence of an endothelial cell monolayer also was unaffected by the sulfation state. Additionally, we have found that the cleaved propeptide of vWF is sulfated on asparagine-linked carbohydrate.

  4. Mechanisms of sulfate removal from subsurface calcium chloride brines: Heletz-Kokhav oilfields, Israel

    NASA Astrophysics Data System (ADS)

    Gavrieli, Ittai; Starinsky, Avraham; Spiro, Baruch; Aizenshtat, Zeev; Nielsen, Heimo

    1995-09-01

    The evolution of the Ca-chloride brines in the Heletz Formation, Lower Cretaceous, in the southern coastal plain of Israel was reconstructed through the study of its sulfate concentration and isotopic composition. Particular emphasis was given to the brine-oil interaction in the oilfields and to the sulfate depletion and lower SO 4/Cl ratio in brines in contact with hydrocarbons (oil brines) relative to "oil-free" from dry wells in the same oilfields. A method is presented for a calculation of the amount of sulfate removed from the original seawater in the various stages of its evolution to Ca-chloride brine. These stages include evaporation, dolomitization, and sulfate reduction in different stages of its evolution, from early diagenetic processes to the contact with crude oil. In the present study, based on the δ34S SO 4 and SO 4/Cl ratio, it was found that in the Heletz brines most of the sulfate (80-94%) was removed from the original seawater prior to their interaction with the hydrocarbons and only a negligible fraction of few percent of the sulfate was removed during the crude oil-water contact. The Ca-chloride brines evolved from Messinian (Upper Miocene) seawater that underwent evaporation during the desiccation of the Mediterranean. Sulfate was removed from Messinian lagoon (s) during gypsum precipitation due to evaporation and dolomitization. Bacterial sulfate reduction further depleted the brine in sulfate and changed its isotopic composition, from its original Miocene seawater composition of δ34S SO 4 ˜ 20%o, 26%o. Overall, some 50% of the original sulfate, as normalized to chloride, was removed from the original lagoon through the above processes, mostly by gypsum precipitation. Eastward migration of the Messinian Ca-Chloride brine into the Heletz Formation was accompanied by dolomitization of the country rock. Final depletion of sulfate from the brines took place, and possibly still occurs, in the presence of crude oil in the oilfields. The two oil

  5. Antibody purification: ammonium sulfate fractionation or gel filtration.

    PubMed

    Grodzki, Ana Cristina; Berenstein, Elsa

    2010-01-01

    Antibodies can be purified by a variety of methods based on their unique physical and chemical properties such as size, solubility, charge, hydrophobicity and binding affinity. This chapter focuses on ammonium sulfate precipitation as a convenient first step in antibody purification in that, it allows the concentration of the starting material and the precipitation of the desired protein. The principle of ammonium sulfate precipitation lies in "salting out" proteins from the solution. The proteins are prevented to form hydrogen bonds with water and the salt facilitates their interaction with each other forming aggregates that afterward precipitate out of solution. Gel filtration or size- exclusion chromatography is also discussed in this chapter. Gel filtration is based on the relative size of protein molecules and it is of great value to separate IgMs, exchange buffers and/or desalt solutions. The columns designed to separate the proteins are composed of porous beads and the proteins will flow through the packed column inside and around the beads, depending on its size.

  6. Lack of effect of drinking water barium on cardiovascular risk factors.

    PubMed

    Wones, R G; Stadler, B L; Frohman, L A

    1990-04-01

    Higher cardiovascular mortality has been associated in a single epidemiological study with higher levels of barium in drinking water. The purpose of this study was to determine whether drinking water barium at levels found in some U.S. communities alters the known risk factors for cardiovascular disease. Eleven healthy men completed a 10-week dose-response protocol in which diet was controlled (600 mg cholesterol; 40% fat, 40% carbohydrate, 20% protein; sodium and potassium controlled at the subject's pre-protocol estimated intake). Other aspects of the subjects' lifestyles known to affect cardiac risk factors were controlled, and the barium content (as barium chloride) of the drinking water (1.5 L/day) was varied from 0 (first 2 weeks), to 5 ppm (next 4 weeks), to 10 ppm (last 4 weeks). Multiple blood and urine samples, morning and evening blood pressure measurements, and 48-hr electrocardiographic monitoring were performed at each dose of barium. There were no changes in morning or evening systolic or diastolic blood pressures, plasma cholesterol or lipoprotein or apolipoprotein levels, serum potassium or glucose levels, or urine catecholamine levels. There were no arrhythmias related to barium exposure detected on continuous electrocardiographic monitoring. A trend was seen toward increased total serum calcium levels with exposure to barium, which was of borderline statistical significance and of doubtful clinical significance. In summary, drinking water barium at levels of 5 and 10 ppm did not appear to affect any of the known modifiable cardiovascular risk factors.

  7. Boron Carbide as a Barium-Free Green Light Emitter and Burn Rate Modifier in Pyrotechnics

    DTIC Science & Technology

    2011-05-09

    ABSTRACT A pyrotechnic with green-light emission for both military use and civilian fireworks has been developed without the need to use barium or...material, when combined with a suitable oxidizer, may serve as an alternative in replacing barium in commercial green light emitting fireworks . In summary

  8. Replacement of SR 4990 by Barium Styphnate in the Mk 24 Actuator

    DTIC Science & Technology

    the SR-4990 in the Mk 24 Actuator. Experimental work was performed with barium styphnate , lead mononitroresorcinate, and two manufactured powders...Candidate materials were first screened using a pressure bomb. Final testing was performed in the Mk 24 Actuator design. Test results showed that of the four candidates, barium styphnate is the best material for the Actuator Mk 24.

  9. Diel cycles in dissolved barium, lead, iron, vanadium, and nitrite in a stream draining a former zinc smelter site near Hegeler, Illinois

    USGS Publications Warehouse

    Kay, R.T.; Groschen, G.E.; Cygan, G.; Dupre, David H.

    2011-01-01

    Diel variations in the concentrations of a number of constituents have the potential to substantially affect the appropriate sampling regimen in acidic streams. Samples taken once during the course of the day cannot adequately reflect diel variations in water quality and may result in an inaccurate understanding of biogeochemical processes, ecological conditions, and of the threat posed by the water to human health and the associated wildlife. Surface water and groundwater affected by acid drainage were sampled every 60 to 90. min over a 48-hour period at a former zinc smelter known as the Hegeler Zinc Superfund Site, near Hegeler, Illinois. Diel variations related to water quality in the aquifer were not observed in groundwater. Diel variations were observed in the temperature, pH, and concentration of dissolved oxygen, nitrite, barium, iron, lead, vanadium, and possibly uranium in surface water. Temperature, dissolved oxygen, nitrite, barium, lead, and uranium generally attained maximum values during the afternoon and minimum values during the night. Iron, vanadium, and pH generally attained minimum values during the afternoon and maximum values during the night. Concentrations of dissolved oxygen were affected by the intensity of photosynthetic activity and respiration, which are dependent upon insolation. Nitrite, an intermediary in many nitrogen reactions, may have been formed by the oxidation of ammonium by dissolved oxygen and converted to other nitrogen species as part of the decomposition of organic matter. The timing of the pH cycles was distinctly different from the cycles found in Midwestern alkaline streams and likely was the result of the photoreduction of Fe3+ to Fe 2+ and variations in the intensity of precipitation of hydrous ferric oxide minerals. Diel cycles of iron and vanadium also were primarily the result of variations in the intensity of precipitation of hydrous ferric oxide minerals. The diel variation in the concentrations of lead, uranium

  10. On the nature of striae in strontium barium niobate

    NASA Astrophysics Data System (ADS)

    Monchamp, R. R.; Mihalik, G. B.; Franks, L. A.

    1994-08-01

    Strontium barium niobate crystals were grown by the Czochralski technique. These crystals were 15-20 mm in diameter and 25 to 75 mm long. Two types of striae, designated as coarse and fine, were characterized. The coarse striae are optically dense and are spaced by 100 to 500 microns apart; the fine striae are optically less dense and spaced 5-50 microns apart. The origins of the striae are attributed to thermal fluctuations in the melt related to the control system and to rotation of the growing crystal in non-isothermal radial gradients. Analysis of the crystals indicated that the coarse striae may contain increased concentrations of sodium.

  11. Dielectric behavior of barium modified strontium bismuth titanate ceramic

    NASA Astrophysics Data System (ADS)

    Nayak, P.; Badapanda, T.; Anwar, S.; Panigrahi, S.

    2014-04-01

    Barium Modified Strontium Bismuth Titanate(SBT) ceramic with general formula Sr1-xBaxBi4Ti4O15 is prepared by solid state reaction route. The structural analysis of the ceramics was done by X-ray diffraction technique. The X-ray patterns show that all the compositions are of single phase with orthorhombic structure. The temperature dependent dielectric behavior shows that the transition temperature decreases with Ba content but the maximum dielectric constant increases. The decreases of the transition with increase in Ba2+ ion, may be due to the decrease of orthorhombicity by the incorporation of Ba2+ ion in SBT lattice.

  12. The barium ion jet experiments of the Porcupine project

    NASA Astrophysics Data System (ADS)

    Haerendel, G.

    1980-06-01

    The injection of a barium plasma from a sounding rocket by the shaped charge technique offers several possibilities that cannot be achieved by conventional releases. This is due to high initial velocities of the atoms of up to 14 km/sec. Most of the the applications are related to the great heights that the ions can reach, but some depend directly on the initial momentum. Typical applications are: tracing at high altitudes, modifications, and alternate Ionization processes. Project Porcupine contributions in this field are summarized.

  13. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    SciTech Connect

    Garten, Lauren M. Trolier-McKinstry, Susan

    2015-03-07

    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d{sub 33} piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m{sup −1}. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response.

  14. Strain engineered barium strontium titanate for tunable thin film resonators

    SciTech Connect

    Khassaf, H.; Khakpash, N.; Sun, F.; Sbrockey, N. M.; Tompa, G. S.; Kalkur, T. S.; Alpay, S. P.

    2014-05-19

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  15. Annual sulfate budgets for Dutch lowland peat polders: The soil is a major sulfate source through peat and pyrite oxidation

    NASA Astrophysics Data System (ADS)

    Vermaat, Jan E.; Harmsen, Joop; Hellmann, Fritz A.; van der Geest, Harm G.; de Klein, Jeroen J. M.; Kosten, Sarian; Smolders, Alfons J. P.; Verhoeven, Jos T. A.; Mes, Ron G.; Ouboter, Maarten

    2016-02-01

    Annual sulfate mass balances have been constructed for four low-lying peat polders in the Netherlands, to resolve the origin of high sulfate concentrations in surface water, which is considered a water quality problem, as indicated amongst others by the absence of sensitive water plant species. Potential limitation of these plants to areas with low sulfate was analyzed with a spatial match-up of two large databases. The peat polders are generally used for dairy farming or nature conservation, and have considerable areas of shallow surface water (mean 16%, range 6-43%). As a consequence of continuous drainage, the peat in these polders mineralizes causing subsidence rates generally ranging between 2 and 10 mm y-1. Together with pyrite oxidation, this peat mineralization the most important internal source of sulfate, providing an estimated 96 kg SO4 ha-1 mm-1 subsidence y-1. External sources are precipitation and water supplied during summer to compensate for water shortage, but these were found to be minor compared to internal release. The most important output flux is discharge of excess surface water during autumn and winter. If only external fluxes in and out of a polder are evaluated, inputs average 37 ± 9 and exports 169 ± 17 kg S ha-1 y-1. During summer, when evapotranspiration exceeds rainfall, sulfate accumulates in the unsaturated zone, to be flushed away and drained off during the wet autumn and winter. In some polders, upward seepage from early Holocene, brackish sediments can be a source of sulfate. Peat polders export sulfate to the regional water system and the sea during winter drainage. The available sulfate probably only plays a minor role in the oxidation of peat: we estimate that this is less than 10% whereas aerobic mineralization is the most important. Most surface waters in these polders have high sulfate concentrations, which generally decline during the growing season when aquatic sediments are a sink. In the sediment, this sulfur is

  16. Studies on effective utilization of precipitates from neutralized mine drainage

    SciTech Connect

    Harada, Taneomi

    1995-12-31

    Mine drainage has high acidity and sometimes contains more than the allowable concentration of ionized iron. In such a case, mine drainage is neutralized with calcium carbonate and calcium hydroxide to separate precipitates, such as the iron hydroxide and gypsum generated. Currently, most of these precipitates are not utilized and are accumulated in tailing dams. As a result, the service life of the tailing dams is reduced. This becomes a matter of concern, since securing sites for such dams is difficult. A most effective means of solving this problem would be to promote utilization of these neutralized precipitates. This paper reports on the results of studies on neutralized precipitates produced at the old Matsuo Mine (Iwate Prefecture), which has the largest neutralization treatment facility in Japan. As a result of the studies, the following was proposed regarding application of neutralized precipitates. Utilization as ferrite: mix ferrous hydroxide and ferric hydroxide in water to synthesize magnetite-like ferrite, to be used in the manufacture of magnetic markers for a mobility support system for blind pedestrians, or in producing magnetic fluids for sink-and-float separation of nonmagnetic metals and nonmetals. Utilization as hematite: bake ferric hydroxide to produce hematite, thereby extracting metallic iron for paint pigment as well as for the manufacture of ironware by local industry. Production of aluminum sulfate: precipitate aluminum ions from water and add sulfuric acid to produce aluminum sulfate.

  17. Enzyme precipitate coatings of lipase on polymer nanofibers.

    PubMed

    An, Hyo Jin; Lee, Hye-Jin; Jun, Seung-Hyun; Hwang, Sang Youn; Kim, Byoung Chan; Kim, Kwanghee; Lee, Kyung-Mi; Oh, Min-Kyu; Kim, Jungbae

    2011-09-01

    Lipase (LP) was immobilized on electrospun and ethanol-dispersed polystyrene-poly(styrene-co-maleic anhydride) (PS-PSMA) nanofibers (EtOH-NF) in the form of enzyme precipitate coatings (EPCs). LP precipitate coatings (EPCs-LP) were prepared in a three-step process, consisting of covalent attachment, LP precipitation, and crosslinking of precipitated LPs onto the covalently attached LPs via glutaraldehyde treatment. The LP precipitation was performed by adding various concentrations of ammonium sulfate (20-50%, w/v). EPCs-LP improved the LP activity and stability when compared to covalently attached LPs (CA-LP) and the enzyme coatings of LPs (EC-LP) without the LP precipitation. For example, the use of 40% (w/v) ammonium sulfate resulted in EPC40-LP with the highest activity, which was 4.0 and 3.6 times higher than those of CA-LP and EC-LP, respectively. After 165-day incubation under rigorous shaking at 200 rpm, the residual activities of EPC50-LP were 0.5 μM/min mg of EtOH-NF, representing 113 and 75 times higher than those of CA-LP and EC-LP, respectively. When LP was partially purified via a simple ammonium sulfate precipitation and dialysis, both activities and stabilities of EC-LP and EPC-LP could be marginally improved. It is anticipated that the improved LP activity and stability in the form of EPCs would allow for their potential applications in various bioconversion processes such as biodiesel production and ibuprofen resolution.

  18. Evidence against barium in the mushroom Trogia venenata as a cause of sudden unexpected deaths in Yunnan, China.

    PubMed

    Zhang, Ying; Li, Yanchun; Wu, Gang; Feng, Bang; Yoell, Shanze; Yu, Zefen; Zhang, Keqin; Xu, Jianping

    2012-12-01

    This study examined barium concentrations in the mushroom Trogia venenata, the leading culprit for sudden unexpected deaths in Yunnan, southwest China. We found that barium concentrations in T. venenata from Yunnan were low and comparable to other foods, inconsistent with barium concentrations in this mushroom as a significant contributor to these deaths.

  19. Global Precipitation Measurement

    NASA Technical Reports Server (NTRS)

    Hou, Arthur Y.; Skofronick-Jackson, Gail; Kummerow, Christian D.; Shepherd, James Marshall

    2008-01-01

    This chapter begins with a brief history and background of microwave precipitation sensors, with a discussion of the sensitivity of both passive and active instruments, to trace the evolution of satellite-based rainfall techniques from an era of inference to an era of physical measurement. Next, the highly successful Tropical Rainfall Measuring Mission will be described, followed by the goals and plans for the Global Precipitation Measurement (GPM) Mission and the status of precipitation retrieval algorithm development. The chapter concludes with a summary of the need for space-based precipitation measurement, current technological capabilities, near-term algorithm advancements and anticipated new sciences and societal benefits in the GPM era.

