Sample records for beta sheet formation

  1. Slow formation of aggregation-resistant beta-sheet folding intermediates.


    Junker, Mirco; Clark, Patricia L


    Protein folding has been studied extensively for decades, yet our ability to predict how proteins reach their native state from a mechanistic perspective is still rudimentary at best, limiting our understanding of folding-related processes in vivo and our ability to manipulate proteins in vitro. Here, we investigate the in vitro refolding mechanism of a large beta-helix protein, pertactin, which has an extended, elongated shape. At 55 kDa, this single domain, all-beta-sheet protein allows detailed analysis of the formation of beta-sheet structure in larger proteins. Using a combination of fluorescence and far-UV circular dichroism spectroscopy, we show that the pertactin beta-helix refolds remarkably slowly, with multiexponential kinetics. Surprisingly, despite the slow refolding rates, large size, and beta-sheet-rich topology, pertactin refolding is reversible and not complicated by off-pathway aggregation. The slow pertactin refolding rate is not limited by proline isomerization, and 30% of secondary structure formation occurs within the rate-limiting step. Furthermore, site-specific labeling experiments indicate that the beta-helix refolds in a multistep but concerted process involving the entire protein, rather than via initial formation of the stable core substructure observed in equilibrium titrations. Hence pertactin provides a valuable system for studying the refolding properties of larger, beta-sheet-rich proteins, and raises intriguing questions regarding the prevention of aggregation during the prolonged population of partially folded, beta-sheet-rich refolding intermediates. Proteins 2010. (c) 2009 Wiley-Liss, Inc. PMID:19847915

  2. Conformational diversity in prion protein variants influences intermolecular [beta]-sheet formation

    SciTech Connect

    Lee, Seungjoo; Antony, Lizamma; Hartmann, Rune; Knaus, Karen J.; Surewicz, Krystyna; Surewicz, Witold K.; Yee, Vivien C.


    A conformational transition of normal cellular prion protein (PrP{sup C}) to its pathogenic form (PrP{sup Sc}) is believed to be a central event in the transmission of the devastating neurological diseases known as spongiform encephalopathies. The common methionine/valine polymorphism at residue 129 in the PrP influences disease susceptibility and phenotype. We report here seven crystal structures of human PrP variants: three of wild-type (WT) PrP containing V129, and four of the familial variants D178N and F198S, containing either M129 or V129. Comparison of these structures with each other and with previously published WT PrP structures containing M129 revealed that only WT PrPs were found to crystallize as domain-swapped dimers or closed monomers; the four mutant PrPs crystallized as non-swapped dimers. Three of the four mutant PrPs aligned to form intermolecular {beta}-sheets. Several regions of structural variability were identified, and analysis of their conformations provides an explanation for the structural features, which can influence the formation and conformation of intermolecular {beta}-sheets involving the M/V129 polymorphic residue.

  3. Conversion of alpha-helices into beta-sheets features in the formation of the scrapie prion proteins.

    PubMed Central

    Pan, K M; Baldwin, M; Nguyen, J; Gasset, M; Serban, A; Groth, D; Mehlhorn, I; Huang, Z; Fletterick, R J; Cohen, F E


    Prions are composed largely, if not entirely, of prion protein (PrPSc in the case of scrapie). Although the formation of PrPSc from the cellular prion protein (PrPC) is a post-translational process, no candidate chemical modification was identified, suggesting that a conformational change features in PrPSc synthesis. To assess this possibility, we purified both PrPC and PrPSc by using nondenaturing procedures and determined the secondary structure of each. Fourier-transform infrared (FTIR) spectroscopy demonstrated that PrPC has a high alpha-helix content (42%) and no beta-sheet (3%), findings that were confirmed by circular dichroism measurements. In contrast, the beta-sheet content of PrPSc was 43% and the alpha-helix 30% as measured by FTIR. As determined in earlier studies, N-terminally truncated PrPSc derived by limited proteolysis, designated PrP 27-30, has an even higher beta-sheet content (54%) and a lower alpha-helix content (21%). Neither PrPC nor PrPSc formed aggregates detectable by electron microscopy, while PrP 27-30 polymerized into rod-shaped amyloids. While the foregoing findings argue that the conversion of alpha-helices into beta-sheets underlies the formation of PrPSc, we cannot eliminate the possibility that an undetected chemical modification of a small fraction of PrPSc initiates this process. Since PrPSc seems to be the only component of the "infectious" prion particle, it is likely that this conformational transition is a fundamental event in the propagation of prions. Images Fig. 1 Fig. 4 PMID:7902575

  4. Liquid Crystal Based Sensor to Detect Beta-Sheet Formation of Peptides

    NASA Astrophysics Data System (ADS)

    Sadati, Monirosadat; Izmitli Apik, Aslin; Abbott, Nicholas L.; de Pablo, Juan J.


    Protein aggregation into amyloid fibrils is involved in the progression of Alzheimer's, typeII diabetes and Huntington's diseases. Although larger aggregates remain important for clinical determination, small oligomers are of great interest due to their potentially toxic nature. It is therefore crucial to develop methods that probe the aggregation process at early stages and in the vicinity of biological membranes. Here, we present a simple method that relies on liquid crystalline materials and a Langmuir monolayer at the aqueous-liquid crystal (LC) interface. The approach is based on the LC's specific response to β-sheet structures, which abound in amyloid fibrils. When the system is observed under polarized light, the fibrils formed by amyloidogenic peptides give rise to the formation of elongated and branched structures in the LCs. Moreover, the PolScope measurements prove that the LCs are predominantly aligned along the fibrils when exposed to a β-sheet forming peptide. In contrast, non-amyloidogenic peptides form ellipsoidal domains of irregularly tilted LCs. This method is capable of reporting aggregation at lipid-aqueous interfaces at nanomolar concentrations of the peptide, and much earlier than commonly used fluorescence-based techniques. We thank Prof. Oleg D. Levrentovich and Young-Ki Kim from the Liquid Crystal Institute of Kent State University for the use of their PolScope instrument. This work was partially supported by the Swiss National Science Foundation (P300P2_151342).

  5. Specific collapse followed by slow hydrogen-bond formation of beta-sheet in the folding of single-chain monellin.


    Kimura, Tetsunari; Uzawa, Takanori; Ishimori, Koichiro; Morishima, Isao; Takahashi, Satoshi; Konno, Takashi; Akiyama, Shuji; Fujisawa, Tetsuro


    Characterization of the conformational landscapes for proteins with different secondary structures is important in elucidating the mechanism of protein folding. The folding trajectory of single-chain monellin composed of a five-stranded beta-sheet and a helix was investigated by using a pH-jump from the alkaline unfolded to native state. The kinetic changes in the secondary structures and in the overall size and shape were measured by circular dichroism spectroscopy and small-angle x-ray scattering, respectively. The formation of the tertiary structure was monitored by intrinsic and extrinsic fluorescence. A significant collapse was observed within 300 micros after the pH-jump, leading to the intermediate with a small amount of secondary and tertiary structures but with an overall oblate shape. Subsequently, the stepwise formation of secondary and tertiary structures was detected. The current observation was consistent with the theoretical prediction that a more significant collapse precedes the formation of secondary structures in the folding of beta-sheet proteins than that of helical proteins [Shea, J. E., Onuchic, J. N. & Brooks, C. L., III (2002) Proc. Natl. Acad. Sci. USA 99, 16064-16068]. Furthermore, it was implied that the initial collapse was promoted by the formation of some specific structural elements, such as tight turns, to form the oblate shape. PMID:15710881

  6. Formation of intermolecular beta-sheet structures: a phenomenon relevant to protein film structure at oil-water interfaces of emulsions.


    Lefèvre, Thierry; Subirade, Muriel


    Oil-in-water emulsions stabilized with beta-lactoglobulin (beta-lg) were made using a homogenizer or a high-speed blender. The protein was studied by Fourier transform infrared (FTIR) spectroscopy in the raw emulsion, in the bulk phase, and at the interface, as a function of pH, oil content, and homogenizing pressure. Results show that the amount of adsorbed protein varies with the available interfacial area. The protein that remains in the aqueous phase exhibit no spectral change, which suggests that homogenization causes no conformational modification or reversible ones. Strong and irreversible changes were observed in the adsorbed protein. Our findings reveal the formation of intermolecular antiparallel beta-sheets upon adsorption due to the protein self-aggregation. As deduced from transmission electronic microscopy, this surface aggregation leads to the formation of continuous and homogeneous membranes coating the globules. The structure of the adsorbed proteins is unaffected by the homogenizing pressures used in our study and slightly modified by the pH. FTIR spectroscopy allows to characterize the type of aggregates formed at the interface. An analysis of the spectra of beta-lg heat-induced gels shows that the aggregates at the interface are very close at a molecular scale to those that constitute particulate gels near the protein's isoelectric point. Since the type of aggregates is similar when the emulsion water phase is pure D(2)O and D(2)O at pD 4.4, the interface not only seems to induce aggregation, but seems to determine the type of aggregation as well. The mechanism that drives the formation of particulate aggregates (rather than fine-stranded ones) may reside in strong protein-protein interactions that are promoted by adverse oil-protein interactions. PMID:12804885

  7. The Promiscuity of [beta]-Strand Pairing Allows for Rational Design of [beta]-Sheet Face Inversion

    SciTech Connect

    Makabe, Koki; Koide, Shohei


    Recent studies suggest the dominant role of main-chain H-bond formation in specifying {beta}-sheet topology. Its essentially sequence-independent nature implies a large degree of freedom in designing {beta}-sheet-based nanomaterials. Here we show rational design of {beta}-sheet face inversions by incremental deletions of {beta}-strands from the single-layer {beta}-sheet of Borrelia outer surface protein A. We show that a {beta}-sheet structure can be maintained when a large number of native contacts are removed and that one can design large-scale conformational transitions of a {beta}-sheet such as face inversion by exploiting the promiscuity of strand-strand interactions. High-resolution X-ray crystal structures confirmed the success of the design and supported the importance of main-chain H-bonds in determining {beta}-sheet topology. This work suggests a simple but effective strategy for designing and controlling nanomaterials based on {beta}-rich peptide self-assemblies.

  8. Amyloid Beta Mediates Memory Formation

    ERIC Educational Resources Information Center

    Garcia-Osta, Ana; Alberini, Cristina M.


    The amyloid precursor protein (APP) undergoes sequential cleavages to generate various polypeptides, including the amyloid [beta] (1-42) peptide (A[beta][1-42]), which is believed to play a major role in amyloid plaque formation in Alzheimer's disease (AD). Here we provide evidence that, in contrast with its pathological role when accumulated,…

  9. Structural principles for the propeller assembly of beta-sheets: the preference for seven-fold symmetry.


    Murzin, A G


    Twisted beta-sheets, packed face to face, may be arranged in circular formation like blades of a propeller or turbine. This beta-propeller fold has been found in three proteins: that in neuraminidase consists of six beta-sheets while those in methylamine dehydrogenase and galactose oxidase are composed of seven beta-sheets. A model for multisheet packing in the beta-propeller fold is proposed. This model gives both geometrical parameters of the beta-propellers composed of different numbers of sheets and patterns of residue packing at their sheet-to-sheet interfaces. All the known beta-propeller structures have been analyzed, and the observed geometries and residue packing are found to be in good agreement with those predicted by models. It is shown that unusual seven-fold symmetry is preferable to six- or eight-fold symmetry for propeller-like multi-sheet assembly. According to the model, a six-beta-sheet propeller has to have predominantly small residues in the beta-strands closed to its six-fold axis, but no strong sequence constraints are necessary for a seven-fold beta-propeller. PMID:1409568

  10. Current Sheet Formation and Reconnection at a Magnetic X Line

    NASA Astrophysics Data System (ADS)

    DeVore, C. Richard; Antiochos, S. K.


    Phenomena ranging from the quiescent heating of the ambient plasma to the highly explosive release of energy and acceleration of particles in flares are conjectured to result from magnetic reconnection at electric current sheets in the Sun's corona. We are investigating numerically the formation and eventual reconnection of a current sheet in an initially potential 2D magnetic field containing a null. Subjecting this simple configuration to unequal stresses in the four quadrants bounded by the X-line separatrix distorts the potential null into a double-Y-line current sheet. Although the gas pressure is finite in our simulations, so that the plasma beta is infinite at the null, we find that even small distortions of the magnetic field induce the formation of a tangential discontinuity there. This result is well known to occur in the zero-beta, force-free limit; surprisingly, it persists into the high-beta regime where, in principle, a small plasma pressure inhomogeneity could balance all of the magnetic stress. In addition to working to understand the dynamical details of this ideal process, we are examining the effect of resistive dissipation on the development of the current sheet and are seeking to determine the critical condition for fast-reconnection onset in the sheet. Our progress on understanding these issues, and the implications for the dynamic activity associated with current sheets in the solar corona, will be reported at the conference. We gratefully acknowledge NASA sponsorship of our research.

  11. Beating the Heat - Fast Scanning Melts Silk Beta Sheet Crystals

    PubMed Central

    Cebe, Peggy; Hu, Xiao; Kaplan, David L.; Zhuravlev, Evgeny; Wurm, Andreas; Arbeiter, Daniela; Schick, Christoph


    Beta-pleated-sheet crystals are among the most stable of protein secondary structures, and are responsible for the remarkable physical properties of many fibrous proteins, such as silk, or proteins forming plaques as in Alzheimer's disease. Previous thinking, and the accepted paradigm, was that beta-pleated-sheet crystals in the dry solid state were so stable they would not melt upon input of heat energy alone. Here we overturn that assumption and demonstrate that beta-pleated-sheet crystals melt directly from the solid state to become random coils, helices, and turns. We use fast scanning chip calorimetry at 2,000 K/s and report the first reversible thermal melting of protein beta-pleated-sheet crystals, exemplified by silk fibroin. The similarity between thermal melting behavior of lamellar crystals of synthetic polymers and beta-pleated-sheet crystals is confirmed. Significance for controlling beta-pleated-sheet content during thermal processing of biomaterials, as well as towards disease therapies, is envisioned based on these new findings. PMID:23350037

  12. Structure and dynamics of parallel beta-sheets, hydrophobic core, and loops in Alzheimer's A beta fibrils.


    Buchete, Nicolae-Viorel; Hummer, Gerhard


    We explore the relative contributions of different structural elements to the stability of Abeta fibrils by molecular-dynamics simulations performed over a broad range of temperatures (298 K to 398 K). Our fibril structures are based on solid-state nuclear magnetic resonance experiments of Abeta(1-40) peptides, with sheets of parallel beta-strands connected by loops and stabilized by interior salt bridges. We consider models with different interpeptide interfaces, and different staggering of the N- and C-terminal beta-strands along the fibril axis. Multiple 10-20 ns molecular-dynamics simulations show that fibril segments with 12 peptides are stable at ambient temperature. The different models converge toward an interdigitated side-chain packing, and present water channels solvating the interior D23/K28 salt bridges. At elevated temperatures, we observe the early phases of fibril dissociation as a loss of order in the hydrophilic loops connecting the two beta-strands, and in the solvent-exposed N-terminal beta-sheets. As the most dramatic structural change, we observe collective sliding of the N- and C-terminal beta-sheets on top of each other. The interior C-terminal beta-sheets in the hydrophobic core remain largely intact, indicating that their formation and stability is crucial to the dissociation/elongation and stability of Abeta fibrils. PMID:17293399

  13. Beating the Heat: Fast Scanning Melts Beta Sheet Crystals

    NASA Astrophysics Data System (ADS)

    Cebe, Peggy; Hu, Xiao; Kaplan, David; Zhuravlev, Evgeny; Wurm, Andreas; Arbeiter, Daniella; Schick, Christoph


    Beta-pleated-sheet crystals are among the most stable of protein secondary structures, and are responsible for the remarkable physical properties of many fibrous proteins, such as silk. Previous thinking was that beta-pleated-sheet crystals in the dry solid state would not melt upon input of heat energy alone. Indeed, at conventional heating rates (~1-50 °C/min), silk exhibits its glass transition (~175 °C), followed by cold crystallization, and then by immediate thermal degradation beginning at about 225 °C. Here we demonstrate that beta-pleated-sheet crystals can melt directly from the solid state to become random coils, helices, and turns. We use fast scanning chip calorimetry at 2,000 K/s to avoid thermal degradation, and report the first reversible thermal melting of protein beta-pleated-sheet crystals, exemplified by silk fibroin. The similarity between thermal melting behavior of lamellar crystals of synthetic polymers and beta-pleated-sheet crystals is confirmed. The authors acknowledge support from the National Science Foundation and German Academic Exchange Service DAAD; EZ acknowledges a European Union funded Marie Curie EST fellowship (ADVATEC); XH and DK acknowledge NIH P41 Tissue Engineering Resource Center.

  14. Enhancement of beta-sheet assembly by cooperative hydrogen bonds potential

    PubMed Central

    Levy-Moonshine, Ami; Amir, El-ad David; Keasar, Chen


    Motivation: The roughness of energy landscapes is a major obstacle to protein structure prediction, since it forces conformational searches to spend much time struggling to escape numerous traps. Specifically, beta-sheet formation is prone to stray, since many possible combinations of hydrogen bonds are dead ends in terms of beta-sheet assembly. It has been shown that cooperative terms for backbone hydrogen bonds ease this problem by augmenting hydrogen bond patterns that are consistent with beta sheets. Here, we present a novel cooperative hydrogen-bond term that is both effective in promoting beta sheets and computationally efficient. In addition, the new term is differentiable and operates on all-atom protein models. Results: Energy optimization of poly-alanine chains under the new term led to significantly more beta-sheet content than optimization under a non-cooperative term. Furthermore, the optimized structure included very few non-native patterns. Availability: The new term is implemented within the MESHI package and is freely available at∼meshi. Contact: Supplementary information: Supplementary data are available at Bioinformatics online. PMID:19628506

  15. Continuum Theory of Beta-Sheet Ribbons.

    NASA Astrophysics Data System (ADS)

    Ghafouri, Rouzbeh


    We present a continuum description for the β-sheet ribbons encountered in amyloid fibrils, allowing both stretching and bending of the ribbon in response to chiral twist. The theory leads to a non-linear variant of the Worm-Like Chain (WLC). At a critical value of the ratio of the bending and stretching moduli, the Foppl-von K'arm'an Number, we encounter a continuous buckling transition from a straight Helicoid to a Spiral Ribbon. Two of the three persistence lengths of the ribbon become very short at the transition point indicating strong thermal shape fluctuations. The transition becomes discontinuous if the ribbon width is treated as a free thermodynamic variable.

  16. Laminated, Nontwisting Beta-Sheet Fibrils Constructed via Peptide Self-Assembly

    NASA Astrophysics Data System (ADS)

    Lamm, Matthew S.; Rajagopal, Karthikan; Schneider, Joel P.; Pochan, Darrin J.


    A de novo designed peptide has been characterized that self-assembles into beta-sheet fibrils exhibiting a nontwisted, laminated morphology. The laminated morphology is constituted by 2.5nm wide filaments that laterally associate to form flat fibril laminates exceeding 100nm in width and microns in length. The height of each fibril is determined by the length of exactly one peptide momomer in an extended beta-strand conformation, approximately 7nm. Once formed, these fibrils are highly stable over a range of temperatures and pH and exhibit characteristics similar to those of amyloid fibrils. Kinetic parameters of pH and temperature can be used to affect the rate of beta-sheet formation and, consequently, the degree of lamination. Finally, the importance of peptide sequence on the resultant fibril morphology is demonstrated via rational peptide design and discussed in the context of current theories of fibril twisting.

  17. Evidence for Novel [beta]-Sheet Structures in Iowa Mutant [beta]-Amyloid Fibrils

    SciTech Connect

    Tycko, Robert; Sciarretta, Kimberly L.; Orgel, Joseph P.R.O.; Meredith, Stephen C.


    Asp23-to-Asn mutation within the coding sequence of {beta}-amyloid, called the Iowa mutation, is associated with early onset, familial Alzheimer's disease and cerebral amyloid angiopathy, in which patients develop neuritic plaques and massive vascular deposition predominantly of the mutant peptide. We examined the mutant peptide, D23N-A{beta}40, by electron microscopy, X-ray diffraction, and solid-state NMR spectroscopy. D23N-A{beta}40 forms fibrils considerably faster than the wild-type peptide (k = 3.77 x 10{sup -3} min{sup -1} and 1.07 x 10{sup -4} min{sup -1} for D23N-A{beta}40 and the wild-type peptide WT-A{beta}40, respectively) and without a lag phase. Electron microscopy shows that D23N-A{beta}40 forms fibrils with multiple morphologies. X-ray fiber diffraction shows a cross-{beta} pattern, with a sharp reflection at 4.7 {angstrom} and a broad reflection at 9.4 {angstrom}, which is notably smaller than the value for WT-A{beta}40 fibrils (10.4 {angstrom}). Solid-state NMR measurements indicate molecular level polymorphism of the fibrils, with only a minority of D23N-A{beta}40 fibrils containing the in-register, parallel {beta}-sheet structure commonly found in WT-A{beta}40 fibrils and most other amyloid fibrils. Antiparallel {beta}-sheet structures in the majority of fibrils are indicated by measurements of intermolecular distances through 13C-13C and 15N-13C dipole-dipole couplings. An intriguing possibility exists that there is a relationship between the aberrant structure of D23N-A{beta}40 fibrils and the unusual vasculotropic clinical picture in these patients.

  18. Current Sheet Formation and Reconnection Dynamics in the Solar Corona

    NASA Astrophysics Data System (ADS)

    Edmondson, Justin K.; Antiochos, S. K.; DeVore, C.; Zurbuchen, T. H.


    Current sheet formation is a necessary consequence of the evolution of the multi-polar magnetic field topologies that are ubiquitous throughout the solar corona. We present a very high-resolution study of 3D MHD current sheet formation and the resulting reconnection dynamics in an environment appropriate for the corona. The initial field consists of a translationally invariant, potential field with a null-point topology (i.e., 4-flux systems) and a low-beta plasma. A finite-extent, 3D Syrovatskii-type current sheet forms as a result of stressing of this system by a uniform, incompressible flow applied at the line-tied photospheric boundary. The system is assumed to be ideal, except for the presence of numerical resistivity. The fully 3-D evolution is calculated with very high resolution (9x and 10x refinement across the full extent of the current sheet) using the Adaptively Refined MHD Solver (ARMS). The initial evolution of this computationally-intensive simulation results in a current sheet with a nearly 30-to-1 aspect ratio, a significant fraction of the system characteristic length, that unexpectedly appears to be stable. In addition, up to this point in the evolution any magnetic reconnection that we observe is of the slow Sweet-Parker type. We expect, however, that as we continue stressing the field, the current sheet will become unstable and develop explosive dynamics. We discuss the implications of our results on coronal structure and activity, such as heating and eruptions. This work has been supported, in part, by the NASA HTP and SR&T programs.

  19. Infrared spectroscopy of pyrrole-2-carboxaldehyde and its dimer: a planar beta-sheet peptide model?


    Rice, Corey A; Dauster, Ingo; Suhm, Martin A


    Intermolecular interactions relevant for antiparallel beta-sheet formation between peptide strands are studied by Fourier transform infrared spectroscopy of the low temperature, vacuum-isolated model compound pyrrole-2-carboxaldehyde and its dimer in the N-H and C=O stretching range. Comparison to quantum chemical predictions shows that even for some triple-zeta quality basis sets, hybrid density functionals and Møller-Plesset perturbation calculations fail to provide a consistent and fully satisfactory description of hydrogen bond induced frequency shifts and intensity ratios in the double-harmonic approximation. The latter approach even shows problems in reproducing the planar structure of the dimer and the correct sign of the C=O stretching shift for standard basis sets. The effect of matrix isolation is modeled by condensing layers of Ar atoms on the isolated monomer and dimer. The dimer structure is discussed in the context of the peptide beta-sheet motif. PMID:17430038

  20. Role of Polyalanine Domains in -Sheet Formation in Spider Silk Block Copolymers

    SciTech Connect

    Rabotyagova, O.; Cebe, P; Kaplan, D


    Genetically engineered spider silk-like block copolymers were studied to determine the influence of polyalanine domain size on secondary structure. The role of polyalanine block distribution on {beta}-sheet formation was explored using FT-IR and WAXS. The number of polyalanine blocks had a direct effect on the formation of crystalline {beta}-sheets, reflected in the change in crystallinity index as the blocks of polyalanines increased. WAXS analysis confirmed the crystalline nature of the sample with the largest number of polyalanine blocks. This approach provides a platform for further exploration of the role of specific amino acid chemistries in regulating the assembly of {beta}-sheet secondary structures, leading to options to regulate material properties through manipulation of this key component in spider silks.

  1. Formation of Sprays From Conical Liquid Sheets

    NASA Technical Reports Server (NTRS)

    Peck, Bill; Mansour, N. N.; Koga, Dennis (Technical Monitor)


    Our objective is to predict droplet size distributions created by fuel injector nozzles in Jet turbines. These results will be used to determine the initial conditions for numerical simulations of the combustion process in gas turbine combustors. To predict the droplet size distribution, we are currently constructing a numerical model to understand the instability and breakup of thin conical liquid sheets. This geometry serves as a simplified model of the liquid jet emerging from a real nozzle. The physics of this process is difficult to study experimentally as the time and length scales are very short. From existing photographic data, it does seem clear that three-dimensional effects such as the formation of streamwise ligaments and the pulling back of the sheet at its edges under the action of surface tension are important.

  2. Folding dynamics of a family of beta-sheet proteins

    NASA Astrophysics Data System (ADS)

    Rousseau, Denis


    Fatty acid binding proteins (FABP) consist of ten anti-parallel beta strands and two small alpha helices. The beta strands are arranged into two nearly orthogonal five-strand beta sheets that surround the interior cavity, which binds unsaturated long-chain fatty acids. In the brain isoform (BFABP), these are very important for the development of the central nervous system and neuron differentiation. Furthermore, BFABP is implicated in the pathogenesis of a variety of human diseases including cancer and neuronal degenerative disorders. In this work, site-directed spin labeling combined with EPR techniques have been used to study the folding mechanism of BFABP. In the first series of studies, we labeled the two Cys residues at position 5 and 80 in the wild type protein with an EPR spin marker; in addition, two singly labeled mutants at positions 5 and 80 in the C80A and C5A mutants, respectively, were also produced and used as controls. The changes in the distances between the two residues were examined by a pulsed EPR method, DEER (Double Electron Electron Resonance), as a function of guanidinium hydrochloride concentration. The results were compared with those from CW EPR, circular dichroism and fluorescence measurements, which provide the information regarding sidechain mobility, secondary structure and tertiary structure, respectively. The results will be discussed in the context of the folding mechanism of the family of fatty acid binding proteins.

  3. A recipe for designing water-soluble, beta-sheet-forming peptides.

    PubMed Central

    Mayo, K. H.; Ilyina, E.; Park, H.


    Based on observations of solubility and folding properties of peptide 33-mers derived from the beta-sheet domains of platelet factor-4 (PF4), interleukin-8 (IL-8), and growth related protein (Gro-alpha), as well as other beta-sheet-forming peptides, general guidelines have been developed to aid in the design of water soluble, self-association-induced beta-sheet-forming peptides. CD, 1H-NMR, and pulsed field gradient NMR self-diffusion measurements have been used to assess the degree of folding and state of aggregation. PF4 peptide forms native-like beta-sheet tetramers and is sparingly soluble above pH 6. IL-8 peptide is insoluble between pH 4.5 and pH 7.5, yet forms stable, native-like beta-sheet dimers at higher pH. Gro-alpha peptide is soluble at all pH values, yet displays no discernable beta-sheet structure even when diffusion data indicate dimer-tetramer aggregation. A recipe used in the de novo design of water-soluble beta-sheet-forming peptides calls for the peptide to contain 40-50% hydrophobic residues, usually aliphatic ones (I, L, V, A, M) (appropriately paired and mostly but not always alternating with polar residues in the sheet sequence), a positively charged (K, R) to negatively charged (E, D) residue ratio between 4/2 and 6/2, and a noncharged polar residue (N, Q, T, S) composition of about 20% or less. Results on four de novo designed, 33-residue peptides are presented supporting this approach. Under near physiologic conditions, all four peptides are soluble, form beta-sheet structures to varying degrees, and self-associate. One peptide folds as a stable, compact beta-sheet tetramer, whereas the others are transient beta-sheet-containing aggregates. PMID:8819163

  4. Diffraction from the beta-sheet crystallites in spider silk.


    Ulrich, S; Glišović, A; Salditt, T; Zippelius, A


    We analyze the wide-angle X-ray scattering from oriented spider silk fibers in terms of a quantitative scattering model, including both structural and statistical parameters of the beta-sheet crystallites of spider silk in the amorphous matrix. The model is based on kinematic scattering theory and allows for rather general correlations of the positional and orientational degrees of freedom, including the crystallite's size, composition and dimension of the unit cell. The model is evaluated numerically and compared to experimental scattering intensities allowing us to extract the geometric and statistical parameters. We show explicitly that for the experimentally found mosaicity (width of the orientational distribution) intercrystallite effects are negligible and the data can be analyzed in terms of single-crystallite scattering, as is usually assumed in the literature. PMID:18843512

  5. Precise assembly of complex beta sheet topologies from de novo designed building blocks

    PubMed Central

    King, Indigo Chris; Gleixner, James; Doyle, Lindsey; Kuzin, Alexandre; Hunt, John F; Xiao, Rong; Montelione, Gaetano T; Stoddard, Barry L; DiMaio, Frank; Baker, David


    Design of complex alpha-beta protein topologies poses a challenge because of the large number of alternative packing arrangements. A similar challenge presumably limited the emergence of large and complex protein topologies in evolution. Here, we demonstrate that protein topologies with six and seven-stranded beta sheets can be designed by insertion of one de novo designed beta sheet containing protein into another such that the two beta sheets are merged to form a single extended sheet, followed by amino acid sequence optimization at the newly formed strand-strand, strand-helix, and helix-helix interfaces. Crystal structures of two such designs closely match the computational design models. Searches for similar structures in the SCOP protein domain database yield only weak matches with different beta sheet connectivities. A similar beta sheet fusion mechanism may have contributed to the emergence of complex beta sheets during natural protein evolution. DOI: PMID:26650357

  6. Propagating structure of alzheimer's {beta}-amyloid is parallel {beta}-sheet with residues in exact register.

    SciTech Connect

    Benzinger, T. L. S.; Gregory, D. M.; Burkoth, T. S.; Miller-Auer, H.; Lynn, D. G.; Botto, R. E.; Meredith, S. C.; Chemistry; Univ. of Chicago


    The pathognomonic plaques of Alzheimer's disease are composed primarily of the 39- to 43-aa {beta}-amyloid (A{beta}) peptide. Crosslinking of A{beta} peptides by tissue transglutaminase (tTg) indicates that Gln15 of one peptide is proximate to Lys16 of another in aggregated A{beta}. Here we report how the fibril structure is resolved by mapping interstrand distances in this core region of the A{beta} peptide chain with solid-state NMR. Isotopic substitution provides the source points for measuring distances in aggregated A{beta}. Peptides containing a single carbonyl 13C label at Gln15, Lys16, Leu17, or Val18 were synthesized and evaluated by NMR dipolar recoupling methods for the measurement of interpeptide distances to a resolution of 0.2 Angstrom. Analysis of these data establish that this central core of A{beta} consists of a parallel {beta}-sheet structure in which identical residues on adjacent chains are aligned directly, i.e., in register. Our data, in conjunction with existing structural data, establish that the A{beta} fibril is a hydrogen-bonded, parallel {beta}-sheet defining the long axis of the A{beta} fibril propagation.