  20. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  1. p-Cresyl Sulfate

    PubMed Central

    Gryp, Tessa; Vanholder, Raymond; Vaneechoutte, Mario; Glorieux, Griet

    2017-01-01

    If chronic kidney disease (CKD) is associated with an impairment of kidney function, several uremic solutes are retained. Some of these exert toxic effects, which are called uremic toxins. p-Cresyl sulfate (pCS) is a prototype protein-bound uremic toxin to which many biological and biochemical (toxic) effects have been attributed. In addition, increased levels of pCS have been associated with worsening outcomes in CKD patients. pCS finds its origin in the intestine where gut bacteria metabolize aromatic amino acids, such as tyrosine and phenylalanine, leading to phenolic end products, of which pCS is one of the components. In this review we summarize the biological effects of pCS and its metabolic origin in the intestine. It appears that, according to in vitro studies, the intestinal bacteria generating phenolic compounds mainly belong to the families Bacteroidaceae, Bifidobacteriaceae, Clostridiaceae, Enterobacteriaceae, Enterococcaceae, Eubacteriaceae, Fusobacteriaceae, Lachnospiraceae, Lactobacillaceae, Porphyromonadaceae, Staphylococcaceae, Ruminococcaceae, and Veillonellaceae. Since pCS remains difficult to remove by dialysis, the gut microbiota could be a future target to decrease pCS levels and its toxicity, even at earlier stages of CKD, aiming at slowing down the progression of the disease and decreasing the cardiovascular burden. PMID:28146081

  2. Residual keratan sulfate in chondroitin sulfate formulations for oral administration.

    PubMed

    Pomin, Vitor H; Piquet, Adriana A; Pereira, Mariana S; Mourão, Paulo A S

    2012-10-01

    Chondroitin sulfate is a biomedical glycosaminoglycan (GAG) mostly used as a dietary supplement. We undertook analysis on some formulations of chondroitin sulfates available for oral administration. The analysis was based on agarose-gel electrophoresis, strong anion-exchange chromatography, digestibility with specific GAG lyases, uronic acid content, NMR spectroscopy, and size-exclusion chromatography. Keratan sulfate was detected in batches from shark cartilage, averaging ∼16% of the total GAG. Keratan sulfate is an inert material, and hazardous effects due to its presence in these formulations are unlikely to occur. However, its unexpected high percentage compromises the desired amounts of the real ingredient specified on the label claims, and forewarns the pharmacopeias to update their monographs. The techniques they recommended, especially cellulose acetate electrophoresis, are inefficient in detecting keratan sulfate in chondroitin sulfate formulations. In addition, this finding also alerts the manufacturers for improved isolation procedures as well as the supervisory agencies for better audits. Analysis based on strong anion-exchange chromatography is shown to be more reliable than the methods presently suggested by standard pharmacopeias.

  3. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    PubMed Central

    FarrokhTakin, Elmira; Ciofani, Gianni; Puleo, Gian Luigi; de Vito, Giuseppe; Filippeschi, Carlo; Mazzolai, Barbara; Piazza, Vincenzo; Mattoli, Virgilio

    2013-01-01

    The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia) to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 μg/mL) on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR) laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 μg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment, and our results represent a promising first step for subsequent investigations on their applicability in clinical practice. PMID:23847415

  4. Monte Carlo calculations of the microstructure of barium ferrite dispersions

    NASA Astrophysics Data System (ADS)

    Walmsley, N. S.; Coverdale, G. N.; Chantrell, R. W.; Parker, D. A.; Bissell, P. R.

    1998-07-01

    A Monte Carlo (MC) model has been developed to investigate the influences of the volume packing fraction and applied field on the equilibrium microstructure of a dispersion of barium ferrite particles. We accounted for magnetostatic interaction effects by using a surface charge model which allows the calculation of the energy term required for the Metropolis-type MC algorithm. In addition to single particle moves, the model employs a clustering algorithm, based on particle proximity, in order to take into account the cooperative behaviour of the particles bound by magnetostatic energy. The stacks which are thought to be characteristic of barium ferrite systems are an example of this type of binding. Our study provides strong evidence, in agreement with experiment, for the formation of stacks both in the zero field and in the applied field equilibrium configurations. The simulation also predicts, by considering the effects of the packing density, that the dispersion properties are strongly affected by the mobility of these stacks. The equilibrium particle configurations have been investigated using a correlation function and visualized by computer graphics. The magnetic behaviour has been investigated by calculation of the magnetization curve.

  5. Brillouin function characteristics for La-Co substituted barium hexaferrites

    NASA Astrophysics Data System (ADS)

    Wu, Chuanjian; Yu, Zhong; Yang, Yan; Sun, Ke; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen

    2015-09-01

    La-Co substituted barium hexaferrites with the chemical formula of Ba1-xLaxFe12-xCoxO19 (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f1, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ωbf2, ωkf1, ωaf1, ωkf2, and ωbk of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f1, 4f2, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ωbf2 and ωaf1 decrease constantly, while the molecular-field coefficients ωkf1, ωkf2, and ωbk show a slight change.

  6. Synthesis of Barium Titanate Using Deep Eutectic Solvents.

    PubMed

    Boston, Rebecca; Foeller, Philip Y; Sinclair, Derek C; Reaney, Ian M

    2017-01-03

    Novel synthetic routes to prepare functional oxides at lower temperatures are an increasingly important area of research. Many of these synthetic routes, however, use water as the solvent and rely on dissolution of the precursors, precluding their use with, for example, titanates. Here we present a low-cost solvent system as a means to rapidly create phase-pure ferroelectric barium titanate using a choline chloride-malonic acid deep eutectic solvent. This solvent is compatible with alkoxide precursors and allows for the rapid synthesis of nanoscale barium titanate powders at 950 °C. The phase and morphology were determined, along with investigation of the synthetic pathway, with the reaction proceeding via BaCl2 and TiO2 intermediates. The powders were also used to create sintered ceramics, which exhibit a permittivity maximum corresponding to a tetragonal-cubic transition at 112 °C, as opposed to the more conventional temperature of ∼120 °C. The lower-than-expected value for the ferro- to para-electric phase transition is likely due to undetectable levels of contaminants.

  7. Plasma waves associated with the first AMPTE magnetotail barium release

    NASA Technical Reports Server (NTRS)

    Gurnett, D. A.; Anderson, R. R.; Bernhardt, P. A.; Luehr, H.; Haerendel, G.

    1986-01-01

    Plasma waves observed during the March 21, 1985, AMPTE magnetotail barium release are described. Electron plasma oscillations provided local measurements of the plasma density during both the expansion and decay phases. Immediately after the explosion, the electron density reached a peak of about 400,000/cu cm, and then started decreasing approximately as t to the -2.4 as the cloud expanded. About 6 minutes after the explosion, the electron density suddenly began to increase, reached a secondary peak of about 240/cu cm, and then slowly decayed down to the preevent level over a period of about 15 minutes. The density increase is believed to be caused by the collapse of the ion cloud into the diamagnetic cavity created by the initial expansion. The plasma wave intensities observed during the entire event were quite low. In the diamagnetic cavity, electrostatic emissions were observed near the barium ion plasma frequency, and in another band at lower frequencies. A broadband burst of electrostatic noise was also observed at the boundary of the diamagnetic cavity. Except for electron plasma oscillations, no significant wave activity was observed outside of the diamagnetic cavity.

  8. Structural and optical study of tellurite-barium glasses

    NASA Astrophysics Data System (ADS)

    Grelowska, I.; Reben, M.; Burtan, B.; Sitarz, M.; Cisowski, J.; Yousef, El Sayed; Knapik, A.; Dudek, M.

    2016-12-01

    The goal of this work was to determine the effect of barium oxide on the structural, thermal and optical properties of the TeO2-BaO-Na2O (TBN) and TeO2-BaO-WO3 (TBW) glass systems. Raman spectra allow relating the glass structure and vibration properties (i.e. vibrational frequencies and Raman intensities) with the glass composition. Raman spectra show the presence of TeO4 and TeO3+1/TeO3 units that conform with the glass matrix. Differential thermal analysis DTA, XRD measurements have been considered in term of BaO addition. The spectral dependence of ellipsometric angles of the tellurite-barium glass has been studied. The optical measurements were conducted on Woollam M2000 spectroscopic ellipsometer in spectral range of 190-1700 nm. The reflectance and transmittance measurements have been done on spectrophotometer Perkin Elmer, Lambda 900 in the range of 200-2500 nm (UV-VIS-NIR). From the transmittance spectrum, the energy gap was determined.

  9. Prospects for the ORNL/TAMU Barium Fluoride Array

    NASA Astrophysics Data System (ADS)

    Townsend, Austin; McIntosh, Alan; Youngs, Mike; Mosby, Shea; Varner, Robert

    2016-09-01

    Understanding the symmetry energy in the nuclear equation of state is essential to understanding properties such as the structure of a neutron star or its gravitational collapse, leading to supernovae. It has been suggested that to better constrain the symmetry energy one can use the bremmstrahlung gamma rays emitted from the hot, dense nuclear matter in the early stages of heavy ion collisions. These gamma rays have the potential to provide a cleaner probe than the more traditional hadronic probes. To measure these bremmstrahlung photons, barium fluoride scintillation crystals were chosen for their ability to detect photons across a large energy range and for their inherent pulse shape discrimination properties. This summer, the detectors of the TAMU/ORNL barium fluoride array were tested in preparation for such an experiment. Signals from each detector were recorded individually for cosmic rays and radioactive source events. The full waveforms were digitized with flash ADCs. A selected set of detectors was assembled and tested with beam from the K500 cyclotron. With this in-beam data, waveform integration parameters may be optimized. Results from the testing of these detectors with flash digitizers will be presented. Department of Energy, National Science Foundation, Cyclotron Institute.

  10. Final report on the safety assessment of sodium cetearyl sulfate and related alkyl sulfates as used in cosmetics.

    PubMed

    Fiume, Monice; Bergfeld, Wilma F; Belsito, Donald V; Klaassen, Curtis D; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Alan Andersen, F

    2010-05-01

    Sodium cetearyl sulfate is the sodium salt of a mixture of cetyl and stearyl sulfate. The other ingredients in this safety assessment are also alkyl salts, including ammonium coco-sulfate, ammonium myristyl sulfate, magnesium coco-sulfate, sodium cetyl sulfate, sodium coco/hydrogenated tallow sulfate, sodium coco-sulfate, sodium decyl sulfate, sodium ethylhexyl sulfate, sodium myristyl sulfate, sodium oleyl sulfate, sodium stearyl sulfate, sodium tallow sulfate, sodium tridecyl sulfate, and zinc coco-sulfate. These ingredients are surfactants used at concentrations from 0.1% to 29%, primarily in soaps and shampoos. Many of these ingredients are not in current use. The Cosmetic Ingredient Review (CIR) Expert Panel previously completed a safety assessment of sodium and ammonium lauryl sulfate. The data available for sodium lauryl sulfate and ammonium lauryl sulfate provide sufficient basis for concluding that sodium cetearyl sulfate and related alkyl sulfates are safe in the practices of use and concentration described in the safety assessment.

  11. Liquid-Phase Processing of Barium Titanate Thin Films

    NASA Astrophysics Data System (ADS)

    Harris, David Thomas

    Processing of thin films introduces strict limits on the thermal budget due to substrate stability and thermal expansion mismatch stresses. Barium titanate serves as a model system for the difficulty in producing high quality thin films because of sensitivity to stress, scale, and crystal quality. Thermal budget restriction leads to reduced crystal quality, density, and grain growth, depressing ferroelectric and nonlinear dielectric properties. Processing of barium titanate is typically performed at temperatures hundreds of degrees above compatibility with metalized substrates. In particular integration with silicon and other low thermal expansion substrates is desirable for reductions in costs and wider availability of technologies. In bulk metal and ceramic systems, sintering behavior has been encouraged by the addition of a liquid forming second phase, improving kinetics and promoting densification and grain growth at lower temperatures. This approach is also widespread in the multilayer ceramic capacitor industry. However only limited exploration of flux processing with refractory thin films has been performed despite offering improved dielectric properties for barium titanate films at lower temperatures. This dissertation explores physical vapor deposition of barium titanate thin films with addition of liquid forming fluxes. Flux systems studied include BaO-B2O3, Bi2O3-BaB2O 4, BaO-V2O5, CuO-BaO-B2O3, and BaO-B2O3 modified by Al, Si, V, and Li. Additions of BaO-B2O3 leads to densification and an increase in average grain size from 50 nm to over 300 nm after annealing at 900 °C. The ability to tune permittivity of the material improved from 20% to 70%. Development of high quality films enables engineering of ferroelectric phase stability using residual thermal expansion mismatch in polycrystalline films. The observed shifts to TC match thermodynamic calculations, expected strain from the thermal expansion coefficients, as well as x-ray diffract measurements

  12. Cement composition and sulfate attack

    SciTech Connect

    Shanahan, Natalya; Zayed, Abla . E-mail: zayed@eng.usf.edu

    2007-04-15

    Four cements were used to address the effect of tricalcium silicate content of cement on external sulfate attack in sodium sulfate solution. The selected cements had similar fineness and Bogue-calculated tricalcium aluminate content but variable tricalcium silicates. Durability was assessed using linear expansion and compressive strength. Phases associated with deterioration were examined using scanning electron microscopy and X-ray diffraction. Mineralogical phase content of the as-received cements was studied by X-ray diffraction using two methods: internal standard and Rietveld analysis. The results indicate that phase content of cements determined by X-ray mineralogical analysis correlates better with the mortar performance in sulfate environment than Bogue content. Additionally, it was found that in cements containing triclacium aluminate only in the cubic form, the observed deterioration is affected by tricalcium silicate content. Morphological similarities between hydration products of high tricalcium aluminate and high tricalcium silicate cements exposed to sodium sulfate environment were also observed.

  13. PRECIPITATION OF PROTACTINIUM

    DOEpatents

    Moore, R.L.

    1958-07-15

    An lmprovement in the separation of protactinium from aqueous nitric acid solutions is described. 1t covers the use of lead dioxide and tin dioxide as carrier precipitates for the protactinium. In carrying out the process, divalent lead or divalent tin is addcd to the solution and oxidized, causing formation of a carrier precipitate of lead dioxide or stannic oxide, respectively.

  14. Simulation of Natural Acid Sulfate Weathering in an Alpine Watershed

    NASA Astrophysics Data System (ADS)

    Bassett, R. L.; Miller, William R.; McHugh, John; Catts, John G.

    1992-09-01

    Streams with acidic sulfate compositions (pH less than 3.5) are naturally generated in the alpine Geneva Creek Basin of the southern Rocky Mountains, an area underlain by Proterozoic metamorphic and igneous rocks that are intruded by Tertiary felsic stocks with associated pyritic alteration. These naturally acidic waters are similar in composition to more familiar man-made acid mine waters or to surface waters acidified by sulfate precipitation. Detailed study of the stream compositions has revealed the principal reactions driving the weathering process and was used to estimate the relative effects of snowpack ionic input versus the solute contribution from acid attack in soil zones and groundwater. In the Geneva Creek Basin, atmospheric sources of solute represent a minor component to the stream water composition, except for chloride, which can be used to determine the fraction of contribution. The weathering process is a balance between oxidation of sulfides, dissolution of silicates, formation of the clay minerals vermiculite, kaolinite, and smectite, carbonate neutralization, and precipitation of ferric and aluminum oxyhydroxides and aluminum sulfate. The chemical analyses of snow samples, multiple samples of water from Geneva Creek and its tributaries, and the composition of primary and secondary minerals identified in the basin serve as input to a mass balance geochemical model, which facilitates the interpretation of the principal geochemical processes.

  15. In defense of magnesium sulfate.

    PubMed

    Elliott, John P; Lewis, David F; Morrison, John C; Garite, Thomas J

    2009-06-01

    Magnesium sulfate has been used by obstetricians for more than 25 years to treat preterm labor. Magnesium sulfate is effective in delaying delivery for at least 48 hours in patients with preterm labor when used in higher dosages. There do not seem to be any harmful effects of the drug on the fetus, and indeed there is a neuroprotective effect in reducing the incidence of cerebral palsy in premature newborns weighing less than 1,500 g.

  16. Functionalized synchrotron in-line phase-contrast computed tomography: a novel approach for simultaneous quantification of structural alterations and localization of barium-labelled alveolar macrophages within mouse lung samples.

    PubMed

    Dullin, Christian; dal Monego, Simeone; Larsson, Emanuel; Mohammadi, Sara; Krenkel, Martin; Garrovo, Chiara; Biffi, Stefania; Lorenzon, Andrea; Markus, Andrea; Napp, Joanna; Salditt, Tim; Accardo, Agostino; Alves, Frauke; Tromba, Giuliana

    2015-01-01

    Functionalized computed tomography (CT) in combination with labelled cells is virtually non-existent due to the limited sensitivity of X-ray-absorption-based imaging, but would be highly desirable to realise cell tracking studies in entire organisms. In this study we applied in-line free propagation X-ray phase-contrast CT (XPCT) in an allergic asthma mouse model to assess structural changes as well as the biodistribution of barium-labelled macrophages in lung tissue. Alveolar macrophages that were barium-sulfate-loaded and fluorescent-labelled were instilled intratracheally into asthmatic and control mice. Mice were sacrificed after 24 h, lungs were kept in situ, inflated with air and scanned utilizing XPCT at the SYRMEP beamline (Elettra Synchrotron Light Source, Italy). Single-distance phase retrieval was used to generate data sets with ten times greater contrast-to-noise ratio than absorption-based CT (in our setup), thus allowing to depict and quantify structural hallmarks of asthmatic lungs such as reduced air volume, obstruction of airways and increased soft-tissue content. Furthermore, we found a higher concentration as well as a specific accumulation of the barium-labelled macrophages in asthmatic lung tissue. It is believe that XPCT will be beneficial in preclinical asthma research for both the assessment of therapeutic response as well as the analysis of the role of the recruitment of macrophages to inflammatory sites.

  17. Functionalized synchrotron in-line phase-contrast computed tomography: a novel approach for simultaneous quantification of structural alterations and localization of barium-labelled alveolar macrophages within mouse lung samples

    PubMed Central

    Dullin, Christian; dal Monego, Simeone; Larsson, Emanuel; Mohammadi, Sara; Krenkel, Martin; Garrovo, Chiara; Biffi, Stefania; Lorenzon, Andrea; Markus, Andrea; Napp, Joanna; Salditt, Tim; Accardo, Agostino; Alves, Frauke; Tromba, Giuliana

    2015-01-01

    Functionalized computed tomography (CT) in combination with labelled cells is virtually non-existent due to the limited sensitivity of X-ray-absorption-based imaging, but would be highly desirable to realise cell tracking studies in entire organisms. In this study we applied in-line free propagation X-ray phase-contrast CT (XPCT) in an allergic asthma mouse model to assess structural changes as well as the biodistribution of barium-labelled macrophages in lung tissue. Alveolar macrophages that were barium-sulfate-loaded and fluorescent-labelled were instilled intratracheally into asthmatic and control mice. Mice were sacrificed after 24 h, lungs were kept in situ, inflated with air and scanned utilizing XPCT at the SYRMEP beamline (Elettra Synchrotron Light Source, Italy). Single-distance phase retrieval was used to generate data sets with ten times greater contrast-to-noise ratio than absorption-based CT (in our setup), thus allowing to depict and quantify structural hallmarks of asthmatic lungs such as reduced air volume, obstruction of airways and increased soft-tissue content. Furthermore, we found a higher concentration as well as a specific accumulation of the barium-labelled macrophages in asthmatic lung tissue. It is believe that XPCT will be beneficial in preclinical asthma research for both the assessment of therapeutic response as well as the analysis of the role of the recruitment of macrophages to inflammatory sites. PMID:25537601

  18. Barium zirconate-titanate/barium calcium-titanate ceramics via sol-gel process: novel high-energy-density capacitors

    NASA Astrophysics Data System (ADS)

    Sreenivas Puli, Venkata; Kumar, Ashok; Chrisey, Douglas B.; Tomozawa, M.; Scott, J. F.; Katiyar, Ram S.

    2011-10-01

    Lead-free barium zirconate-titanate/barium calcium-titanate, [(BaZr0.2Ti0.80)O3]1-x-[(Ba0.70Ca0.30)TiO3]x (x = 0.10, 0.15, 0.20) (BZT-BCT) ceramics with high dielectric constant, low dielectric loss and moderate electric breakdown field were prepared by the sol-gel synthesis technique. X-ray diffraction patterns revealed tetragonal crystal structure and this was further confirmed by Raman spectra. Well-behaved ferroelectric hysteresis loops and moderate polarizations (spontaneous polarization, Ps ~ 3-6 µC cm-2) were obtained in these BZT-BCT ceramics. Frequency-dependent dielectric spectra confirmed that ferroelectric diffuse phase transition (DPT) exists near room temperature. Scanning electron microscope images revealed monolithic grain growth in samples sintered at 1280 °C. 1000/ɛ versus (T) plots revealed ferroelectric DPT behaviour with estimated γ values of ~1.52, 1.51 and 1.88, respectively, for the studied BZT-BCT compositions. All three compositions showed packing-limited breakdown fields of ~47-73 kV cm-1 with an energy density of 0.05-0.6 J cm-3 for thick ceramics (>1 mm). Therefore these compositions might be useful in Y5V-type capacitor applications.

  19. Catalyzed precipitation in aluminum

    NASA Astrophysics Data System (ADS)

    Mitlin, David

    The work reported in Chapter 1 concerned the influence of Si on the precipitation of theta' (metastable Al2Cu) during the isothermal aging of Al-2Cu-1Si (wt. %). The binary alloys Al-2Cu and Al-1Si were studied for comparison. Only two precipitate phases were detected: pure Si in Al-Si and Al-Cu-Si, and theta' (metastable Al 2Cu) in Al-Cu and Al-Cu-Si. On aging the ternary, Si precipitates first, and provides heterogeneous sites to nucleate theta'. As a consequence, the density of theta' precipitates in Al-Cu-Si is much higher than in the binary Al-Cu. Also, the theta ' precipitates in the ternary alloy have lower aspect ratio (at given particle size) and lose coherence on their broad faces at a slower rate. The principal focus of Chapter 2 is to explain precipitation in Al-lat.%Si-lat%Ge. The microstructure is characterized using conventional and high resolution transmission electron microscopy, as well as energy dispersive X-ray spectroscopy. The first precipitates to come out of solid solution have a cube-cube orientation relationship with the matrix. High resolution TEM demonstrated that all the precipitates start out, and remain multiply twinned throughout the aging treatment. There is a variation in the stoichiometry of the precipitates, with the mean composition being Si-44.5at%Ge. It is also shown that in Al-Si-Ge it is not possible to achieve satisfactory hardness through a conventional heat treatment. This result is explained in terms of sluggish precipitation of the diamond-cubic Si-Ge phase coupled with particle coarsening. The purpose of Chapters 3 and 4 is to explain these properties in terms of the role that the Si-Ge additions have on modifying the conventional Al-Cu aging sequence. In both AlCu and AlCuSiGe the room temperature microstructure consists of both GP zones and theta″ precipitates. Upon aging at 190°C Al-Cu displays the well known precipitation sequence; the slow dissolution of GP zones and theta″ and the gradual formation of theta

  20. Fabrication and characterization of cerium-doped barium titanate inverse opal by sol-gel method

    SciTech Connect

    Jin Yi; Zhu Yihua Yang Xiaoling; Li Chunzhong; Zhou Jinghong

    2007-01-15

    Cerium-doped barium titanate inverted opal was synthesized from barium acetate contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a polystyrene (PS) opal. This procedure involves infiltration of precursors into the interstices of the PS opal template followed by hydrolytic polycondensation of the precursors to amorphous barium titanate and removal of the PS opal by calcination. The morphologies of opal and inverse opal were characterized by scanning electron microscope (SEM). The pores were characterized by mercury intrusion porosimetry (MIP). X-ray photoelectron spectroscopy (XPS) investigation showed the doping structure of cerium, barium and titanium. And powder X-ray diffraction allows one to observe the influence of doping degree on the grain size. The lattice parameters, crystal size and lattice strain were calculated by the Rietveld refinement method. The synthesis of cerium-doped barium titanate inverted opals provides an opportunity to electrically and optically engineer the photonic band structure and the possibility of developing tunable three-dimensional photonic crystal devices. - Graphical abstract: Cerium-doped barium titanate inverted opal was synthesized from barium acetate acid contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a PS opal, which involves infiltration of precursors into the interstices of the PS opal template and removal of the PS opal by calcination.

  1. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    PubMed

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed.

  2. Effects of thermal sulfate reduction on permeability distributions of the Norphlet Formation

    SciTech Connect

    Dunn, T.L.; Surdam, R.C. )

    1991-03-01

    Framework grain coatings are common in the Norphlet. Clay coatings are present throughout the depth range (16,000 to 22,000 ft) over which significant variations of permeability occur. Pyrobitumen coatings occur within the deep, low-permeability interval (approximately 18,000-20,000 ft) and the deeper (greater than 20,000 ft), more permeable interval. Both types of coatings may be important in preserving porosity during portions of the burial history of the Norphlet sandstones; however, their occurrence does not correlate with observed variations in permeability. Diagenetic reactions associated with thermal sulfate reduction provide a mechanism for the dissolution of carbonate cements in deep zones characterized by enhanced permeabilities. Protons generated from dissociation of H{sub 2}S produced during sulfate reduction results in the dissolution of carbonate cements. To be effective, this process must remove cements that precipitated after grain coatings. Uncoated quartz grains produce quartz overgrowths. Vertical permeability distributions within the Norphlet suggest that early and intermediate diagenetic carbonate and sulfate cements, sourced from the intercalated, interdunal pond strata, were redistributed throughout the dune sands. Portions of carbonate cements were either dissolved or the extent of their precipitation was reduced as thermal decarboxylation was closely followed by the initiation of sulfate reduction. Hence, variations in Norphlet permeability distributions are in part the result of diagenetic reactions associated with thermal sulfate reduction and, therefore, can be predicted using kinetic modeling of sulfate reaction.

  3. Dissolved Organic Carbon In Precipitation At A Coastal Rural Site

    NASA Astrophysics Data System (ADS)

    Liptzin, D.; Daley, M.; Sive, B. C.; Talbot, R. W.; McDowell, W. H.

    2013-12-01

    Dissolved organic carbon (DOC) is a ubiquitous component of precipitation. This DOC is a complex mixture of compounds from biogenic and anthropogenic sources. The amount and chemistry of the DOC in precipitation has been studied for a variety of reasons: as a source of acidity, as a source of C to marine and terrestrial ecosystems, or to track the fate of individual compounds or pollutants. In most cases, past studies have focused on particular compounds or a limited number of precipitation events. Very little is known about the temporal trends in DOC or the relationship between DOC and other constituents of precipitation. We collected precipitation events for more than five years at a rural coastal site in New Hampshire. We evaluated the seasonal patterns and compared the DOC concentrations to other typical measures of the wet atmospheric deposition (ammonium, nitrate, sulfate, and chloride). In addition, we compared the DOC in precipitation to the concentrations of various organic constituents of the atmosphere. The volume weighted mean C concentration was 0.75 mg C/L with concentrations in the summer significantly higher than in the other three seasons. The DOC concentration was most strongly associated with ammonium concentrations (r=0.81), but was also significantly related to nitrate (r=0.50) and sulfate (r=0.63) concentrations. There was no significant association between DOC and chloride concentrations. Preliminary regression tree analysis suggests that the DOC concentration in precipitation was best predicted by the atmospheric concentration of methyl vinyl ketone, an oxidation product of isoprene. These results suggest that both terrestrial biogenic and anthropogenic sources may be important precursors to the C removed from the atmosphere during precipitation events.

  4. Magnetic properties of Ni substituted Y-type barium ferrite

    NASA Astrophysics Data System (ADS)

    Won, Mi Hee; Kim, Chul Sung

    2014-05-01

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba2Co2-xNixFe12O22 (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (Ms) decreases with Ni contents. Ni2+, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co2+ having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba2Co1.5Ni0.5Fe12O22 shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature TC is increased with Ni contents, while TS is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3bVI, 6cIV*, 6cVI, 18hVI, 6cIV, and 3aIV sites at below TC. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe3+ and obtained the isomer shift (δ), magnetic hyperfine field (Hhf), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna applications in UHF band.

  5. Magnetic properties of Ni substituted Y-type barium ferrite

    SciTech Connect

    Won, Mi Hee; Kim, Chul Sung

    2014-05-07

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba{sub 2}Co{sub 2−x}Ni{sub x}Fe{sub 12}O{sub 22} (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (M{sub s}) decreases with Ni contents. Ni{sup 2+}, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co{sup 2+} having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba{sub 2}Co{sub 1.5}Ni{sub 0.5}Fe{sub 12}O{sub 22} shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature T{sub C} is increased with Ni contents, while T{sub S} is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3b{sub VI}, 6c{sub IV}*, 6c{sub VI}, 18h{sub VI}, 6c{sub IV}, and 3a{sub IV} sites at below T{sub C}. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe{sup 3+} and obtained the isomer shift (δ), magnetic hyperfine field (H{sub hf}), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna

  6. Chondroitin sulfate/dermatan sulfate sulfatases from mammals and bacteria.

    PubMed

    Wang, Shumin; Sugahara, Kazuyuki; Li, Fuchuan

    2016-12-01

    Sulfatases that specifically catalyze the hydrolysis of the sulfate groups on chondroitin sulfate (CS)/dermatan sulfate (DS) poly- and oligosaccharides belong to the formylglycine-dependent family of sulfatases and have been widely found in various mammalian and bacterial organisms. However, only a few types of CS/DS sulfatase have been identified so far. Recently, several novel CS/DS sulfatases have been cloned and characterized. Advanced studies have provided significant insight into the biological function and mechanism of action of CS/DS sulfatases. Moreover, further studies will provide powerful tools for structural and functional studies of CS/DS as well as related applications. This article reviews the recent progress in CS/DS sulfatase research and is expected to initiate further research in this field.

  7. FY-15 Progress Report on Cleanup of irradiated SHINE Target Solutions Containing 140g-U/L Uranyl Sulfate

    SciTech Connect

    Bennett, Megan E.; Bowers, Delbert L.; Vandegrift, George F.

    2015-09-01

    During FY 2012 and 2013, a process was developed to convert the SHINE Target Solution (STS) of irradiated uranyl sulfate (140 g U/L) to uranyl nitrate. This process is necessary so that the uranium solution can be processed by the UREX (Uranium Extraction) separation process, which will remove impurities from the uranium so that it can be recycled. The uranyl sulfate solution must contain <0.02 M SO42- so that the uranium will be extractable into the UREXsolvent. In addition, it is desired that the barium content be below 0.0007 M, as this is the limit in the Resource Conservation and Recovery Act (RCRA).

  8. Strontium and barium iodide high light yield scintillators

    NASA Astrophysics Data System (ADS)

    Cherepy, Nerine J.; Hull, Giulia; Drobshoff, Alexander D.; Payne, Stephen A.; van Loef, Edgar; Wilson, Cody M.; Shah, Kanai S.; Roy, Utpal N.; Burger, Arnold; Boatner, Lynn A.; Choong, Woon-Seng; Moses, William W.

    2008-02-01

    Europium-doped strontium and barium iodide are found to be readily growable by the Bridgman method and to produce high scintillation light yields. SrI2(Eu ) emits into the Eu2+ band, centered at 435nm, with a decay time of 1.2μs and a light yield of ˜90000photons/MeV. It offers energy resolution better than 4% full width at half maximum at 662keV, and exhibits excellent light yield proportionality. BaI2(Eu ) produces >30000photons/MeV into the Eu2+ band at 420nm (<1μs decay). An additional broad impurity-mediated recombination band is present at 550nm (>3μs decay), unless high-purity feedstock is used.