  7. Formation and separation of merged liquid sheets developed from the mixing of coaxial swirling liquid sheets

    NASA Astrophysics Data System (ADS)

    Sivakumar, D.; Raghunandan, B. N.


    Liquid-liquid coaxial swirl atomizers are used in liquid rocket engines to achieve an efficient mixing between the fuel and oxidizer sprays. The characteristics of the mixed spray are mainly controlled by the flow behavior of merged liquid sheet originating at the contact point of inner and outer swirling liquid sheets. With an intention of identifying various flow regimes of merged liquid sheet at different conditions of inner and outer liquid sheets, we report here a fundamental experimental investigation on the characteristics of merged liquid sheets using water as the experimental liquid. The physical processes involved in the formation and separation of a merged liquid sheet are described from the experimental measurements. For a given outer liquid sheet condition, the merged liquid sheet forms and separates at specific inner liquid sheet flow conditions. At low outer liquid sheet flow conditions with Weber number less than 50, the merged liquid sheet exhibits a self-sustaining periodic separation process, whose frequency increases with increasing inner liquid sheet Weber number for a given outer liquid sheet Weber number. Experimental measurements are presented to show that the dynamics of the contact point plays a major role in governing the characteristics of merged liquid sheets.

  8. Conversion of non-fibrillar {beta}-sheet oligomers into amyloid fibrils in Alzheimer's disease amyloid peptide aggregation

    SciTech Connect

    Benseny-Cases, Nuria; Cocera, Mercedes; Cladera, Josep


    A{beta}(1-40) is one of the main components of the fibrils found in amyloid plaques, a hallmark of brains affected by Alzheimer's disease. It is known that prior to the formation of amyloid fibrils in which the peptide adopts a well-ordered intermolecular {beta}-sheet structure, peptide monomers associate forming low and high molecular weight oligomers. These oligomers have been previously described in electron microscopy, AFM, and exclusion chromatography studies. Their specific secondary structures however, have not yet been well established. A major problem when comparing aggregation and secondary structure determinations in concentration-dependent processes such as amyloid aggregation is the different concentration range required in each type of experiment. In the present study we used the dye Thioflavin T (ThT), Fourier-transform infrared spectroscopy, and electron microscopy in order to structurally characterize the different aggregated species which form during the A{beta}(1-40) fibril formation process. A unique sample containing 90 {mu}M peptide was used. The results show that oligomeric species which form during the lag phase of the aggregation kinetics are a mixture of unordered, helical, and intermolecular non-fibrillar {beta}-structures. The number of oligomers and the amount of non-fibrillar {beta}-structures grows throughout the lag phase and during the elongation phase these non-fibrillar {beta}-structures are transformed into fibrillar (amyloid) {beta}-structures, formed by association of high molecular weight intermediates.

  9. Structural characterization of adsorbed helical and beta-sheet peptides

    NASA Astrophysics Data System (ADS)

    Samuel, Newton Thangadurai

    Adsorbed peptides on surfaces have potential applications in the fields of biomaterials, tissue engineering, peptide microarrays and nanobiotechnology. The surface region, the "biomolecular interface" between a material and the biological environment, plays a crucial role in these applications. As a result, characterization of adsorbed peptide structure, especially with respect to identity, concentration, spatial distribution, conformation and orientation, is important. The present research employs NEXAFS (near-edge X-ray absorption fine structure spectroscopy) and SFG (sum frequency generation spectroscopy) to provide information about the adsorbed peptide structure. Soft X-ray NEXAFS is a synchrotron-based technique which typically utilizes polarized X-rays to interrogate surfaces under ultra-high vacuum conditions. SFG is a non-linear optical technique which utilizes a combination of a fixed visible and a tunable infrared laser beams to generate a surface-vibrational spectrum of surface species. SFG has the added advantage of being able to directly analyze the surface-structure at the solid-liquid interface. The main goals of the present research were twofold: characterize the structure of adsorbed peptides (1) ex situ using soft X-ray NEXAFS, and (2) in situ using non-linear laser spectroscopy (SFG). Achieving the former goal involved first developing a comprehensive characterization of the carbon, nitrogen and oxygen k-edge NEXAFS spectra for amino acids, and then using a series of helical and beta-sheet peptides to demonstrate the sensitivity of polarization-dependent NEXAFS to secondary structure of adsorbed peptides. Characterizing the structure of adsorbed peptides in situ using SFG involved developing a model system to probe the solid-liquid interface in situ; demonstrating the ability to probe the molecular interactions and adsorbed secondary structure; following the time-dependent ordering of the adsorbed peptides; and establishing the ability to obtain

  10. Thickness of mouthguard sheets after vacuum-pressure formation: influence of mouthguard sheet material.


    Takahashi, Mutsumi; Koide, Kaoru; Iwasaki, Shin-Ichi


    The aim of this study was to investigate the thickness of mouthguard sheet after vacuum-pressure formation based on the mouthguard sheet material. Three mouthguard sheet materials (4.0 mm thick) were compared: ethylene-vinyl acetate co-polymer (EVA), olefin co-polymer (OL), and polyolefin-polystyrene co-polymer (OS). The working model was made by hard gypsum that was trimmed to the height of 20 mm at the cutting edge of the maxillary central incisor and 15 mm at the mesiobuccal cusp of the maxillary first molar. Where the center of the softened sheet sagged 15 mm lower than the clamp, the sheet was pressed against the working model, followed by vacuum forming for 10 s and compression molding for 2 min. The thickness of mouthguard sheets after fabrication was determined for the incisal portion (incisal edge and labial surface) and molar portion (cusp and buccal surface), and dimensional measurements were obtained using a measuring device. Differences in the change in thickness due to sheet materials were analyzed by one-way analysis of variance (anova) followed by Bonferroni's multiple comparison tests. The OL sheet was thickest at all measurement points. At the incisal edge and cusp, thickness after formation was highest for OL, then EVA and finally OS. At the labial surface and buccal surface, the thickness after formation was highest for OL, then OS and finally EVA. This study suggested that post-fabrication mouthguard thickness differed according to sheet material, with the olefin co-polymer sheet having the smallest thickness reduction. PMID:26446242

  11. Magnetohydrodynamic Simulations of Current-Sheet Formation and Reconnection at a Magnetic X Line

    NASA Astrophysics Data System (ADS)

    DeVore, C. R.; Antiochos, S. K.; Karpen, J. T.; Black, C.


    Phenomena ranging from the quiescent heating of the ambient plasma to the highly explosive release of energy and acceleration of particles in flares are conjectured to result from magnetic reconnection at electric current sheets in the Sun's corona. We are investigating numerically, using a macroscopic magnetohydrodynamic (MHD) model with adaptive mesh refinement, the formation and reconnection of a current sheet in an initially potential 2D magnetic field containing a null. Subjecting this simple configuration to unequal stresses in the four quadrants bounded by the X-line separatrix distorts the potential null into a double-Y-line current sheet. We find that even small distortions of the magnetic field induce the formation of a tangential discontinuity in the high-beta region around the null. A continuously applied stress eventually leads to the onset of fast magnetic reconnection across the sheet, with copious production, merging, and ejection of magnetic islands. We compare the current-sheet development and evolution for three cases: quasi-ideal MHD with numerical resistivity only; uniformly resistive MHD; and MHD with an embedded kinetic reconnection model. Analogous kinetic simulations using particle-in-cell (PIC) methods to investigate the small-scale dynamics of the system also are being pursued (C. Black et al., this meeting). Our progress toward understanding this simple system will be reported, as will the implications of our results for the dynamic activity associated with coronal current sheets and for general multiscale modeling of magnetized plasmas in the Heliosphere. Our research was supported by NASA.

  12. Formation of current sheets in magnetic reconnection

    SciTech Connect

    Boozer, Allen H.


    An ideal evolution of magnetic fields in three spatial dimensions tends to cause neighboring field lines to increase their separation exponentially with distance ℓ along the lines, δ(ℓ)=δ(0)e{sup σ(ℓ)}. The non-ideal effects required to break magnetic field line connections scale as e{sup −σ}, so the breaking of connections is inevitable for σ sufficiently large—even though the current density need nowhere be large. When the changes in field line connections occur rapidly compared to an Alfvén transit time, the constancy of j{sub ||}/B along the magnetic field required for a force-free equilibrium is broken in the region where the change occurs, and an Alfvénic relaxation of j{sub ||}/B occurs. Independent of the original spatial distribution of j{sub ||}/B, the evolution is into a sheet current, which is stretched by a factor e{sup σ} in width and contracted by a factor e{sup σ} in thickness with the current density j{sub ||} increasing as e{sup σ}. The dissipation of these sheet currents and their associated vorticity sheets appears to be the mechanism for transferring energy from a reconnecting magnetic field to a plasma. Harris sheets, which are used in models of magnetic reconnection, are shown to break up in the direction of current flow when they have a finite width and are in a plasma in force equilibrium. The dependence of the longterm nature of magnetic reconnection in systems driven by footpoint motion can be studied in a model that allows qualitative variation in the nature of that motion: slow or fast motion compared to the Alfvén transit time and the neighboring footpoints either exponentially separating in time or not.

  13. Multi-layer Parallel Beta-Sheet Structure of Amyloid Beta peptide (1-40) aggregate observed by discrete molecular dynamics simulations

    NASA Astrophysics Data System (ADS)

    Peng, Shouyong; Urbanc, Brigita; Ding, Feng; Cruz, Luis; Buldyrev, Sergey; Dokholyan, Nikolay; Stanley, H. E.


    New evidence shows that oligomeric forms of Amyloid-Beta are potent neurotoxins that play a major role in neurodegeneration of Alzheimer's disease. Detailed knowledge of the structure and assembly dynamics of Amyloid-Beta is important for the development of new therapeutic strategies. Here we apply a two-atom model with Go interactions to model aggregation of Amyloid-Beta (1-40) peptides using the discrete molecular dynamics simulation. At temperatures above the transition temperature from an alpha-helical to random coil, we obtain two types of parallel beta-sheet structures, (a) a helical beta-sheet structure at a lower temperature and (b) a parallel beta-sheet structure at a higher temperature, both with inter-sheet distance of 10 A and with free edges which possibly enable further fibrillar elongation.

  14. Characteristics of Amyloid-Related Oligomers Revealed by Crystal Structures of Macrocyclic [beta]-Sheet Mimics

    SciTech Connect

    Liu, Cong; Sawaya, Michael R.; Cheng, Pin-Nan; Zheng, Jing; Nowick, James S.; Eisenberg, David


    Protein amyloid oligomers have been strongly linked to amyloid diseases and can be intermediates to amyloid fibers. {beta}-Sheets have been identified in amyloid oligomers. However, because of their transient and highly polymorphic properties, the details of their self-association remain elusive. Here we explore oligomer structure using a model system: macrocyclic peptides. Key amyloidogenic sequences from A{beta} and tau were incorporated into macrocycles, thereby restraining them to {beta}-strands, but limiting the growth of the oligomers so they may crystallize and cannot fibrillate. We determined the atomic structures for four such oligomers, and all four reveal tetrameric interfaces in which {beta}-sheet dimers pair together by highly complementary, dry interfaces, analogous to steric zippers found in fibers, suggesting a common structure for amyloid oligomers and fibers. In amyloid fibers, the axes of the paired sheets are either parallel or antiparallel, whereas the oligomeric interfaces display a variety of sheet-to-sheet pairing angles, offering a structural explanation for the heterogeneity of amyloid oligomers.

  15. Dynamics of sheet nacre formation in bivalves.


    Rousseau, Marthe; Meibom, Anders; Gèze, Marc; Bourrat, Xavier; Angellier, Martine; Lopez, Evelyne


    Formation of nacre (mother-of-pearl) is a biomineralization process of fundamental scientific as well as industrial importance. However, the dynamics of the formation process is still not understood. Here, we use scanning electron microscopy and high spatial resolution ion microprobe depth-profiling to image the full three-dimensional distribution of organic materials around individual tablets in the top-most layer of forming nacre in bivalves. Nacre formation proceeds by lateral, symmetric growth of individual tablets mediated by a growth-ring rich in organics, in which aragonite crystallizes from amorphous precursors. The pivotal role in nacre formation played by the growth-ring structure documented in this study adds further complexity to a highly dynamical biomineralization process. PMID:19121399

  16. The molecular organization of the beta-sheet region in Corneous beta-proteins (beta-keratins) of sauropsids explains its stability and polymerization into filaments.


    Calvaresi, Matteo; Eckhart, Leopold; Alibardi, Lorenzo


    The hard corneous material of avian and reptilian scales, claws, beak and feathers is mainly derived from the presence of proteins formerly known as beta-keratins but now termed Corneous beta-proteins of sauropsids to distinguish them from keratins, which are members of the intermediate filament protein family. The modeling of the conserved 34 amino acid residues long central beta-sheet region of Corneous beta-proteins using an ab initio protein folding and structure prediction algorithm indicates that this region is formed by four antiparallel beta-sheets. Molecular dynamic simulations and Molecular Mechanics/Poisson Boltzmann Surface Area (MM-PBSA) analysis showed that the disposition of polar and apolar amino acids within the beta-region gives rise to an amphipathic core whose stability is further increased, especially in an aqueous environment, by the association into a dimer due to apolar interactions and specific amino-acid interactions. The dimers in turn polymerize into a 3nm thick linear beta-filament due to van der Waals and hydrogen-bond interactions. It is suggested that once this nuclear core of anti-parallel sheets evolved in the genome of a reptilian ancestor of the extant reptiles and birds about 300 millions years ago, new properties emerged in the corneous material forming scales, claws, beaks and feathers in these amniotes based on the tendency of these unique corneous proteins to form stable filaments different from keratin intermediate filaments or sterical structures formed by other corneous proteins so far known. PMID:26965557

  17. On spontaneous formation of current sheets: Untwisted magnetic fields

    SciTech Connect

    Bhattacharyya, R.; Low, B. C.; Smolarkiewicz, P. K.


    This is a study of the spontaneous formation of electric current sheets in an incompressible viscous fluid with perfect electrical conductivity, governed by the magnetohydrodynamic Navier-Stokes equations. Numerical solutions to two initial value problems are presented for a three-dimensional, periodic, untwisted magnetic field evolving, with no change in magnetic topology under the frozen-in condition and at characteristic fluid Reynolds numbers of the order of 500, from a nonequilibrium initial state with the fluid at rest. The evolution converts magnetic free energy into kinetic energy to be all dissipated away by viscosity so that the field settles into a minimum-energy, static equilibrium. The solutions demonstrate that, as a consequence of the frozen-in condition, current sheets must form during the evolution despite the geometric simplicity of the prescribed initial fields. In addition to the current sheets associated with magnetic neutral points and field reversal layers, other sheets not associated with such magnetic features are also in evidence. These current sheets form on magnetic flux surfaces. This property is used to achieve a high degree of the frozen-in condition in the simulations, by describing the magnetic field entirely in terms of the advection of its flux surfaces and integrating the resulting governing equations with a customized version of a general-purpose high-resolution (viz., nonoscillatory) hydrodynamical simulation code EULAG [J. M. Prusa et al., Comput. Fluids 37, 1193 (2008)]. Incompressibility imposes the additional global constraint that the flux surfaces must evolve with no change in the spatial volumes they enclose. In this approach, current sheet formation is demonstrated graphically by the progressive pressing together of suitably selected flux surfaces until their separation has diminished below the minimal resolved distance on a fixed grid. The frozen-in condition then fails in the simulation as the field reconnects through

  18. Laminated Morphology of Nontwisting beta-Sheet Fibrilis Constructed via Peptide Self-Assembly

    SciTech Connect

    Lamm,M.; Rajagopal, K.; Schneider, J.; Pochan, D.


    A synthetic peptide has been de novo designed that self-assembles into {beta}-sheet fibrils exhibiting a nontwisted, stacked morphology. The stacked morphology is constituted by 2.5 nm wide filaments that laterally associate to form flat fibril laminates exceeding 50 nm in width and micrometers in length. The height of each fibril is limited to the length of exactly one peptide monomer in an extended {beta}-strand conformation, approximately 7 nm. Once assembled, these highly ordered, 2-D structures are stable over a wide range of pH and temperature and exhibit characteristics similar to those of amyloid fibrils. Furthermore, the rate of assembly and degree of fibril lamination can be controlled with kinetic parameters of pH and temperature. Finally, the presence of a diproline peptide between two {beta}-sheet-forming strands in the peptide sequence is demonstrated to be an important factor in promoting the nontwisting, laminated fibril morphology.

  19. Metallopolymer-peptide conjugates: synthesis and self-assembly of polyferrocenylsilane graft and block copolymers containing a beta-sheet forming Gly-Ala-Gly-Ala tetrapeptide segment.


    Vandermeulen, Guido W M; Kim, Kyoung Taek; Wang, Zhuo; Manners, Ian


    We describe the synthesis and self-assembly of two beta-sheet forming metallopolymer-peptide conjugates. The ability of the oligotetrapeptide sequence Gly-Ala-Gly-Ala (GAGA) to form antiparallel beta-sheets was retained in PFS-b-AGAG (PFS = polyferrocenylsilane) and PFS-g-AGAG conjugates with block and graft architectures, respectively. In the solid state, DSC experiments suggest a phase separation between the peptide and PFS domains. In toluene, PFS-b-AGAG interestingly forms a fibrous network which consists of a core containing the self-assembled antiparallel beta-sheet peptide and a corona of organometallic PFS. The self-assembly of the peptide into antiparallel beta-sheets is the driving force for the fiber formation, whereas PFS prevents uncontrolled lateral aggregation of the fibers. The use of an oligopeptide to self-assemble an otherwise random coiled organometallic polymer may be a useful strategy to enhance nanostructure formation. In the cases described here, the conjugates may be used to create nanopatterned ceramics, and the redox properties of the resulting supramolecular aggregates are of significant interest. PMID:16602714

  20. Captides: Rigid Junctions between Beta Sheets and Small Molecules

    PubMed Central

    Kier, Brandon L.; Andersen, Niels H.


    An extensive series of covalently linked small molecule-peptide adducts based on a terminally capped beta hairpin motif is reported. The constructs can be prepared by standard solid-phase fmoc chemistry with 1 to 4 peptide chains linked to small molecule hubs bearing carboxylic acid moieties. The key feature of interest is the precise, buried environment of the small molecule, and its rigid orientation relative to one or more short, but fully structured peptide chain(s). Most of this study employs a minimalist 9 residue “captide”, a capped β-turn, but we illustrate general applicability to peptides which can terminate in a beta strand. The non-peptide portion of these adducts can include nearly any molecule bearing one or more carboxylic acid groups. Fold-dependent rigidity sets this strategy apart from currently available bioconjugation methods, which typically engender significant flexibility between peptide and tag. Applications to catalyst enhancement, drug design, higher-order assembly, and FRET calibration rulers are discussed. PMID:24909552

  1. Reversible transition between alpha-helix and beta-sheet conformation of a transmembrane domain.


    Yassine, Wissam; Taib, Nada; Federman, Silvina; Milochau, Alexandra; Castano, Sabine; Sbi, Walid; Manigand, Claude; Laguerre, Michel; Desbat, Bernard; Oda, Reiko; Lang, Jochen


    Despite the important functions of protein transmembrane domains, their structure and dynamics are often scarcely known. The SNARE proteins VAMP/synaptobrevin and syntaxin 1 are implicated in membrane fusion. Using different spectroscopic approaches we observed a marked sensitivity of their transmembrane domain structure in regard to the lipid/peptide ratio. In the dilute condition, peptides corresponding to the complete transmembrane domain fold into an alpha-helix inserted at approximately 35 degrees to the normal of the membranes, an observation in line with molecular simulations. Upon an increase in the peptide/lipid ratio, the peptides readily exhibited transition to beta-sheet structure. Moreover, the insertion angle of these beta-sheets increased to 54 degrees and was accompanied by a derangement of lipid acyl chains. For both proteins the transition from alpha-helix to beta-sheet was reversible under certain conditions by increasing the peptide/lipid ratio. This phenomenon was observed in different model systems including multibilayers and small unilamellar vesicles. In addition, differences in peptide structure and transitions were observed when using distinct lipids (DMPC, DPPC or DOPC) thus indicating parameters influencing transmembrane domain structure and conversion from helices to sheets. The putative functional consequences of this unprecedented dynamic behavior of a transmembrane domain are discussed. PMID:19482005

  2. Hydrophobic interactions and hydrogen bonds in β-sheet formation

    NASA Astrophysics Data System (ADS)

    Narayanan, Chitra; Dias, Cristiano L.


    In this study, we investigate interactions of extended conformations of homodimeric peptides made of small (glycine or alanine) and large hydrophobic (valine or leucine) sidechains using all-atom molecular dynamics simulations to decipher driving forces for β-sheet formation. We make use of a periodic boundary condition setup in which individual peptides are infinitely long and stretched. Dimers adopt β-sheet conformations at short interpeptide distances (ξ ˜ 0.5 nm) and at intermediate distances (˜0.8 nm), valine and leucine homodimers assume cross-β-like conformations with side chains interpenetrating each other. These two states are identified as minima in the potential of mean force. While the number of interpeptide hydrogen bonds increases with decreasing interpeptide distance, the total hydrogen bond number in the system does not change significantly, suggesting that formation of β-sheet structures from extended conformations is not driven by hydrogen bonds. This is supported by an increase in electrostatic energy at short interpeptide distances. A remarkable correlation between the volume of the system and the total electrostatic energy is observed, further reinforcing the idea that excluding water in proteins comes with an enthalpic penalty. We also discuss microscopic mechanisms accounting for β-sheet formation based on computed enthalpy and entropy and we show that they are different for peptides with small and large side chains.

  3. Possible participation of transient sheets of 1. -->. 4-. beta. -glucans in the biosynthesis of cellulose I. [Acetobacter xylinum

    SciTech Connect

    Colvin, J.R.


    It is suggested that a primary, essential stage in the biologic formation of a microfibril of cellulose I is an extracellular, lateral association of presynthesized (1..-->..4)-..beta..-D-glucans, by hydrogen bonding, to form long, thin sheets. These sheets then superimpose themselves nonenzymatically by London forces to form the nascent microfibril. The ends of the constituent glucans of the nascent microfibril may undergo extension or rearrangement of the type indicated by Maclachlan and colleagues. The formation of the metastable, native structure (cellulose I) may be deduced from the above suggestion as a natural consequence of closest packing of the sheets. The irreversibility of the change from cellulose I to cellulose II, either by mercerization or regeneration, also follows from the postulate. The suggestion also explains why cellulose microfibrils and chitin microfibrils may be formed contiguously in cell walls without interfering with each other. High-resolution electron micrographs of the tips of newly formed microfibrils of bacterial cellulose which had been very lightly negatively stained with sodium phosphotungstate are consistent with the suggestion. 33 references, 3 figures.

  4. Thermally Induced Alpha-Helix to Beta-Sheet Transition in Regenerated Silk Fibers and Films

    SciTech Connect

    Drummy,L.; Phillips, D.; Stone, M.; Farmer, B.; Naik, R.


    The structure of thin films cast from regenerated solutions of Bombyx mori cocoon silk in hexafluoroisopropyl alcohol (HFIP) was studied by synchrotron X-ray diffraction during heating. A solid-state conformational transition from an alpha-helical structure to the well-known beta-sheet silk II structure occurred at a temperature of approximately 140 degrees C. The transition appeared to be homogeneous, as both phases do not coexist within the resolution of the current study. Modulated differential scanning calorimetry (DSC) of the films showed an endothermic melting peak followed by an exothermic crystallization peak, both occurring near 140 degrees C. Oriented fibers were also produced that displayed this helical molecular conformation. Subsequent heating above the structural transition temperature produced oriented beta-sheet fibers very similar in structure to B. mori cocoon fibers. Heat treatment of silk films at temperatures well below their degradation temperature offers a controllable route to materials with well-defined structures and mechanical behavior.

  5. Design and biological activity of {beta}-sheet breaker peptide conjugates

    SciTech Connect

    Rocha, Sandra Cardoso, Isabel; Boerner, Hans; Pereira, Maria Carmo; Saraiva, Maria Joao; Coelho, Manuel


    The sequence LPFFD (iA{beta}{sub 5}) prevents amyloid-{beta} peptide (A{beta}) fibrillogenesis and neurotoxicity, hallmarks of Alzheimer's disease (AD), as previously demonstrated. In this study iA{beta}{sub 5} was covalently linked to poly(ethylene glycol) (PEG) and the activity of conjugates was assessed and compared to the activity of the peptide alone by in vitro studies. The conjugates were characterized by MALDI-TOF. Competition binding assays established that conjugates retained the ability to bind A{beta} with similar strength as iA{beta}{sub 5}. Transmission electron microscopy analysis showed that iA{beta}{sub 5} conjugates inhibited amyloid fibril formation, which is in agreement with binding properties observed for the conjugates towards A{beta}. The conjugates were also able to prevent amyloid-induced cell death, as evaluated by activation of caspase 3. These results demonstrated that the biological activity of iA{beta}{sub 5} is not affected by the pegylation process.

  6. Inhibition of aggregation of amyloid peptides by beta-sheet breaker peptides and their binding affinity.


    Viet, Man Hoang; Ngo, Son Tung; Lam, Nguyen Sy; Li, Mai Suan


    The effects of beta-sheet breaker peptides KLVFF and LPFFD on the oligomerization of amyloid peptides were studied by all-atom simulations. It was found that LPFFD interferes the aggregation of Aβ(16-22) peptides to a greater extent than does KLVFF. Using the molecular mechanics-Poisson-Boltzmann surface area (MM-PBSA) method, we found that the former binds more strongly to Aβ(16-22). Therefore, by simulations, we have clarified the relationship between aggregation rates and binding affinity: the stronger the ligand binding, the slower the oligomerization process. The binding affinity of pentapeptides to full-length peptide Aβ(1-40) and its mature fibrils has been considered using the Autodock and MM-PBSA methods. The hydrophobic interaction between ligands and receptors plays a more important role for association than does hydrogen bonding. The influence of beta-sheet breaker peptides on the secondary structures of monomer Aβ(1-40) was studied in detail, and it turns out that, in their presence, the total beta-sheet content can be enhanced. However, the aggregation can be slowed because the beta-content is reduced in fibril-prone regions. Both pentapeptides strongly bind to monomer Aβ(1-40), as well as to mature fibrils, but KLVFF displays a lower binding affinity than LPFFD. Our findings are in accord with earlier experiments that both of these peptides can serve as prominent inhibitors. In addition, we predict that LPFFD inhibits/degrades the fibrillogenesis of full-length amyloid peptides better than KLVFF. This is probably related to a difference in their total hydrophobicities in that the higher the hydrophobicity, the lower the inhibitory capacity. The GROMOS96 43a1 force field with explicit water and the force field proposed by Morris et al. (Morris et al. J. Comput. Chem. 1998, 19, 1639 ) were employed for all-atom molecular dynamics simulations and Autodock experiments, respectively. PMID:21563780

  7. Formation and dynamical history of the beta Pictoris system

    NASA Astrophysics Data System (ADS)

    Wyatt, M.