  9. Barium titanate nanocomposite capacitor FY09 year end report.

    SciTech Connect

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.

    2009-11-01

    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  10. A buffer gas cooled beam of barium monohydride

    NASA Astrophysics Data System (ADS)

    Iwata, Geoffrey; Tarallo, Marco; Zelevinsky, Tanya

    2016-05-01

    Significant advances in direct laser cooling of diatomic molecules have opened up a wide array of molecular species to precision studies spanning many-body physics, quantum collisions and ultracold dissociation. We present a cryogenic beam source of barium monohydride (BaH), and study laser ablation of solid precursor targets as well as helium buffer gas cooling dynamics. Additionally, we cover progress towards a molecular magneto-optical trap, with spectroscopic studies of relevant cooling transitions in the B2 Σ <--X2 Σ manifold in laser ablated molecules, including resolution of hyperfine structure and precision measurements of the vibrational Frank-Condon factors. Finally, we examine the feasibility of photo dissociation of trapped BaH molecules to yield optically accessible samples of ultracold hydrogen.

  11. Calcium, Strontium and Barium Homogeneous Catalysts for Fine Chemicals Synthesis.

    PubMed

    Sarazin, Yann; Carpentier, Jean-François

    2016-12-01

    The large alkaline earths (Ae), calcium, strontium and barium, have in the past 15 years yielded a brand new generation of heteroleptic molecular catalysts for the production of fine chemicals. However, the integrity of these complexes is often plagued by ligand redistribution equilibria in solution. This personal account retraces the paths followed in our research group towards the design of stable heteroleptic alkalino-earth complexes, including the use of intramolecular noncovalent Ae···H-Si and Ae···F-C interactions. Their implementation as homogenous precatalysts for reactions such as the intramolecular and intermolecular hydroamination and hydrophosphination of activated alkenes, the hydrophosphonylation of ketones, and the dehydrogenative coupling of amines and hydrosilanes that enable the efficient and controlled formations of CP, CN, or SiN σ-bonds, is presented in a synthetic perspective that highlights their overall outstanding catalytic performance.

  12. Influence of Barium Hexaferrite on Magnetic Properties of Hydroxyapatite Ceramics.

    PubMed

    Jarupoom, P; Jaita, P

    2015-11-01

    Hydroxyapatite (HA) powders was derived from natural bovine bone by sequence of thermal processes. The barium hexaferrite (BF) find magnetic powders were added into HA powders in ratio of 1-3 vol.%. The HA-BF ceramics were prepared by a solid state reaction method and sintered at 1250 degrees C for 2 h. Effects of BF additive on structural, physical and magnetic properties of HA ceramics were investigated. X-ray diffraction revealed that all HA-BF samples showed a main phase of high purity hydroxyapatite [Ca10(PO4)6(OH)2] with calcium and phosphate molar ratio of 1.67. The addition of BF into HA inhibited grain growth and caused an improvement of mechanical properties. The M-H hysteresis loops also showed an improvement in magnetic behavior for higher content of BF. Moreover, in vitro bioactivity test indicated that the 2-3 vol.% sample may be suitable for biological applications.

  13. Spectroscopic study of Er:Sm doped barium fluorotellurite glass.

    PubMed

    Bahadur, A; Dwivedi, Y; Rai, S B

    2010-09-15

    In this paper, we report the physical and spectroscopic properties of Er(3+), Sm(3+) and Er(3+):Sm(3+) ions codoped barium fluorotellurite (BFT) glasses. Different Stokes and anti-Stokes emissions were observed under 532 nm and 976 nm laser excitations. Energy transfer from Er(3+) ion to Sm(3+) ion was confirmed on the basis of luminescence intensity variation and decay curve analysis in both the cases. Under green (532 nm) excitation emission intensity of Sm(3+) ion bands improves whereas on NIR (976 nm) excitation new emission bands of Sm(3+) ions were observed in Er:Sm codoped samples. Ion interactions and the different energy transfer parameters were also calculated.

  14. Dynamics of the CRRES barium releases in the magnetosphere

    NASA Technical Reports Server (NTRS)

    Fuselier, S. A.; Mende, S. B.; Geller, S. P.; Miller, M.; Hoffman, R. A.; Wygant, J. R.; Pongratz, M.; Meredith, N. P.; Anderson, R. R.

    1994-01-01

    The Combined Release and Radiation Effects Satellite (CRRES) G-2, G-3, and G-4 ionized and neutral barium cloud positions are triangulated from ground-based optical data. From the time history of the ionized cloud motion perpendicular to the magnetic field, the late time coupling of the ionized cloud with the collisionless ambient plasma in the magnetosphere is investigated for each of the releases. The coupling of the ionized clouds with the ambient medium is quantitatively consistent with predictions from theory in that the coupling time increases with increasing distance from the Earth. Quantitative comparison with simple theory for the couping time also yields reasonable agreement. Other effects not predicted by the theory are discussed in the context of the observations.

  15. Synthesis and optical study of barium magnesium aluminate blue phosphors

    SciTech Connect

    Jeet, Suninder Pandey, O. P.; Sharma, Manoj

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  16. Impact of vanadium ions in barium borate glass.

    PubMed

    Abdelghany, A M; Hammad, Ahmed H

    2015-02-25

    Combined optical and infrared spectral measurements of prepared barium borate glasses containing different concentrations of V2O5 were carried out. Vanadium containing glasses exhibit extended UV-visible (UV/Vis.) bands when compared with base binary borate glass. UV/Vis. spectrum shows the presence of an unsymmetrical strong UV broad band centered at 214 nm attributed to the presence of unavoidable trace iron impurities within the raw materials used for the preparation of such glass. The calculated direct and indirect optical band gaps are found to decrease with increasing the vanadium content (2.9:137 for indirect and 3.99:2.01 for direct transition). This change was discussed in terms of structural changes in the glass network. Infrared absorption spectra of the glasses reveal the appearance of both triangular and tetrahedral borate units. Electron spin resonance analyses indicate the presence of unpaired species in sufficient quantity to be identified and to confirm the spectral data.

  17. Impact of vanadium ions in barium borate glass

    NASA Astrophysics Data System (ADS)

    Abdelghany, A. M.; Hammad, Ahmed H.

    2015-02-01

    Combined optical and infrared spectral measurements of prepared barium borate glasses containing different concentrations of V2O5 were carried out. Vanadium containing glasses exhibit extended UV-visible (UV/Vis.) bands when compared with base binary borate glass. UV/Vis. spectrum shows the presence of an unsymmetrical strong UV broad band centered at 214 nm attributed to the presence of unavoidable trace iron impurities within the raw materials used for the preparation of such glass. The calculated direct and indirect optical band gaps are found to decrease with increasing the vanadium content (2.9:137 for indirect and 3.99:2.01 for direct transition). This change was discussed in terms of structural changes in the glass network. Infrared absorption spectra of the glasses reveal the appearance of both triangular and tetrahedral borate units. Electron spin resonance analyses indicate the presence of unpaired species in sufficient quantity to be identified and to confirm the spectral data.

  18. Niobium and rubidium in the barium star Zeta Capricorni

    NASA Astrophysics Data System (ADS)

    Smith, V. V.; Lambert, D. L.

    1984-03-01

    An abundance analysis of the elements Rb to Nb (relative to the G-giant standard ɛ Vir) has been carried out for the barium star ζ Cap using low-noise, high-resolution Digicon and Reticon spectra. Tech's (1971) low abundance of Nb in ζ Cap suggests that the s-process ceased less than about a million years ago. The authors' improved analysis finds a higher Nb abundance consistent with the complete decay of 93Zr to 93Nb; i.e., more than 3×106 years have elapsed since the principal phase of s-processing. The abundance of Rb suggests a neutron density of N(n) ≡ 107cm-3 for the s-process site at the close of s-processing.

  19. Dielectric behavior of barium modified strontium bismuth titanate ceramic

    SciTech Connect

    Nayak, P.; Badapanda, T.; Anwar, S.; Panigrahi, S.

    2014-04-24

    Barium Modified Strontium Bismuth Titanate(SBT) ceramic with general formula Sr1−xBaxBi4Ti4O15 is prepared by solid state reaction route. The structural analysis of the ceramics was done by X-ray diffraction technique. The X-ray patterns show that all the compositions are of single phase with orthorhombic structure. The temperature dependent dielectric behavior shows that the transition temperature decreases with Ba content but the maximum dielectric constant increases. The decreases of the transition with increase in Ba{sup 2+} ion, may be due to the decrease of orthorhombicity by the incorporation of Ba{sup 2+} ion in SBT lattice.

  20. Synthesis and optical study of barium magnesium aluminate blue phosphors

    NASA Astrophysics Data System (ADS)

    Jeet, Suninder; Sharma, Manoj; Pandey, O. P.

    2015-05-01

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum.

  1. A new type of microphone using flexoelectric barium strontium titnate

    NASA Astrophysics Data System (ADS)

    Kwon, Seol ryung; Huang, Wenbin; Zhang, Shujun; Yuan, Fuh-Gwo; Jiang, Xiaoning

    2014-03-01

    A flexoelectric bridge-structured microphone using bulk barium strontium titanate (Ba0.65Sr0.35TiO3 or BST) ceramic was investigated in this study. The flexoelectric microphone was installed in an anechoic box and exposed to the sound pressure emitted from a loud speaker. Charge sensitivity of the flexoelectric microphone was measured and calibrated using a reference microphone. The 1.5 mm×768 μm×50 μm micro-machined bridge-structured flexoelectric microphone has a sensitivity of 0.92 pC/Pa, while its resonance frequency was calculated to be 98.67 kHz. The analytical and experimental results show that the flexoelectric microphone has both high sensitivity and broad bandwidth, indicating that flexoelectric microphones are potential candidates for many applications.

  2. Preparation and magnetic properties of barium hexaferrite nanorods

    SciTech Connect

    Mu Guohong Pan Xifeng; Chen Na; Gan Keke; Gu Mingyuan

    2008-06-03

    The barium hexaferrite nanorods were successfully prepared by sol-gel technique combined with polymethylmethacrylate as template. The crystal structure, morphology and magnetic properties of BaFe{sub 12}O{sub 19} with different shape were investigated with X-ray diffraction, field emission scanning electron microscope and vibrating sample magnetometry. The results show that diameters and lengths of magnetic nanorods are about 60 nm and 300 nm, respectively. The coercivity of rod-shaped BaFe{sub 12}O{sub 19} is increased to 5350 Oe, in comparison with 4800 Oe with plate-shape. The formation mechanism of BaFe{sub 12}O{sub 19} nanorods and reasons resulting in high coercivity are discussed.

  3. Sulfate-rich Archean Oceans

    NASA Astrophysics Data System (ADS)

    Brainard, J. L.; Choney, A. P.; Ohmoto, H.

    2012-12-01

    There is a widely held belief that prior to 2.4 Ga, the Archean oceans and atmosphere were reducing, and therefore sulfate poor (concentrations <0.1 mmol). However, there is mounting evidence from diverse rock types of Archean ages that sulfate concentrations were likely similar to those in the modern ocean (~28 mmol). In this study we demonstrate that in different lithologies, representing a wide range of marine environments, there is ubiquitous evidence for abundant seawater sulfate. One of the more apparent lines of evidence for sulfate rich Archean waters are bedded barite (BaSO4) deposits, such as those in the ~3.4 Ga Fig Tree Group, South Africa and ~3.5 Ga Dresser Formation, Western Australia (WA). These deposits are thick (>100 m), widely distributed (> km2), and contain only minor amounts of sulfides. These barite beds may have developed from reactions between Ba-rich hydrothermal fluids and evaporate bodies. Simple mass balance calculations suggest that the sulfate contents of the pre-evaporitic seawater must have been greater than ~1 mM. Some researchers have suggested that the SO4 for these beds was derived from the hydrolysis of SO2-rich magmatic fluids. However, this was unlikely as the reaction, 4SO2 + 4H2O → 3H2SO4 + H2S would have produced large amounts of sulfide, as well as sulfate minerals. Many Archean-aged volcanogenic massive sulfide (VMS) deposits, much like those of the younger ages, record evidence for abundant seawater sulfate. As VMS deposits are most likely formed by submarine hydrothermal fluids that developed from seawater circulating through the seafloor rock, much of the seawater sulfate is reduced to from sulfides at depths. However, some residual sulfate in the hydrothermal fluids, with or without the addition of sulfate from the local seawater, can form sulfate minerals such as barite at near the seafloor. The d34S relationships between barites and pyrites in the Archean VMS deposits are similar to those of the younger VMS

  4. IMERG Global Precipitation Rates

    NASA Video Gallery

    NASA's Global Precipitation Measurement mission has produced its first global map of rainfall and snowfall. The GPM Core Observatory launched one year ago on Feb. 27, 2014 as a collaboration betwee...

  5. My NASA Data Precipitation

    NASA Video Gallery

    This lesson has two activities that help students develop a basic understanding of the relationship between cloud type and the form of precipitation and the relationship between the amount of water...

  6. Precipitation Estimates for Hydroelectricity

    NASA Technical Reports Server (NTRS)

    Tapiador, Francisco J.; Hou, Arthur Y.; de Castro, Manuel; Checa, Ramiro; Cuartero, Fernando; Barros, Ana P.

    2011-01-01

    Hydroelectric plants require precise and timely estimates of rain, snow and other hydrometeors for operations. However, it is far from being a trivial task to measure and predict precipitation. This paper presents the linkages between precipitation science and hydroelectricity, and in doing so it provides insight into current research directions that are relevant for this renewable energy. Methods described include radars, disdrometers, satellites and numerical models. Two recent advances that have the potential of being highly beneficial for hydropower operations are featured: the Global Precipitation Measuring (GPM) mission, which represents an important leap forward in precipitation observations from space, and high performance computing (HPC) and grid technology, that allows building ensembles of numerical weather and climate models.

  7. Chemisorption And Precipitation Reactions

    EPA Science Inventory

    The transport and bioavailability of chemical components within soils is, in part, controlled by partitioning between solids and solution. General terms used to describe these partitioning reactions include chemisorption and precipitation. Chemisorption is inclusive of the suit...

  8. Bioengineered heparins and heparan sulfates.

    PubMed

    Fu, Li; Suflita, Matthew; Linhardt, Robert J

    2016-02-01

    Heparin and heparan sulfates are closely related linear anionic polysaccharides, called glycosaminoglycans, which exhibit a number of important biological and pharmacological activities. These polysaccharides, having complex structures and polydispersity, are biosynthesized in the Golgi of animal cells. While heparan sulfate is a widely distributed membrane and extracellular glycosaminoglycan, heparin is found primarily intracellularly in the granules of mast cells. While heparin has historically received most of the scientific attention for its anticoagulant activity, interest has steadily grown in the multi-faceted role heparan sulfate plays in normal and pathophysiology. The chemical synthesis of these glycosaminoglycans is largely precluded by their structural complexity. Today, we depend on livestock animal tissues for the isolation and the annual commercial production of hundred ton quantities of heparin used in the manufacture of anticoagulant drugs and medical device coatings. The variability of animal-sourced heparin and heparan sulfates, their inherent impurities, the limited availability of source tissues, the poor control of these source materials and their manufacturing processes, suggest a need for new approaches for their production. Over the past decade there have been major efforts in the biotechnological production of these glycosaminoglycans, driven by both therapeutic applications and as probes to study their natural functions. This review focuses on the complex biology of these glycosaminoglycans in human health and disease, and the use of recombinant technology in the chemoenzymatic synthesis and metabolic engineering of heparin and heparan sulfates.

  9. BD-21 3873: another yellow-symbiotic barium star.

    NASA Astrophysics Data System (ADS)

    Smith, V. V.; Cunha, K.; Jorissen, A.; Boffin, H. M. J.