    The structure of the beta Pic disk holds many clues to its formation and dynamical history. In particular there is strong evidence for sculpting by the beta Pic-b planet. For example, a warp in the disk at 80au is thought to be driven by the secular perturbations of that planet, and scattering of comets by beta Pic-b is thought to be the origin of the Falling Evaporating Bodies. A clump in the disk coincident with the warp, also at ~80au, provides clues to the outer planetary system which for now is poorly constrained. One possible origin for the clump is in trapping of comets into resonance with an outer planet currently at ~60au, with an alternative scenario being a giant impact between planetary embryos. This talk will consider the various disk structures and what they tell us about the formation and dynamical history of the beta Pictoris system.

  8. The beta-sheet to alpha-helix transition of beta-lactoglobulin monitored in real time with a microfabricated IR mixer

    NASA Astrophysics Data System (ADS)

    Kauffmann, Ekkehard; Darton, Nick; Gerwert, Klaus; Austin, Robert


    The helix to sheet transition of proteins, a crucial step in amylogenic diseases, is investigated with a new diffusional IR mixer using time-resolved FTIR spectroscopy capable of 400 microsecond time resolution. We show that the beta to alpha transition of beta-lactoglobulin proceeds via a compact molten globule b-sheet intermediate with an unusually short lifetime of 7 ms. Because the protein does not have to unfold for the beta-sheet to alpha-helix transition the energy barrier seems to be unexpectedly low. The rough energy landscape of a protein includes not only the steep free energy funnel that guides the unfolded protein into its compact native state

  9. Current Sheets Formation in Tangled Coronal Magnetic Fields

    NASA Astrophysics Data System (ADS)

    Rappazzo, A. F.; Parker, E. N.


    We investigate the dynamical evolution of magnetic fields in closed regions of solar and stellar coronae. To understand under which conditions current sheets form, we examine dissipative and ideal reduced magnetohydrodynamic models in Cartesian geometry, where two magnetic field components are present: the strong guide field B 0, extended along the axial direction, and the dynamical orthogonal field b. Magnetic field lines thread the system along the axial direction that spans the length L and are line-tied at the top and bottom plates. The magnetic field b initially has only large scales, with its gradient (current) length scale of the order of l b . We identify the magnetic intensity threshold b/B 0 ~ l b /L. For values of b below this threshold, field-line tension inhibits the formation of current sheets, while above the threshold they form quickly on fast ideal timescales. In the ideal case, above the magnetic threshold, we show that current sheets thickness decreases in time until it becomes smaller than the grid resolution, with the analyticity strip width δ decreasing at least exponentially, after which the simulations become underresolved.


    SciTech Connect

    Rappazzo, A. F.; Parker, E. N. E-mail:


    We investigate the dynamical evolution of magnetic fields in closed regions of solar and stellar coronae. To understand under which conditions current sheets form, we examine dissipative and ideal reduced magnetohydrodynamic models in Cartesian geometry, where two magnetic field components are present: the strong guide field B{sub 0}, extended along the axial direction, and the dynamical orthogonal field b. Magnetic field lines thread the system along the axial direction that spans the length L and are line-tied at the top and bottom plates. The magnetic field b initially has only large scales, with its gradient (current) length scale of the order of l{sub b}. We identify the magnetic intensity threshold b/B{sub 0} {approx} l{sub b}/L. For values of b below this threshold, field-line tension inhibits the formation of current sheets, while above the threshold they form quickly on fast ideal timescales. In the ideal case, above the magnetic threshold, we show that current sheets thickness decreases in time until it becomes smaller than the grid resolution, with the analyticity strip width {delta} decreasing at least exponentially, after which the simulations become underresolved.

  11. Factors contributing to decreased protein stability when aspartic acid residues are in {beta}-sheet regions.

    SciTech Connect

    Pokkuluri, P. R.; Cai, X.; Raffen, R.; Gu, M.; Stevens, F. J.; Schiffer, M.


    Asp residues are significantly under represented in {beta}-sheet regions of proteins, especially in the middle of {beta}-strands, as found by a number of studies using statistical, modeling, or experimental methods. To further understand the reasons for this under representation of Asp, we prepared and analyzed mutants of a {beta}-domain. Two Gln residues of the immunoglobulin light-chain variable domain (V{sub L}) of protein Len were replaced with Asp, and then the effects of these changes on protein stability and protein structure were studied. The replacement of Q38D, located at the end of a {beta}-strand, and that of Q89D, located in the middle of a {beta}-strand, reduced the stability of the parent immunoglobulin VL domain by 2.0 kcal/mol and 5.3 kcal/mol, respectively. Because the Q89D mutant of the wild-type V{sub L}-Len domain was too unstable to be expressed as a soluble protein, we prepared the Q89D mutant in a triple mutant background, V{sub L}-Len M4L/Y27dD/T94H, which was 4.2 kcal/mol more stable than the wild-type V{sub L}-Len domain. The structures of mutants V{sub L}-Len Q38D and V{sub L}-Len Q89D/M4L/Y27dD/T94H were determined by X-ray diffraction at 1.6 A resolution. We found no major perturbances in the structures of these QD mutant proteins relative to structures of the parent proteins. The observed stability changes have to be accounted for by cumulative effects of the following several factors: (1) by changes in main-chain dihedral angles and in side-chain rotomers, (2) by close contacts between some atoms, and, most significantly, (3) by the unfavorable electrostatic interactions between the Asp side chain and the carbonyls of the main chain. We show that the Asn side chain, which is of similar size but neutral, is less destabilizing. The detrimental effect of Asp within a {beta}-sheet of an immunoglobulin-type domain can have very serious consequences. A somatic mutation of a {beta}-strand residue to Asp could prevent the expression of the

  12. An exact collisionless equilibrium for the Force-Free Harris Sheet with low plasma beta

    SciTech Connect

    Allanson, O. Neukirch, T. Wilson, F. Troscheit, S.


    We present a first discussion and analysis of the physical properties of a new exact collisionless equilibrium for a one-dimensional nonlinear force-free magnetic field, namely, the force-free Harris sheet. The solution allows any value of the plasma beta, and crucially below unity, which previous nonlinear force-free collisionless equilibria could not. The distribution function involves infinite series of Hermite polynomials in the canonical momenta, of which the important mathematical properties of convergence and non-negativity have recently been proven. Plots of the distribution function are presented for the plasma beta modestly below unity, and we compare the shape of the distribution function in two of the velocity directions to a Maxwellian distribution.

  13. Moulin distribution and formation on the southwest Greenland ice sheet

    NASA Astrophysics Data System (ADS)

    Chu, V. W.; Smith, L. C.; Gleason, C. J.; Yang, K.; Poinar, K.; Joughin, I.; Pitcher, L. H.


    River moulins represent a significant connection between surface meltwater generated on the Greenland ice sheet and subglacial drainage networks, where increased meltwater can enhance ice sliding dynamics. In this study, a new high-resolution moulin map is created from WorldView-1/2 imagery acquired during the 2012 record melt year for a 12,500 km2 area near Russell Glacier in southwest Greenland. A total of 1,236 moulins are mapped and categorized as being located: in crevasse fields, along a single ice fracture, within drained lake basins, or having no visible formation mechanism. We find the presence of moulins up to 1787 m elevation, with 11% of moulins found above 1600 m elevation: higher than previously mapped moulins and where glaciological theory suggests few moulins should form. Our study observes moulins in both extensional and compressional ice flow regimes (28% of moulins are found in areas of high extensional strain rate >0.005 yr-1), suggesting that strain rates are not a strong indicator of the likelihood for moulin formation. Overall, moulin density tends to increase with higher bed elevation, thinner ice, lower surface slope, higher velocity, and higher strain rate. In sum, moulins are most common in crevassed, thinner ice near the ice sheet edge, but significant quantities also develop at high elevations. This indicates that future inland expansion of melting may create hydrologic connections between the surface and the bed at higher elevations than previously thought.

  14. sup 1 H NMR identification of a. beta. -sheet structure and description of folding topology in putidaredoxin

    SciTech Connect

    Pochapsky, T.C.; Ye, Xiao Mei )


    Putidaredoxin (Pdx), a 106-residue globular protein consisting of a single polypeptide chain and a (2Fe-2S) cluster, is the physiological reductant of P-450{sub cam}, which in turn catalyzes the monohydroxylation of camphor by molecular oxygen. No crystal structure has been obtained for Pdx or for any closely homologous protein. The application of two-dimensional {sup 1}H NMR methods to the problem of structure determination in Pdx is reported. A {beta}-sheet consisting of five short strands and one {beta}-turn has been identified from distinctive nuclear Overhauser effect patterns. All of the backbone resonances and a majority of the side-chain resonances corresponding to protons in the {beta}-sheet have been assigned sequence specifically. The sheet contains one parallel and three antiparallel strand orientations. Hydrophobic side chains in the {beta}-sheet face primarily toward the protein interior, except for a group of three valine side chains that are apparently solvent exposed. The potential significance of this hydrophobic patch in terms of biological activity is discussed. The folding topology, as determined by the constraints of the {beta}-sheet, is compared with that of other (2Fe-2S) proteins for which folding topologies are known.

  15. Designing biomaterials exploiting beta-sheet forming peptides self-assembly

    NASA Astrophysics Data System (ADS)

    Saiani, Alberto


    The use of non-covalent self-assembly to construct materials has become a prominent strategy in material science offering practical routes for the construction of increasingly functional materials for a variety of applications ranging from electronic to biotechnology. A variety of molecular building blocks can be used for this purpose, one such block that has attracted considerable attention are de-novo designed peptides. The library of 20 natural amino acids offers the ability to play with the intrinsic properties of the peptide such as structure, hydrophobicity, charge and functionality allowing the design of materials with a wide range of properties. The beta-sheet motif is of particular interest as short peptides can be designed to form beta-sheet rich fibres that entangle and consequently form hydrogels. These hydrogels can be further functionalised using specific biological signals or drugs by synthesising functionalised peptides that are incorporated into the hydrogel network during the self-assembling process. This functionalisation approach is very attractive has it does not require any chemistry avoiding therefore the use of additional potentially toxic chemicals. It also offers the possibility to introduce multiple functionalities in a straightforward fashion. The hydrogels can also be made responsive through the use of enzymatic catalysis and/or conjugation with responsive polymers. In this presentation we will discuss the design opportunities offered by these peptides to create new functional biomaterials.

  16. Strength limit of entropic elasticity in beta-sheet protein domains

    NASA Astrophysics Data System (ADS)

    Keten, Sinan; Buehler, Markus J.


    Elasticity and strength of individual beta-sheet protein domains govern key biological functions and the mechanical properties of biopolymers including spider silk, amyloids, and muscle fibers. The worm-like-chain (WLC) model is commonly used to describe the entropic elasticity of polypeptides and other biomolecules. However, force spectroscopy experiments have shown pronounced deviations from the ideal WLC behavior, leading to controversial views about the appropriate elastic description of proteins at nanoscale. Here we report a simple model that explains the physical mechanism that leads to the breakdown of the WLC idealization in experiments by using only two generic parameters of the protein domain, the H-bond energy and the protein backbone’s persistence length. We show that a rupture initiation condition characterized by the free energy release rate of H-bonds characterizes the limit of WLC entropic elasticity of beta-sheet protein domains and the onset of rupture. Our findings reveal that strength and elasticity are coupled and cannot be treated separately. The predictions of the model are compared with atomic force microscopy experiments of protein rupture.

  17. Microphase Separation Controlled beta-Sheet Crystallization Kinetics in Fibrous Proteins

    SciTech Connect

    Hu, X.; Lu, Q; Kaplan, D; Cebe, P


    Silk is a naturally occurring fibrous protein with a multiblock chain architecture. As such, it has many similarities with synthetic block copolymers, including the possibility for e-sheet crystallization restricted within the crystallizable blocks. The mechanism of isothermal crystallization kinetics of e-sheet crystals in silk multiblock fibrous proteins is reported in this study. Kinetics theories, such as Avrami analysis which was established for studies of synthetic polymer crystal growth, are for the first time extended to investigate protein self-assembly in e-sheet rich Bombyx mori silk fibroin samples, using time-resolved Fourier transform infrared spectroscopy (FTIR), differential scanning calorimetry (DSC) and synchrotron real-time wide-angle X-ray scattering (WAXS). The Avrami exponent, n, was close to 2 for all methods and crystallization temperatures, indicating formation of e-sheet crystals in silk proteins is different from the 3-D spherulitic crystal growth found in synthetic polymers. Observations by scanning electron microscopy support the view that the protein structures vary during the different stages of crystal growth, and show a microphase separation pattern after chymotrypsin enzyme biodegradation. We present a model to explain the crystallization of the multiblock silk fibroin protein, by analogy to block copolymers: crystallization of e-sheets occurs under conditions of geometrical restriction caused by phase separation of the crystallizable and uncrystallizable blocks. This crystallization model could be widely applicable in other proteins with multiblock (i.e., crystallizable and noncrystallizable) domains.

  18. Current Sheet Formation, Equilibria and Heating in the Closed Corona

    NASA Astrophysics Data System (ADS)

    Rappazzo, A. F.


    Parker model for coronal heating is investigated within theframework of reduced magnetohydrodynamics (RMHD) in cartesian geometry. A popular hypothesis is that in response to slow photospheric motionsthe magnetic field evolves quasi-statically through a seriesof unstable equilibria. Instabilities, e.g., kink modes or else,allow the release of energy while the field relaxes to a new equilibrium.On the other hand it has long been suggested that the dynamics relevant to the basic heating of coronal loops may not entaila quasi-static evolution (Parker 1972, 1994), and recently it has beenshown that the relaxation of an initial configuration out of equilibriumdevelops current sheets without accessing intermediate equilibria (Rappazzo & Parker 2013).The properties of the equilibria are therefore key in understanding thedynamics of coronal heating both in the case of low-frequency photospheric motions (DC) and for propagating waves (AC).Equilibria and nonlinear dynamics are studied numerically and theoretically,explaining why dynamics are inhibited below a critical twist, while for highervalues of the fluctuations nonlinear dynamics lead to the formation of current sheets (and magnetic reconnection in the non ideal case), whose thickness istracked with the analiticity strip method and shown to decrease at least exponentiallydown to dissipative lenght-scales on fast ideal Alfvenic timescales. The impact onthe heating of solar and stellar coronae will be discussed.

  19. Helix versus sheet formation in a small peptide

    NASA Astrophysics Data System (ADS)

    Peng, Yong; Hansmann, Ulrich H.


    Segments with the amino acid sequence EKAYLRT (glutamine-lysine-alanine-tyrosine-leucine-arginine-threonine) appear in naturally occurring proteins both in α-helices and β-sheets. For this reason, we have used this peptide to study how secondary structure formation in proteins depends on the local environment. Our data rely on multicanonical Monte Carlo simulations where the interactions among all atoms are taken into account. Results in gas phase are compared with that in an implicit solvent. We find that both the solvated molecule and EKAYLRT in gas phase form an α-helix when not interacting with other molecules. However, in the vicinity of a β-strand, the peptide forms a β-strand. Because of this change in secondary structure our peptide may provide a simple model for the α→β transition that is supposedly related to the outbreak of prion diseases and similar illnesses.

  20. Protein unfolding at interfaces: slow dynamics of alpha-helix to beta-sheet transition.


    Sethuraman, Ananthakrishnan; Vedantham, Ganesh; Imoto, Taiji; Przybycien, Todd; Belfort, Georges


    A two-phase sequential dynamic change in the secondary structure of hen egg lysozyme (Lys) adsorbed on solid substrates was observed. The first phase involved fast conversion of alpha-helix to random/turns (within the first minute or at very low coverage or high substrate wettability) with no perceptible change in beta-sheet content. The second phase (1-1200 min), however, involved a relatively slow conversion from alpha-helix to beta-sheet without a noticeable change in random/turns. An important finding of this work is that the concentration of lysozyme in the adsorbed state has a substantial effect on the fractional content of secondary structures. Attenuated total reflection Fourier transform infrared (ATR/FTIR) spectroscopy, along with a newly-developed optimization algorithm for predicting the content of secondary structure motifs, was used to correlate the secondary structure and the amount of adsorbed lysozyme with the surface wettability of six different flat nanoporous substrates. Although three independent variables, surface wettability, solution concentration and time for adsorption, were used to follow the fractional structural changes of lysozyme, the results were all normalized onto a single plot with the amount adsorbed as the universal independent variable. Consequently, lateral interactions among proteins likely drive the transition process. Direct intermolecular force adhesion measurements between lysozyme and different functionalized self-assembled alkanethiol monolayers confirm that hydrophobic surfaces interact strongly with proteins. The lysozyme-unfolding pathway during early adsorption appears to be similar to that predicted by published molecular modeling results. PMID:15281120

  1. Reversible Hydrogel–Solution System of Silk with High Beta-Sheet Content

    PubMed Central


    Silkworm silk has been widely used as a textile fiber, as biomaterials and in optically functional materials due to its extraordinary properties. The β-sheet-rich natural nanofiber units of about 10–50 nm in diameter are often considered the origin of these properties, yet it remains unclear how silk self-assembles into these hierarchical structures. A new system composed of β-sheet-rich silk nanofibers about 10–20 nm in diameter is reported here, where these nanofibers formed into “flowing hydrogels” at 0.5–2% solutions and could be transformed back into the solution state at lower concentrations, even with a high β-sheet content. This is in contrast with other silk processed materials, where significant β-sheet content negates reversibility between solution and solid states. These fibers are formed by regulating the self-assembly process of silk in aqueous solution, which changes the distribution of negative charges while still supporting β-sheet formation in the structures. Mechanistically, there appears to be a shift toward negative charges along the outside of the silk nanofibers in our present study, resulting in a higher zeta potential (above −50 mV) than previous silk materials which tend to be below −30 mV. The higher negative charge on silk nanofibers resulted in electrostatic repulsion strong enough to negate further assembly of the nanofibers. Changing silk concentration changed the balance between hydrophobic interactions and electrostatic repulsion of β-sheet-rich silk nanofibers, resulting in reversible hydrogel–solution transitions. Furthermore, the silk nanofibers could be disassembled into shorter fibers and even nanoparticles upon ultrasonic treatment following the transition from hydrogel to solution due to the increased dispersion of hydrophobic smaller particles, without the loss of β-sheet content, and with retention of the ability to transition between hydrogel and solution states through reversion to longer nanofibers

  2. Reversible hydrogel-solution system of silk with high beta-sheet content.


    Bai, Shumeng; Zhang, Xiuli; Lu, Qiang; Sheng, Weiqin; Liu, Lijie; Dong, Boju; Kaplan, David L; Zhu, Hesun


    Silkworm silk has been widely used as a textile fiber, as biomaterials and in optically functional materials due to its extraordinary properties. The β-sheet-rich natural nanofiber units of about 10-50 nm in diameter are often considered the origin of these properties, yet it remains unclear how silk self-assembles into these hierarchical structures. A new system composed of β-sheet-rich silk nanofibers about 10-20 nm in diameter is reported here, where these nanofibers formed into "flowing hydrogels" at 0.5-2% solutions and could be transformed back into the solution state at lower concentrations, even with a high β-sheet content. This is in contrast with other silk processed materials, where significant β-sheet content negates reversibility between solution and solid states. These fibers are formed by regulating the self-assembly process of silk in aqueous solution, which changes the distribution of negative charges while still supporting β-sheet formation in the structures. Mechanistically, there appears to be a shift toward negative charges along the outside of the silk nanofibers in our present study, resulting in a higher zeta potential (above -50 mV) than previous silk materials which tend to be below -30 mV. The higher negative charge on silk nanofibers resulted in electrostatic repulsion strong enough to negate further assembly of the nanofibers. Changing silk concentration changed the balance between hydrophobic interactions and electrostatic repulsion of β-sheet-rich silk nanofibers, resulting in reversible hydrogel-solution transitions. Furthermore, the silk nanofibers could be disassembled into shorter fibers and even nanoparticles upon ultrasonic treatment following the transition from hydrogel to solution due to the increased dispersion of hydrophobic smaller particles, without the loss of β-sheet content, and with retention of the ability to transition between hydrogel and solution states through reversion to longer nanofibers during self

  3. Singularity formation and nonlinear evolution of a viscous vortex sheet model

    NASA Astrophysics Data System (ADS)

    Sohn, Sung-Ik


    We study Dhanak's model [J. Fluid Mech. 269, 265 (1994)], 10.1017/S0022112094001552 of a viscous vortex sheet in the sharp limit, to investigate singularity formations and present nonlinear evolutions of the sheets. The finite-time singularity does not disappear by giving viscosity to the vortex sheet, but is delayed. The singularity in the sharp viscous vortex sheet is found to be different from that of the inviscid sheet in several features. A discontinuity in the curvature is formed in the viscous sheet, similarly as the inviscid sheet, but a cusp in the vortex sheet strength is less sharpened by viscosity. Exponential decay of the Fourier amplitudes is lost by the formation of the singularity, and the amplitudes of high wavenumbers exhibit an algebraic decay, while in the inviscid vortex sheet, the algebraic decay of the Fourier amplitudes is valid from fairly small wavenumbers. The algebraic decay rate of the viscous vortex sheet is approximately -2.5, independent of viscosity, which is the same rate as the asymptotic analysis of the inviscid sheet. Results for evolutions of the regularized vortex sheets show that the roll-up is weakened by viscosity, and the regularization parameter has more significant effects on the fine-structure of the core than does viscosity.

  4. Network formation through active migration of human vascular endothelial cells in a multilayered skeletal myoblast sheet.


    Nagamori, Eiji; Ngo, Trung Xuan; Takezawa, Yasunori; Saito, Atsuhiro; Sawa, Yoshiki; Shimizu, Tatsuya; Okano, Teruo; Taya, Masahito; Kino-oka, Masahiro


    Autologous transplantation of myoblast sheet has attracted attention as a new technique for curing myocardial infarction. Myoblast sheet has the ability to secret cytokines that improve heart function via the facilitation of angiogenesis on affected part. To mimic the in vivo angiogenesis in the myoblast sheet after transplantation, a five-layered cell sheet of human skeletal muscle myoblasts (HSMMs) was overlaid on human umbilical vein endothelial cells (HUVECs) which enables evaluation of dynamic HUVEC behavior. HUVECs existing initially at the bottom of the sheet changed to be a stretched shape and migrated upward compared with the surrounding HSMMs in the sheet. Prolonged incubation resulted in network formation of HUVECs in the middle of the sheet, although non-networked HUVECs continued to migrate to the top of the sheet, which meant the spatial habitation of HUVECs in the cell sheet. Image processing was performed to determine the variation in the extent of network formation at different HUVEC densities. It was found that the extent of formed network depended on the frequency of encounters among HUVECs in the middle of the sheet. The present system, which can evaluate network formation, is considered to be a promising in vitro angiogenesis model. PMID:23117213

  5. New insights regarding protein folding as learned from beta-sheets

    PubMed Central

    Zhang, Ning; Feng, Yuanming; Gao, Shan; Ruan, Jishou; Zhang, Tao


    The folding of denatured proteins into their native conformations is called Anfinsen's dogma, and is the rationale for predicting protein structures based on primary sequences. Through the last 40 years of study, all available algorithms which either predict 3D or 2D protein structures, or predict the rate of protein folding based on the amino acid sequence alone, are limited in accuracy (80 %). This fact has led some researchers to look for the lost information, from mRNA to protein sequences, and it encourages us to rethink the rationale of Anfinsen's dogma. In this study, we focus on the relationship between the strand and its partners. We find two rules based on a non-redundant dataset taken from the PDB database. We refer to these two rules as the “first coming first pairing” rule and the “loveless” rule. The first coming first pairing rule indicates that a given strand prefers to pair with the next strand, if the connected region is flexible enough. The loveless rule means that the affinities between a given strand and another strand are comparable to the affinity between the given strand and its partner. Of course, the affinities between the given strand and a helix/coil peptide are significantly less than the affinity between the given strand and its partner. These two rules suggest that in protein folding, we have folding taking place during translation, and suggest also that a denatured protein is not the same as its primary sequence. Rechecking the original Anfinsen experiments, we find that the method used to denature protein in the experiment simply breaks the disulfide bonds, while the helices and sheets remain intact. In other words, denatured proteins still retain all helices and beta sheets, while the primary sequence does not. Although further verification via biological experiments is needed, our results as shown in this study may reveal a new insight for studying protein folding.

  6. Membrane Pore Formation by Amyloid beta (25-35) Peptide

    NASA Astrophysics Data System (ADS)

    Kandel, Nabin; Tatulian, Suren

    Amyloid (A β) peptide contributes to Alzheimer's disease by a yet unidentified mechanism. One of the possible mechanisms of A β toxicity is formation of pores in cellular membranes. We have characterized the formation of pores in phospholipid membranes by the Aβ25 - 35 peptide (GSNKGAIIGLM) using fluorescence, Fourier transform infrared spectroscopy (FTIR) and circular dichroism (CD) techniques. CD and FTIR identified formation of β-sheet structure upon incubation of the peptide in aqueous buffer for 2 hours. Unilamellar vesicles composed of a zwitterionic lipid, 1-palmitoyl-2-oleoyl-phosphatidylcholine (POPC), and 70 % POPC plus 30 % of an acidic lipid, 1-palmitoyl-2-oleoyl-phosphatidylglycerol (POPG), are made in 30 mM CaCl2. Quin-2, a fluorophore that displays increased fluorescence upon Ca2+ binding, is added to the vesicles externally. Peptide addition results in increased Quin-2 fluorescence, which is interpreted by binding of the peptide to the vesicles, pore formation, and Ca2+ leakage. The positive and negative control measurements involve addition of a detergent, Triton X-100, which causes vesicle rupture and release of total calcium, and blank buffer, respectively.

  7. Collective oscillations and the linear and two-dimensional infrared spectra of inhomogeneous beta-sheets.


    Dijkstra, Arend G; Knoester, Jasper


    We numerically calculate the collective amide I oscillations and the associated linear and two-dimensional infrared (2DIR) spectra for model antiparallel beta-sheets and study the effect of inhomogeneity. To visualize the collective vibrational exciton states, a new method is introduced, which proves very useful in classifying the optically dominant states with respect to their symmetry properties and phase relations, even in the absence of exact symmetries. We find that energy (diagonal) and interaction (off-diagonal) disorder may have profoundly different effects on the main peaks in the linear spectrum. We also show that in the 2DIR spectra energy disorder leads to diagonal stretching of the diagonal peaks, while the cross-peaks are typically stretched more horizontally. This offers an explanation for the recently observed overall Z-shape in experimental spectra. Finally, we find that the anharmonic splitting between associated positive and negative features in the 2DIR spectra scales inversely proportionally with the exciton delocalization size imposed by the disorder, thus offering a spectroscopic ruler for this size. PMID:16852179

  8. A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA.

    PubMed Central

    Allen, M D; Yamasaki, K; Ohme-Takagi, M; Tateno, M; Suzuki, M


    The 3D solution structure of the GCC-box binding domain of a protein from Arabidopsis thaliana in complex with its target DNA fragment has been determined by heteronuclear multidimensional NMR in combination with simulated annealing and restrained molecular dynamic calculation. The domain consists of a three-stranded anti-parallel beta-sheet and an alpha-helix packed approximately parallel to the beta-sheet. Arginine and tryptophan residues in the beta-sheet are identified to contact eight of the nine consecutive base pairs in the major groove, and at the same time bind to the sugar phosphate backbones. The target DNA bends slightly at the central CG step, thereby allowing the DNA to follow the curvature of the beta-sheet. PMID:9736626

  9. The crystal structure of human glycosylation-inhibiting factor is a trimeric barrel with three 6-stranded beta-sheets.

    PubMed Central

    Kato, Y; Muto, T; Tomura, T; Tsumura, H; Watarai, H; Mikayama, T; Ishizaka, K; Kuroki, R


    Glycosylation-inhibiting factor (GIF) is a cytokine that is involved in the regulation of IgE synthesis. The crystal structure of recombinant human GIF was determined by the multiple isomorphous replacement method. The structure was refined to an R factor of 0.168 at 1.9 angstrom resolution. The overall structure is seen to consist of three interconnected subunits forming a barrel with three 6-stranded beta-sheets on the inside and six alpha-helices on the outside. There is a 5-angstrom-diameter "hole" through the middle of the barrel. The barrel structure of GIF in part resembles other "trefoil" cytokines such as interleukin 1 and fibroblast growth factor. Each subunit has a new class of alpha + beta sandwich structure consisting of two beta-alpha-beta motifs. These beta-alpha-beta motifs are related by a pseudo-twofold axis and resemble both interleukin 8 and the peptide binding domain of major histocompatibility complex protein, although the topology of the polypeptide chain is quite different. Images Fig. 1 Fig. 3 PMID:8610159

  10. The crystal structure of human glycosylation-inhibiting factor is a trimeric barrel with three 6-stranded beta-sheets.


    Kato, Y; Muto, T; Tomura, T; Tsumura, H; Watarai, H; Mikayama, T; Ishizaka, K; Kuroki, R


    Glycosylation-inhibiting factor (GIF) is a cytokine that is involved in the regulation of IgE synthesis. The crystal structure of recombinant human GIF was determined by the multiple isomorphous replacement method. The structure was refined to an R factor of 0.168 at 1.9 angstrom resolution. The overall structure is seen to consist of three interconnected subunits forming a barrel with three 6-stranded beta-sheets on the inside and six alpha-helices on the outside. There is a 5-angstrom-diameter "hole" through the middle of the barrel. The barrel structure of GIF in part resembles other "trefoil" cytokines such as interleukin 1 and fibroblast growth factor. Each subunit has a new class of alpha + beta sandwich structure consisting of two beta-alpha-beta motifs. These beta-alpha-beta motifs are related by a pseudo-twofold axis and resemble both interleukin 8 and the peptide binding domain of major histocompatibility complex protein, although the topology of the polypeptide chain is quite different. PMID:8610159

  11. [Neutralization of static electricity charged on running vinyl chloride sheet by the use of soft beta-ray sources (author's transl)].