    1997-08-01

    An abundance analysis of the yellow symbiotic system BD-21 3873 reveals it to be a metal-poor K-giant ([Fe/H]=-1.3) which is enriched in the heavy s-process elements. In that respect, this star appears to be a twin of AG Dra, another yellow symbiotic system analyzed in a previous paper (Smith et al., 1996A&A...315..179S). The heavy-element abundance distributions of AG Dra and BD-21 3873 are almost identical, and are best reproduced by a s-process with a neutron exposure parameter of 1.2-1.3mb^-1^ and a neutron density logN_n_=8.3 (as derived from the Rb/Zr ratio). These two systems thus link the symbiotic stars to the binary barium and CH stars which are also s-process enriched. These binary systems, which exhibit overabundances of the heavy elements, owe their abundance peculiarities to mass transfer from thermally-pulsing asymptotic giant branch stars, which have since evolved to become white-dwarf companions of the cool stars we now view as the chemically-peculiar primaries. The spectroscopic orbits of BD-21 3873 (derived from CORAVEL measurements) and AG Dra are similar to those of barium and CH stars. With an orbital period of 281.6d, BD-21 3873 is one of the closest systems in these families, and its light curve indeed suggests that variations due to reflection and ellipticity effects are present. The amplitude of the ellipsoidal variations indicates that the giant must be close to filling its Roche lobe. However, no acceptable solution simultaneously satisfies the constraints from the light curve, the orbital elements and the evolutionary tracks in the framework of the standard Roche lobe geometry. We suggest that this discrepancy may be resolved by taking into account the deformation of the Roche lobe caused by the force driving the large mass loss of the giant.

  10. Brillouin function characteristics for La-Co substituted barium hexaferrites

    SciTech Connect

    Wu, Chuanjian E-mail: ksun@uestc.edu.cn; Yu, Zhong; Sun, Ke E-mail: ksun@uestc.edu.cn; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen; Yang, Yan

    2015-09-14

    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  11. Methods of producing sulfate salts of cations from heteroatomic compounds and dialkyl sulfates and uses thereof

    DOEpatents

    Friesen, Cody A.; Wolfe, Derek; Johnson, Paul Bryan

    2015-09-29

    Methods of preparing sulfate salts of heteroatomic compounds using dialkyl sulfates as a primary reactant are disclosed. Also disclosed are methods of making ionic liquids from the sulfate salts of the heteroatomic compound, and electrochemical cells comprising the ionic liquids.

  12. The possible role of sulfate-reduction kinetics in the formation of hydrothermal uranium deposits

    USGS Publications Warehouse

    Spirakis, Charles S.

    1981-01-01

    Sulfate is known to be an active oxidizing agent at high temperatures; however, both experimental and geologic evidence indicate that as a hydrothermal solution cools (to about 200 degrees C, depending on pH) kinetic factors slow the rate at which sulfate enters into redox reactions. This retardation of sulfate reduction diminishes the effectiveness of sulfate as an oxidizing agent. Consequently, as cooling proceeds, the reducing effect of H2S (and other reduced species) is not balanced with the oxidizing effect of SO (super -2) 4 to the same extent as at higher temperatures. The result is a progressively more reducing solution, which is precisely what is needed to precipitate reduced uranium minerals and to generate the paragenetic sequence observed in these deposits. The same mechanism may apply to other types of epithermal deposits.

  13. Volumetric determination of uranium titanous sulfate as reductant before oxidimetric titration

    USGS Publications Warehouse

    Wahlberg, J.S.; Skinner, D.L.; Rader, L.F.

    1957-01-01

    Need for a more rapid volumetric method for the routine determination of uranium in uranium-rich materials has led to the development of a method that uses titanous sulfate as a reductant before oxidimetric titration. Separation of the hydrogen sulfide group is not necessary. Interfering elements precipitated by cupferron are removed by automatic filtrations made simultaneously rather than by the longer chloroform extraction method. Uranium is reduced from VI to IV by addition of an excess of titanous sulfate solution, cupric ion serving as an indicator by forming red metallic copper when reduction is complete. The copper is reoxidized by addition of mercuric perchlorate. The reduced uranium is then determined by addition of excess ferric sulfate and titration with ceric sulfate. The method has proved to be rapid, accurate, and economical.

  14. Chemical quality of precipitation at Greenville, Maine

    USGS Publications Warehouse

    Smath, J.A.; Potter, T.L.

    1987-01-01

    Weekly composite precipitation samples were collected at a rural site located in Greenville, Maine for analysis of trace metals and organic compounds. Samples collected during February 1982, through May 1984, were analyzed for cadmium, chromium, copper, lead, mercury, nickel, and zinc and during February 1982, through March 1983, for chlorinated hydrocarbon pesticides, pthalate ester plasticizers, and polychlorinated biphenyls. Deposition rates were computed. Data reported by the NADP (National Atmospheric Deposition Program) was used to evaluate the general chemical quality of the precipitation. The precipitation had relatively high concentrations of hydrogen ions, sulfate, and nitrate, compared to other constituents. Of the trace metals included for analysis, only copper, lead, and zinc were consistently detected. Lead concentrations exceeded the U.S. EPA recommended limit for domestic water supply in three samples. High deposition rates for some of the metals were episodic. Alpha-hexachlorocyclohexane was the only organic compound that was consistently detected (maximum 120 nanograms/L). None of the other organic compounds were detected in any of the samples. (Author 's abstract)

  15. Heparan sulfate structure: methods to study N-sulfation and NDST action.

    PubMed

    Dagälv, Anders; Lundequist, Anders; Filipek-Górniok, Beata; Dierker, Tabea; Eriksson, Inger; Kjellén, Lena

    2015-01-01

    Heparan sulfate proteoglycans are important modulators of cellular processes where the negatively charged polysaccharide chains interact with target proteins. The sulfation pattern of the heparan sulfate chains will determine the proteins that will bind and the affinity of the interactions. The N-deacetylase/N-sulfotransferase (NDST) enzymes are of key importance during heparan sulfate biosynthesis when the sulfation pattern is determined. In this chapter, metabolic labeling of heparan sulfate with [(35)S]sulfate or [(3)H]glucosamine in cell cultures is described, in addition to characterization of polysaccharide chain length and degree of N-sulfation. Methods to measure NDST enzyme activity are also presented.

  16. Diatom-mediated barite precipitation in microbial mats calcifying at Stinking Springs, a warm sulphur spring system in Northwestern Utah, USA

    NASA Astrophysics Data System (ADS)

    Bonny, Sandy M.; Jones, Brian

    2007-02-01

    The Stinking Springs, Utah, produce warm (avg. 48 °C), saline, sulphur- and bicarbonate-rich spring water that is anomalously enriched in barium (up to 7.8 ppm). Diatoms, cyanobacteria and sulphate reducing bacteria form thick microbial mats in the flow path, and are lithified by calcite precipitating from the spring water. The flow path is underlain by relic tufas that formed in an analogous manner. Samples of microbial mats, fresh mineral precipitates and relic tufa were examined by light microscopy, scanning electron microscopy, and electron microprobe. Relic tufas were found to contain weakly radioactive diagenetic barite cements. Primary barite is localized around diatom frustules: microcrystalline barite forms haloes around grouped diatoms, lines diatom frustules, forms internal casts of diatoms, and locally replaces diatom silica. Bioaccumulation of barium in diatom tissues and adsorption of barium to diatom extracellular polysaccharides mediates barite saturation in lithifying microbial mats and is directly responsible for precipitation of primary barite at the Stinking Hot Springs. Cyanobacteria and sulphate reducing bacteria are locally preserved in relic tufa by impregnation or encrustation with calcite, but are not associated with barite. This suggests a re-evaluation of the capability of different microbial groups to mediate barite precipitation, which may influence the efficacy of particulate marine barite as a palaeoproductivity proxy.

  17. Early Triassic seawater sulfate drawdown

    NASA Astrophysics Data System (ADS)

    Song, Huyue; Tong, Jinnan; Algeo, Thomas J.; Song, Haijun; Qiu, Haiou; Zhu, Yuanyuan; Tian, Li; Bates, Steven; Lyons, Timothy W.; Luo, Genming; Kump, Lee R.

    2014-03-01

    The marine sulfur cycle is intimately linked to global carbon fluxes, atmospheric composition, and climate, yet relatively little is known about how it responded to the end-Permian biocrisis, the largest mass extinction of the Phanerozoic. Here, we analyze carbonate-associated-sulfate (CAS) from three Permo-Triassic sections in South China in order to document the behavior of the C-S cycle and its relationship to marine environmental changes during the mass extinction and its aftermath. We find that δ34SCAS varied from +9‰ to +44‰ at rates up to 100‰ Myr-1 during the Griesbachian-Smithian substages of the Early Triassic. We model the marine sulfur cycle to demonstrate that such rapid variation required drawdown of seawater sulfate concentrations to ⩽4 mM and a reduction in its residence time to ⩽200 kyr. This shorter residence time resulted in positive covariation with δ13Ccarb due to strong coupling of the organic carbon and pyrite burial fluxes. Carbon and sulfur isotopic shifts were associated with contemporaneous changes in climate, marine productivity, and microbial sulfate reduction rates, with negative shifts in δ13Ccarb and δ34SCAS linked to warming, decreased productivity, and reduced sulfate reduction. Sustained cooling during the Spathian re-invigorated oceanic overturning circulation, reduced marine anoxia, and limited pyrite burial. As seawater sulfate built to higher concentrations during the Spathian, the coupling of the marine C and S cycles came to an end and a general amelioration of marine environmental conditions set the stage for a recovery of invertebrate faunas. Variation in seawater sulfate during the Early Triassic was probably controlled by climate change, possibly linked to major eruptive phases of the Siberian Traps.

  18. Wastewater treatment using ferrous sulfate

    SciTech Connect

    Boetskaya, K.P.; Ioffe, E.M.

    1980-01-01

    Treatment of industrial wastewater with coagulants is used extensively in the thorough removal of emulsified tars and oils. The central plant laboratory at the Zhdanov Coke Works conducted investigations of the treatment of wastewater, subsequently used for quenching coke, with ferrous sulfate. Laboratory tests and subsequent industrial tests demonstrated the efficiency of the method. In order to further intensify the wastewater treatment process we conducted laboratory tests with the addition of certain quantities of other coagulation reagents, for example polyacrylamide (PAA) and caustic soda, in addition to the ferrous sulfate. The combined use of polyacrylamide and ferrous sulfate permits instant coagulation of the sludge and very rapid (5 to 10 min) clarification of the water. In addition, in this case the degree of purification of the water is less dependent on the initial concentration of impurities. The purification is also improved when caustic soda is added, raising the pH. From the data it is apparent that an identical degree of purification of the water may be achieved either by increasing the consumption of ferrous sulfate, or by adding PAA or NaOH. During industrial tests of the purification of wastewater with ferrous sulfate, we also investigated the resulting sludge. The use of ferrous sulfate causes a significant increase in its quantity (by a factor of 1.5 to 1.8) and in its oil content (by a factor of 2 to 2.5). The water content in the sludge decreases. The sludge (in the quantity of 0.6% of the charge) may be added to the coking charge.

  19. Antarctic polar stratospheric aerosols: The roles of nitrates, chlorides and sulfates

    NASA Technical Reports Server (NTRS)

    Pueschel, R. F.; Snetsinger, K. G.; Goodman, J. K.; Ferry, G. V.; Oberbeck, V. R.; Verma, S.; Fong, W.

    1988-01-01

    Nitric and hydrochloric acids have been postulated to condense in the winter polar stratosphere to become an important component of polar stratospheric clouds. One implication is that the removal of NO(y) from the gas phase by this mechanism allows high Cl(x) concentrations to react with O3, because the formation of ClNO3 is inhibited. Contributions of NO3 and Cl to the stratospheric aerosol were determined during the 1987 Airborne Antarctic Ozone Experiment by testing for the presence of nitrates and chlorides in the condensed phase. Aerosol particles were collected on four 500 micron diameter gold wires, each pretreated differently to give results that were specific to certain physical and chemical aerosol properties. One wire was carbon-coated for concentration and size analyses by scanning electron microscopy; X-ray energy dispersive analyses permitted the detection of S and Cl in individual particles. Three more wires were coated with Nitron, barium chloride and silver nitrate, respectively, to detect nitrate, sulfate and chloride in aerosol particles. All three ions, viz., sulfates, nitrates and chlorides were detected in the Antarctic stratospheric aerosol. In terms of number concentrations, the aerosol was dominated by sulfates, followed by chlorides and nitrates. An inverse linear regression can be established between nitrate concentrations and ozone mixing ratio, and between temperature and nitrates.

  20. Numberical simulation of the effects of radially injected barium plasma in the ionosphere

    NASA Technical Reports Server (NTRS)

    Swift, D. W.

    1985-01-01

    The morphology of the ion cloud in the radial shaped charge barium injection was studied. The shape of the ion cloud that remains after the explosive products and neutral barium clears away was examined. The ion cloud which has the configuration of a rimless wagon wheel is shown. The major features are the 2.5 km radius black hole in the center of the cloud, the surrounding ring of barium ion and the spokes of barium ionization radiating away from the center. The cloud shows no evolution after it emerges from the neutral debris and it is concluded that it is formed within 5 seconds of the event. A numerical model is used to calculate the motion of ions and electrons subject to the electrostatic and lorenz forces.

  1. Severe acute cholangitis after endoscopic sphincterotomy induced by barium examination: A case report.

    PubMed

    Zhang, Zhen-Hai; Wu, Ya-Guang; Qin, Cheng-Kun; Su, Zhong-Xue; Xu, Jian; Xian, Guo-Zhe; Wu, Shuo-Dong

    2012-10-21

    Endoscopic sphincterotomy (EST) is considered as a possible etiological factor for severe cholangitis. We herein report a case of severe cholangitis after endoscopic sphincterotomy induced by barium examination. An adult male patient presented with epigastric pain was diagnosed as having choledocholithiasis by ultrasonography. EST was performed and the stone was completely cleaned. Barium examination was done 3 d after EST and severe cholangitis appeared 4 h later. The patient was recovered after treated with tienam for 4 d. Barium examination may induce severe cholangitis in patients after EST, although rare, barium examination should be chosen cautiously. Cautions should be also used when EST is performed in patients younger than 50 years to avoid the damage to the sphincter of Oddi.

  2. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver... use in enemas. Tannic acid for rectal use to enhance X-ray visualization is regarded as a new...

  3. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver... use in enemas. Tannic acid for rectal use to enhance X-ray visualization is regarded as a new...

  4. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver... use in enemas. Tannic acid for rectal use to enhance X-ray visualization is regarded as a new...

  5. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver... use in enemas. Tannic acid for rectal use to enhance X-ray visualization is regarded as a new...

  6. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver... use in enemas. Tannic acid for rectal use to enhance X-ray visualization is regarded as a new...

  7. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-06-28

    ... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October 29... the order is barium chloride, a chemical compound having the formulas BaCl 2 or BaCl 2 - 2H 2...

  8. Acid Sulfate Alteration on Mars

    NASA Technical Reports Server (NTRS)

    Ming, D. W.; Morris, R. V.

    2016-01-01

    A variety of mineralogical and geochemical indicators for aqueous alteration on Mars have been identified by a combination of surface and orbital robotic missions, telescopic observations, characterization of Martian meteorites, and laboratory and terrestrial analog studies. Acid sulfate alteration has been identified at all three landing sites visited by NASA rover missions (Spirit, Opportunity, and Curiosity). Spirit landed in Gusev crater in 2004 and discovered Fe-sulfates and materials that have been extensively leached by acid sulfate solutions. Opportunity landing on the plains of Meridiani Planum also in 2004 where the rover encountered large abundances of jarosite and hematite in sedimentary rocks. Curiosity landed in Gale crater in 2012 and has characterized fluvial, deltaic, and lacustrine sediments. Jarosite and hematite were discovered in some of the lacustrine sediments. The high elemental abundance of sulfur in surface materials is obvious evidence that sulfate has played a major role in aqueous processes at all landing sites on Mars. The sulfate-rich outcrop at Meridiani Planum has an SO3 content of up to 25 wt.%. The interiors of rocks and outcrops on the Columbia Hills within Gusev crater have up to 8 wt.% SO3. Soils at both sites generally have between 5 to 14 wt.% SO3, and several soils in Gusev crater contain around 30 wt.% SO3. After normalization of major element compositions to a SO3-free basis, the bulk compositions of these materials are basaltic, with a few exceptions in Gusev crater and in lacustrine mudstones in Gale crater. These observations suggest that materials encountered by the rovers were derived from basaltic precursors by acid sulfate alteration under nearly isochemical conditions (i.e., minimal leaching). There are several cases, however, where acid sulfate alteration minerals (jarosite and hematite) formed in open hydrologic systems, e.g., in Gale crater lacustrine mudstones. Several hypotheses have been suggested for the

  9. Solid and Dissolved Barium Profiles in Gas Hydrate Systems at Blake Ridge (ODP 164) and Peru Margin (ODP 201): Implications for Long-Term Carbon-Cycling in the Deep Biosphere.

    NASA Astrophysics Data System (ADS)

    Snyder, G. T.; Dickens, G. R.; Castellini, D. G.

    2003-12-01

    While many investigations have focused on quantifying either the amount of gas hydrates in marine sediment sequences or the methane fluxes to and from these systems, relatively little is known about how gas hydrate reservoirs evolve over time. Our research focuses on barium in gas hydrate systems, which may serve as a proxy for the accumulation of organic matter throughout the history of a depositional location, while also providing an indication of certain post-depositional processes. The accumulation of Ba in marine sediment is intimately associated with the supply of organic matter so that the total Ba abundance should reflect the extent to which organic matter has been supplied to a gas hydrate system. Once in the sediment column, the partitioning of Ba is highly correlated to dissolved sulfate concentrations, such that present and past levels of anaerobic oxidation of methane (AOM) and sulfate reduction can be traced with Ba profiles. Prior investigations of Ba cycling in gas hydrate systems generally have been limited by low-resolution profiles of dissolved or solid Ba concentrations. Moreover, there have been no sites with data for both dissolved and solid Ba profiles as well as dissolved sulfate and methane profiles. We present high-resolution profiles of pore fluid and sedimentary Ba in sediments from Blake Ridge and the Peru Margin, locations where profiles of sulfate and methane have also been generated. At both locations, dissolved Ba is low in the shallow sulfate reduction zone. Immediately above the depth of present AOM, dissolved Ba concentrations rapidly rise. These intervals are also marked by a prominent peak in solid Ba, or Ba-front. At Peru Margin, Ba concentrations increase fairly steadily below the depth of AOM to 1200 μ M at 250m depth, among the highest dissolved Ba concentrations ever reported for a marine borehole. At the Blake Ridge, however, Ba concentrations oscillate below the depth of AOM with a series of highs and lows, reaching a

  10. Time constraints on sulfate-related diagenesis, Capitan Reef Complex, west Texas and New Mexico

    SciTech Connect

    Darke, G. ); Harwood, G. )

    1990-05-01

    Petrographic, paleomagnetic, and outcrop studies of the middle Capitan Reef Complex in the Guadalupe Mountains have provided time constraints on diagenetic events and demonstrated the crucial role of calcium sulfate. Sulfate emplacement occurred at an early stage. The sulfate emplacement post-dated and replaced syndepositional marine margins and lath forms demonstrate replacement was by anhydrite rather then gypsum. Fabric-selective dolomitization and kaolinite precipitation derived from reworking shelf evaporite sequences moving downdip during early stages of drawdown within the Delaware basin. A second period of brine migration causing sulfate emplacement and dolomitization, occurred as the Delaware basin gradually filled with the Castile evaporites, when all remaining porosity within the Capitan shelf margin became indurated by calcium sulfate-laden fluids. This caused pervasive dolomitization, particularly in the lower foreslope, with formation of dolomite rhombs and overgrowths on earlier dolomitized marine cements, coeval with replacive clusters of anhydrite. Most porosity was plugged, some with syndepositional marine cements, but the greater proportion with evaporites until uplift in the Tertiary. Then a meteoric groundwater system became established with subsequent sulfate dissolution. Minor sulfate reduction formed iron sulfides. This oxidized to hematite, which was enclosed within a first generation of zoned calcite spar along some pore margins. Most hematite has a paleomagnetic age of 20 Ma, although minor hematite formation continues to the present. A second, also zoned, coarser calcite spar generation was followed by the latest nonluminescent calcite spar. These calcite spars form the vast bulk of that visible at outcrop.

  11. Role of Barium Swallow in Diagnosing Clinically Significant Anastomotic Leak following Esophagectomy

    PubMed Central

    Roh, Simon; Iannettoni, Mark D.; Keech, John C.; Bashir, Mohammad; Gruber, Peter J.; Parekh, Kalpaj R.

    2016-01-01

    Background Barium swallow is performed following esophagectomy to evaluate the anastomosis for detection of leaks and to assess the emptying of the gastric conduit. The aim of this study was to evaluate the reliability of the barium swallow study in diagnosing anastomotic leaks following esophagectomy. Methods Patients who underwent esophagectomy from January 2000 to December 2013 at our institution were investigated. Barium swallow was routinely done between days 5–7 to detect a leak. These results were compared to clinically determined leaks (defined by neck wound infection requiring jejunal feeds and or parenteral nutrition) during the postoperative period. The sensitivity and specificity of barium swallow in diagnosing clinically significant anastomotic leaks was determined. Results A total of 395 esophagectomies were performed (mean age, 62.2 years). The indications for the esophagectomy were as follows: malignancy (n=320), high-grade dysplasia (n=14), perforation (n=27), benign stricture (n=7), achalasia (n=16), and other (n=11). A variety of techniques were used including transhiatal (n=351), McKeown (n=35), and Ivor Lewis (n=9) esophagectomies. Operative mortality was 2.8% (n=11). Three hundred and sixty-eight patients (93%) underwent barium swallow study after esophagectomy. Clinically significant anastomotic leak was identified in 36 patients (9.8%). Barium swallow was able to detect only 13/36 clinically significant leaks. The sensitivity of the swallow in diagnosing a leak was 36% and specificity was 97%. The positive and negative predictive values of barium swallow study in detecting leaks were 59% and 93%, respectively. Conclusion Barium swallow is an insensitive but specific test for detecting leaks at the cervical anastomotic site after esophagectomy. PMID:27066433

  12. Elevated Z line: a new sign of Barrett's esophagus on double-contrast barium esophagograms.

    PubMed

    Levine, Marc S; Ahmad, Nuzhat A; Rubesin, Stephen E

    2015-01-01

    We describe an elevated Z line as a new radiographic sign of Barrett's esophagus characterized by a transversely oriented, zigzagging, barium-etched line extending completely across the circumference of the midesophagus. An elevated Z line is rarely seen in other patients, so this finding should be highly suggestive of Barrett's esophagus on double-contrast barium esophagograms. If the patient is a potential candidate for surveillance, endoscopy and biopsy should be performed to confirm the presence of Barrett's esophagus.

  13. Calculations of energy levels and lifetimes of low-lying states of barium and radium

    SciTech Connect

    Dzuba, V. A.; Ginges, J. S. M.

    2006-03-15

    We use the configuration-interaction method and many-body perturbation theory to perform accurate calculations of energy levels, transition amplitudes, and lifetimes of low-lying states of barium and radium. Calculations for radium are needed for the planning of measurements of parity- and time-invariance-violating effects which are strongly enhanced in this atom. Calculations for barium are used to control the accuracy of the calculations.

  14. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element

    NASA Technical Reports Server (NTRS)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.

    1983-01-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  15. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae

    PubMed Central

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  16. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae.

    PubMed

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla.

  17. Stability of Magnesium Sulfate Minerals in Martian Environments

    NASA Technical Reports Server (NTRS)

    Marion, G. M.; Kargel, J. S.

    2005-01-01

    Viking Lander, Pathfinder, and Mars Exploration Rover missions to Mars have found abundant sulfur in surface soils and rocks, and the best indications are that magnesium sulfates are among the key hosts. At Meridiani Planum, MgSO4 salts constitute 15 to 40 wt.% of sedimentary rocks. Additional S is hosted by gypsum and jarosite. Reflectance and thermal emission spectroscopy is consistent with the presence of kieserite (MgSO4 H2O) and epsomite (MgSO4*7H2O). Theoretically, the dodecahydrate (MgSO4*12H2O) should also have precipitated. We first examine theoretically which MgSO4 minerals should have precipitated on Mars, and then how dehydration might have altered these minerals.

  18. Effect of sulfide removal on sulfate reduction at pH 5 in a hydrogen fed gas-lift bioreactor.

    PubMed

    Bijmans, Martijn F M; Dopson, Mark; Ennin, Frederick; Lens, Piet N L; Buisman, Cees J N

    2008-11-01

    Biotechnological treatment of sulfate- and metal-ionscontaining acidic wastewaters from mining and metallurgical activities utilizes sulfate-reducing bacteria to produce sulfide that can subsequently precipitate metal ions. Reducing sulfate at a low pH has several advantages above neutrophilic sulfate reduction. This study describes the effect of sulfide removal on the reactor performance and microbial community in a high-rate sulfidogenic gas-lift bioreactor fed with hydrogen at a controlled internal pH of 5. Under sulfide removal conditions, 99% of the sulfate was converted at a hydraulic retention time of 24 h, reaching a volumetric activity as high as 51 mmol sulfate/l/d. Under nonsulfide removal conditions, <25% of the sulfate was converted at a hydraulic retention time of 24 h reaching volumetric activities of <13mmol sulfate/l/d. The absence of sulfide removal at a hydraulic retention time of 24 h resulted in an average H2S concentration of 18.2 mM (584 mg S/l). The incomplete sulfate removal was probably due to sulfide inhibition. Molecular phylogenetic analysis identified 11 separate 16S rRNA bands under sulfide stripping conditions, whereas under nonsulfide removal conditions only 4 separate 16S rRNA bands were found. This shows that a less diverse population was found in the presence of a high sulfide concentration.

  19. Thermal conversions of the yttrium-barium-copper salt of carboxylated cellulose and the synthesis of yttrium barium cuprate from it

    SciTech Connect

    Kaputskii, F.N.; Bashmakov, I.A.; Novikov, V.P.

    1994-09-20

    Thermal solid-phase conversions of the yttrium-barium-copper salt of tricarboxycellulose (TCC) with a 1-2-3 cation stoichiometry, respectively, have been considered. Yttrium barium cuprate is the end product of the thermal treatment of the triple salt. According to the data of X-ray analysis the onset of 1-2-3 phase formation is noticeable at 750-800{degrees}C. The temperature 875{degrees}C (with a duration of heating of 12 h) is sufficient for practically complete conversion of the Y-Ba-Cu salt of TCC into YBa{sub 2}Cu{sub 3}O{sub 7-{delta}}.

  20. A sulfate conundrum: Dissolved sulfates of deep-saline brines and carbonate-associated sulfates

    NASA Astrophysics Data System (ADS)

    Labotka, Dana M.; Panno, Samuel V.; Locke, Randall A.

    2016-10-01

    Sulfates in deeply circulating brines and carbonate-associated sulfates (CAS) within sedimentary units of the Cambrian strata in the Illinois Basin record a complex history. Dissolved sulfate within the Mt. Simon Sandstone brines exhibits average δ34SSO4 values of 35.4‰ and δ18OSO4 values of 14.6‰ and appears to be related to Cambrian seawater sulfate, either original seawater or sourced from evaporite deposits such as those in the Michigan Basin. Theoretical and empirical relationships based on stable oxygen isotope fractionation suggest that sulfate within the lower depths of the Mt. Simon brines has experienced a long period of isolation, possibly several tens of millions of years. Comparison with brines from other stratigraphic units shows the Mt. Simon brines are geochemically unique. Dissolved sulfate from brines within the Ironton-Galesville Sandstone averages 22.7‰ for δ34SSO4 values and 13.0‰ for δ18OSO4 values. The Ironton-Galesville brine has mixed with younger groundwater, possibly of Ordovician to Devonian age and younger. The Eau Claire Formation lies between the Mt. Simon and Ironton-Galesville Sandstones. The carbonate units of the Eau Claire and stratigraphically equivalent Bonneterre Formation contain CAS that appears isotopically related to the Late Pennsylvanian-Early Permian Mississippi Valley-type ore pulses that deposited large sulfide minerals in the Viburnum Trend/Old Lead Belt ore districts. The δ34SCAS values range from 21.3‰ to 9.3‰, and δ18OCAS values range from +1.4‰ to -2.6‰ and show a strong covariance (R2 = 0.94). The largely wholesale replacement of Cambrian seawater sulfate signatures in these dolomites does not appear to have affected the sulfate signatures in the Mt. Simon brines even though these sulfide deposits are found in the stratigraphically equivalent Lamotte Sandstone to the southwest. On the basis of this and previous studies, greater fluid densities of the Mt. Simon brines may have prevented the

  1. Chiral Crystallization of Ethylenediamine Sulfate

    ERIC Educational Resources Information Center

    Koby, Lawrence; Ningappa, Jyothi B.; Dakesssian, Maria; Cuccia, Louis A.

    2005-01-01

    The optimal conditions for the crystallization of achiral ethylenediamine sulfate into large chiral crystals that are ideal for polarimetry studies and observation using Polaroid sheets are presented. This experiment is an ideal undergraduate experiment, which clearly demonstrates the chiral crystallization of an achiral molecule.

  2. URANIUM PRECIPITATION PROCESS

    DOEpatents

    Thunaes, A.; Brown, E.A.; Smith, H.W.; Simard, R.

    1957-12-01

    A method for the recovery of uranium from sulfuric acid solutions is described. In the present process, sulfuric acid is added to the uranium bearing solution to bring the pH to between 1 and 1.8, preferably to about 1.4, and aluminum metal is then used as a reducing agent to convert hexavalent uranium to the tetravalent state. As the reaction proceeds, the pH rises amd a selective precipitation of uranium occurs resulting in a high grade precipitate. This process is an improvement over the process using metallic iron, in that metallic aluminum reacts less readily than metallic iron with sulfuric acid, thus avoiding consumption of the reducing agent and a raising of the pH without accomplishing the desired reduction of the hexavalent uranium in the solution. Another disadvantage to the use of iron is that positive ferric ions will precipitate with negative phosphate and arsenate ions at the pH range employed.

  3. FORMATION OF URANIUM PRECIPITATES

    DOEpatents

    Googin, J.M. Jr.

    1959-03-17

    A method is described for precipitation of uranium peroxide from uranium- containing solutions so as to obtain larger aggregates which facilitates washings decantations filtrations centrifugations and the like. The desired larger aggregate form is obtained by maintaining the pH of the solution in the approximate range of 1 to 3 and the temperature at about 25 deg C or below while carrytng out the precipitation. Then prior to removal of the precipitate a surface active sulfonated bicarboxyacids such as di-octyl sodium sulfo-succinates is incorporated in an anount of the order of 0.01 to 0.05 percent by weights and the slurry is allowed to ripen for about one-half hour at a temperatare below 10 deg C.

  4. Sulfite-sulfide-sulfate-carbonate equilibria with applications to Mars

    NASA Astrophysics Data System (ADS)

    Marion, G. M.; Kargel, J. S.; Crowley, J. K.; Catling, D. C.

    2013-07-01

    Mars volcanic SO2 and H2S gas emissions are likely the dominant source of martian sulfate, and the source of sulfuric acid. Until this work, the FREZCHEM model lacked SO2 and H2S gases and associated sulfite and sulfide minerals. The specific objectives of this paper were to add these components and associated sulfite and sulfide minerals and phases into FREZCHEM, and to explore some possible roles of these chemistries on Mars. New solid phases added included the sulfites: Na2SO3·7H2O, K2SO3, (NH4)2SO3·H2O, MgSO3·6H2O, CaSO3·0.5H2O, and FeSO3·1.5H2O, and the sulfide: FeS2. The lowest eutectic of these minerals was K2SO3 (= 6.57 m) at 228 K. Because sulfurous acid is stronger than carbonic acid, this causes a much larger fraction of S(IV) to exist as sulfite (SO32-) at acidic to mildly alkaline pH, whereas almost none of the C is present as carbonate anion. Model calculations show that small quantities of SO2 in an early CO2-rich martian atmosphere suppressed formation of carbonates because SO2 is much more water soluble than CO2 and a stronger acid, which may be a major reason why sulfates are much more common than carbonates on Mars. Also, perhaps equally important are low temperatures that favor sulfite mineral precipitation, the oxidation of which leads to sulfate minerals. Another potentially important factor that favors sulfite/sulfide mineral formation is low pH values that cannot allow carbonate minerals, but can allow sulfide minerals such as pyrite (FeS2). The presence of pyrite, highly insoluble, would lead to sulfate minerals when oxygen becomes available in acidic environments. Major cations for both sulfites (or sulfates) and carbonates (Ca and Mg) can limit carbonates. Sulfite-sulfide volcanism on a cold, lower pH, Mars are the primary causes of high sulfate minerals (e.g., Ca and Mg sulfates), compared to volcanism on a warm, higher pH, Earth that led to more abundant carbonate minerals (e.g., Ca and Mg carbonates).