    Itakura, K; Wada, N


    The feasibility of 147Pm and 3H beta-ray sources as static eliminator was experimentally investigated. A sheet of vinyl chloride of 0.1 mm in thickness was used as an example of electrified materials. Its surface charge densities before and after beta-ray neutralization were measured as the function of electrostatic charge changing the speed of the sheet and the distance between the beta-ray source and the sheet. With a 147Pm beta-ray source of 200mCi in effective activity, almost complete neutralization was found for the sheet with the charge density less than 6 X 10(-6) C/m2 running at the speed of 0.18 m/s. In the case of the running speed of 0.5 m/s frequently used in industry, the electrostatic charge below 3 X 10(6) C/m2, where corona discharger is not so effective, was also perfectly eliminated. It was found that the optimal distance between the beta-ray source and the sheet was 10 cm in the case of 147Pm. The use of 3H beta-ray source of 1 Ci was not satisfactory. These results demonstrate that 147 Pm beta-ray source operates most efficiently as static eliminator when the charge density of material and/or its moving speed is not high. PMID:663315

  12. Current Sheet Formation in a Conical Theta Pinch Faraday Accelerator with Radio-frequency Assisted Discharge

    NASA Technical Reports Server (NTRS)

    Polzin, Kurt A.; Hallock, Ashley K.; Choueiri, Edgar Y.


    Data from an inductive conical theta pinch accelerator are presented to gain insight into the process of inductive current sheet formation in the presence of a preionized background gas produced by a steady-state RF-discharge. The presence of a preionized plasma has been previously shown to allow for current sheet formation at lower discharge voltages and energies than those found in other pulsed inductive accelerator concepts, leading to greater accelerator efficiencies at lower power levels. Time-resolved magnetic probe measurements are obtained for different background pressures and pulse energies to characterize the effects of these parameters on current sheet formation. Indices are defined that describe time-resolved current sheet characteristics, such as the total current owing in the current sheet, the time-integrated total current ('strength'), and current sheet velocity. It is found that for a given electric field strength, maximums in total current, strength, and velocity occur for one particular background pressure. At other pressures, these current sheet indices are considerably smaller. The trends observed in these indices are explained in terms of the principles behind Townsend breakdown that lead to a dependence on the ratio of the electric field to the background pressure. Time-integrated photographic data are also obtained at the same experimental conditions, and qualitatively they compare quite favorably with the time-resolved magnetic field data.

  13. The peculiarities of formation of thin current sheet in the Earth's magnetotail

    NASA Astrophysics Data System (ADS)

    Kropotkin, Alexey; Artemyev, Anton; Malova, Helmi; Domrin, Vladimir

    We investigate the process of self-consistent thinning of magnetotail current sheet in the presence of the evolving magnetic field normal component Bz, which usually decreases during the substorm growth phase. Using PIC codes to describe plasma processes with ions becoming demagnetized and electrons being considered as the cold neutralizing background, we show that the appearance of the self-consistent electric field component inside CS can lead to the current sheet thinning and to the appearance of an extremely thin current sheet with thickness close to the ion gyroradius. Due to particle [ExB] drift during the current sheet evolution, the enhanced trapping of ions near the current sheet central plane takes place. It is shown that the density of quasi-trapped particles around current sheet at the final stage depends on both the value of the initial magnetic field normal component Bz, and the speed of the Bz decrease. If the initial magnetic field normal component is less than about 0.14 of the tangential field at the edges, the trapped plasma density near the current sheet is small. As a result, the above mentioned extremely thin current sheet is formed. In the opposite case, when the initial normal component related to the tangential field is larger than 0.14, the density of trapped particles is much higher, which produces effective thickening of the current sheet. In both cases transient (Speiser) ions are the main current carriers, but in the second case local diamagnetic currents of the trapped plasma perturb the сurrent sheet profile making it thicker. Also trapped particles can be responsible for intense negative currents at the current sheet edges. During the Bz decrease, an additional effect of ion polarization drifts in the Y direction can compete with these negative diamagnetic fields of quasi-trapped ions. Therefore the ion dynamics is probably the general mechanism which contributes to the formation of thin current sheet and its fine structure.

  14. Spontaneous formation of electric current sheets and the origin of solar flares

    NASA Technical Reports Server (NTRS)

    Low, B. C.; Wolfson, R.


    It is demonstrated that the continuous boundary motion of a sheared magnetic field in a tenuous plasma with an infinite electrical conductivity can induce the formation of multiple electric current sheets in the interior plasma. In response to specific footpoint displacements, the quadrupolar magnetic field considered is shown to require the formation of multiple electric current sheets as it achieves a force-free state. Some of the current sheets are found to be of finite length, running along separatrix lines of force which separate lobes of magnetic flux. It is suggested that current sheets in the form of infinitely thin magnetic shear layers may be unstable to resistive tearing, a process which may have application to solar flares.

  15. Ballooning Instability Induced Plasmoid Formation in Near-Earth Plasma Sheet*

    NASA Astrophysics Data System (ADS)

    Zhu, P.; Raeder, J.


    The formation of plasmoids in the near-Earth magnetotail is believed to be a key element of the substorm onset process. The physical mechanism of plasmoid formation in the plasma sheet has remained a subject of considerable interests and investigations. Previous work has identified a new scenario in MHD simulations where the nonlinear evolution of a ballooning instability is able to induce the formation of plasmoids in a generalized Harris sheet with finite normal magnetic component [1]. In present work, we further examine this novel mechanism for plasmoid formation and explore its implications in the context of substorm onset trigger problem. For that purpose, we adopt the generalized Harris sheet as a model proxy to the near-Earth region of magnetotail during the substorm growth phase. In this region the magnetic component normal to the neutral sheet Bn is weak but nonzero. The magnetic field lines are closed and there are no X-lines. Simulation results indicate that in the higher Lundquist number regime, the linear axial tail mode, which is also known as ``two-dimensional resistive tearing mode'', is stabilized by the finite Bn, hence cannot give rise to the formation of X-lines or plasmoids by itself. On the other hand, the linear ballooning mode is unstable in the same regime, and in its nonlinear stage, the tailward stretching of the plasma sheet in the closed field line region due to the growing ballooning finger structures tends to accelerate the thinning of the near-Earth current sheet. This eventually leads to the formation of a series of plasmoid structures in the near-Earth and middle magnetotail regions of plasma sheet. This new scenario of plasmoid formation suggests a critical role of ballooning instability in the near-Earth plasma sheet in triggering the onset of a substorm expansion. [1] P. Zhu and J. Raeder, Plasmoid formation in current sheet with finite normal magnetic component, Phys. Rev. Lett. 110, 235005 (2013). *Supported by NSF grants AGS

  16. Engineering of betabellin-15D: a 64 residue beta sheet protein that forms long narrow multimeric fibrils.

    PubMed Central

    Lim, A.; Saderholm, M. J.; Makhov, A. M.; Kroll, M.; Yan, Y.; Perera, L.; Griffith, J. D.; Erickson, B. W.


    The betabellin target structure is a beta-sandwich protein consisting of two 32 residue beta-sheets packed against one another by interaction of their hydrophobic faces. The 32 residue chain of betabellin-15S (HSLTAKIpkLTFSIAphTYTCAV pkYTAKVSH, where p=DPro, k=DLys, and h=DHis) did not fold in water at pH 6.5. Air oxidation of betabellin-15S provided betabellin-15D, the 64 residue disulfide bridged two-chain molecule, which also remained unfolded in water at pH 6.5. By circular dichroic spectropolarimetry, the extent of beta structure observed for betabellin-15D increased with the pH and ionic strength of the solution and the betabellin-15D concentration. By electron microscopy, in 5.0 mM MOPS and 0.25 M NaCl at pH 6.9, betabellin-15D formed long narrow multimeric fibrils. A molecular model was constructed to show that the dimensions of these betabellin-15D fibrils are consistent with a single row of beta-sandwich molecules joined by multiple intersheet H-bonds. PMID:9684887

  17. [Effect of synthetic beta-carotene on the formation of cytolytic T-lymphocytes].


    Efimov, S A; Vakulova, L A; Rytenko, A N; Samokhvalov, G I; Sergeev, I M


    The effect of intraperitoneal injection of beta-carotene in different doses on the formation of cytolytic T lymphocytes (CTL) in a one-way mixed lymphocyte culture (MLC) of allogeneic mice was studied. The maximal cytotoxic activity of lymphocytes was attained in the MLC with splenocytes of mice which received 10 mg/kg beta-carotene 6 days before experimentation. The correlation was studied between the beta-carotene ability to stimulate CTL formation and antineoplastic activity. It was discovered that injection of beta-carotene in doses and times provoking maximal CTL induction had no effect on the animals' lifespan and the size of transplanted sarcoma 180. PMID:6234949

  18. The formation of wrinkles in single-layer graphene sheets under nanoindentation

    NASA Astrophysics Data System (ADS)

    Gil, A. J.; Adhikari, S.; Scarpa, F.; Bonet, J.


    We investigate the formation of wrinkles and bulging in single-layer graphene sheets using an equivalent atomistic continuum nonlinear hyperelastic theory for nanoindentation and nanopressurization. We show that nonlinear geometrical effects play a key role in the development of wrinkles. Without abandoning the classical tension field membrane theory, we develop an enhanced model based upon the minimization of a relaxed energy functional in conjunction with nonlinear finite hyperelasticity. Formation of wrinkles are observed in rectangular graphene sheets due to the combination of induced membrane tension and edge effects under external pressure.

  19. Relating thin current sheet formation and tail reconnection to substorm development

    SciTech Connect

    Birn, J.; Schindler, K.


    Observations and simulations have demonstrated the important role of thin current sheet formation and magnetic reconnection in the course of substorms. We discuss new results on the formation of thin current sheets, obtained both within MHD and kinetic theory. They demonstrate when kinetic effects become important and indicate the possibility of a catastrophic onset of substorm dynamics and the potential association with arc brightening. MHD simulations show the role of reconnection in the buildup of the substorm current wedge and the influence of the underlying configuration on the quasi-static and dynamic evolution.

  20. Magnetic quadrupole formation of low-voltage sheet electron beams for high-power microwave devices

    SciTech Connect

    Basten, M.A.; Booske, J.H.; Anderson, J.; Joe, J.; Scharer, J.E.


    Sheet electron beams have the potential to make possible higher power sources of microwave radiation due to their ability to transport high currents, at reduced current densities, through a single narrow RF interaction circuit. Possible microwave device applications using sheet electron beams include sheet-beam klystrons, grating TWT`s, and planar FELs. One difficulty with the experimental investigation and implementation of sheet beams is the lack of a satisfactory source for large aspect-ratio beams. An attractive solution is the use of magnetic quadrupoles to transform an initially round beam from a conventional Pierce gun into a highly eccentric elliptical beam. Both 2-D envelope simulations and 3-D envelope and PIC code simulations indicate that this is a viable method of sheet beam formation, particularly for experimental investigations where flexibility and low-cost fabrication is desired. The authors are currently constructing a system to experimentally test this method. Features of the experiment include a low-cost commercially available Pierce gun, a four quadrupole sheet beam-forming system, and a highly elliptical output beam. Results of the 3-D PIC simulations of the beam and 3-D magnetostatic finite-element simulations of the quadrupole fringe fields will be discussed. Details of the experimental design and initial experimental measurements are presented.

  1. Beta-D-Allose inhibits fruiting body formation and sporulation in Myxococcus xanthus.


    Chavira, Marielena; Cao, Nga; Le, Karen; Riar, Tanveer; Moradshahi, Navid; McBride, Melinda; Lux, Renate; Shi, Wenyuan


    Myxococcus xanthus, a gram-negative soil bacterium, responds to amino acid starvation by entering a process of multicellular development which culminates in the assembly of spore-filled fruiting bodies. Previous studies utilizing developmental inhibitors (such as methionine, lysine, or threonine) have revealed important clues about the mechanisms involved in fruiting body formation. We used Biolog phenotype microarrays to screen 384 chemicals for complete inhibition of fruiting body development in M. xanthus. Here, we report the identification of a novel inhibitor of fruiting body formation and sporulation, beta-d-allose. beta-d-Allose, a rare sugar, is a member of the aldohexose family and a C3 epimer of glucose. Our studies show that beta-d-allose does not affect cell growth, viability, agglutination, or motility. However, beta-galactosidase reporters demonstrate that genes activated between 4 and 14 h of development show significantly lower expression levels in the presence of beta-d-allose. Furthermore, inhibition of fruiting body formation occurs only when beta-d-allose is added to submerged cultures before 12 h of development. In competition studies, high concentrations of galactose and xylose antagonize the nonfruiting response to beta-d-allose, while glucose is capable of partial antagonism. Finally, a magellan-4 transposon mutagenesis screen identified glcK, a putative glucokinase gene, required for beta-d-allose-mediated inhibition of fruiting body formation. Subsequent glucokinase activity assays of the glcK mutant further supported the role of this protein in glucose phosphorylation. PMID:17056749

  2. Formation and function of the Rbl2p-beta-tubulin complex.


    Archer, J E; Magendantz, M; Vega, L R; Solomon, F


    The yeast protein Rbl2p suppresses the deleterious effects of excess beta-tubulin as efficiently as does alpha-tubulin. Both in vivo and in vitro, Rbl2p forms a complex with beta-tubulin that does not contain alpha-tubulin, thus defining a second pool of beta-tubulin in the cell. Formation of the complex depends upon the conformation of beta-tubulin. Newly synthesized beta-tubulin can bind to Rbl2p before it binds to alpha-tubulin. Rbl2p can also bind beta-tubulin from the alpha/beta-tubulin heterodimer, apparently by competing with alpha-tubulin. The Rbl2p-beta-tubulin complex has a half-life of approximately 2.5 h and is less stable than the alpha/beta-tubulin heterodimer. The results of our experiments explain both how excess Rbl2p can rescue cells overexpressing beta-tubulin and how it can be deleterious in a wild-type background. They also suggest that the Rbl2p-beta-tubulin complex is part of a cellular mechanism for regulating the levels and dimerization of tubulin chains. PMID:9488492

  3. Most of the structural elements of the globular domain of murine prion protein form fibrils with predominant beta-sheet structure.


    Jamin, Nadège; Coïc, Yves-Marie; Landon, Céline; Ovtracht, Ludmila; Baleux, Françoise; Neumann, Jean-Michel; Sanson, Alain


    The conversion of the cellular prion protein into the beta-sheet-rich scrapie prion protein is thought to be the key step in the pathogenesis of prion diseases. To gain insight into this structural conversion, we analyzed the intrinsic structural propensity of the amino acid sequence of the murine prion C-terminal domain. For that purpose, this globular domain was dissected into its secondary structural elements and the structural propensity of the protein fragments was determined. Our results show that all these fragments, excepted that strictly encompassing helix 1, have a very high propensity to form structured aggregates with a dominant content of beta-sheet structures. PMID:12372610

  4. The palladium assisted transfer reduction of. alpha. ,. beta. -unsaturated nitroalkenes to oximes using ammonium formate

    SciTech Connect

    Kabalka, G.W.; Pace, R.D.; Wadgaonkar, P.P. )


    {alpha},{beta}-Unsaturated nitroalkenes are readily reduced to the corresponding oximes in good yields using ammonium formate in the presence of palladium. The reactions occur rapidly at room temperature in a solvent system of methanol and tetrahydrofuran.

  5. Bond formation in ultrasonically welded aluminum sheet metal

    NASA Astrophysics Data System (ADS)

    Wilkosz, Daniel Edward

    Ultrasonic welding (USW), a solid state joining technology, has been used to bond aluminum alloys commonly used in the automotive industry. Bonding occurs due to USW's high frequency (˜20 kHz) in-plane vibration of sample interfaces while being held under moderate clamp pressure normal to the plane of vibration. Vibration and clamp pressure are transmitted into bond formation via contact with a weld-tip. To better understand how weld-tip geometry affected bond formation, experiments were conducted to quantify how tip geometry influenced plastic deformation characteristics between fully welded coupons of 0.9mm thick AA6111-T4 aluminum alloy. Weld-interface microstructure features were documented by optical microscopy and features quantified in a 19 point matrix. Correlation between microstructure features, such as rolling-wakes, and resulting weld bond strengths of more than 3.0kN is made. Weld zone microstructure features appear to result from deformation at and severe migration of the original weld interface during USW. To confirm this hypothesis, intrinsic and extrinsic markers were employed to monitor weld interface deformation characteristics. Various physical and analytical techniques were used in conjunction with these markers to show that joining of "like" and "dislike" aluminum samples is achieved through mechanical mixing of mating interfaces and not by elemental diffusion. It is also hypothesized that severe deformation of the original interface would result in areas of high residual strain within a formed weld zone. To investigate this and the influence that tip geometry may have on residual strain, fully welded samples were annealed at 500°C for a controlled period of time and recovery, recrystallization and grain growth characteristics were monitored. In all welds, initial recrystallization and grain growth occurred at the outer ends of weld zones and along weld interfaces where the most turbulent mixing and grain size reduction was observed

  6. EGCG Inhibited Lipofuscin Formation Based on Intercepting Amyloidogenic β-Sheet-Rich Structure Conversion

    PubMed Central

    Cai, Shuxian; Yang, Heng; Zeng, Kewu; Zhang, Jing; Zhong, Ni; Wang, Yingzi; Ye, Jing; Tu, Pengfei; Liu, Zhonghua


    Background Lipofuscin (LF) is formed during lipid peroxidation and sugar glycosylation by carbonyl-amino crosslinks with biomacrolecules, and accumulates slowly within postmitotic cells. The environmental pollution, modern dietary culture and lifestyle changes have been found to be the major sources of reactive carbonyl compounds in vivo. Irreversible carbonyl-amino crosslinks induced by carbonyl stress are essentially toxiferous for aging-related functional losses in modern society. Results show that (-)-epigallocatechin gallate (EGCG), the main polyphenol in green tea, can neutralize the carbonyl-amino cross-linking reaction and inhibit LF formation, but the underlying mechanism is unknown. Methods and Results We explored the mechanism of the neutralization process from protein, cell, and animal levels using spectrofluorometry, infrared spectroscopy, conformation antibodies, and electron microscopy. LF demonstrated an amyloidogenic β-sheet-rich with antiparallel structure, which accelerated the carbonyl-amino crosslinks formation and disrupted proteolysis in both PC12 cells and D-galactose (D-gal)-induced brain aging mice models. Additionally, EGCG effectively inhibited the formation of the amyloidogenic β-sheet-rich structure of LF, and prevented its conversion into toxic and on-pathway aggregation intermediates, thereby cutting off the carbonyl-amino crosslinks. Conclusions Our study indicated that the amyloidogenic β-sheet structure of LF may be the core driving force for carbonyl-amino crosslinks further formation, which mediates the formation of amyloid fibrils from native state of biomacrolecules. That EGCG exhibits anti-amyloidogenic β-sheet-rich structure properties to prevent the LF formation represents a novel strategy to impede the development of degenerative processes caused by ageing or stress-induced premature senescence in modern environments. PMID:27030967

  7. The imidazole role in strontium beta-diketonate complexes formation.


    Marchetti, Fabio; Pettinari, Claudio; Pettinari, Riccardo; Cingolani, Augusto; Gobetto, Roberto; Chierotti, Michele R; Drozdov, Andrei; Troyanov, Sergey I


    A selection of new strontium beta-diketonate derivatives (imH2)2[Sr2(beta-dike)6] [where imH = imidazole and beta-dike = tfac (tfacH = 1,1,1-trifluoro-2,4-pentanedione), tfbz (tfbzH = 1,1,1-trifluoro-4-phenyl-2,4-butanedione), or hfac (hfacH = 1,1,1,5,5,5-hexafluoro-2,4-pentanedione)], [Sr2(tfac)4(Meim)2(H2O)2], (MeimH)2[Sr(beta-dike)4] (where Meim = 1-methylimidazole and beta-dike = tfbz or hfac), [Sr2(thd)4(imH)2(EtOH)], and [Sr2(thd)4(Meim)2(EtOH)] (where thdH = 2,2,6,6-tetramethyl-3,5-heptanedione) have been synthesized and fully characterized. (imH2)2[Sr2(beta-dike)6] and (MeimH)2[Sr(beta-dike)4] are di- and mononuclear Sr anionic complexes, respectively, while [Sr2(tfac)4(Meim)2(H2O)2], [Sr2(thd)4(imH)2(EtOH)], and [Sr2(thd)4(Meim)2(EtOH)] are neutral dinuclear molecular derivatives. The derivative (imH2)2[Sr2(hfac)6] slowly decomposes in solution under aerobic conditions, giving (imH2)2[Sr(H2O)2(tfa)3](tfa) (tfaH = trifluoroacetic acid), which is an ionic compound containing polynuclear anionic chains composed of Sr(H2O)2(tfa)3 units. When a deficiency of imH is employed, the thdH proligand forms not only the dinuclear derivative [Sr2(thd)4(imH)2(EtOH)] but also an additional product with the formula [Sr(thd)2(H2O)2(EtOH)], in which the Sr atom is seven-coordinated. A complete solid-state characterization has been accomplished by comparing X-ray and solid-state 13C NMR data. Elucidation of the H-bond interaction between the heterocyclic rings and metal complexes by cross-polarization magic-angle-spinning 15N NMR is also reported. PMID:16562964

  8. Self-organization in space plasma: formation of magnetic shear in current sheets

    NASA Astrophysics Data System (ADS)

    Zelenyi, Lev; Delcourt, Dominique; Mingalev, Oleg; Malova, Helmi; Popov, Victor; Grigorenko, Elena; Petrukovich, Anatoli


    Thin current sheets are plasma structures that usually appear near reconnection regions. The presence of the shear magnetic field is characteristic for these structures. Self-consistent kinetic model of magnetotail thin current sheet (TCS) is used to understand the mechanisms of self-organization of sheared thin current sheets in a space plasma. It is shown that these configurations appear as a result of self-consistent evolution of some initial magnetic perturbation at current sheet center. Two general shapes of shear TCS components are found as a function of the transverse coordinate: symmetric and antisymmetric. We show that TCS formation goes together with the emergence of field-aligned currents in the center of the current sheet, as a result of north-south asymmetry of quasi-adiabatic ion motions. Ion drift currents can also contribute to the magnetic shear evolution, but their role is much less significant, their contribution depending upon the normal component Bz and the amplitude of the initial perturbation in TCS. Parametric maps illustrating different types of TCS equilibria are presented.

  9. Designed α-sheet peptides inhibit amyloid formation by targeting toxic oligomers

    PubMed Central

    Hopping, Gene; Kellock, Jackson; Barnwal, Ravi Pratap; Law, Peter; Bryers, James; Varani, Gabriele; Caughey, Byron; Daggett, Valerie


    Previous studies suggest that the toxic soluble-oligomeric form of different amyloid proteins share a common backbone conformation, but the amorphous nature of this oligomer prevents its structural characterization by experiment. Based on molecular dynamics simulations we proposed that toxic intermediates of different amyloid proteins adopt a common, nonstandard secondary structure, called α-sheet. Here we report the experimental characterization of peptides designed to be complementary to the α-sheet conformation observed in the simulations. We demonstrate inhibition of aggregation in two different amyloid systems, β-amyloid peptide (Aβ) and transthyretin, by these designed α-sheet peptides. When immobilized the α-sheet designs preferentially bind species from solutions enriched in the toxic conformer compared with non-aggregated, nontoxic species or mature fibrils. The designs display characteristic spectroscopic signatures distinguishing them from conventional secondary structures, supporting α-sheet as a structure involved in the toxic oligomer stage of amyloid formation and paving the way for novel therapeutics and diagnostics. DOI: PMID:25027691


    SciTech Connect

    Edmondson, J. K.; Antiochos, S. K.; DeVore, C. R.; Zurbuchen, T. H.


    Current-sheet formation and magnetic reconnection are believed to be the basic physical processes responsible for much of the activity observed in astrophysical plasmas, such as the Sun's corona. We investigate these processes for a magnetic configuration consisting of a uniform background field and an embedded line dipole, a topology that is expected to be ubiquitous in the corona. This magnetic system is driven by a uniform horizontal flow applied at the line-tied photosphere. Although both the initial field and the driver are translationally symmetric, the resulting evolution is calculated using a fully three-dimensional (3D) magnetohydrodynamic simulation with adaptive mesh refinement that resolves the current sheet and reconnection dynamics in detail. The advantage of our approach is that it allows us to directly apply the vast body of knowledge gained from the many studies of two-dimensional (2D) reconnection to the fully 3D case. We find that a current sheet forms in close analogy to the classic Syrovatskii 2D mechanism, but the resulting evolution is different than expected. The current sheet is globally stable, showing no evidence for a disruption or a secondary instability even for aspect ratios as high as 80:1. The global evolution generally follows the standard Sweet-Parker 2D reconnection model except for an accelerated reconnection rate at a very thin current sheet, due to the tearing instability and the formation of magnetic islands. An interesting conclusion is that despite the formation of fully 3D structures at small scales, the system remains close to 2D at global scales. We discuss the implications of our results for observations of the solar corona.

  11. Formation and Reconnection of Three-Dimensional Current Sheets in the Solar Corona

    NASA Technical Reports Server (NTRS)

    Edmondson, J. K.; Antiochos, S. K.; DeVore, C. R.; Zurbuchen, T. H.


    Current-sheet formation and magnetic reconnection are believed to be the basic physical processes responsible for much of the activity observed in astrophysical plasmas, such as the Sun s corona. We investigate these processes for a magnetic configuration consisting of a uniform background field and an embedded line dipole, a topology that is expected to be ubiquitous in the corona. This magnetic system is driven by a uniform horizontal flow applied at the line-tied photosphere. Although both the initial field and the driver are translationally symmetric, the resulting evolution is calculated using a fully three-dimensional magnetohydrodynamic (3D MHD) simulation with adaptive mesh refinement that resolves the current sheet and reconnection dynamics in detail. The advantage of our approach is that it allows us to apply directly the vast body of knowledge gained from the many studies of 2D reconnection to the fully 3D case. We find that a current sheet forms in close analogy to the classic Syrovatskii 2D mechanism, but the resulting evolution is different than expected. The current sheet is globally stable, showing no evidence for a disruption or a secondary instability even for aspect ratios as high as 80:1. The global evolution generally follows the standard Sweet- Parker 2D reconnection model except for an accelerated reconnection rate at a very thin current sheet, due to the tearing instability and the formation of magnetic islands. An interesting conclusion is that despite the formation of fully 3D structures at small scales, the system remains close to 2D at global scales. We discuss the implications of our results for observations of the solar corona. Subject Headings: Sun: corona Sun: magnetic fields Sun: reconnection

  12. Probing the Nanosecond Dynamics of a Designed Three-Stranded Beta-Sheet with a Massively Parallel Molecular Dynamics Simulation

    PubMed Central

    Voelz, Vincent A.; Luttmann, Edgar; Bowman, Gregory R.; Pande, Vijay S.


    Recently a temperature-jump FTIR study of a designed three-stranded sheet showing a fast relaxation time of ~140 ± 20 ns was published. We performed massively parallel molecular dynamics simulations in explicit solvent to probe the structural events involved in this relaxation. While our simulations produce similar relaxation rates, the structural ensemble is broad. We observe the formation of turn structure, but only very weak interaction in the strand regions, which is consistent with the lack of strong backbone-backbone NOEs in previous structural NMR studies. These results suggest that either DPDP-II folds at time scales longer than 240 ns, or that DPDP-II is not a well-defined three-stranded β-sheet. This work also provides an opportunity to compare the performance of several popular forcefield models against one another. PMID:19399235

  13. Nature of Axial Tail Instability and Bubble-Blob Formation in Near-Earth Plasma Sheet*

    NASA Astrophysics Data System (ADS)

    Zhu, P.; Raeder, J.; Hegna, C. C.; Sovinec, C. R.