  5. Characterization of sulfated quercetin and epicatechin metabolites.

    PubMed

    Dueñas, Montserrat; González-Manzano, Susana; Surco-Laos, Felipe; González-Paramas, Ana; Santos-Buelga, Celestino

    2012-04-11

    Different monosulfates of quercetin and epicatechin with metabolic interest were obtained by hemisynthesis and characterized regarding their chromatographic behavior and absorption and mass spectra. Three of these compounds were further isolated, and their structures were elucidated by mass spectrometry and (1)H and (13)C nuclear magnetic resonance using one- and two-dimensional techniques (heteronuclear single-quantum coherence and heteronuclear multiple-bond correlation). The calculation of the proton and carbon shifts caused by sulfation allowed for the assignment of the position of the sulfate group in the flavonoids, so that the compounds were identified as quercetin-3'-O-sulfate, quercetin 4'-O-sulfate, and epicatechin 4'-O-sulfate. It was found that sulfation at position 3' induced a large upfield shift in the carbon bearing the sulfate group and downfield displacements of the adjacent carbons, whereas no significant upfield or downfield shifts were observed with respect to the parent flavonoid when sulfation was produced at position 4'.

  6. Precipitation-Regulated Feedback

    NASA Astrophysics Data System (ADS)

    Voit, Mark

    2016-07-01

    Star formation in the central galaxies of galaxy clusters appears to be fueled by precipitation of cold clouds out of hot circumgalactic gas via thermal instability. I will present both observational and theoretical support for the precipitation mode in large galaxies and discuss how it can be implemented in cosmological simulations of galaxy evolution. Galaxy cluster cores are unique laboratories for studying the astrophysics of thermal instability and may be teaching us valuable lessons about how feedback works in galaxies spanning the entire mass spectrum.

  7. Chronic barium intoxication disrupts sulphated proteoglycan synthesis: a hypothesis for the origins of multiple sclerosis.

    PubMed

    Purdey, Mark

    2004-01-01

    High level contamination by natural and industrial sources of the alkali earth metal, barium (Ba) has been identified in the ecosystems/workplaces that are associated with high incidence clustering of multiple sclerosis (MS) and other neurodegenerative diseases such as the transmissible spongiform encephalopathies (TSEs) and amyotrophic lateral sclerosis (ALS). Analyses of ecosystems supporting the most renowned MS clusters in Saskatchewan, Sardinia, Massachusetts, Colorado, Guam, NE Scotland demonstrated consistently elevated levels of Ba in soils (mean: 1428 ppm) and vegetation (mean: 74 ppm) in relation to mean levels of 345 and 19 ppm recorded in MS-free regions adjoining. The high levels of Ba stemmed from local quarrying for Ba ores and/or use of Ba in paper/foundry/welding/textile/oil and gas well related industries, as well as from the use of Ba as an atmospheric aerosol spray for enhancing/refracting the signalling of radio/radar waves along military jet flight paths, missile test ranges, etc. It is proposed that chronic contamination of the biosystem with the reactive types of Ba salts can initiate the pathogenesis of MS; due to the conjugation of Ba with free sulphate, which subsequently deprives the endogenous sulphated proteoglycan molecules (heparan sulfates) of their sulphate co partner, thereby disrupting synthesis of S-proteoglycans and their crucial role in the fibroblast growth factor (FGF) signalling which induces oligodendrocyte progenitors to maintain the growth and structural integrity of the myelin sheath. Loss of S-proteoglycan activity explains other key facets of MS pathogenesis; such as the aggregation of platelets and the proliferation of superoxide generated oxidative stress. Ba intoxications disturb the sodium-potassium ion pump--another key feature of the MS profile. The co-clustering of various neurodegenerative diseases in these Ba-contaminated ecosystems suggests that the pathogenesis of all of these diseases could pivot upon a

  8. Mineralogy and Organic Geochemistry of Acid Sulfate Environments from Valles Caldera, New Mexico: Habitability, Weathering and Biosignatures

    NASA Astrophysics Data System (ADS)

    Vogel, M. B.; Des Marais, D. J.; Jahnke, L. L.; Kubo, M.

    2009-12-01

    We report on the mineralogy, organic preservation potential and habitability of sulfate deposits in acid sulfate volcanic settings at Valles Caldera, New Mexico. Fumaroles and acidic springs are potential analogs for aqueous environments on Mars and may offer insights into habitability of sulfate deposits such as those at Meridiani Planum. Sulfates recently detected on Mars are posited to have formed from fluids derived from basaltic weathering and igneous volatile input, ultimately precipitating from acidic brines subjected to desiccation and freeze-thaw cycles (McClennan and Grotzinger, 2008). Key issues concerning martian sulfate deposits are their relationship to aqueous clay deposits, and whether or not specific sulfates deposits represent former habitable environments (see Soderblum and Bell, 2008; Tosca et al., 2008). Modern terrestrial volcanic fumaroles and hot springs precipitate various Ca-, Mg- and Fe- sulfates along with clays, and can help clarify whether certain acid sulfate mineral assemblages reflect habitable environments. Valles caldera is a resurgent caldera last active in the Pleistocene (1.4 - 1.0 Ma) that hosts several active fumaroles and over 40 geothermal exploration wells (see Goff, 2009). Fumaroles and associated mudpots and springs at Valles range from pH < 1 to 3, and affect argillic alteration upon rhylolitic tuffs and sedimentary deposits (Charles et al., 1986). We identified assemblages containing gypsum, quartz, Al-sulfates, elemental sulfur, clays and other minerals using XRD and SEM-EDS. Our previous research has shown that sulfates from different marine depositional environments display textural and morphological traits that are indicative of biological influence, or specific conditions in the depositional environments (Vogel et al., 2009). Gypsum crystals that develop in the presence of microbial biofilms in marine environments may have distorted crystal morphologies, biofilm - associated dissolution features, and accessory

  9. 21 CFR 184.1461 - Manganese sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... dioxide in sulfuric acid, and the roasting of pyrolusite (MnO2) ore with solid ferrous sulfate and coal... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Manganese sulfate. 184.1461 Section 184.1461 Food... Specific Substances Affirmed as GRAS § 184.1461 Manganese sulfate. (a) Manganese sulfate (MnSO4·H2O,...

  10. 21 CFR 184.1461 - Manganese sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... dioxide in sulfuric acid, and the roasting of pyrolusite (MnO2) ore with solid ferrous sulfate and coal... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Manganese sulfate. 184.1461 Section 184.1461 Food... Specific Substances Affirmed as GRAS § 184.1461 Manganese sulfate. (a) Manganese sulfate (MnSO4·H2O,...

  11. 21 CFR 184.1461 - Manganese sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... dioxide in sulfuric acid, and the roasting of pyrolusite (MnO2) ore with solid ferrous sulfate and coal... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Manganese sulfate. 184.1461 Section 184.1461 Food... Specific Substances Affirmed as GRAS § 184.1461 Manganese sulfate. (a) Manganese sulfate (MnSO4·H2O,...

  12. 21 CFR 184.1461 - Manganese sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... dioxide in sulfuric acid, and the roasting of pyrolusite (MnO2) ore with solid ferrous sulfate and coal... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Manganese sulfate. 184.1461 Section 184.1461 Food... Specific Substances Affirmed as GRAS § 184.1461 Manganese sulfate. (a) Manganese sulfate (MnSO4·H2O,...

  13. 21 CFR 184.1261 - Copper sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of...

  14. 21 CFR 184.1261 - Copper sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5 H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of...

  15. 21 CFR 184.1261 - Copper sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Copper sulfate. 184.1261 Section 184.1261 Food and....1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5 H2O, CAS Reg. No. 7758-99-8) usually... sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of a purity suitable...

  16. 21 CFR 184.1261 - Copper sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of...

  17. 21 CFR 184.1261 - Copper sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5 H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of...

  18. Supramolecular curcumin-barium prodrugs for formulating with ceramic particles.

    PubMed

    Kamalasanan, Kaladhar; Anupriya; Deepa, M K; Sharma, Chandra P

    2014-10-01

    A simple and stable curcumin-ceramic combined formulation was developed with an aim to improve curcumin stability and release profile in the presence of reactive ceramic particles for potential dental and orthopedic applications. For that, curcumin was complexed with barium (Ba(2+)) to prepare curcumin-barium (BaCur) complex. Upon removal of the unbound curcumin and Ba(2+) by dialysis, a water-soluble BaCur complex was obtained. The complex was showing [M+1](+) peak at 10,000-20,000 with multiple fractionation peaks of MALDI-TOF-MS studies, showed that the complex was a supramolecular multimer. The (1)H NMR and FTIR studies revealed that, divalent Ba(2+) interacted predominantly through di-phenolic groups of curcumin to form an end-to-end complex resulted in supramolecular multimer. The overall crystallinity of the BaCur was lower than curcumin as per XRD analysis. The complexation of Ba(2+) to curcumin did not degrade curcumin as per HPLC studies. The fluorescence spectrum was blue shifted upon Ba(2+) complexation with curcumin. Monodisperse nanoparticles with size less than 200dnm was formed, out of the supramolecular complex upon dialysis, as per DLS, and upon loading into pluronic micelles the size was remaining in similar order of magnitude as per DLS and AFM studies. Stability of the curcumin was improved greater than 50% after complexation with Ba(2+) as per UV/Vis spectroscopy. Loading of the supramloecular nanoparticles into pluronic micelles had further improved the stability of curcumin to approx. 70% in water. These BaCur supramolecule nanoparticles can be considered as a new class of prodrugs with improved solubility and stability. Subsequently, ceramic nanoparticles with varying chemical composition were prepared for changing the material surface reactivity in terms of the increase in, degradability, surface pH and protein adsorption. Further, these ceramic particles were combined with curcumin prodrug formulations and optimized the curcumin release

  19. Defect Chemistry and Microstructure of Complex Perovskite Barium Zinc Niobate

    NASA Astrophysics Data System (ADS)

    Peng, Ping

    1991-02-01

    This dissertation presents a systematic study of the characterization of the phase transitions, microstructures, defects and transport properties of undoped and doped complex perovskite barium zinc niobate (BZN). Complex perovskite BZN is a paraelectric material while its parent material barium titanate is ferroelectric. With codoping of (Zn + 2Nb) into Ti site, BaTiO_3 shows three distinguished features. First, the Curie temperature is lowered; second, the three phase transitions (cubic-tetragonal-orthorhombic-rhombohedral) coalesce; and lastly, the transition becomes diffuse showing a typical 2nd order phase transition compared with 1st order in undoped BaTiO_3. Complex microchemical ordering is another characteristic of BZN. Stoichiometric BZN shows a mixture of two types of ordering schemes. 1:1, 1:2 ordered microdomains and the disordered matrix co-exist. The 1:1 type ordering involves an internal charge imbalance which inhibits the growth of 1:1 type of ordered microdomains. The 1:2 type ordering is consistent with the chemical composition of BZN. These ordering patterns can be modified by either adjustment of the Zn/Nb ratio or by doping. The defect structure of the stoichiometric BZN is closely related to that of BaTiO_3. Stoichiometric BZN is an insulator with wide band gap (~ 3.70 eV). Undoped BZN has a high oxygen vacancy concentration which comes from three possible sources, such as unavoidable acceptor impurities, due to their natural abundance, Zn/Nb ratio uncertainty due to processing limitations, and high temperature ZnO loss due to sintering process. The oxygen vacancy concentration for undoped BZN lays in the neighborhood of 1500 ppm (atm.). The compensation defects for various dopants have also been identified. Both electrons and holes conduct by a small polaron mechanism. Various thermodynamic parameters, such as enthalpies of oxidation and reduction, mass action constants for intrinsic electronic disorder, oxidation and reduction have been

  20. Volumetric determination of uranium using titanous sulfate as reductant before oxidimetric titration

    USGS Publications Warehouse

    Wahlberg, James S.; Skinner, Dwight L.; Rader, Lewis F.

    1956-01-01

    A new method for determining uranium in samples containing 0.05 percent or more U3O8, using titanous sulfate as reducing agent, is much shorter, faster, and has fewer interferences than conventional methods using reductor columns. The sample is dissolved with sulfuric, nitric, perchloric, and hydrofluoric acids. Elements that would otherwise form insoluble fluorides are kept in solution by complexing the fluoride ion with boric acid. A precipitation is made with cupferron to remove interfering elements. The solution is filtered to remove the precipitated cupferrates instead of extracting them with chloroform as is usually done. Filtration is preferred to extraction because any niobium that may be in solution forms an insoluble cupferrate that may be removed by filtering but is very difficult to extract with chloroform. Excess cupferron is destroyed by oxidizing with nitric and perchloric acids, and evaporating to dense fumes of sulfuric acid. The uranium is reduced to U(IV) by the addition of titanous sulfate, with cupric sulfate used as an indicator of the completeness of the reduction. Metallic copper is formed when all the uranium is reduced. The reduced copper is then reoxidized by the addition of mercuric perchlorate, an excess of ferric sulfate added, and the solution titrated immediately with standard ceric sulfate with ferroin as an indicator. Precision of the method compared favorable with methods in common use, both for uranium ores and for most types of uranium-rich materials.

  1. Active experiments in space in conjunction with Skylab. [barium plasma injection experiment and magnetic storm of March 7, 1972

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.

    1974-01-01

    Two papers are presented which relate to the Skylab barium shaped charge experiments. The first describes the L=6.6 OOSIK barium plasma injection experiment and magnetic storm of March 7, 1972. Rocket payload, instrumentation, data reduction methods, geophysical environment at the time of the experiment, and results are given. The second paper presents the observation of an auroral Birkeland current which developed from the distortion of a barium plasma jet during the above experiment.

  2. 21 CFR 182.8997 - Zinc sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Zinc sulfate. 182.8997 Section 182.8997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Nutrients § 182.8997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions...

  3. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ferrous sulfate. 184.1315 Section 184.1315 Food... Specific Substances Affirmed as GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II... iron. It occurs as pale, bluish-green crystals or granules. Progressive heating of ferrous...

  4. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ferrous sulfate. 184.1315 Section 184.1315 Food... Specific Substances Affirmed as GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II... iron. It occurs as pale, bluish-green crystals or granules. Progressive heating of ferrous...

  5. 21 CFR 184.1315 - Ferrous sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ferrous sulfate. 184.1315 Section 184.1315 Food... Specific Substances Affirmed as GRAS § 184.1315 Ferrous sulfate. (a) Ferrous sulfate heptahydrate (iron (II... iron. It occurs as pale, bluish-green crystals or granules. Progressive heating of ferrous...

  6. 21 CFR 184.1643 - Potassium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg... having a bitter, saline taste. It is prepared by the neutralization of sulfuric acid with...

  7. 21 CFR 582.1643 - Potassium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Potassium sulfate. 582.1643 Section 582.1643 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1643 Potassium sulfate. (a) Product. Potassium sulfate. (b) Conditions of use....

  8. 21 CFR 582.1643 - Potassium sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Potassium sulfate. 582.1643 Section 582.1643 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1643 Potassium sulfate. (a) Product. Potassium sulfate. (b) Conditions of use....

  9. 21 CFR 184.1643 - Potassium sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Potassium sulfate. 184.1643 Section 184.1643 Food... GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg. No. 7778-80-5) occurs.... It is prepared by the neutralization of sulfuric acid with potassium hydroxide or potassium...

  10. 21 CFR 582.1643 - Potassium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Potassium sulfate. 582.1643 Section 582.1643 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1643 Potassium sulfate. (a) Product. Potassium sulfate. (b) Conditions of use....

  11. 21 CFR 582.1643 - Potassium sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Potassium sulfate. 582.1643 Section 582.1643 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1643 Potassium sulfate. (a) Product. Potassium sulfate. (b) Conditions of use....