    Previous global MHD simulations of substorm events have identified the dynamic presence of an axial tail instability with dawn-dusk symmetry in the near-Earth plasma sheet as a major cause of the initial loss of MHD equilibrium on closed field lines prior to the subsequent magnetic reconnection and substorm expansion onset processes [Raeder et al. 2010; Siscoe et al. 2009]. In this work, energy principle analysis indicates that a two-dimensional thin current sheet configuration in the magnetotail is typically stable to the axial mode within the framework of ideal MHD model. Linear resistive MHD calculations find axial tail instabilities on closed field lines in the generalized Harris sheet configurations. The properties of these instabilities are similar to the axial tail modes observed in the global MHD simulations. The axial tail mode is unstable in regimes of low Lundquist number and regions with small normal component of magnetic field. Mode growth and structure show both similarities and differences in comparison to the linear resistive tearing mode of a one-dimensional Harris sheet. Unlike the conventional tearing mode of Harris sheet, the linear axial tail instability does not involve any reconnection process. Instead, the nature of the mode is dominantly an interchange or slippage process among neighboring flux tubes as facilitated by dissipations such as resistivity. The formation of bubble-blob pairs in pressure and entropy distributions in the near-Earth plasma sheet is shown to be a natural component as well as consequence of this axial instability process. *Supported by NSF grants AGS-0902360 and PHY-0821899. REFERENCES: Raeder, J., P. Zhu, Y. Ge, and G. Siscoe (2010), Open Geospace General Circulation Model simulation of a substorm: Axial tail instability and ballooning mode preceding substorm onset, J. Geophys. Res., 115, A00I16, doi:10.1029/2010JA015876. Siscoe, G. L., M. M. Kuznetsova, and J. Raeder (2009), Search for an onset mechanism that

  14. Radical Formation Initiates Solvent-Dependent Unfolding and β-sheet Formation in a Model Helical Peptide.


    Owen, Michael C; Strodel, Birgit; Csizmadia, Imre G; Viskolcz, Béla


    We examined the effects of Cα-centered radical formation on the stability of a model helical peptide, N-Ac-KK(AL)10KK-NH2. Three, 100 ns molecular dynamics simulations using the OPLS-AA force field were carried out on each α-helical peptide in six distinct binary TIP4P water/2,2,2-trifluoroethanol (TFE) mixtures. The α-helicity was at a maximum in 20% TFE, which was inversely proportional to the number of H-bonds between water molecules and the peptide backbone. The radial distribution of TFE around the peptide backbone was highest in 20% TFE, which enhanced helix stability. The Cα-centered radical initiated the formation of a turn within 5 ns, which was a smaller kink at high TFE concentrations, and a loop at lower TFE concentrations. The highest helicity of the peptide radical was measured in 100% TFE. The formation of hydrogen bonds between the peptide backbone and water destabilized the helix, whereas the clustering of TFE molecules around the radical center stabilized the helix. Following radical termination, the once helical structure converted to a β-sheet rich state in 100% water only, and this transition did not occur in the nonradical control peptide. This study gives evidence on how the formation of peptide radicals can initiate α-helical to β-sheet transitions under oxidative stress conditions. PMID:27169334

  15. Formation and Degradation of Beta-casomorphins in Dairy Processing

    PubMed Central

    Nguyen, Duc Doan; Johnson, Stuart Keith; Busetti, Francesco; Solah, Vicky Ann


    Milk proteins including casein are sources of peptides with bioactivity. One of these peptides is beta-casomorphin (BCM) which belongs to a group of opioid peptides formed from β-casein variants. Beta-casomorphin 7 (BCM7) has been demonstrated to be enzymatically released from the A1 or B β-casein variant. Epidemiological evidence suggests the peptide BCM 7 is a risk factor for development of human diseases, including increased risk of type 1 diabetes and cardiovascular diseases but this has not been thoroughly substantiated by research studies. High performance liquid chromatography coupled to UV-Vis and mass spectrometry detection as well as enzyme–linked immunosorbent assay (ELISA) has been used to analyze BCMs in dairy products. BCMs have been detected in raw cow's milk and human milk and a variety of commercial cheeses, but their presence has yet to be confirmed in commercial yoghurts. The finding that BCMs are present in cheese suggests they could also form in yoghurt, but be degraded during yoghurt processing. Whether BCMs do form in yoghurt and the amount of BCM forming or degrading at different processing steps needs further investigation and possibly will depend on the heat treatment and fermentation process used, but it remains an intriguing unknown. PMID:25077377

  16. Landscape formation by past continental ice sheets: insights into the subglacial environment

    NASA Astrophysics Data System (ADS)

    Piotrowski, Jan A.


    Glaciers and ice sheets are known as most powerful, climatically driven agents of large-scale sediment redistribution and landscape formation in the Earth system. During the Quaternary, repeated waxing and waning of continental ice sheets contributed to profound reshaping of the Earth surface and set the scene for the development of ecosystems in the post-glacial time. Despite the well-established impact of glaciers on the upper lithosphere the specific processes of glacial erosion, transport and deposition and the formation landforms at the ice-bed interface are contentious. In particular, the relative importance of direct ice impact versus the impact of glacial meltwater is highly controversial. Here, we focus on the southern peripheral area of the Scandinavian Ice Sheet hosting thick successions of soft, deformable sediments and examine some spectacular sediment/landform assemblages found nowadays in both terrestrial and marine settings to illustrate the nature of the subglacial processes. In order to decipher the past ice sheet behavior field, experimental and numerical approaches are combined. It is shown that the strength of the coupling between the ice and the bed that controls the response of the substratum to ice overriding and stress propagation depends primarily on the ability of the glacial system to evacuate meltwater from ice-bed interface. Strong coupling, locally enhanced by subglacial permafrost resulted in deeply rooted (100's of meters) glaciotectonic deformation reflected on the surface as ice-shoved hills whereas weak coupling promoted by water accumulating under the ice triggered the formation of deep (100's of meters) tunnel valley networks. Under the arteries of fast-flowing ice known as palaeo-ice streams, remoulding of soft sediments generated mega-scale glacial lineations and drumlins that hold the key to understanding glacier dynamics. The subglacial environment is envisaged as a four-dimensional mosaic of stable and deforming spots

  17. Magnetic quadrupole formation of elliptical sheet electron beams for high-power microwave devices

    SciTech Connect

    Basten, M.A.; Booske, J.H.; Anderson, J. . Electrical and Computer Engineering Dept.)


    Sheet electron beams are attractive for high-power microwave sources due to their ability to transport high current, at reduced current density, through thin clearance apertures and in close proximity to walls or RF structures. This paper reports on the theoretical investigation of magnetic quadrupole formation of elliptical sheet electron beams for use in high-power microwave devices. The beam envelope equations for an initially round beam passing through a physical non-symmetric quadrupole pair in the presence of space-charge, finite beam emittance, and under the effects of third-order field components and longitudinal velocity variations are presented. The presence of space-charge compensates for over-focusing in the thin beam-dimension and allows for the formation of highly elliptic sheet electron beams. As an example, the results of the study were applied to an existing Pierce gun source with a beam radius of 0.6 cm, beam energy of 10 keV and current density of 2.0 A/cm[sup 2]. The authors find that an elliptical beam with major radius r[sub a] = 3.61 cm, minor radius r[sub b] = 0.16 cm and ellipticity (r[sub a]/r[sub b]) of 22.5 can be produced with only modest quadrupole gradients of 64 G/cm and 18 G/cm. Quadrupole formation of elliptical sheet-beams may be particularly suited for experimental research applications since existing round-beam electron guns may be used and changes in beam ellipticity may be made without breaking the vacuum system.

  18. Current sheet Formation in a Conical Theta Pinch Faraday Accelerator with Radio-Frequency Assisted Discharge

    NASA Technical Reports Server (NTRS)

    Hallock, Ashley K.; Choueiri, Edgar Y.; Polzin, Kurt A.


    The inductive formation of current sheets in a conical theta pinch FARAD (Faraday Accelerator with Radio-frequency Assisted Discharge) thruster is investigated experimentally with time-integrated photography. The goal is to help in understanding the mechanisms and conditions controlling the strength and extent of the current sheet, which are two indices important for FARAD as a propulsion concept. The profiles of these two indices along the inside walls of the conical acceleration coil are assumed to be related to the profiles of the strength and extent of the luminosity pattern derived from photographs of the discharge. The variations of these profiles as a function of uniform back-fill neutral pressure (with no background magnetic field and all parameters held constant) provided the first clues on the nature and qualitative dependencies of current sheet formation. It was found that there is an optimal pressure for which both indices reach a maximum and that the rate of change in these indices with pressure differs on either side of this optimal pressure. This allowed the inference that current sheet formation follows a Townsend-like breakdown mechanism modified by the existence of a finite pressure-dependent radio-frequency-generated electron density background. The observation that the effective location of the luminosity pattern favors the exit-half of the conical coil is explained as the result of the tendency of the inductive discharge circuit to operate near its minimal self-inductance. Movement of the peak in the luminosity pattern towards the upstream side of the cone with increasing pressure is believed to result from the need of the circuit to compensate for the increase in background plasma resistivity due to increasing pressure.

  19. In Search of the Attributes Responsible for Sliver Formation in Cold Rolled Steel Sheets

    NASA Astrophysics Data System (ADS)

    Mohanty, Itishree; Das, Prasun; Bhattacharjee, Debashish; Datta, Shubhabrata


    Surface quality is one of the most important characteristics of cold rolled (CR) steel sheets for its application in consumer goods industries. The actual cause of sliver formation is very difficult to determine, as it is revealed only after the final cold rolling of the steel. A thorough investigation on searching the root cause of sliver formation in CR steel is done here using several statistical tools towards mining the industrial data for extraction of knowledge. As the complex interactions between the variables make it difficult to identify the cause, it is seen that findings from different techniques differed to a certain extent. Still it is revealed that 21 variables could be short listed as major contributor for sliver formation, but those are found to be from all the areas of the processing. This leads to the conclusion that no particular process variable or particular processing could be held responsible for sliver formation.

  20. Conditions for the formation of nongyrotropic current sheets in slowly evolving plasmas

    NASA Astrophysics Data System (ADS)

    Schindler, Karl; Hesse, Michael


    This paper addresses the formation of nongyrotropic current sheets resulting from slow external driving. The medium is a collisionless plasma with one spatial dimension and a three-dimensional velocity space. The study is based on particle simulation and an analytical approach. Earlier results that apply to compression of an initial Harris sheet are generalized in several ways. In a first step a general sufficient criterion for the presence of extra ion and electron currents due to nongyrotropic plasma conditions is derived. Then cases with antisymmetric magnetic and electric fields are considered. After establishing consistency of the criterion with the earlier case, the usefulness of this concept is illustrated in detail by two further particle simulations. The results indicate that the formation of nongyrotropic current sheets is a ubiquitous phenomenon for plasmas with antisymmetric fields that have evolved slowly from initial gyrotropic states. A fourth case concerns a plasma with a unidirectional magnetic field. Consistent with the general criterion, the observed final state is fluidlike in that it is approximately gyrotropic. Momentum balance is shown to include a contribution that results from accumulation of an off-diagonal pressure tensor component during the evolution. Heat flux also plays an important role.

  1. Addition of Adipose-Derived Stem Cells to Mesenchymal Stem Cell Sheets Improves Bone Formation at an Ectopic Site

    PubMed Central

    Wang, Zhifa; Li, Zhijin; Dai, Taiqiang; Zong, Chunlin; Liu, Yanpu; Liu, Bin


    To determine the effect of adipose-derived stem cells (ADSCs) added to bone marrow-derived mesenchymal stem cell (MSC) sheets on bone formation at an ectopic site. We isolated MSCs and ADSCs from the same rabbits. We then prepared MSC sheets for implantation with or without ADSCs subcutaneously in the backs of severe combined immunodeficiency (SCID) mice. We assessed bone formation at eight weeks after implantation by micro-computed tomography and histological analysis. In osteogenic medium, MSCs grew to form multilayer sheets containing many calcium nodules. MSC sheets without ADSCs formed bone-like tissue; although neo-bone and cartilage-like tissues were sparse and unevenly distributed by eight weeks after implantation. In comparison, MSC sheets with ADSCs promoted better bone regeneration as evidenced by the greater density of bone, increased mineral deposition, obvious formation of blood vessels, large number of interconnected ossified trabeculae and woven bone structures, and greater bone volume/total volume within the composite constructs. Our results indicate that although sheets of only MSCs have the potential to form tissue engineered bone at an ectopic site, the addition of ADSCs can significantly increase the osteogenic potential of MSC sheets. Thus, the combination of MSC sheets with ADSCs may be regarded as a promising therapeutic strategy to stimulate bone regeneration. PMID:26848656

  2. Interactive property of large thrust sheets with footwall rocks—the Sub thrust interactive duplex hypothesis: A mechanism of dome formation in thrust sheets

    NASA Astrophysics Data System (ADS)

    Hatcher, Robert D.


    Recently acquired Appalachian Ultradeep Core Hole (ADCOH) Project site investigation seismic reflection data and geologic data from the Appalachians and several other orogenic belts suggest an important mutually interdependent relationship exists between emplacement of large crystalline thrust sheets and the deforming foreland rocks beneath. This relationship suggests isolated domes beneath crystalline thrust sheets may be produced by passive folding of the sheet as a result of formation of an antiformal stack duplex in the platform sedimentary sequence beneath. Suggestions that domes in crystalline thrust sheets formed by interference of late open folds is doubtlessly still valid in places, but the platform duplex mechanism is probably also valid to explain the late doming of many crystalline and other large thrust sheets. The dome beneath the Shooting Creek and Brasstown Bald windows in the ADCOH site region is imaged as an antiformal stack duplex at depth. The Tallulah Falls dome, Grandfather Mountain and Mountain City windows, and Smokies Foothills duplex in the site region and elsewhere in the southern Blue Ridge are all late isolated domes and all are probably or demonstrably underlain by antiformal stack duplexes beneath the Blue Ridge-Piedmont composite crystalline thrust sheet. The Assynt window and footwall duplex benath the Arnabol and Moine thrusts in Scotland, and the Engadine window in the Alps may be similar structures.

  3. Beta-Sheet-Forming, Self-Assembled Peptide Nanomaterials towards Optical, Energy, and Healthcare Applications.


    Kim, Sungjin; Kim, Jae Hong; Lee, Joon Seok; Park, Chan Beum


    Peptide self-assembly is an attractive route for the synthesis of intricate organic nanostructures that possess remarkable structural variety and biocompatibility. Recent studies on peptide-based, self-assembled materials have expanded beyond the construction of high-order architectures; they are now reporting new functional materials that have application in the emerging fields such as artificial photosynthesis and rechargeable batteries. Nevertheless, there have been few reviews particularly concentrating on such versatile, emerging applications. Herein, recent advances in the synthesis of self-assembled peptide nanomaterials (e.g., cross β-sheet-based amyloid nanostructures, peptide amphiphiles) are selectively reviewed and their new applications in diverse, interdisciplinary fields are described, ranging from optics and energy storage/conversion to healthcare. The applications of peptide-based self-assembled materials in unconventional fields are also highlighted, such as photoluminescent peptide nanostructures, artificial photosynthetic peptide nanomaterials, and lithium-ion battery components. The relation of such functional materials to the rapidly progressing biomedical applications of peptide self-assembly, which include biosensors/chips and regenerative medicine, are discussed. The combination of strategies shown in these applications would further promote the discovery of novel, functional, small materials. PMID:25929870

  4. Low cost fabrication of sheet structure using a new beta titanium alloy, Ti-15V-3Cr-3Al-3Sn

    NASA Technical Reports Server (NTRS)

    Kaneko, R. S.; Davis, G. W.; Woods, C. A.; Royster, D. M.


    Development efforts have been undertaken to improve the processing and structural efficiencies of advanced cold-formable beta Ti alloys, using the standard, hot-formed and rivetted construction of Ti-6Al-4V sheet structures as a basis for comparison. Ti-15V-3Cr-3Al-3Sn (Ti-15-3) beta alloy is formable, brazable and weldable in the solution-treated condition, and after aging displays mechanical properties suitable for postulated service in the -65 to 600 F temperature range. A novel methodology using cold-formed Ti-15-3 stringers and Ti-6Al-4V face sheets that are joined by means of an out-of-furnace isothermal brazing process, followed by low temperature aging, can reduce production costs by as much as 28 per cent. Structural efficiency has been demonstrated in room and elevated temperature crippling tests of small skin-stringer assemblies.

  5. Circularly permuted monomeric red fluorescent proteins with new termini in the beta-sheet.


    Carlson, Haley J; Cotton, Darrel W; Campbell, Robert E


    Circularly permuted fluorescent proteins (FPs) have a growing number of uses in live cell fluorescence biosensing applications. Most notably, they enable the construction of single fluorescent protein-based biosensors for Ca(2+) and other analytes of interest. Circularly permuted FPs are also of great utility in the optimization of fluorescence resonance energy transfer (FRET)-based biosensors by providing a means for varying the critical dipole-dipole orientation. We have previously reported on our efforts to create circularly permuted variants of a monomeric red FP (RFP) known as mCherry. In our previous work, we had identified six distinct locations within mCherry that tolerated the insertion of a short peptide sequence. Creation of circularly permuted variants with new termini at the locations corresponding to the sites of insertion led to the discovery of three permuted variants that retained no more than 18% of the brightness of mCherry. We now report the extensive directed evolution of the variant with new termini at position 193 of the protein sequence for improved fluorescent brightness. The resulting variant, known as cp193g7, has 61% of the intrinsic brightness of mCherry and was found to be highly tolerant of circular permutation at other locations within the sequence. We have exploited this property to engineer an expanded series of circularly permuted variants with new termini located along the length of the 10th beta-strand of mCherry. These new variants may ultimately prove useful for the creation of single FP-based Ca(2+) biosensors. PMID:20521333

  6. Numerical modeling of Tibetan Plateau formation: Thin-sheet versus fully 3D models

    NASA Astrophysics Data System (ADS)

    Lechmann, S. M.; Schmalholz, S. M.; Kaus, B. J. P.


    Knowledge about the tectonic evolution of the Tibetan Plateau is still incomplete and many open questions remain concerning the deformation style of the crustal thickening, causing the abnormally high elevation of the Tibetan Plateau. Different models have been suggested explaining the crustal thickening by (1) homogeneous, continuous deformation using thin-sheet models, (2) discrete movement along thrusts developing crustal wedges and (3) lateral crustal flow due to pressure gradients resulting from topography. Most existing models are not fully three-dimensional (3D) models (e.g. thin-sheet models) and assume a certain deformation style a priori, which makes it difficult to judge the applicability of such constrained models to the formation of the Tibetan Plateau. We present a comparison of deformation styles during continent indentation resulting from a fully 3D numerical model and a thin-sheet model. The rheology for both models is power-law. The 3D model consists of four layers representing a simplified lithosphere: strong upper crust, weak lower crust, strong upper mantle and weak lower mantle. From the effective viscosity distribution of the 3D model a vertically averaged effective viscosity is calculated and used for the thin-sheet model to make direct comparisons between the two models. Simulating indentation is achieved by assigning free slip at one lateral side of the model, and fixing two other sides. The boundary at which indentation is taking place, exhibits a tripartite velocity profile: Next to the free slip side a section with constant horizontal velocity is applied. The velocity then gradually decreases towards zero, applying a cosine-function. The last section of the indenting boundary next to the fixed side is also fixed. The 3D model additionally exhibits a free surface and a bottom boundary allowing free slip. The 3D code employs the finite element method with a mixed velocity-pressure formulation to simulate incompressible flow. A Lagrangian

  7. Calcofluor fluorescence assay for wort beta-glucan in a microplate format

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The widely-used fluorescent (Calcofluor) flow injection analysis method for determining the concentrations of beta-glucans in Congress worts from barley malts is adapted to microplate format. Adaptation of the Calcofluor assay to use widely available fluorescent microplate readers makes the assay m...

  8. Effect of secondary structure on the potential of mean force for poly-L-lysine in the alpha-Helix and beta-sheet conformations

    SciTech Connect

    Grigsby, J.J.; Blanch, H.W.; Prausnitz, J.M.


    Because poly-L-lysine (PLL) can exist in the {alpha}-helix or {beta}-sheet conformation depending on solution preparation and solution conditions, PLL is a suitable candidate to probe the dependence of protein interactions on secondary structure. The osmotic second virial coefficient and weight-average molecular weight are reported from low-angle laser-light scattering measurements for PLL as a function of NaCl concentration, pH, and {alpha}-helix or {beta}-sheet content. Interactions between PLL molecules become more attractive as salt concentration increases due to screening of PLL charge by salt ions and at low salt concentration become more attractive as pH increases due to decreased net charge on PLL. The experimental results show that interactions are stronger for the {beta}-sheet conformation than for the {alpha}-helix conformation. A spherically-symmetric model for the potential of mean force is used to account for specific interactions not described by DLVO theory and to show how differences in secondary structure affect PLL interactions.

  9. A common structural motif incorporating a cystine knot and a triple-stranded beta-sheet in toxic and inhibitory polypeptides.

    PubMed Central

    Pallaghy, P. K.; Nielsen, K. J.; Craik, D. J.; Norton, R. S.


    A common structural motif consisting of a cystine knot and a small triple-stranded beta-sheet has been defined from comparison of the 3-dimensional structures of the polypeptides omega-conotoxin GVIA (Conus geographus), kalata BI (Oldenlandia affinis DC), and CMTI-I (Curcurbita maxima). These 3 polypeptides have diverse biological activities and negligible amino acid sequence identity, but each contains 3 disulfide bonds that give rise to a cystine knot. This knot consists of a ring formed by the first 2 bonds (1-4 and 2-5) and the intervening polypeptide backbone, through which the third disulfide (3-6) passes. The other component of this motif is a triple-stranded, anti-parallel beta-sheet containing a minimum of 10 residues, XXC2, XC5X, XXC6X (where the numbers on the half-cysteine residues refer to their positions in the disulfide pattern). The presence in these polypeptides of both the cysteine knot and antiparallel beta-sheet suggests that both structural features are required for the stability of the motif. This structural motif is also present in other protease inhibitors and a spider toxin. It appears to be one of the smallest stable globular domains found in proteins and is commonly used in toxins and inhibitors that act by blocking the function of larger protein receptors such as ion channels or proteases. PMID:7849598

  10. Phosphoinositide 3-kinase p85beta regulates invadopodium formation

    PubMed Central

    Cariaga-Martínez, Ariel E.; Cortés, Isabel; García, Esther; Pérez-García, Vicente; Pajares, María J.; Idoate, Miguel A.; Redondo-Muñóz, Javier; Antón, Inés M.; Carrera, Ana C.


    ABSTRACT The acquisition of invasiveness is characteristic of tumor progression. Numerous genetic changes are associated with metastasis, but the mechanism by which a cell becomes invasive remains unclear. Expression of p85β, a regulatory subunit of phosphoinositide-3-kinase, markedly increases in advanced carcinoma, but its mode of action is unknown. We postulated that p85β might facilitate cell invasion. We show that p85β localized at cell adhesions in complex with focal adhesion kinase and enhanced stability and maturation of cell adhesions. In addition, p85β induced development at cell adhesions of an F-actin core that extended several microns into the cell z-axis resembling the skeleton of invadopodia. p85β lead to F-actin polymerization at cell adhesions by recruiting active Cdc42/Rac at these structures. In accordance with p85β function in invadopodium-like formation, p85β levels increased in metastatic melanoma and p85β depletion reduced invadopodium formation and invasion. These results show that p85β enhances invasion by inducing cell adhesion development into invadopodia-like structures explaining the metastatic potential of tumors with increased p85β levels. PMID:25217619

  11. Beta-catenin and BMP-2 synergize to promote osteoblast differentiation and new bone formation.


    Mbalaviele, Gabriel; Sheikh, Sharmin; Stains, Joseph P; Salazar, Valerie S; Cheng, Su-Li; Chen, Di; Civitelli, Roberto


    Mutations of critical components of the Wnt pathway profoundly affect skeletal development and maintenance, probably via modulation of beta-catenin signaling. We tested the hypothesis that beta-catenin is involved in mesenchymal lineage allocation to osteogenic cells using a beta-catenin mutant with constitutive transcriptional activity (DeltaN151). Although this stable beta-catenin had no effects by itself on osteogenic differentiation of multipotent embryonic cell lines, it synergized with bone morphogenetic protein-2 (BMP-2) resulting in dramatic stimulation of alkaline phosphatase activity, osteocalcin gene expression, and matrix mineralization. Likewise, DeltaN151 and BMP-2 synergistically stimulated new bone formation after subperiosteal injection in mouse calvaria in vivo. Conversely, DeltaN151 prevented adipogenic differentiation from pre-adipocytic or uncommitted mesenchymal cells in vitro. Intriguingly, the synergism with BMP-2 on gene transcription occurred without altering expression of Cbfa1/Runx2, suggesting actions independent or downstream of this osteoblast-specific transcription factor. Thus, beta-catenin directs osteogenic lineage allocation by enhancing mesenchymal cell responsiveness to osteogenic factors, such as BMP-2, in part via Tcf/Lef dependent mechanisms. In vivo, this synergism leads to increased new bone formation. PMID:15526274

  12. Formation and transport of sheet electron beams and multi-beam configurations for high-power microwave devices

    SciTech Connect

    Basten, M.A.; Booske, J.H.; Anderson, J.; Scharer, J.E.


    Sheet electron beams and configurations with multiple electron beams have the potential to make possible higher power sources of microwave radiation due to their ability to transport high currents, at reduced current densities, through a single RF interaction circuit. Possible microwave device applications using sheet electron beams include sheet-beam klystrons, rectangular grating circuits, and planar FELS. Historically, implementation of sheet beams in microwave devices has been discouraged by their susceptibility to the diocotron instability in solenoidal focusing systems. However, recent theoretical and numerical studies have shown that stable transport of sheet beams is possible, in periodically cusped magnetic (PCM) fields. The use of an offset-pole PCM configuration has been shown analytically to provide side-fields for 2-D focusing of the beam, and this has been recently verified with PIC code simulations. The authors will present further theoretical studies of sheet and multi-beam transport and discuss results from an experimental investigation of the formation, stability and transport of PCM-focused sheet electron beams. This includes a laboratory method of forming an elliptical sheet beam using a magnetic quadrupole pair and a round-beam Pierce gun.

  13. High-Resolution Structure of a Self-Assembly-Competent Form of a Hydrophobic Peptide Captured in a Soluble [beta]-Sheet Scaffold

    SciTech Connect

    Makabe, Koki; Biancalana, Matthew; Yan, Shude; Tereshko, Valentina; Gawlak, Grzegorz; Miller-Auer, Hélène; Meredith, Stephen C.; Koide, Shohei


    {beta}-Rich self-assembly is a major structural class of polypeptides, but still little is known about its atomic structures and biophysical properties. Major impediments for structural and biophysical studies of peptide self-assemblies include their insolubility and heterogeneous composition. We have developed a model system, termed peptide self-assembly mimic (PSAM), based on the single-layer {beta}-sheet of Borrelia outer surface protein A. PSAM allows for the capture of a defined number of self-assembly-like peptide repeats within a water-soluble protein, making structural and energetic studies possible. In this work, we extend our PSAM approach to a highly hydrophobic peptide sequence. We show that a penta-Ile peptide (Ile{sub 5}), which is insoluble and forms {beta}-rich self-assemblies in aqueous solution, can be captured within the PSAM scaffold in a form capable of self-assembly. The 1.1-{angstrom} crystal structure revealed that the Ile{sub 5} stretch forms a highly regular {beta}-strand within this flat {beta}-sheet. Self-assembly models built with multiple copies of the crystal structure of the Ile5 peptide segment showed no steric conflict, indicating that this conformation represents an assembly-competent form. The PSAM retained high conformational stability, suggesting that the flat {beta}-strand of the Ile{sub 5} stretch primed for self-assembly is a low-energy conformation of the Ile{sub 5} stretch and rationalizing its high propensity for self-assembly. The ability of the PSAM to 'solubilize' an otherwise insoluble peptide stretch suggests the potential of the PSAM approach to the characterization of self-assembling peptides.

  14. Biosynthesis of streptothricin F. 5. Formation of. beta. -lysine by Streptomyces L-1689-23

    SciTech Connect

    Thiruvengadam, T.K.; Gould, S.J.; Aberhart, D.J.; Lin, H.J.


    The formation of the ..beta..-lysine moiety of streptothricin F has been studied by feeding to Streptomyces L-1689-23 ..cap alpha..-(3-/sup 13/C,/sup 15/N)-, ..cap alpha..-((3RS)-/sup 2/H/sub 2/)-, ..cap alpha..-((3R)-/sup 2/H)-, and ..cap alpha..-((3S)-/sup 2/H)lysine and ..beta..-((2S)-/sup 2/H)lysine. From the analysis of either the /sup 13/C NMR or /sup 2/H NMR spectrum of the derived antibiotics, it has been determined that the ..cap alpha..-nitrogen migrates to C-3 with inversion of configuration by an intramolecular process, and the 3-pro-R hydrogen migrates to C-2 with inversion of configuration by a process that is substantially or completely intermolecular. The very high degree of incorporation of labeled ..beta..-lysine indicates it is probably an intermediate in the biosynthesis of streptothricin F.

  15. Amyloid formation and inhibition of an all-beta protein: A study on fungal polygalacturonase

    NASA Astrophysics Data System (ADS)

    Chinisaz, Maryam; Ghasemi, Atiyeh; Larijani, Bagher; Ebrahim-Habibi, Azadeh


    Theoretically, all proteins can adopt the nanofibrillar structures known as amyloid, which contain cross-beta structures. The all-beta folded proteins are particularly interesting in this regard, since they appear to be naturally more predisposed toward this structural arrangement. In this study, methanol has been used to drive the beta-helix protein polygalacturonase (PG), toward amyloid fibril formation. Congo red absorbance, thioflavin T fluorescence, circular dichroism (CD) and transmission electron microscopy have been used to characterize this process. Similar to other all-beta proteins, PG shows a non-cooperative fibrillation mechanism, but the structural changes that are monitored by CD indicate a different pattern. Furthermore, several compounds containing aromatic components were tested as potential inhibitors of amyloid formation. Another protein predominantly composed of alpha-helices (human serum albumin) was also targeted by these ligands, in order to get an insight into their potential anti-aggregation property toward structurally different proteins. Among tested compounds, silibinin and chlorpropamide were able to considerably affect both proteins fibrillation process.

  16. Observations of magnetic merging and the formation of the plasma sheet in the earth's magnetotail

    NASA Technical Reports Server (NTRS)

    Lin, R. P.; Anderson, K. A.; Mccoy, J. E.; Russell, C. T.