  12. 21 CFR 184.1643 - Potassium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg... having a bitter, saline taste. It is prepared by the neutralization of sulfuric acid with...

  13. 21 CFR 184.1643 - Potassium sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg... having a bitter, saline taste. It is prepared by the neutralization of sulfuric acid with...

  14. 21 CFR 184.1643 - Potassium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg... having a bitter, saline taste. It is prepared by the neutralization of sulfuric acid with...

  15. 21 CFR 582.1643 - Potassium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Potassium sulfate. 582.1643 Section 582.1643 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1643 Potassium sulfate. (a) Product. Potassium sulfate. (b) Conditions of use....

  16. 21 CFR 184.1230 - Calcium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Calcium sulfate. 184.1230 Section 184.1230 Food... Specific Substances Affirmed as GRAS § 184.1230 Calcium sulfate. (a) Calcium sulfate (CaSO4, CAS Reg. No... gypsum, occurs naturally and exists as a fine, white to slightly yellow-white odorless powder....

  17. 21 CFR 184.1230 - Calcium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Calcium sulfate. 184.1230 Section 184.1230 Food... Specific Substances Affirmed as GRAS § 184.1230 Calcium sulfate. (a) Calcium sulfate (CaSO4, CAS Reg. No... gypsum, occurs naturally and exists as a fine, white to slightly yellow-white odorless powder....

  18. 21 CFR 184.1230 - Calcium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Calcium sulfate. 184.1230 Section 184.1230 Food... Specific Substances Affirmed as GRAS § 184.1230 Calcium sulfate. (a) Calcium sulfate (CaSO4, CAS Reg. No... gypsum, occurs naturally and exists as a fine, white to slightly yellow-white odorless powder....

  19. 21 CFR 582.5997 - Zinc sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Zinc sulfate. 582.5997 Section 582.5997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... 1 § 582.5997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions of use. This substance...

  20. 21 CFR 582.5997 - Zinc sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Zinc sulfate. 582.5997 Section 582.5997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... 1 § 582.5997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions of use. This substance...

  1. 21 CFR 582.5997 - Zinc sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Zinc sulfate. 582.5997 Section 582.5997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... 1 § 582.5997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions of use. This substance...

  2. 21 CFR 582.5997 - Zinc sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Zinc sulfate. 582.5997 Section 582.5997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... 1 § 582.5997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions of use. This substance...

  3. 21 CFR 582.5997 - Zinc sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Zinc sulfate. 582.5997 Section 582.5997 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... 1 § 582.5997 Zinc sulfate. (a) Product. Zinc sulfate. (b) Conditions of use. This substance...

  4. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  5. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  6. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  7. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  8. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DIRECT... GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS Reg. No. 7783-20-2)...

  9. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  10. 21 CFR 184.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Ammonium sulfate. 184.1143 Section 184.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Specific Substances Affirmed as GRAS § 184.1143 Ammonium sulfate. (a) Ammonium sulfate ((NH4)2SO4, CAS...

  11. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  12. 21 CFR 582.1143 - Ammonium sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammonium sulfate. 582.1143 Section 582.1143 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1143 Ammonium sulfate. (a) Product. Ammonium sulfate. (b) Conditions of use. This...

  13. 21 CFR 186.1797 - Sodium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Sodium sulfate. 186.1797 Section 186.1797 Food and... Substances Affirmed as GRAS § 186.1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6... crystalline powder. It is prepared by the neutralization of sulfuric acid with sodium hydroxide. (b)...

  14. 21 CFR 186.1797 - Sodium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Sodium sulfate. 186.1797 Section 186.1797 Food and... Substances Affirmed as GRAS § 186.1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6... crystalline powder. It is prepared by the neutralization of sulfuric acid with sodium hydroxide. (b)...

  15. 21 CFR 186.1797 - Sodium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Sodium sulfate. 186.1797 Section 186.1797 Food and... Substances Affirmed as GRAS § 186.1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6... crystalline powder. It is prepared by the neutralization of sulfuric acid with sodium hydroxide. (b)...

  16. 21 CFR 186.1797 - Sodium sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium sulfate. 186.1797 Section 186.1797 Food and... Substances Affirmed as GRAS § 186.1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6... crystalline powder. It is prepared by the neutralization of sulfuric acid with sodium hydroxide. (b)...

  17. 21 CFR 186.1797 - Sodium sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Sodium sulfate. 186.1797 Section 186.1797 Food and....1797 Sodium sulfate. (a) Sodium sulfate (Na2SO4, CAS Reg. No. 7757-82-6), also known as Glauber's salt... by the neutralization of sulfuric acid with sodium hydroxide. (b) The ingredient is used as...

  18. 21 CFR 184.1443 - Magnesium sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to...

  19. 21 CFR 184.1443 - Magnesium sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to...

  20. 21 CFR 184.1443 - Magnesium sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to...

  1. 21 CFR 184.1443 - Magnesium sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to...

  2. 21 CFR 582.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  3. 21 CFR 582.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  4. 21 CFR 182.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  5. 21 CFR 182.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Aluminum sulfate. 182.1125 Section 182.1125 Food... GENERALLY RECOGNIZED AS SAFE Multiple Purpose GRAS Food Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance is generally recognized as safe when used...

  6. 21 CFR 182.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  7. 21 CFR 582.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  8. 21 CFR 582.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  9. 21 CFR 182.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  10. 21 CFR 182.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  11. 21 CFR 582.1125 - Aluminum sulfate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This...

  12. Low-frequency Electrical Response to Microbial Induced Sulfide Precipitation

    SciTech Connect

    Ntarlagiannis, Dimitrios; Williams, Kenneth H.; Slater, Lee D.; Hubbard, Susan S.

    2005-11-19

    We investigated the sensitivity of low-frequency electrical measurements to microbeinduced metal sulfide precipitation. Three identical sand-packed monitoring columns were used; a geochemical column, an electrical column and a control column. In the first experiment, continuous upward flow of nutrients and metals in solution was established in each column. Cells of Desulfovibrio vulgaris (D. vulgaris) were injected into the center of the geochemical and electrical columns. Geochemical sampling and post-experiment destructive analysis showed that microbial induced sulfate reduction led to metal precipitation on bacteria cells, forming motile biominerals. Precipitation initially occurred in the injection zone, followed by chemotactic migration of D. vulgaris and ultimate accumulation around the nutrient source at the column base.

  13. Lead removal and toxicity reduction from industrial wastewater through biological sulfate reduction process.

    PubMed

    Teekayuttasakul, Paphungkorn; Annachhatre, Ajit P

    2008-10-01

    The practicability of lead removal from sulfate-rich wastewater through biological sulfate reduction process with hydrogen as electron donor was investigated. Sulfide, which was converted from sulfate by a sulfate-reducing bacteria (SRB) in a gas-lift reactor, was used to remove lead as lead sulfide precipitate. Furthermore, the toxicity of wastewater in terms of whole effluent toxicity (WET) before and after treatment was analyzed by using Microtox analyzer. The experiment was divided into three stages as follows: Stage I, startup and operation of sulfidogenic process fed with synthetic wastewater in a gas-lift reactor; Stage II, operation of sulfidogenic process fed with real wastewater in the same reactor and analysis of toxicity; and Stage III, separation of lead from wastewater. In stage I, the volumetric sulfate-sulfur loading rate was gradually increased from 1.0 g/L.d until no improvement of sulfide-sulfur production efficiency was evident at 2.58 g/L.d and maximum sulfide-sulfur concentration was set to 340 mg/L. In stage II, the results showed that the laboratory scale reactor could treat a real wastewater without inhibition or any remarkable problem. The produced sulfide-sulfur, 200 mg/L, was a little less in comparison with that of the previous stage. It could be due to the higher concentration of total dissolved solid (TDS). However, the sulfate concentration was still reduced by approximately 30%. The WET test by Microtox showed that toxicity was reduced more than 13 times. In stage III, the effluent from the reactor containing sulfide-sulfur of about 200 mg/L and lead-containing solution of 20 mg/L were fed with sulfide to lead ratio 3 moles: 1 mole into the precipitation chamber in which the optimum pH for lead sulfide precipitation of 8.0 was maintained. It was found that lead removal of 99% was attained.

  14. Efflorescence as a source of hydrated sulfate minerals in valley settings on Mars

    NASA Astrophysics Data System (ADS)

    Szynkiewicz, Anna; Borrok, David M.; Vaniman, David T.

    2014-05-01

    A distinctive sulfur cycle dominates many geological processes on Mars and hydrated sulfate minerals are found in numerous topographic settings with widespread occurrences on the Martian surface. However, many of the key processes controlling the hydrological transport of sulfur, including sulfur sources, climate and the depositional history that led to precipitation of these minerals, remain unclear. In this paper, we use a model for the formation of sulfate efflorescent salts (Mg-Ca-Na sulfates) in the Rio Puerco watershed of New Mexico, a terrestrial analog site from the semiarid Southwest U.S., to assess the origin and environmental conditions that may have controlled deposition of hydrated sulfates in Valles Marineris on Mars. Our terrestrial geochemical results (δS34 of -36.0 to +11.1‰) show that an ephemeral arid hydrological cycle that mobilizes sulfur present in the bedrock as sulfides, sulfate minerals, and dry/wet atmospheric deposition can lead to widespread surface accumulations of hydrated sulfate efflorescences. Repeating cycles of salt dissolution and reprecipitation appear to be major processes that migrate sulfate efflorescences to sites of surface deposition and ultimately increase the aqueous SO42- flux along the watershed (average 41,273 metric tons/yr). We suggest that similar shallow processes may explain the occurrence of hydrated sulfates detected on the scarps and valley floors of Valles Marineris on Mars. Our estimates of salt mass and distribution are in accord with studies that suggest a rather short-lived process of sulfate formation (minimum rough estimate ∼100 to 1000 years) and restriction by prevailing arid conditions on Mars.

  15. The Global Precipitation Mission

    NASA Technical Reports Server (NTRS)

    Braun, Scott; Kummerow, Christian

    2000-01-01

    The Global Precipitation Mission (GPM), expected to begin around 2006, is a follow-up to the Tropical Rainfall Measuring Mission (TRMM). Unlike TRMM, which primarily samples the tropics, GPM will sample both the tropics and mid-latitudes. The primary, or core, satellite will be a single, enhanced TRMM satellite that can quantify the 3-D spatial distributions of precipitation and its associated latent heat release. The core satellite will be complemented by a constellation of very small and inexpensive drones with passive microwave instruments that will sample the rainfall with sufficient frequency to be not only of climate interest, but also have local, short-term impacts by providing global rainfall coverage at approx. 3 h intervals. The data is expected to have substantial impact upon quantitative precipitation estimation/forecasting and data assimilation into global and mesoscale numerical models. Based upon previous studies of rainfall data assimilation, GPM is expected to lead to significant improvements in forecasts of extratropical and tropical cyclones. For example, GPM rainfall data can provide improved initialization of frontal systems over the Pacific and Atlantic Oceans. The purpose of this talk is to provide information about GPM to the USWRP (U.S. Weather Research Program) community and to discuss impacts on quantitative precipitation estimation/forecasting and data assimilation.

  16. Total Precipitable Water

    SciTech Connect

    2012-01-01

    The simulation was performed on 64K cores of Intrepid, running at 0.25 simulated-years-per-day and taking 25 million core-hours. This is the first simulation using both the CAM5 physics and the highly scalable spectral element dynamical core. The animation of Total Precipitable Water clearly shows hurricanes developing in the Atlantic and Pacific.

  17. Crystallization of Chicken Egg White Lysozyme from Assorted Sulfate Salts

    NASA Technical Reports Server (NTRS)

    Forsythe, Elizabeth L.; Snell, Edward H.; Malone, Christine C.; Pusey, Marc L.

    1998-01-01

    Chicken egg white lysozyme has been found to crystallize from ammonium, sodium, potassium, rubidium, magnesium, and manganese sulfates at acidic and basic pH, with protein concentrations from 60 to 190 mg/ml. Four different crystal morphologies have been obtained, depending upon the temperature, protein concentration, and precipitating salt employed, Crystals grown at 15 C were generally tetragonal, with space group P43212. Crystallization at 20 C typically resulted in the formation of orthorhombic crystals, space group P21212 1. The tetragonal much less than orthorhombic morphology transition appeared to be a function of both the temperature and protein concentration, occurring between 15 and 20 C and between 100 and 125 mg/ml protein concentration. Crystallization from 0.8 -1.2M magnesium sulfate at pH 7.6 - 8.0 gave a hexagonal (trigonal) crystal form, space group P3121, which diffracted to 2.8 A. Ammonium sulfate was also found to result in a monoclinic form, space group C2. Small twinned monoclinic crystals of approx. 0.2 mm on edge were grown by dialysis followed by seeded sitting drop crystallization.

  18. Conversion of alkali metal sulfate to the carbonate

    DOEpatents

    Sheth, A.C.

    1979-10-01

    A process is described for converting potassium sulfate to potassium carbonate in which a mixture of potassium sulfate and calcium oxide are reacted at a temperature in the range of between about 700/sup 0/C and about 800/sup 0/C with a gaseous mixture having a minor amount of hydrogen and/or carbon monoxide in a diluent with the calcium oxide being present in an amount not greater than about 20 percent by weight of the potassium sulfate to produce an aqueous mixture of potassium sulfide, potassium bisulfide, potassium hydroxide and calcium sulfide and a gaseous mixture of steam and hydrogen sulfide. The potassium and calcium salts are quenched to produce an aqueous slurry of soluble potassium salts and insoluble calcium salts and a gaseous mixture of steam and hydrogen sulfide. The insoluble calcium salts are then separated from the aqueous solution of soluble potassium salts. The calcium salts are dried to produce calcium sulfide, calcium bisulfide and steam, and then, the calcium sulfide and calcium bisulfide are converted to the oxide and recycled. The soluble potassium salts are carbonated to produce potassium carbonate which is concentrated and the precipitated crystals separated. the sulfur-containing compounds are further treated. This process was developed for desulfurization and reprocessing of spent seed from open-cycle coal-fired MHD generators for reuse.

  19. Conversion of alkali metal sulfate to the carbonate

    DOEpatents

    Sheth, Atul C.

    1982-01-01

    A process for converting potassium sulfate to potassium carbonate in which a mixture of potassium sulfate and calcium oxide are reacted at a temperature in the range of between about 700.degree. C. and about 800.degree. C. with a gaseous mixture having a minor amount of hydrogen and/or carbon monoxide in a diluent with the calcium oxide being present in an amount not greater than about 20 percent by weight of the potassium sulfate to produce an aqueous mixture of potassium sulfide, potassium bisulfide, potassium hydroxide and calcium sulfide and a gaseous mixture of steam and hydrogen sulfide. The potassium and calcium salts are quenched to produce an aqueous slurry of soluble potassium salts and insoluble calcium salts and a gaseous mixture of steam and hydrogen sulfide. The insoluble calcium salts are then separated from the aqueous solution of soluble potassium salts. The calcium salts are dried to produce calcium sulfide, calcium bisulfide and steam, and then, the calcium sulfide and calcium bisulfide are converted to the oxide and recycled. The soluble potassium salts are carbonated to produce potassium carbonate which is concentrated and the precipitated crystals separated. The sulfur-containing compounds are further treated.

  20. METHOD OF FORMING PLUTONIUM-BEARING CARRIER PRECIPITATES AND WASHING SAME

    DOEpatents

    Faris, B.F.

    1959-02-24

    An improvement of the lanthanum fluoride carrier precipitation process for the recovery of plutonium is presented. In this process the plutonium is first segregated in the LaF/su precipitate and this precipitate is later dissolved and the plutonium reprecipitated as the peroxide. It has been found that the loss of plutonium by its remaining in the supernatant liquid associated with the peroxide precipitate is greatly reduced if, before dissolution, the LaF/ sub 3/ precipitate is subjected to a novel washing step which constitutes the improvement of this patent. The step consists in intimately contactifng the LaF/ sub 3/ precipitate with a 4 to 10 percent solution of sodium hydrogen sulfate at a temperature between 10 and 95 deg C for 1/2 to 3 hours.