    Particle and magnetic field observations of the field line merging process in the earth's magnetotail are presented. By analyzing the lunar shadow pattern of electron fluxes detected by the lunar-orbiting Apollo 16 subsatellite it has been possible to identify the topology and to measure the velocity of the magnetotail field lines. The observations reported here were made as the moon crossed the separatrix between premerging and merged field lines. The measured field line velocities toward the merging region were 30-60 km/s, and the thickness of the separatrix was estimated to be about 2000 km. Most of the magnetic energy released in the merging process appears to go into the energization of particles. The length and the thickness of the merging region are inferred to be of the order of about 10 earth radii and about 4000 km, respectively. The energized particles travel away from the merging region along the separatrix. Those headed earthward may form the plasma sheet by being trapped on closed field lines. The rate of energization and the energy spectrum of those particles are consistent with those required for formation of the plasma sheet.

  17. Enzyme-catalyzed formation of beta-peptides: beta-peptidyl aminopeptidases BapA and DmpA acting as beta-peptide-synthesizing enzymes.


    Heck, Tobias; Kohler, Hans-Peter E; Limbach, Michael; Flögel, Oliver; Seebach, Dieter; Geueke, Birgit


    In recent studies, we discovered that the three beta-peptidyl aminopeptidases, BapA from Sphingosinicella xenopeptidilytica 3-2W4, BapA from S. microcystinivorans Y2, and DmpA from Ochrobactrum anthropi LMG7991, possess the unique feature of cleaving N-terminal beta-amino acid residues from beta- and alpha/beta-peptides. Herein, we investigated the use of the same three enzymes for the reverse reaction catalyzing the oligomerization of beta-amino acids and the synthesis of mixed peptides with N-terminal beta-amino acid residues. As substrates, we employed the beta-homoamino acid derivatives H-beta hGly-pNA, H-beta3 hAla-pNA, H-(R)-beta3 hAla-pNA, H-beta3 hPhe-pNA, H-(R)-beta3 hPhe-pNA, and H-beta3 hLeu-pNA. All three enzymes were capable of coupling the six beta-amino acids to oligomers with chain lengths of up to eight amino acid residues. With the enzyme DmpA as the catalyst, we observed very high conversion rates, which correspond to dimer yields of up to 76%. The beta-dipeptide H-beta3 hAla-beta3 hLeu-OH and the beta/alpha-dipeptide H-beta hGly-His-OH (carnosine) were formed with almost 50% conversion, when a five-fold excess of beta3-homoleucine or histidine was incubated with H-beta3 hAla-pNA and H-beta hGly-pNA, respectively, in the presence of the enzyme BapA from S. microcystinivorans Y2. BapA from S. xenopeptidilytica 3-2W4 turned out to be a versatile catalyst capable of coupling various beta-amino acid residues to the free N-termini of beta- and alpha-amino acids and even to an alpha-tripeptide. Thus, these aminopeptidases might be useful to introduce a beta-amino acid residue as an N-terminal protecting group into a 'natural' alpha-peptide, thereby stabilizing the peptide against degradation by other proteolytic enzymes. PMID:17886858

  18. 2D 1H and 3D 1H-15N NMR of zinc-rubredoxins: contributions of the beta-sheet to thermostability.

    PubMed Central

    Richie, K. A.; Teng, Q.; Elkin, C. J.; Kurtz, D. M.


    Based on 2D 1H-1H and 2D and 3D 1H-15N NMR spectroscopies, complete 1H NMR assignments are reported for zinc-containing Clostridium pasteurianum rubredoxin (Cp ZnRd). Complete 1H NMR assignments are also reported for a mutated Cp ZnRd, in which residues near the N-terminus, namely, Met 1, Lys 2, and Pro 15, have been changed to their counterparts, (-), Ala and Glu, respectively, in rubredoxin from the hyperthermophilic archaeon, Pyrococcus furiosus (Pf Rd). The secondary structure of both wild-type and mutated Cp ZnRds, as determined by NMR methods, is essentially the same. However, the NMR data indicate an extension of the three-stranded beta-sheet in the mutated Cp ZnRd to include the N-terminal Ala residue and Glu 15, as occurs in Pf Rd. The mutated Cp Rd also shows more intense NOE cross peaks, indicating stronger interactions between the strands of the beta-sheet and, in fact, throughout the mutated Rd. However, these stronger interactions do not lead to any significant increase in thermostability, and both the mutated and wild-type Cp Rds are much less thermostable than Pf Rd. These correlations strongly suggest that, contrary to a previous proposal [Blake PR et al., 1992, Protein Sci 1:1508-1521], the thermostabilization mechanism of Pf Rd is not dominated by a unique set of hydrogen bonds or electrostatic interactions involving the N-terminal strand of the beta-sheet. The NMR results also suggest that an overall tighter protein structure does not necessarily lead to increased thermostability. PMID:8732760

  19. Nonlinear evolution of three-dimensional instabilities of thin and thick electron scale current sheets: Plasmoid formation and current filamentation

    SciTech Connect

    Jain, Neeraj; Büchner, Jörg


    Nonlinear evolution of three dimensional electron shear flow instabilities of an electron current sheet (ECS) is studied using electron-magnetohydrodynamic simulations. The dependence of the evolution on current sheet thickness is examined. For thin current sheets (half thickness =d{sub e}=c/ω{sub pe}), tearing mode instability dominates. In its nonlinear evolution, it leads to the formation of oblique current channels. Magnetic field lines form 3-D magnetic spirals. Even in the absence of initial guide field, the out-of-reconnection-plane magnetic field generated by the tearing instability itself may play the role of guide field in the growth of secondary finite-guide-field instabilities. For thicker current sheets (half thickness ∼5 d{sub e}), both tearing and non-tearing modes grow. Due to the non-tearing mode, current sheet becomes corrugated in the beginning of the evolution. In this case, tearing mode lets the magnetic field reconnect in the corrugated ECS. Later thick ECS develops filamentary structures and turbulence in which reconnection occurs. This evolution of thick ECS provides an example of reconnection in self-generated turbulence. The power spectra for both the thin and thick current sheets are anisotropic with respect to the electron flow direction. The cascade towards shorter scales occurs preferentially in the direction perpendicular to the electron flow.

  20. Formation and transport of low-voltage, space-charge dominated sheet electron beams for high-power microwave devices

    SciTech Connect

    Basten, M.A.; Booske, J.H.; Louis, L.J.; Joe, J.; Scharer, J.E.


    Sheet electron beams have the potential to make possible higher power sources of microwave radiation due to their ability to transport high currents, at reduced current densities, through a single narrow RF interaction circuit. The authors will discuss experimental investigations of the formation of an elliptical sheet beam using magnet quadrupoles and a round-beam electron gun. Features of this configuration include a low-cost, commercially available Pierce gun and a lens system consisting of four tunable magnetic quadrupoles with modest field gradients. Three-dimensional envelope and particle-in-cell simulations indicate that this method can generate highly elliptic output beams, with variability in final beam size, for laboratory experiments on sheet beam transport. They also will present the results of particle-in-cell simulations of the transport of sheet beams in long-period offset-pole periodic magnet arrays. While the stability of sheet beams in short-period arrays has previously been established, the extension to longer magnet periods indicate that side-focusing of space-charge dominated sheet beams is more problematic than beam stability. However, long-term (> 20 periods) stable transport is demonstrated for {lambda}{sub m} = 1 cm for a 2 A, 10 kV elliptical beam with a = 2.7 cm and b = 0.05 cm.

  1. The three-dimensional structural surface of two beta-sheet scorpion toxins mimics that of an alpha-helical dihydropyridine receptor segment.

    PubMed Central

    Green, Daniel; Pace, Suzi; Curtis, Suzanne M; Sakowska, Magdalena; Lamb, Graham D; Dulhunty, Angela F; Casarotto, Marco G


    An alpha-helical II-III loop segment of the dihydropyridine receptor activates the ryanodine receptor calcium-release channel. We describe a novel manipulation in which this agonist's activity is increased by modifying its surface structure to resemble that of a toxin molecule. In a unique system, native beta-sheet scorpion toxins have been reported to activate skeletal muscle ryanodine receptor calcium channels with high affinity by binding to the same site as the lower-affinity alpha-helical dihydropyridine receptor segment. We increased the alignment of basic residues in the alpha-helical peptide to mimic the spatial orientation of active residues in the scorpion toxin, with a consequent 2-20-fold increase in the activity of the alpha-helical peptide. We hypothesized that, like the native peptide, the modified peptide and the scorpion toxin may bind to a common site. This was supported by (i) similar changes in ryanodine receptor channel gating induced by the native or modified alpha-helical peptide and the beta-sheet toxin, a 10-100-fold reduction in channel closed time, with a < or = 2-fold increase in open dwell time and (ii) a failure of the toxin to further activate channels activated by the peptides. These results suggest that diverse structural scaffolds can present similar conformational surface properties to target common receptor sites. PMID:12429019

  2. Protein Secondary Structures (alpha-helix and beta-sheet) at a Cellular Levle and Protein Fractions in Relation to Rumen Degradation Behaviours of Protein: A New Approach

    SciTech Connect



    Studying the secondary structure of proteins leads to an understanding of the components that make up a whole protein, and such an understanding of the structure of the whole protein is often vital to understanding its digestive behaviour and nutritive value in animals. The main protein secondary structures are the {alpha}-helix and {beta}-sheet. The percentage of these two structures in protein secondary structures influences protein nutritive value, quality and digestive behaviour. A high percentage of {beta}-sheet structure may partly cause a low access to gastrointestinal digestive enzymes, which results in a low protein value. The objectives of the present study were to use advanced synchrotron-based Fourier transform IR (S-FTIR) microspectroscopy as a new approach to reveal the molecular chemistry of the protein secondary structures of feed tissues affected by heat-processing within intact tissue at a cellular level, and to quantify protein secondary structures using multicomponent peak modelling Gaussian and Lorentzian methods, in relation to protein digestive behaviours and nutritive value in the rumen, which was determined using the Cornell Net Carbohydrate Protein System. The synchrotron-based molecular chemistry research experiment was performed at the National Synchrotron Light Source at Brookhaven National Laboratory, US Department of Energy. The results showed that, with S-FTIR microspectroscopy, the molecular chemistry, ultrastructural chemical make-up and nutritive characteristics could be revealed at a high ultraspatial resolution ({approx}10 {mu}m). S-FTIR microspectroscopy revealed that the secondary structure of protein differed between raw and roasted golden flaxseeds in terms of the percentages and ratio of {alpha}-helixes and {beta}-sheets in the mid-IR range at the cellular level. By using multicomponent peak modelling, the results show that the roasting reduced (P <0.05) the percentage of {alpha}-helixes (from 47.1% to 36.1%: S

  3. Formation of a very thin current sheet in the near-earth magnetotail and the explosive growth phase of substorms

    NASA Technical Reports Server (NTRS)

    Lee, L. C.; Zhang, L.; Choe, G. S.; Cai, H. J.


    A magnetofricional method is used to construct two-dimensional MHD equilibria of the Earth's magnetosphere for a given distribution of entropy functions(S = pV(exp gamma), where p is the plasma pressure and V is the tube volume per unit magnetic flux. It is found that a very thin current sheet with B (sub zeta) is less than 0.5 nu T and thickness less than 1000 km can be formed in the near-earth magnetotail (x is approximately -8 to -20R(sub e) during the growth phase of substorm. The tail current sheets are found to become thinner as the entropy or the entropy gradient increases. It is suggested that the new entropy anti-diffusion instability associated with plasma transport across field lines leads to magnetic field dipolarization and accelerates the formation of thin current sheet, which may explain the observed explosive growth phase of substorms.

  4. Interactive desktop analysis of high resolution simulations: application to turbulent plume dynamics and current sheet formation

    NASA Astrophysics Data System (ADS)

    Clyne, John; Mininni, Pablo; Norton, Alan; Rast, Mark


    The ever increasing processing capabilities of the supercomputers available to computational scientists today, combined with the need for higher and higher resolution computational grids, has resulted in deluges of simulation data. Yet the computational resources and tools required to make sense of these vast numerical outputs through subsequent analysis are often far from adequate, making such analysis of the data a painstaking, if not a hopeless, task. In this paper, we describe a new tool for the scientific investigation of massive computational datasets. This tool (VAPOR) employs data reduction, advanced visualization, and quantitative analysis operations to permit the interactive exploration of vast datasets using only a desktop PC equipped with a commodity graphics card. We describe VAPORs use in the study of two problems. The first, motivated by stellar envelope convection, investigates the hydrodynamic stability of compressible thermal starting plumes as they descend through a stratified layer of increasing density with depth. The second looks at current sheet formation in an incompressible helical magnetohydrodynamic flow to understand the early spontaneous development of quasi two-dimensional (2D) structures embedded within the 3D solution. Both of the problems were studied at sufficiently high spatial resolution, a grid of 5042 by 2048 points for the first and 15363 points for the second, to overwhelm the interactive capabilities of typically available analysis resources.

  5. Repetitive formation and decay of current sheets in magnetic loops: An origin of diverse magnetic structures

    SciTech Connect

    Kumar, Dinesh; Bhattacharyya, R.; Smolarkiewicz, P. K.


    In this work, evolution of an incompressible, thermally homogeneous, infinitely conducting, viscous magnetofluid is numerically explored as the fluid undergoes repeated events of magnetic reconnection. The initial magnetic field is constructed by a superposition of two linear force-free fields and has similar morphology as the magnetic loops observed in the solar corona. The results are presented for computations with three distinct sets of footpoint geometries. To onset reconnection, we rely on numerical model magnetic diffusivity, in the spirit of implicit large eddy simulation. It is generally expected that in a high Lundquist number fluid, repeated magnetic reconnections are ubiquitous and hence can lead to a host of magnetic structures with considerable observational importance. In particular, the simulations presented here illustrate formations of magnetic islands, rotating magnetic helices and rising flux ropes—depending on the initial footpoint geometry but through the common process of repeated magnetic reconnections. Further, we observe the development of extended current sheets in two case studies, where the footpoint reconnections generate favorable dynamics.

  6. Optimal heating condition of mouthguard sheet in vacuum-pressure formation: part 2 Olefin-based thermoplastic elastomer.


    Takahashi, Mutsumi; Koide, Kaoru


    The purposes of this study were to clarify the suitable heating conditions during vacuum-pressure formation of olefin copolymer sheets and to examine the sheet temperature at molding and the thickness of the molded mouthguard. Mouthguards were fabricated using 4.0-mm-thick olefin copolymer sheets utilizing a vacuum-pressure forming device, and then, 10 s of vacuum forming and 2 min of compression molding were applied. Three heating conditions were investigated. They were, defined by the degree of sagging observed at the center of the softened sheet (10, 15, or 20 mm lower than the clamp (H-10, H-15, or H-20, respectively)). The working model was trimmed to the height of 20 mm at the maxillary central incisor and 15 mm at the mesiobuccal cusp of the maxillary first molar. The temperature on both the directly heated and the non-heated surfaces of the mouthguard sheet was measured by the radiation thermometer for each condition. The thickness of mouthguard sheets after fabrication was determined for the incisal portion (incisal edge and labial surface) and molar portion (cusp and buccal surface), and dimensional measurements were obtained using a measuring device. Differences in the thickness due to the heating condition of the sheets were analyzed by one-way analysis of variance and Bonferroni's multiple comparison tests. The temperature difference between the heated and non-heated surfaces was highest under H-10. Sheet temperature under H-15 and H-20 was almost the same. The thickness differences were noted at incisal edge, cusp, and buccal surface, and H-15 was the greatest. This study demonstrated that heating of the sheet resulting in sag of 15 mm or more was necessary for sufficient softening of the sheet and that the mouthguard thickness decreased with increased sag. In conclusion, sag of 15 mm can be recommended as a good indicator of appropriate molding timing for this material. PMID:26341504

  7. Different roles of protein kinase C-beta and -delta in arachidonic acid cascade, superoxide formation and phosphoinositide hydrolysis.

    PubMed Central

    Duyster, J; Schwende, H; Fitzke, E; Hidaka, H; Dieter, P


    In contrast with protein kinase C (PKC)-beta, PKC-delta is exclusively detectable in the membrane fraction of liver macrophages. After long-term treatment with phorbol 12-myristate 13-acetate (PMA) PKC-beta is depleted faster (within 3 h) than PKC-delta (> 7h). Simultaneously, pretreatment with PMA for 3 h inhibits the PMA- and zymosan-induced generation of superoxide and the PMA-induced formation of prostaglandin (PG) E2, whereas a preincubation of more than 7 h is required to affect the zymosan-induced release of PGE2 and inositol phosphates. These results support an involvement of PKC-beta in the PMA-induced activation of the arachidonic acid cascade and in superoxide formation and imply an involvement of PKC-delta in zymosan-induced phosphoinositide hydrolysis and PGE2 formation. Two phorbol ester derivates, sapintoxin A (SAPA) and 12-deoxyphorbol 13-phenylacetate 20-acetate (DOPPA), which have been previously reported to activate preferentially PLC-beta but not PKC-delta in vitro [Ryves, Evans, Olivier, Parker and Evans (1992) FEBS Lett. 288, 5-9], induce the formation of PGE2 and superoxide, down-regulate PKC-delta and potentiate inositol phosphate formation in parallel SAPA, but not DOPPA, down-regulates PKC-beta and inhibits the PMA-induced formation of eicosanoids and superoxide. Images Figure 1 Figure 2 Figure 5 PMID:8389125

  8. Spontaneous formation of stringlike clusters and smectic sheets for colloidal rods confined in thin wedgelike gaps.


    Maeda, Hideatsu; Maeda, Yoshiko


    Monodispersed colloidal rods of β-FeOOH with sizes ranging from 270 to 580 nm in length and 50 to 80 nm in width were synthesized. Narrow wedgelike gaps (0 to 700 nm in height) were formed around the inner bottom edge of the suspension glass cells. Optical microscopic observations revealed the formation of stringlike clusters of the rods and smectic sheets (by spontaneous side-by-side clustering of the strings) in the isotropic phase of the rod suspensions confined in narrow gaps; the electrolyte (HCl) concentrations of the suspensions are 5-40 mM, at which inter-rod interactions are attractive. The strings exhibit different colors that were used to investigate the structures of the strings with the help of interference color theory for thin films. The results are as follows. (1) The rods, lying flat on the gap bottom, are connected side-by-side and stacked upward to form stringlike clusters with different thicknesses depending on the gap height. (2) The stacking numbers (N(sr)) of the rods are estimated to be 1-5. With N(sr) increasing from 2 to 5, the volume fractions (ϕ) of the rods in the strings increased typically from 0.25-0.3 to 0.35-0.42 to reach limiting values (close to the ϕ values of the rods in the bulk smectic phase). (3) Unexpected low-ϕ strings are found in regions with an intermediate height in the gaps. These behaviors of ϕ may be caused by thermal fluctuations of the strings. PMID:23876087

  9. Targets of TGF-beta signaling in Caenorhabditis elegans dauer formation.


    Inoue, T; Thomas, J H


    Caenorhabditis elegans dauer formation is controlled by multiple environmental factors. The chemosensory neuron ASI regulates dauer formation by secretion of DAF-7/TGF-beta, but the molecular targets of the DAF-7 ligand are incompletely defined and the cellular targets are unknown. We genetically characterized and cloned a putative transducer of DAF-7 signaling called daf-14 and found that it encodes a Smad protein. DAF-14 Smad has a highly unusual structure completely lacking the N-terminal domain found in all other Smad proteins known to date. daf-14 genetically interacts with daf-8, which encodes another Smad, and the interaction suggests partial functional redundancy between these two Smad proteins. We also studied the cellular targets of DAF-7 signaling by studying the sites of action of daf-14 and daf-4, the putative receptor for DAF-7. daf-14::gfp is expressed in multiple tissues that are remodeled during dauer formation. However, analysis of mosaics generated by free duplication loss and tissue-specific expression constructs indicate cell-nonautonomous function of daf-4, arguing against direct DAF-7 signaling to tissues throughout the animal. Instead, these experiments suggest the nervous system as a target of DAF-7 signaling and that the nervous system in turn regulates dauer formation by other tissues. PMID:10625546

  10. A study of the formation and dynamics of the Earth's plasma sheet using ion composition data

    NASA Technical Reports Server (NTRS)

    Lennartsson, O. W.


    Over two years of data from the Lockheed Plasma Composition Experiment on the ISEE 1 spacecraft, covering ion energies between 100 eV/e and about 16 keV/e, have been analyzed in an attempt to extract new information about three geophysical issues: (1) solar wind penetration of the Earth's magnetic tail; (2) relationship between plasma sheet and tail lobe ion composition; and (3) possible effects of heavy terrestrial ions on plasma sheet stability.

  11. Differential mode of interaction of ThioflavinT with native β structural motif in human α 1-acid glycoprotein and cross beta sheet of its amyloid: Biophysical and molecular docking approach

    NASA Astrophysics Data System (ADS)

    Ajmal, Mohammad Rehan; Nusrat, Saima; Alam, Parvez; Zaidi, Nida; Badr, Gamal; Mahmoud, Mohamed H.; Rajpoot, Ravi Kant; Khan, Rizwan Hasan


    The present study details the interaction mechanism of Thioflavin T (ThT) to Human α1-acid glycoprotein (AAG) applying various spectroscopic and molecular docking methods. Fluorescence quenching data revealed the binding constant in the order of 104 M-1 and the standard Gibbs free energy change value, ΔG = -6.78 kcal mol-1 for the interaction between ThT and AAG indicating process is spontaneous. There is increase in absorbance of AAG upon the interaction of ThT that may be due to ground state complex formation between ThT and AAG. ThT impelled rise in β-sheet structure in AAG as observed from far-UV CD spectra while there are minimal changes in tertiary structure of the protein. DLS results suggested the reduction in AAG molecular size, ligand entry into the central binding pocket of AAG may have persuaded the molecular compaction in AAG. Isothermal titration calorimetric (ITC) results showed the interaction process to be endothermic with the values of standard enthalpy change ΔH0 = 4.11 kcal mol-1 and entropy change TΔS0 = 10.82 kcal.mol- 1. Moreover, docking results suggested hydrophobic interactions and hydrogen bonding played the important role in the binding process of ThT with F1S and A forms of AAG. ThT fluorescence emission at 485 nm was measured for properly folded native form and for thermally induced amyloid state of AAG. ThT fluorescence with native AAG was very low, while on the other hand with amyloid induced state of the protein AAG showed a positive emission peak at 485 nm upon the excitation at 440 nm, although it binds to native state as well. These results confirmed that ThT binding alone is not responsible for enhancement of ThT fluorescence but it also required beta stacked sheet structure found in protein amyloid to give proper signature signal for amyloid. This study gives the mechanistic insight into the differential interaction of ThT with beta structures found in native state of the proteins and amyloid forms, this study reinforce

  12. The effect of low levels of dopants upon the formation and properties of beta-phase molybdenum nitride

    SciTech Connect

    Cairns, A.G.; Gallagher, J.G.; Hargreaves, J.S.J.; Mckay, D.; Rico, J.L.; Wilson, K.


    The addition of 1 wt% Pd, Au, Ni and Cu dopants has been demonstrated to strongly alter the morphology of beta-phase molybdenum nitride prepared by treatment of MoO{sub 3} with a 3/1 H{sub 2}/N{sub 2} mixture at 750 deg. C. Furthermore, the addition of Pd significantly enhances the surface area and the formation of the nitride phase. It is proposed that the facile formation of molybdenum bronzes in this system is important in this respect. The dopants have also been observed to modify the denitridation characteristics of the beta-phase, with an overall reduction of the proportion of NH{sub 3} formed upon using a 3/1 H{sub 2}/Ar mixture with respect to the undoped sample. - Graphical abstract: Low levels of Pd, Au, Ni and Cu dopant have significant effects upon the morphology, formation and dentitridation characteristics of beta-phase molybdenum nitride.

  13. Crystal Structures of IAPP Amyloidogenic Segments Reveal a Novel Packing Motif of Out-of-Register Beta Sheets.


    Soriaga, Angela B; Sangwan, Smriti; Macdonald, Ramsay; Sawaya, Michael R; Eisenberg, David


    Structural studies of amyloidogenic segments by X-ray crystallography have revealed a novel packing motif, consisting of out-of-register β sheets, which may constitute one of the toxic species in aggregation related diseases. Here we sought to determine the presence of such a motif in islet amyloid polypeptide (IAPP), whose amyloidogenic properties are associated with type 2 diabetes. We determined four new crystal structures of segments within IAPP, all forming steric zippers. Most interestingly, one of the segments in the fibril core of IAPP forms an out-of-register steric zipper. Analysis of this structure reveals several commonalities with previously solved out-of-register fibrils. Our results provide additional evidence of out-of-register β sheets as a common structural motif in amyloid aggregates. PMID:26629790

  14. Diagnostics of basal conditions - the formation of extensive zones of surface ribs in ice-sheets and streams

    NASA Astrophysics Data System (ADS)

    Hindmarsh, Richard C. A.; Sergienko, Olga V.; Creyts, Timothy T.


    Most if not all current predictions of the evolution of ice-streams to changes induced by global change assume static basal conditions. This is a result of current restrictions in the remote sensing of the ice-sheet basal physical environment, which cannot resolve the small-scale phenomena believed to control the basal traction. The search therefore is on for observable structures or features that are the result of the operation of basal processes. Any successful theory of ice-sheet basal processes would need to be able to explain such phenomena associated with or caused by special properties of the basal environment. We present one class of these phenomena, and also present tentative hypotheses as to their formation. Using recent high-resolution observations of the Antarctic and Greenland ice sheets topography, the computed driving stress and the inferred basal traction reveal broad-scale organization in 5-20 km band-like patterns in both quantities. The similarity of patterns on the Greenland and Antarctic ice sheets suggests that the flow of ice sheets is controlled by the same fundamental processes operating at their base, which control ice sheet sliding and are highly variable on relatively short spatial and temporal scales. The formation mechanism for these bands contains information about the operation of the sub-glacial system. There are three possible, non-exclusive causes of these ribs which we examine from a theoretical and evidential point-of-view (i) They are the surface response to similar bands in the basal topography, whose regularity would equally require an explanation in terms of basal processes. (ii) They are translating surface waves in the ice, supported by membrane stress gradients rather than by gradients in the basal resistance. (iii) The ribs are due to the development of a band-like structure in the basal shear stress distribution that is the result of a pattern-forming instability in sub-glacial till and water flow, perhaps related to

  15. The formation of ice rises, their dynamics and role in the deglaciation of the Antarctic ice sheet

    NASA Astrophysics Data System (ADS)

    Favier, Lionel; Pattyn, Frank


    Numerous underwater mountains emerge from the edge of the continental shelf around the Antarctic ice sheet. During the last deglaciation, those features gave birth to ice rises, each being small scale copies of a continental ice sheet characterised by an ice divide and a local flow going outwards embedded within the fringing ice shelves. The well-known millenium-scale stability of ice rises can be strong indicators for the past deglaciation termination. However, the interpretation of physical measurements of an ice rise is not straightforward due to unknown past ice dynamics. Here, using the Bisicles ice-sheet model, we investigate for the first time the formation of an ice rise on top of an underwater mountain during the retreat of an ideal Antarctic-like ice sheet (i.e., including both grounded and floating ice flow). Prior to the retreat, the underwater mountain is barely detectable from the ice surface geometry and velocity. During the ice sheet retreat, induced by an increase of the sea level, an ice divide develops quickly above the underwater mountain. Within a short period of hundreds of years, the ice rise adopts a thousand years stability along with two main features: (i) a shifted upstream position of the ice rise compared to the mountain underneath and (ii) a geometrical asymmetry of the ice rise showing a gentle slope upstream and a steep slope downstream. We also investigate the influence of a non uniform surface mass balance on the migration of the ice divide. Our results provide additional ice dynamical constraints to facilitate numerical reconstructions of the last deglacial history in Antarctica as we demonstrate that ice rises are stable, but transient features of the ice shelf, stabilizing fast outlet flow. The timing of pinning and unpinning therefore becomes crucial in simulating the episodes of slow and fast grounding line retreat, respectively.

  16. Inhibition of bacterial cell wall-induced leukocyte recruitment and hepatic granuloma formation by TGF-beta gene transfer.


    Song, X; Zeng, L; Pilo, C M; Zagorski, J; Wahl, S M


    Intraperitoneal injection of streptococcal cell walls (SCW) into Lewis rats results in dissemination of SCW to the liver, spleen, bone marrow, and peripheral joints. The uptake of SCW by Kupffer cells in the liver initiates a chain of events largely mediated by T lymphocytes and macrophages. Local synthesis and secretion of cytokines and growth factors in response to the persistent SCW lead to the evolution and maintenance of a chronic T cell-dependent granulomatous response and result in granuloma formation and irreversible hepatic fibrosis. In an attempt to impede the development of the chronic granulomatous lesions in the liver, we injected a plasmid DNA encoding TGF-beta 1 i.m. to the SCW animals to determine the effect of TGF-beta 1 gene transfer on the course of liver inflammation and fibrosis. A single injection of plasmid DNA encoding TGF-beta 1 resulted in virtual abolition of the development of the SCW-induced hepatic granuloma formation and matrix expansion. TGF-beta 1 DNA not only reduced key proinflammatory cytokines including TNF-alpha, IL-1 beta, IFN-gamma, and IL-18, but also inhibited both CXC and CC chemokine production, thereby blocking inflammatory cell recruitment and accumulation in the liver. Moreover, TGF-beta 1 gene delivery inhibited its own expression in the liver tissue, which is otherwise up-regulated in SCW-injected animals. Our study suggests that TGF-beta 1 gene transfer suppresses hepatic granuloma formation by blocking the recruitment of inflammatory cells to the liver, and thus may provide a new approach to the control of hepatic granulomatous and fibrotic diseases. PMID:10491005

  17. Effects of Transforming Growth Factor Beta 1 in Cerebellar Development: Role in Synapse Formation

    PubMed Central

    Araujo, Ana P. B.; Diniz, Luan P.; Eller, Cristiane M.; de Matos, Beatriz G.; Martinez, Rodrigo; Gomes, Flávia C. A.


    Granule cells (GC) are the most numerous glutamatergic neurons in the cerebellar cortex and represent almost half of the neurons of the central nervous system. Despite recent advances, the mechanisms of how the glutamatergic synapses are formed in the cerebellum remain unclear. Among the TGF-β family, TGF-beta 1 (TGF-β1) has been described as a synaptogenic molecule in invertebrates and in the vertebrate peripheral nervous system. A recent paper from our group demonstrated that TGF-β1 increases the excitatory synapse formation in cortical neurons. Here, we investigated the role of TGF-β1 in glutamatergic cerebellar neurons. We showed that the expression profile of TGF-β1 and its receptor, TβRII, in the cerebellum is consistent with a role in synapse formation in vitro and in vivo. It is low in the early postnatal days (P1–P9), increases after postnatal day 12 (P12), and remains high until adulthood (P30). We also found that granule neurons express the TGF-β receptor mRNA and protein, suggesting that they may be responsive to the synaptogenic effect of TGF-β1. Treatment of granular cell cultures with TGF-β1 increased the number of glutamatergic excitatory synapses by 100%, as shown by immunocytochemistry assays for presynaptic (synaptophysin) and post-synaptic (PSD-95) proteins. This effect was dependent on TβRI activation because addition of a pharmacological inhibitor of TGF-β, SB-431542, impaired the formation of synapses between granular neurons. Together, these findings suggest that TGF-β1 has a specific key function in the cerebellum through regulation of excitatory synapse formation between granule neurons. PMID:27199658

  18. Efficiently engineered cell sheet using a complex of polyethylenimine–alginate nanocomposites plus bone morphogenetic protein 2 gene to promote new bone formation

    PubMed Central

    Jin, Han; Zhang, Kai; Qiao, Chunyan; Yuan, Anliang; Li, Daowei; Zhao, Liang; Shi, Ce; Xu, Xiaowei; Ni, Shilei; Zheng, Changyu; Liu, Xiaohua; Yang, Bai; Sun, Hongchen


    Regeneration of large bone defects is a common clinical problem. Recently, stem cell sheet has been an emerging strategy in bone tissue engineering. To enhance the osteogenic potential of stem cell sheet, we fabricated bone morphogenetic protein 2 (BMP-2) gene-engineered cell sheet using a complex of polyethylenimine–alginate (PEI–al) nanocomposites plus human BMP-2 complementary(c)DNA plasmid, and studied its osteogenesis in vitro and in vivo. PEI–al nanocomposites carrying BMP-2 gene could efficiently transfect bone marrow mesenchymal stem cells. The cell sheet was made by culturing the cells in medium containing vitamin C for 10 days. Assays on the cell culture showed that the genetically engineered cells released the BMP-2 for at least 14 days. The expression of osteogenesis-related gene was increased, which demonstrated that released BMP-2 could effectively induce the cell sheet osteogenic differentiation in vitro. To further test the osteogenic potential of the cell sheet in vivo, enhanced green fluorescent protein or BMP-2-producing cell sheets were treated on the cranial bone defects. The results indicated that the BMP-2-producing cell sheet group was more efficient than other groups in promoting bone formation in the defect area. Our results suggested that PEI–al nanocomposites efficiently deliver the BMP-2 gene to bone marrow mesenchymal stem cells and that BMP-2 gene-engineered cell sheet is an effective way for promoting bone regeneration. PMID:24855355

  19. Study of Benzyl Salicylate/beta-Cyclodextrin Inclusion Complex Formation by Positron Annihilation

    NASA Astrophysics Data System (ADS)

    Bellitto, V. J.; Hsu Hadley, F. H., Jr.; Trinh, T.


    Results of positron annihilation lifetime spectra of beta-cyclodextrin and beta-cyclodextrin complexed with benzyl salicylate,benzyl acetate, or ethyl salicylate in air and vacuum were used to determine the fraction of beta-cyclodextrin which remains uncomplexed in the benzyl salicylate/beta-cyclodextrin 1:2 molar ratio inclusion complex. The intensity of the longest-lived component in vacuum was shown to decrease when the beta-cyclodextrin cavity was filled with benzyl salicylate, benzyl acetate, or ethyl salicylate guest molecules. Comparison of the intensity for beta-cyclodextrin, benzyl salicylate/beta-cyclodextrin 1:2 molar ratio, and 1:1 molar ratio indicated that the benzyl and salicylate moieties each formed an inclusion complex with a molecule of beta-cyclodextrin in the benzyl salicylate/beta-cyclodextrin 1:2 complex. It was determined that the benzyl moiety of the benzyl salicylate molecule is preferred by the beta-cyclodextrin "host" and that only 34of the salicylate moieties are complexed in the benzyl salicylate/beta-cyclodextrin 1:2 sample.

  20. Beta Cell Formation in vivo Through Cellular Networking, Integration and Processing (CNIP) in Wild Type Adult Mice.


    Doiron, Bruno; Hu, Wenchao; DeFronzo, Ralph A


    Insulin replacement therapy is essential in type 1 diabetic individuals and is required in ~40- 50% of type 2 diabetics during their lifetime. Prior attempts at beta cell regeneration have relied upon pancreatic injury to induce beta cell proliferation, dedifferentiation and activation of the embryonic pathway, or stem cell replacement. We report an alternative method to transform adult non-stem (somatic) cells into pancreatic beta cells. The Cellular Networking, Integration and Processing (CNIP) approach targets cellular mechanisms involved in pancreatic function in the organ's adult state and utilizes a synergistic mechanism that integrates three important levels of cellular regulation to induce beta cell formation: (i) glucose metabolism, (ii) membrane receptor function, and (iii) gene transcription. The aim of the present study was to induce pancreatic beta cell formation in vivo in adult animals without stem cells and without dedifferentiating cells to recapitulate the embryonic pathway as previously published (1-3). Our results employing CNIP demonstrate that: (i) insulin secreting cells can be generated in adult pancreatic tissue in vivo and circumvent the problem of generating endocrine (glucagon and somatostatin) cells that exert deleterious effects on glucose homeostasis, and (ii) longterm normalization of glucose tolerance and insulin secretion can be achieved in a wild type diabetic mouse model. The CNIP cocktail has the potential to be used as a preventative or therapeutic treatment or cure for both type 1 and type 2 diabetes. PMID:26696016

  1. Role of the von Hippel-Lindau tumor suppressor gene in the formation of beta1-integrin fibrillar adhesions.


    Esteban-Barragán, Miguel A; Avila, Pilar; Alvarez-Tejado, Miguel; Gutiérrez, M Dolores; García-Pardo, Angeles; Sánchez-Madrid, Francisco; Landázuri, Manuel O


    The von Hippel-Lindau tumor suppressor gene (VHL) is absent or inactivated in the VHLcancer syndrome and in most sporadic renal cancers. VHL is requiredfor the assembly of a proper extracellular fibronectin matrix, although the exact mechanism remains unknown. In this report, we demonstrate that 786-O renal cancer cells are unable to organize an adequate matrix even in the presence of an excess of exogenous fibronectin. Because the formation of integrin fibrillar adhesions plays a pivotal role in the organization of extracellular fibronectin, we next examined the expression and subcellular distribution of integrins in VHL- cells and their wild-type VHL stably transfected counterparts. The levels of beta1 and alphav integrins were increased in VHL- cells when compared with VHL+ transfectants. Early after plating, both VHL+ and VHL- cells were capable of assembling classic "patch-like" alphav focal contacts. As the culture advanced and cells became confluent, alphav integrins partly relocated to the intercellular junctions in VHL+ transfectants, which then developed large beta1 fibrillar-type adhesions and anchored firmly to the substrate. In contrast, confluent VHL- cells were unable to assemble beta1 fibrillar adhesions, and alphav focal contacts remained unchanged at all stages of the culture. Exogenous activation of beta1 integrins with either divalent cations or activating antibodies partly restored the capability of VHL- cells to assemble beta1 fibrillar adhesions and fibronectin fibers. Finally, pulse-chase studies of metabolically labeled 786-O cells revealed that the maturation of the common beta1-integrin chain was delayed in VHL- cells when compared with VHL+ cells. Our results show that VHL is an important regulator of integrins and is essential for the formation of beta1 fibrillar adhesions. These findings help to explain the abnormal extracellular matrix organization and increased motility of VHL- renal cancer cells. PMID:12019174

  2. Observation of Depolarized ZnO(0001) Monolayers: Formation of Unreconstructed Planar Sheets

    SciTech Connect

    Tusche, C.; Meyerheim, H. L.; Kirschner, J.


    A novel nonpolar structure of 2 monolayer (ML) thick ZnO(0001) films grown on Ag(111) has been revealed, using surface x-ray diffraction and scanning tunneling microscopy. Zn and O atoms are arranged in planar sheets like in the hexagonal boron-nitride prototype structure. The observed depolarization is accompanied by a significant lateral 1.6% expansion of the lattice parameter and a 3% reduced Zn-O bond length within the sheets. The nonpolar structure stabilizes an atomically flat surface morphology unseen for ZnO surfaces thus far. The transition to the bulk wurtzite structure occurs in the 3-4 ML coverage range, connected to considerable roughening.

  3. Formation and evolution of flapping and ballooning waves in magnetospheric plasma sheet

    NASA Astrophysics Data System (ADS)

    Ma, J. Z. G.; Hirose, A.


    By adopting Lembége & Pellat's 2D plasma-sheet model, we investigate the flankward flapping motion and Sunward ballooning propagation driven by an external source (e.g., magnetic reconnection) produced initially at the sheet center. Within the ideal MHD framework, we adopt the WKB approximation to obtain the Taylor-Goldstein equation of magnetic perturbations. Fourier spectral method and Runge-Kutta method are employed in numerical simulations, respectively, under the flapping and ballooning conditions. Studies expose that the magnetic shears in the sheet are responsible for the flapping waves, while the magnetic curvature and the plasma gradient are responsible for the ballooning waves. In addition, the flapping motion has three phases in its temporal development: fast damping phase, slow recovery phase, and quasi-stabilized phase; it is also characterized by two patterns in space: propagating wave pattern and standing wave pattern. Moreover, the ballooning modes are gradually damped toward the Earth, with a wavelength in a scale size of magnetic curvature or plasma inhomogeneity, only 1-7% of the flapping one; the envelops of the ballooning waves are similar to that of the observed bursty bulk flows moving toward the Earth.

  4. Formation of lobate debris aprons on Mars: Assessment of regional ice sheet collapse and debris-cover armoring

    NASA Astrophysics Data System (ADS)

    Fastook, James L.; Head, James W.; Marchant, David R.


    Lobate debris aprons (LDA) are lobate-shaped aprons surrounding scarps and isolated massifs that are concentrated in the vicinity of the northern Dichotomy Boundary on Mars. LDAs have been interpreted as (1) ice-cemented talus aprons undergoing viscous flow, (2) local debris-covered alpine-like glaciers, or (3) remnants of the collapse of a regional retreating ice sheet. We investigate the plausibility that LDAs are remnants of a more extensive regional ice sheet by modeling this process. We find that as a regional ice sheet collapses, the surface drops below cliff and massif bedrock margins, exposing bedrock and regolith, and initiating debris deposition on the surface of a cold-based glacier. Reduced sublimation due to debris-cover armoring of the proto-LDA surface produces a surface slope and consequent ice flow that carries the armoring debris away from the rock outcrops. As collapse and ice retreat continue the debris train eventually reaches the substrate surface at the front of the glacier, leaving the entire LDA armored by debris cover. Using a simplified ice flow model we are able to characterize the temperature and sublimation rate that would be necessary to produce LDAs with a wide range of specified lateral extents and thicknesses. We then apply this method to a database of documented LDA parameters (height, lateral extent) from the Dichotomy Boundary region, and assess the implications for predicted climate conditions during their formation and the range of formation times implied by the model. We find that for the population examined here, typical temperatures are in the range of -85 to -40 °C and typical sublimation rates lie in the range of 6-14 mm/a. Lobate debris apron formation times (from the point of bedrock exposure to complete debris cover) cluster near 400-500 ka. These results show that LDA length and thickness characteristics are consistent with climate conditions and a formation scenario typical of the collapse of a regional retreating

  5. Origin of life. Primordial genetics: Information transfer in a pre-RNA world based on self-replicating beta-sheet amyloid conformers.


    Maury, Carl Peter J


    The question of the origin of life on Earth can largely be reduced to the question of what was the first molecular replicator system that was able to replicate and evolve under the presumably very harsh conditions on the early Earth. It is unlikely that a functional RNA could have existed under such conditions and it is generally assumed that some other kind of information system preceded the RNA world. Here, I present an informational molecular system that is stable, self-replicative, environmentally responsive, and evolvable under conditions characterized by high temperatures, ultraviolet and cosmic radiation. This postulated pregenetic system is based on the amyloid fold, a functionally unique polypeptide fold characterized by a cross beta-sheet structure in which the beta strands are arranged perpendicular to the fiber axis. Beside an extraordinary structural robustness, the amyloid fold possesses a unique ability to transmit information by a three-dimensional templating mechanism. In amyloidogenesis short peptide monomers are added one by one to the growing end of the fiber. From the same monomeric subunits several structural variants of amyloid may be formed. Then, in a self-replicative mode, a specific amyloid conformer can act as a template and confer its spatially encoded information to daughter molecular entities in a repetitive way. In this process, the specific conformational information, the spatially changed organization, is transmitted; the coding element is the steric zipper structure, and recognition occurs by amino acid side chain complementarity. The amyloid information system fulfills several basic requirements of a primordial evolvable replicator system: (i) it is stable under the presumed primitive Earth conditions, (ii) the monomeric building blocks of the informational polymer can be formed from available prebiotic compounds, (iii) the system is self-assembling and self-replicative and (iv) it is adaptive to changes in the environment and

  6. Focal adhesion kinase (FAK) phosphorylation is not required for genistein-induced FAK-beta-1-integrin complex formation.


    Liu, Y; Kyle, E; Lieberman, R; Crowell, J; Kellof, G; Bergan, R C


    It has previously been shown that changes in the activity of focal adhesion kinase (FAK), and its binding to beta-1-integrin, accompany genistein-induced adhesion of prostate cells. Consumption of genistein world wide is associated with a lower incidence of metastatic prostate cancer. Early human clinical trials of genistein are under way to evaluate genistein's potential causal role in this regard. Though an important cell adhesion-associated signaling molecule, FAK's role in regulating prostate cell adhesion was not clear. Elucidation of this process would provide important information relating to both biology and potential clinical endpoints. It was hypothesized that FAK activation and complex formation are temporally related in prostate cells, and can thus be separated. Significant activation of FAK was demonstrated when cells adhered to fibronectin, as compared to poly-L-lysine, thus demonstrating that beta-1-integrin plays a significant role in activating FAK. Neither FAK activation, nor FAK-integrin complex formation, required beta-1-integrin ligand. However, disruption of the cellular cytoskeleton by cytochalasin D prevented FAK activation, but did not block genistein-induced complex formation. In the face of a disrupted cytoskeleton, signaling through FAK could not be restored through either integrin cross linking, or re-establishment of tensile forces via attachment to solid matrix. These studies demonstrate that FAK-beta-1-integrin complex formation does not require FAK activation, suggesting that it is an early event in prostate cell adhesion. An intact cytoskeleton is necessary for FAK activation. The functional importance of beta-1-integrin in prostate cells is demonstrated. Current findings support plans to test genistein in prostate cancer. PMID:11315093

  7. Folding into a beta-hairpin can prevent amyloid fibril formation.


    Hosia, Waltteri; Bark, Niklas; Liepinsh, Edvards; Tjernberg, Agneta; Persson, Bengt; Hallén, Dan; Thyberg, Johan; Johansson, Jan; Tjernberg, Lars


    The tetrapeptide KFFE is one of the shortest amyloid fibril-forming peptides described. Herein, we have investigated how the structural environment of this motif affects polymerization. Using a turn motif (YNGK) or a less rigid sequence (AAAK) to fuse two KFFE tetrapeptides, we show by several biophysical methods that the amyloidogenic properties are strongly dependent on the structural environment. The dodecapeptide KFFEAAAKKFFE forms abundant thick fibril bundles. Freshly dissolved KFFEAAAKKFFE is monomeric and shows mainly disordered secondary structure, as evidenced by circular dichroism, NMR spectroscopy, hydrogen/deuterium exchange measurements, and molecular modeling studies. In sharp contrast, the dodecapeptide KFFEYNGKKFFE does not form fibrils but folds into a stable beta-hairpin. This structure can oligomerize into a stable 12-mer and multiples thereof, as shown by size exclusion chromatography, sedimentation analysis, and electrospray mass spectrometry. These data indicate that the structural context in which a potential fibril forming sequence is present can prevent fibril formation by favoring self-limiting oligomerization over polymerization. PMID:15096033

  8. Molecular cloning and characterization of beta-expansin gene related to root hair formation in barley.


    Kwasniewski, Miroslaw; Szarejko, Iwona


    Root hairs are specialized epidermal cells that play a role in the uptake of water and nutrients from the rhizosphere and serve as a site of interaction with soil microorganisms. The process of root hair formation is well characterized in Arabidopsis (Arabidopsis thaliana); however, there is a very little information about the genetic and molecular basis of root hair development in monocots. Here, we report on isolation and cloning of the beta-expansin (EXPB) gene HvEXPB1, tightly related to root hair initiation in barley (Hordeum vulgare). Using root transcriptome differentiation in the wild-type/root-hairless mutant system, a cDNA fragment present in roots of wild-type plants only was identified. After cloning of full-length cDNA and genomic sequences flanking the identified fragment, the subsequent bioinformatics analyses revealed homology of the protein coded by the identified gene to the EXPB family. Reverse transcription-PCR showed that expression of HvEXPB1 cosegregated with the root hair phenotype in F2 progeny of the cross between the hairless mutant rhl1.a and the wild-type Karat parent variety. Expression of the HvEXPB1 gene was root specific; it was expressed in roots of wild-type forms, but not in coleoptiles, leaves, tillers, and spikes. The identified gene was active in roots of two other analyzed root hair mutants: rhp1.a developing root hair primordia only and rhs1.a with very short root hairs. Contrary to this, a complete lack of HvEXPB1 expression was observed in roots of the spontaneous root-hairless mutant bald root barley. All these observations suggest a role of the HvEXPB1 gene in the process of root hair formation in barley. PMID:16679418

  9. Design study of the geometry of the blanking tool to predict the burr formation of Zircaloy-4 sheet

    SciTech Connect

    Ha, Jisun Lee, Hyungyil Kim, Dongchul Kim, Naksoo


    In this work, we investigated factors that influence burr formation for zircaloy-4 sheet used for spacer grids of nuclear fuel roads. Factors we considered are geometric factors of punch. We changed clearance and velocity in order to consider the failure parameters, and we changed shearing angle and corner radius of L-shaped punch in order to consider geometric factors of punch. First, we carried out blanking test with failure parameter of GTN model using L-shaped punch. The tendency of failure parameters and geometric factors that affect burr formation by analyzing sheared edges is investigated. Consequently, geometric factor's influencing on the burr formation is also high as failure parameters. Then, the sheared edges and burr formation with failure parameters and geometric factors is investigated using FE analysis model. As a result of analyzing sheared edges with the variables, we checked geometric factors more affect burr formation than failure parameters. To check the reliability of the FE model, the blanking force and the sheared edges obtained from experiments are compared with the computations considering heat transfer.

  10. The Growth of Magma Bodies by Amalgamation of Discrete Sheet Intrusions: Implications for the Formation of Magma Chambers

    NASA Astrophysics Data System (ADS)

    Annen, C.


    Until recently, igneous bodies (plutons and magma chambers) were commonly considered to be approximately spherical bodies, rapidly emplaced into the crust. However, field, structural, geophysical, and geochronological studies indicate that many plutons are low aspect-ratio tabular bodies (sills) that are formed by the amalgamation of successive discrete magma pulses. The thermal evolution of an igneous body that grows by accretion of thin magma sheets is fundamentally different from the evolution of a rapidly emplaced magma sphere or of a single thick magma sill. In thin sheet intrusions, the heat loss is through the walls of the sheets and the temperatures within the intrusions do not depend on the volumes injected but on the one-dimension sheets emplacement rate. The first sheets injected in a cold crust rapidly cool down and solidify. The ability of successive intrusions to stay at high temperature and eventually build up a long-lived magma chamber is controlled by the emplacement rate. Heat transfer modeling applied in the context of a volcanic arc shows that average emplacement rates of at least several centimeters per year and an incubation time of tens thousands of years are needed for a persistent magma chamber to form. During the incubation time, the intrusions solidify and when a chamber of high melt fraction magma eventually grows, the volume of eruptible magma only form a small part of the total intruded volume. The emplacement rate of plutons is controversial. Geochronological data suggest that some plutons may be emplaced over millions years. For a pluton that is assembled at a slow rate of a few millimeters per year, millions of years are needed, over which kilometric thicknesses are intruded, before a volume of magma larger than the size of a single intrusion becomes mobile and eruptible. In many cases, volcanic products may come from a deep source without being associated with a long-lived upper crust magma chamber. If volcanism is associated with

  11. Formation of sheet plumes, current coils, and helical magnetic fields in a spherical magnetohydrodynamic dynamo

    NASA Astrophysics Data System (ADS)

    Miyagoshi, Takehiro; Kageyama, Akira; Sato, Tetsuya


    Aiming at understanding of magnetic field generation process in rapidly rotating stars and planets represented by the Earth, computer simulations of magnetohydrodynamic (MHD) dynamo were performed in a rotating spherical shell geometry. Thermal convection and dynamo process with Ekman number of the order of 10-7 were studied. New structures of convection motion, dynamo-generated electrical current, and magnetic field are found. The flow is organized as a set of thin, sheet-like plumes. The current is made of small-scale coil structure with magnetic flux tubes within each of the coil. These flux tubes are connected each other to form a large scale helical magnetic field structure.

  12. Constraining the Late Pleistocene history of the Laurentide Ice Sheet by dating the Missinaibi Formation, Hudson Bay Lowlands, Canada

    NASA Astrophysics Data System (ADS)

    Dalton, April S.; Finkelstein, Sarah A.; Barnett, Peter J.; Forman, Steven L.


    Well-dated paleorecords from periods prior to the Last Glacial Maximum (LGM) are important for validating models of ice sheet build-up and growth. However, owing to glacial erosion, most Late Pleistocene records lie outside of the previously glaciated region, which limits their ability to inform about the dynamics of paleo-ice sheets. Here, we evaluate new and previously published chronology data from the Missinaibi Formation, a Pleistocene-aged deposit in the Hudson Bay Lowlands (HBL), Canada, located near the geographic center of the Laurentide Ice Sheet (LIS). Available radiocarbon (AMS = 44, conventional = 36), amino acid (n = 13), uranium-thorium (U-Th, n = 14), thermoluminescence (TL, n = 15) and optically stimulated luminescence (OSL, n = 5) data suggest that an ice-free HBL may have been possible during parts of Marine Isotope Stage 7 (MIS 7; ca. 243,000 to ca. 190,000 yr BP), MIS 5 (ca. 130,000 to ca. 71,000 yr BP) and MIS 3 (ca. 29,000 to ca. 57,000). While MIS 7 and MIS 5 are well-documented interglacial periods, the development of peat, forest bed and fluvial deposits dating to MIS 3 (n = 20 radiocarbon dates; 4 TL dates, 3 OSL dates), suggests that the LIS retreated and remained beyond, or somewhere within, the boundaries of the HBL during this interstadial. Ice sheet models approximate the margin of the LIS to Southern Ontario during this time, which is 700 km south of the HBL. Therefore, if correct, our data help constrain a significantly different configuration and dynamicity for the LIS than previously modelled. We can find no chronological basis to discount the MIS 3 age assignments. However, since most data originate from radiocarbon dates lying close to the reliable limit of this geochronometer, future work on dating the Missinaibi Formation using other geochronological methods (e.g. U-Th, OSL) is necessary in order to confirm the age estimates and strengthen the boundaries of the LIS during this period.

  13. Exogenous transforming growth factor-beta amplifies its own expression and induces scar formation in a model of human fetal skin repair.

    PubMed Central

    Lin, R Y; Sullivan, K M; Argenta, P A; Meuli, M; Lorenz, H P; Adzick, N S


    OBJECTIVE: Fetal skin wounds heal without scarring. To determine the role of TGF-beta 1 in fetal wound healing, mRNA expression of TGF-beta 1 was analyzed in human fetal and adult skin wounds. METHODS: Human fetal skin transplanted to a subcutaneous location on an adult athymic mouse that was subsequently wounded heals without scar, whereas human adult skin heals with scar formation in that location. In situ hybridization for TGF-beta 1 mRNA expression and species-specific immunohistochemistry for fibroblasts, macrophages, and neutrophils were performed in human adult wounds, fetal wounds, and fetal wounds treated with a TGF-beta 1 slow release disk. RESULTS: Transforming growth factor-beta 1 mRNA expression was induced by wounding adult skin. No TGF-beta 1 mRNA upregulation was detected in human fetal skin after wounding. However, when exogenous TGF-beta 1 was added to human fetal skin, induction of TGF-beta 1 mRNA expression in human fetal fibroblasts occurred, an adult-like inflammatory response was detected, and the skin healed with scar formation. CONCLUSIONS: Transforming growth factor-beta 1 is an important modulator in scar formation. Anti-TGF-beta 1 strategies may promote scarless healing in adult wounds. Images Figure 1. Figure 2. Figure 3. Figure 5. Figure 6. PMID:7639582

  14. Magnetic relaxation, current sheets, and structure formation in an extremely Tenuous fluid medium

    SciTech Connect

    Bajer, K.; Moffatt, H. K.


    The process of relaxation of a unidirectional magnetic field in a highly conducting tenuous fluid medium is considered. Null points of the field play a critical role in this process. During an initial stage of relaxation, variations in magnetic pressure are eliminated, and current sheets build up in the immediate neighborhood of null points. This initial phase is followed by a long diffusive phase of slow algebraic decay of the field, during which fluid is continuously sucked into the current sheets, leading to exponential growth of fluid density and concentration of mass around the null points, which show a tendency to cluster. Ultimately, this second phase of algebraic decay gives way to a final period of exponential decay of the field. The peaks of density at the null points survive as a fossil relic of the decay process. Numerical solution of the governing equations provides convincing confirmation of this three-stage scenario. Generalizations to two- and three-dimensional fields are briefly considered.

  15. Morphological properties of tunnel valleys of the southern sector of the Laurentide Ice Sheet and implications for their formation

    NASA Astrophysics Data System (ADS)

    Livingstone, Stephen J.; Clark, Chris D.


    Tunnel valleys have been widely reported on the bed of former ice sheets and are considered an important expression of subglacial meltwater drainage. Although known to have been cut by erosive meltwater flow, the water source and development of channels has been widely debated; ranging between outburst flood events through to gradually occurring channel propagation. We have mapped and analysed the spatial pattern and morphometry of tunnel valleys and associated glacial landforms along the southern sector of the former Laurentide Ice Sheet from high-resolution digital elevation models. Around 2000 tunnel valleys have been mapped, revealing an organised pattern of sub-parallel, semi-regularly spaced valleys that form in distinctive clusters. The tunnel valleys are typically < 20 km long, and 0.5-3 km wide, although their width varies considerably down-valley. They preferentially terminate at moraines, which suggests that formation is time dependent; while we also observe some tunnel valleys that have grown headwards out of hill-hole pairs. Analysis of cross-cutting relationships between tunnel valleys, moraines and outwash fans permits reconstruction of channel development in relation to the retreating ice margin. This palaeo-drainage reconstruction demonstrates incremental growth of most valleys, with some used repeatedly or for long periods, during deglaciation, while others were abandoned shortly after their formation. Our data and interpretation support gradual (rather than a single-event) formation of most tunnel valleys with secondary contributions from flood drainage of subglacial and or supraglacially stored water down individual tunnel valleys. The distribution and morphology of tunnel valleys is shown to be sensitive to regional factors such as basal thermal regime, ice and bed topography, timing and climate.

  16. Beta4 integrin-dependent formation of polarized three-dimensionalarchitecture confers resistance to apoptosis in normal and malignantmammary epithelium

    SciTech Connect

    Weaver, Valerie M.; Lelievre, Sophie; Lakins, Johnathon N.; Chrenek, Micah A.; Jones, Jonathan C.R.; Giancotti, Filippo; Werb, Zena; Bissell, Mina J.


    Tumor cells can evade chemotherapy by acquiring resistanceto apoptosis. We investigated the molecular mechanism whereby malignantand nonmalignant mammary epithelial cells become insensitive toapoptosis. We show that regardless of growth status formation ofpolarized, three-dimensional structures driven by basement membraneconfers protection to apoptosis in both nonmalignant and malignantmammary epithelial cells. By contrast, irrespective of their malignantstatus, nonpolarized structures are sensitive to induction of apoptosis.Resistance to apoptosis requires ligation of beta4 integrins, whichregulates tissue polarity, hemidesmosome formation and NFkB activation.Expression of beta4 integrin that lacks the hemidesmosome targetingdomain interferes with tissue polarity and NFkB activation and permitsapoptosis. These results indicate that integrin-induced polarity maydrive tumor cell resistance to apoptosis-inducing agents via effects onNFkB.

  17. Lactate adversely affects the in vitro formation of endothelial cell tubular structures through the action of TGF-{beta}1

    SciTech Connect

    Schmid, Stephan A. . E-mail:; Gaumann, Andreas; Wondrak, Marit; Eckermann, Christoph; Schulte, Stephanie; Mueller-Klieser, Wolfgang; Wheatley, Denys N.; Kunz-Schughart, Leoni A.


    When lactate accumulation in a tumor microenvironment reaches an average concentration of 10-20 mM, it tends to reflect a high degree of malignancy. However, the hypothesis that tumor-derived lactate has a number of partially adverse biological effects on malignant and tumor-associated host cells requires further evidence. The present study attempted to evaluate the impact of lactate on the process of angiogenesis, in particular on the formation of tubular structures. The endothelial cell (EC) network in desmoplastic breast tumors is primarily located in areas of reactive fibroblastic stroma. We employed a fibroblast-endothelial cell co-culture model as in vitro angiogenesis system normally producing florid in vitro tubule formation to analyze this situation. In contrast to previous studies, we found that lactate significantly reduces EC network formation in a dose-dependent manner as quantified by semi-automated morphometric analyses following immunohistochemical staining. The decrease in CD31-positive tubular structures and the number of intersections was independent of VEGF supplementation and became more pronounced in the presence of protons. The number of cells, primarily of the fibroblast population, was reduced but cell loss could not be attributed to a decrease in proliferative activity or pronounced apoptotic cell death. Treatment with 10 mM lactate was accompanied by enhanced mRNA expression and release of TGF-{beta}1, which also shows anti-angiogenic activity in the model. Both TGF-{beta}1 and lactate induced myofibroblastic differentiation adjacent to the EC tubular structures. The lactate response on the EC network was diminished by TGF-{beta}1 neutralization, indicating a causal relationship between lactate and TGF-{beta}1 in the finely tuned processes of vessel formation and maturation which may also occur in vivo within tumor tissue.

  18. Thymosin beta4 regulates cardiac valve formation via endothelial-mesenchymal transformation in zebrafish embryos.


    Shin, Sun-Hye; Lee, Sangkyu; Bae, Jong-Sup; Jee, Jun-Goo; Cha, Hee-Jae; Lee, You Mie


    Thymosin beta4 (TB4) has multiple functions in cellular response in processes as diverse as embryonic organ development and the pathogeneses of disease, especially those associated with cardiac coronary vessels. However, the specific roles played by TB4 during heart valve development in vertebrates are largely unknown. Here, we identified a novel function of TB4 in endothelialmesenchymal transformation (EMT) in cardiac valve endocardial cushions in zebrafish. The expressions of thymosin family members in developing zebrafish embryos were determined by whole mount in situ hybridization. Of the thymosin family members only zTB4 was expressed in the developing heart region. Cardiac valve development at 48 h post fertilization was defected in zebrafish TB4 (zTB4) morpholino-injected embryos (morphants). In zTB4 morphants, abnormal linear heart tube development was observed. The expressions of bone morphogenetic protein (BMP) 4, notch1b, and hyaluronic acid synthase (HAS) 2 genes were also markedly reduced in atrio-ventricular canal (AVC). Endocardial cells in the AVC region were stained with anti-Zn5 antibody reactive against Dm-grasp (an EMT marker) to observe EMT in developing cardiac valves in zTB4 morphants. EMT marker expression in valve endothelial cells was confirmed after transfection with TB4 siRNA in the presence of transforming growth factor β (TGFβ) by RT-PCR and immunofluorescent assay. Zn5-positive endocardial AVC cells were not observed in zTB4 morphants, and knockdown of TB4 suppressed TGF-β-induced EMT in ovine valve endothelial cells. Taken together, our results demonstrate that TB4 plays a pivotal role in cardiac valve formation by increasing EMT.1. PMID:24732964

  19. Formation of beta-methylmalate and its conversion to citramalate in Rhodospirillum rubrum.


    Osumi, T; Ebisuno, T; Nakano, H; Katsuki, H


    Using a cell-free extract of Rhodospirillum rubrum, studies were made of the condensation reaction between propionyl-CoA and glyoxylate. When [14C]propionate was incubated with the extract in the presence of glyoxylate, ATP, CoA, Mg2+, and Mn2+, radioactivity was incorporated into several compounds. Two of the main products were characterized as citramalate (CMA) and erythro-beta-methylmalate (erythro-MMA) on the basis of their behavior compared with authentic samples of CMA and erythro-MMA in the following three analyses: (i) paper chromatography using two solvent systems, (ii) radio-gas chromatography on their methyl esters, and (iii) chemical conversion to readily crystallizable derivatives, that is, citramalyl chloralide for CMA, and thymine for MMA. The CMA was thought to be of L(+)-form based on the results of optical resolution with brucine and also its susceptibility to L(+)-citramalate lyase of Clostridium tetanomorphum. When the reaction was carried out with lower concentrations of the enzyme, only MMA was accumulated. However, when the reaction was allowed to proceed further after addition of higher concentrations of the enzyme and of excess semicarbazide to prevent further condensation, the amount of accumulated MMA was decreased and CMA was formed instead. Furthermore, the time course of MMA and CMA formation exhibited a pattern typical of a precursor-product relationship. From these results, it was concluded that MMA was formed by alpha-condensation between propionyl-CoA and glyoxylate, and that CMA was derived from MMA, possibly from its CoA derivative. PMID:814116

  20. Formation of silicon hydride using hyperthermal negative hydrogen ions (H -) extracted from an argon-seeded hydrogen sheet plasma source

    NASA Astrophysics Data System (ADS)

    Fernandez, Marcedon S.; Blantocas, Gene Q.; Ramos, Henry J.


    An E × B probe (a modified Wien filter) is constructed to function both as a mass spectrometer and ion implanter. The device, given the acronym EXBII selects negative hydrogen ions (H -) from a premixed 10% argon-seeded hydrogen sheet plasma. With a vacuum background of 1.0 × 10 -6 Torr, H - extraction ensues at a total gas feed of 1.8 mTorr, 0.5 A plasma discharge. The EXBII is positioned 3 cm distance from the sheet core as this is the region densely populated by cold electrons ( Te ˜ 2 eV, Ne ˜ 3.4 × 10 11 cm -3) best suited for H - formation. The extracted H - ions of flux density ˜0.26 A/m 2 are segregated, accelerated to hyperthermal range (<100 eV) and subsequently deposited into a palladium-coated 1.1 × 1.1 cm 2, n-type Si (1 0 0) substrate held at the rear end of the EXBII, placed in lieu of its Faraday cup. The palladium membrane plays the role of a catalyst initiating the reaction between Si atoms and H - ions simultaneously capping the sample from oxidation and other undesirable adsorbents. AFM and FTIR characterization tests confirm the formation of SiH 2. Absorbance peaks between 900-970 cm -1 (bending modes) and 2050-2260 cm -1 (stretching modes) are observed in the FTIR spectra of the processed samples. It is found that varying hydrogen exposure time results in the shifting of wavenumbers which may be interpreted as changes in the frequencies of vibration for SiH 2. These are manifestations of chemical changes accompanying alterations in the force constant of the molecule. The sample with longer exposure time exhibits an additional peak at 2036 cm -1 which are hydrides of nano-crystalline silicon.

  1. β-sheet-like formation during the mechanical unfolding of prion protein

    NASA Astrophysics Data System (ADS)

    Tao, Weiwei; Yoon, Gwonchan; Cao, Penghui; Eom, Kilho; Park, Harold S.


    Single molecule experiments and simulations have been widely used to characterize the unfolding and folding pathways of different proteins. However, with few exceptions, these tools have not been applied to study prion protein, PrPC, whose misfolded form PrPSc can induce a group of fatal neurodegenerative diseases. Here, we apply novel atomistic modeling based on potential energy surface exploration to study the constant force unfolding of human PrP at time scales inaccessible with standard molecular dynamics. We demonstrate for forces around 100 pN, prion forms a stable, three-stranded β-sheet-like intermediate configuration containing residues 155-214 with a lifetime exceeding hundreds of nanoseconds. A mutant without the disulfide bridge shows lower stability during the unfolding process but still forms the three-stranded structure. The simulations thus not only show the atomistic details of the mechanically induced structural conversion from the native α-helical structure to the β-rich-like form but also lend support to the structural theory that there is a core of the recombinant PrP amyloid, a misfolded form reported to induce transmissible disease, mapping to C-terminal residues ≈160-220.

  2. β-sheet-like formation during the mechanical unfolding of prion protein.


    Tao, Weiwei; Yoon, Gwonchan; Cao, Penghui; Eom, Kilho; Park, Harold S


    Single molecule experiments and simulations have been widely used to characterize the unfolding and folding pathways of different proteins. However, with few exceptions, these tools have not been applied to study prion protein, PrP(C), whose misfolded form PrP(Sc) can induce a group of fatal neurodegenerative diseases. Here, we apply novel atomistic modeling based on potential energy surface exploration to study the constant force unfolding of human PrP at time scales inaccessible with standard molecular dynamics. We demonstrate for forces around 100 pN, prion forms a stable, three-stranded β-sheet-like intermediate configuration containing residues 155-214 with a lifetime exceeding hundreds of nanoseconds. A mutant without the disulfide bridge shows lower stability during the unfolding process but still forms the three-stranded structure. The simulations thus not only show the atomistic details of the mechanically induced structural conversion from the native α-helical structure to the β-rich-like form but also lend support to the structural theory that there is a core of the recombinant PrP amyloid, a misfolded form reported to induce transmissible disease, mapping to C-terminal residues ≈160-220. PMID:26429042

  3. β-sheet-like formation during the mechanical unfolding of prion protein

    SciTech Connect

    Tao, Weiwei; Cao, Penghui; Park, Harold S.; Yoon, Gwonchan; Eom, Kilho


    Single molecule experiments and simulations have been widely used to characterize the unfolding and folding pathways of different proteins. However, with few exceptions, these tools have not been applied to study prion protein, PrP{sup C}, whose misfolded form PrP{sup Sc} can induce a group of fatal neurodegenerative diseases. Here, we apply novel atomistic modeling based on potential energy surface exploration to study the constant force unfolding of human PrP at time scales inaccessible with standard molecular dynamics. We demonstrate for forces around 100 pN, prion forms a stable, three-stranded β-sheet-like intermediate configuration containing residues 155-214 with a lifetime exceeding hundreds of nanoseconds. A mutant without the disulfide bridge shows lower stability during the unfolding process but still forms the three-stranded structure. The simulations thus not only show the atomistic details of the mechanically induced structural conversion from the native α-helical structure to the β-rich-like form but also lend support to the structural theory that there is a core of the recombinant PrP amyloid, a misfolded form reported to induce transmissible disease, mapping to C-terminal residues ≈160-220.

  4. Investigating beta-hydroxyenduracididine formation in the biosynthesis of the mannopeptimycins.


    Haltli, Brad; Tan, Ying; Magarvey, Nathan A; Wagenaar, Melissa; Yin, Xihou; Greenstein, Michael; Hucul, John A; Zabriskie, T Mark


    The mannopeptimycins (MPPs) are potent glycopeptide antibiotics that contain both D and L forms of the unique, arginine-derived amino acid beta-hydroxyenduracididine (betahEnd). The product of the mppO gene in the MPP biosynthetic cluster resembles several non-heme iron, alpha-ketoglutarate-dependent oxygenases, such as VioC and clavaminate synthase. The role of MppO in betahEnd biosynthesis was confirmed through inactivation of mppO, which yielded a strain that produced dideoxy-MPPs, indicating that mppO is essential for generating the beta-hydroxy functionality for both betahEnd residues. Characterization in vitro of recombinant His6-MppO expressed in E. coli revealed that MppO selectively hydroxylates the beta carbon of free L-enduracididine. PMID:16298295

  5. Inhibition of amyloid fibril formation of human amylin by N-alkylated amino acid and alpha-hydroxy acid residue containing peptides.


    Rijkers, Dirk T S; Höppener, Jo W M; Posthuma, George; Lips, Cornelis J M; Liskamp, Rob M J


    Amyloid deposits are formed as a result of uncontrolled aggregation of (poly)peptides or proteins. Today several diseases are known, for example Alzheimer's disease, Creutzfeldt-Jakob disease, mad cow disease, in which amyloid formation is involved. Amyloid fibrils are large aggregates of beta-pleated sheets and here a general method is described to introduce molecular mutations in order to achieve disruption of beta-sheet formation. Eight backbone-modified amylin derivatives, an amyloidogenic peptide involved in maturity onset diabetes, were synthesized. Their beta-sheet forming properties were studied by IR spectroscopy and electron microscopy. Modification of a crucial amide NH by an alkyl chain led to a complete loss of the beta-sheet forming capacity of amylin. The resulting molecular mutated amylin derivative could be used to break the beta-sheet thus retarding beta-sheet formation of unmodified amylin. Moreover, it was found that the replacement of this amide bond by an ester moiety suppressed fibrillogenesis significantly. Introduction of N-alkylated amino acids and/or ester functionalities-leading to depsipeptides-into amyloidogenic peptides opens new avenues towards novel peptidic beta-sheet breakers for inhibition of beta-amyloid aggregation. PMID:12298020

  6. Unfolding Simulations of Holomyoglobin from Four Mammals: Identification of Intermediates and β-Sheet Formation from Partially Unfolded States

    PubMed Central

    Dasmeh, Pouria; Kepp, Kasper P.


    Myoglobin (Mb) is a centrally important, widely studied mammalian protein. While much work has investigated multi-step unfolding of apoMb using acid or denaturant, holomyoglobin unfolding is poorly understood despite its biological relevance. We present here the first systematic unfolding simulations of holoMb and the first comparative study of unfolding of protein orthologs from different species (sperm whale, pig, horse, and harbor seal). We also provide new interpretations of experimental mean molecular ellipticities of myoglobin intermediates, notably correcting for random coil and number of helices in intermediates. The simulated holoproteins at 310 K displayed structures and dynamics in agreement with crystal structures (Rg ∼1.48–1.51 nm, helicity ∼75%). At 400 K, heme was not lost, but some helix loss was observed in pig and horse, suggesting that these helices are less stable in terrestrial species. At 500 K, heme was lost within 1.0–3.7 ns. All four proteins displayed exponentially decaying helix structure within 20 ns. The C- and F-helices were lost quickly in all cases. Heme delayed helix loss, and sperm whale myoglobin exhibited highest retention of heme and D/E helices. Persistence of conformation (RMSD), secondary structure, and ellipticity between 2–11 ns was interpreted as intermediates of holoMb unfolding in all four species. The intermediates resemble those of apoMb notably in A and H helices, but differ substantially in the D-, E- and F-helices, which interact with heme. The identified mechanisms cast light on the role of metal/cofactor in poorly understood holoMb unfolding. We also observed β-sheet formation of several myoglobins at 500 K as seen experimentally, occurring after disruption of helices to a partially unfolded, globally disordered state; heme reduced this tendency and sperm-whale did not display any sheet propensity during the simulations. PMID:24386077

  7. Systemic administration of transforming growth factor-beta 2 prevents the impaired bone formation and osteopenia induced by unloading in rats.

    PubMed Central

    Machwate, M; Zerath, E; Holy, X; Hott, M; Godet, D; Lomri, A; Marie, P J


    We investigated the effect of recombinant human transforming growth factor beta 2 (rhTGF-beta 2) administration on trabecular bone loss induced by unloading in rats. Hind limb suspension for 14 d inhibited bone formation and induced osteopenia as shown by decreased bone volume, calcium and protein contents in long bone metaphysis. Systemic infusion of rhTFG-beta 2 (2 micrograms/kg per day) maintained normal bone formation rate, and prevented the decrease in bone volume, bone mineral content, trabecular thickness and number induced by unloading. In vitro analysis of tibial marrow stromal cells showed that rhTGF-beta 2 infusion in unloaded rats increased the proliferation of osteoblast precursor cells, but did not affect alkaline phosphatase activity or osteocalcin production. Northern blot analysis of RNA extracted from the femoral metaphysis showed that rhTGF-beta 2 infusion in unloaded rats increased steady-state levels of type I collagen mRNA but not alkaline phosphatase mRNA levels. rhTGF-beta 2 infusion at the dose used had no effect on metaphyseal bone volume and formation, osteoblast proliferation or collagen expression in control rats. The results show that systemic administration of rhTGF-beta 2 enhances osteoblast precursor cell proliferation and type I collagen expression by osteoblasts, and prevents the impaired bone formation and osteopenia induced by unloading. Images PMID:7657798

  8. Separation of drug stereoisomers by the formation of. beta. -cyclodextrin inclusion complexes

    SciTech Connect

    Armstrong, D.W.; Ward, T.J.; Armstrong, R.D.; Beesley, T.E.


    For many drugs, only racemic mixtures are available for clinical use. Because different stereoisomers of drugs often cause different physiological responses, the use of pure isomers could elicit more exact therapeutic effects. Differential complexation of a variety of drug stereoisomers by immobilized ..beta..-cyclodextrin was investigated. Chiral recognition and racemic resolution were observed with a number of compounds from such clinically useful classes as ..beta..-blockers, calcium-channel blockers, sedative hypnotics, antihistamines, anticonvulsants, diuretics, and synthetic opiates. Separation of the diastereomers of the cardioactive and antimalarial cinchona alkaloids and of two antiestrogens was demonstrated as well. Three dimensional projections of ..beta..-cyclodextrin complexes of propanol, which is resolved by this technique, and warfarin, which is not, are compared. These studies have improved the understanding and application of the chiral interactions of ..beta..-cyclodextrin, and they have demonstrated a means to measure optical purity and to isolate or produce pure enantiomers of drugs. In addition, this highly specific technique could also be used in the pharmacological evaluation of enantiometric drugs. 27 references, 3 figures, 2 tables.

  9. Non-linear Tearing and Flux rope Formation in 3D Null Current Sheets

    NASA Astrophysics Data System (ADS)

    Wyper, P. F.; Pontin, D. I.


    The manner in which small scale structure affects the large scale reconnection process in realistic 3D geometries is still an unsolved problem. With the increase in computational resources and improvements in satellite instrumentation, signatures of flux ropes or "plasmoids" are now observed with increasing regularity, yet their formation and dynamics are poorly understood. It has been demonstrated that even at MHD scales, in 2D rapid non-linear tearing of Sweet-Parker-like layers forms multiple magnetic islands ("plasmoids") and allows the reconnection rate to become almost independent of the Lundquist number (the "plasmoid instability"). This work presents some of our recent theoretical work focussing on an analogous instability in a fully 3D geometry. Using results from a series of 3D high resolution MHD simulations, the formation and evolution of fully three dimensional "flux rope" structures following the 3D plasmoid instability will be presented, and their effects on the manner of the reconnection process as a whole discussed.

  10. In vitro inhibition of beta-haematin formation, DNA interactions, antiplasmodial activity, and cytotoxicity of synthetic neocryptolepine derivatives.


    Van Miert, Sabine; Jonckers, Tim; Cimanga, Kanyanga; Maes, Louis; Maes, Bert; Lemière, Guy; Dommisse, Roger; Vlietinck, Arnold; Pieters, Luc


    Neocryptolepine, a minor alkaloid of Cryptolepis sanguinolenta, was investigated as a lead for new antiplasmodial agents, because of its lower cytotoxicity than cryptolepine, the major alkaloid. Synthetic 2- or 3-substituted neocryptolepine derivatives were evaluated for their biological activity. In addition to the antiplasmodial activity (Plasmodium falciparum chloroquine-sensitive and -resistant) also the cytotoxicity (MRC-5 cells) was determined. Several compounds such as 2-bromoneocryptolepine showing higher and more selective antiplasmodial activity than neocryptolepine were obtained. Several functional assays and in vitro tests were used to obtain additional information on the mechanism of action, i.e., the beta-haematin formation inhibitory assay (detoxification of haem) and the DNA-methylgreen displacement assay (interaction with DNA). It could be demonstrated that the 2- or 3-substituted neocryptolepine derivatives investigated here have about the same potency to inhibit the beta-haematin formation as chloroquine, indicating that inhibition of haemozoin formation makes at least an important contribution to their antiplasmodial activity, although their in vitro antiplasmodial activity is still less than chloroquine. PMID:15582513

  11. Interdendritic Strain and Macrosegregation-Coupled Phenomena for Interdendritic Crack Formation in Direct-Chill Cast Sheet Ingots

    NASA Astrophysics Data System (ADS)

    EL-Bealy, Mostafa Omar


    In a study of the early stages of dendritic solidification in the direct-chill cast sheet ingots, the coupled effect of interdendritic strain and macrosegregation on the interdendritic cracks formation in dendritic equiaxed structure has been investigated by the metallographic study of ingot samples and by performing a set of mathematical analyses for AA-6061 and AA-1050 aluminum alloys. The metallographic investigation contains microstructure examinations and macrosegregation measurements of collected samples from plant trials. The mathematical analysis consists of a two-dimensional (2-D) fluid flow, heat flow, interdendritic strain, and macrosegregation-coupled model. Also, a simple approach to measure interdendritic crack has been developed based on the accumulative interdendritic strain criterion, local dendritic phases, and the crystal distortion correlation factor resulting from steep positive local segregation. The model predications have clarified the effect of high positive macrosegregation on the surface and subsurface interdendritic crack formation. It has been revealed that interdendritic strain starts to generate just below the liquidus temperature, resulting from shrinkage of liquid→solid phase transformation and contraction of dendritic solid in the incoherent mushy region. In this region, the coupled effect of the shrinkage/contraction mechanism increases the interdendritic distances between equiaxed crystals and the interdendritic crack begins to nucleate. Subsequently, in the coherent mushy region, the different interdendritic strain sources start to affect significantly the distances between equiaxed crystals in a diverse way, and therefore, the final morphology of interdendritic crack begins to form. The mechanism of interdendritic crack formation during dendritic equiaxed structure solidification and the possible solutions to this problem are discussed.

  12. Effects of the Formation of Al x Cu y Gradient Interfaces on Mechanical Property of Steel/Al Laminated Sheets by Introducing Cu Binding-Sheets

    NASA Astrophysics Data System (ADS)

    Wei, Aili; Liu, Xinghai; Shi, Quanxin; Liang, Wei


    Steel/Cu/Al laminated sheets were fabricated by two-pass hot rolling to improve the mechanical properties of steel/Al sheets. The bonding properties and deformability of the steel/Cu/Al sheets were studied. Steel/Al and steel/Cu/Al samples were rolled at 350°C for 15 min with the first-pass reduction of 40%, and then heated at 600°C for 5 min with different reductions. It was found that the steel/Cu/Al samples rolled by the second-pass reduction of 85% could endure the maximum 90° bend cycle times of 45, exhibiting excellent fatigue resistance as well as deformability. The steel/Al samples could only reach the maximum 90° bend cycle times of 20. Furthermore, the scanning electron microscope, energy-dispersive spectrometer, and electron backscattered diffraction results showed that the preferred growth orientations of Cu, Al4Cu9, and Al2Cu on the steel/Cu/Al laminated sheets are {-1, 1, 2} <1, -1, 1>, {1, 0, 0} <0, 1, 0> and {-1, 1, 2} <1, -1, 1> {1, 1, 0} <0, 0, 1>. The orientation relationships between Cu and Al2Cu are {1, 1, 0}(fcc)//{1, 1, 0}(bct) and {1, 1, 1}(fcc)//{1, 1, 1}(bct). The improved bonding property and excellent fatigue resistance as well as deformability were mainly ascribed to the tight combination and consistent deformability across steel, Al, and the transition layers (Cu, Al4Cu9, and Al2Cu).

  13. Reactions of OOH radical with beta-carotene, lycopene, and torulene: hydrogen atom transfer and adduct formation mechanisms.


    Galano, Annia; Francisco-Marquez, Misaela


    The relative free radical scavenging activity of beta-carotene, lycopene, and torulene toward OOH radicals has been studied using density functional theory. Hydrogen atom transfer (HAT) and radical adduct formation (RAF) mechanisms have been considered. All the possible reaction sites have been included in the modeling, and detailed branching ratios are reported for the first time. The reactions of hydrocarbon carotenoids (Car) with peroxyl radicals, in both polar and nonpolar environments, are predicted to proceed via RAF mechanism, with contributions higher than 98% to the overall OOH + Car reactions. Lycopene and torulene were found to be more reactive than beta-carotene. In nonpolar environments the reactivity of the studied carotenoids toward peroxyl radical follows the trend LYC > TOR > BC, whereas in aqueous solutions it is TOR > LYC > BC. OOH adducts are predicted to be formed mainly at the terminal sites of the conjugated polyene chains. The main addition sites were found to be C5 for beta-carotene and lycopene and C30 for torulene. The general agreement between the calculated magnitudes and the available experimental data supports the predictions from this work. PMID:19627101

  14. Synthetic peptides corresponding to human follicle-stimulating hormone (hFSH)-beta-(1-15) and hFSH-beta-(51-65) induce uptake of 45Ca++ by liposomes: evidence for calcium-conducting transmembrane channel formation

    SciTech Connect

    Grasso, P.; Santa-Coloma, T.A.; Reichert, L.E. Jr. )


    We have previously described FSH receptor-mediated influx of 45Ca++ in cultured Sertoli cells from immature rats and receptor-enriched proteoliposomes via activation of voltage-sensitive and voltage-independent calcium channels. We have further shown that this effect of FSH does not require cholera toxin- or pertussis toxin-sensitive guanine nucleotide binding protein or activation of adenylate cyclase. In the present study, we have identified regions of human FSH-beta-subunit which appear to be involved in mediating calcium influx. We screened 11 overlapping peptide amides representing the entire primary structure of hFSH-beta-subunit for their effects on 45Ca++ flux in FSH receptor-enriched proteoliposomes. hFSH-beta-(1-15) and hFSH-beta-(51-65) induced uptake of 45Ca++ in a concentration-related manner. This effect of hFSH-beta-(1-15) and hFSH-beta-(51-65) was also observed in liposomes lacking incorporated FSH receptor. Reducing membrane fluidity by incubating liposomes (containing no receptor) with hFSH-beta-(1-15) or hFSH-beta-(51-65) at temperatures lower than the transition temperatures of their constituent phospholipids resulted in no significant (P greater than 0.05) difference in 45Ca++ uptake. The effectiveness of the calcium ionophore A23187, however, was abolished. Ruthenium red, a voltage-independent calcium channel antagonist, was able to completely block uptake of 45Ca++ induced by hFSH-beta-(1-15) and hFSH-beta-(51-65) whereas nifedipine, a calcium channel blocker specific for L-type voltage-sensitive calcium channels, was without effect. These results suggest that in addition to its effect on voltage-sensitive calcium channel activity, interaction of FSH with its receptor may induce formation of transmembrane aqueous channels which also facilitate influx of extracellular calcium.

  15. Film formation and paper coating with poly ([beta]-hydroxyalkanoate), a biodegradable latex

    SciTech Connect

    Lauzier, C.A.; Monasterios, C.J.; Saracovan, I.; Marchessault, R.H. ); Ramsay, B.A. )


    An aqueous latex of a poly ([beta]-hydroxyalkanoate) (PHA) coated on paper imparted water imperviousness without changing mechanical properties. Hot-pressed films biodegraded faster than solvent cast films. The PHA coating on paper degraded totally in activated sludge within 12 days, leaving the cellulose matrix relatively untouched. Blends of PHA latexes with sodium carboxymethl cellulose, polystyrene latex, carboxylated styrenel butadiene latex, natural rubber latex, carboxylated styrenel butadiene latex; natural rubber latex, and starch powders form satisfactory films at room temperature.

  16. Driving Cartilage Formation in High-Density Human Adipose-Derived Stem Cell Aggregate and Sheet Constructs Without Exogenous Growth Factor Delivery

    PubMed Central

    Dang, Phuong N.; Solorio, Loran D.


    An attractive cell source for cartilage tissue engineering, human adipose-derived stem cells (hASCs) can be easily expanded and signaled to differentiate into chondrocytes. This study explores the influence of growth factor distribution and release kinetics on cartilage formation within 3D hASC constructs incorporated with transforming growth factor-β1 (TGF-β1)-loaded gelatin microspheres. The amounts of microspheres, TGF-β1 concentration, and polymer degradation rate were varied within hASC aggregates. Microsphere and TGF-β1 loading concentrations were identified that resulted in glycosaminoglycan (GAG) production comparable to those of control aggregates cultured in TGF-β1-containing medium. Self-assembling hASC sheets were then engineered for the production of larger, more clinically relevant constructs. Chondrogenesis was observed in hASC-only sheets cultured with exogenous TGF-β1 at 3 weeks. Importantly, sheets with incorporated TGF-β1-loaded microspheres achieved GAG production similar to sheets treated with exogenous TGF-β1. Cartilage formation was confirmed histologically via observation of cartilage-like morphology and GAG staining. This is the first demonstration of the self-assembly of hASCs into high-density cell sheets capable of forming cartilage in the presence of exogenous TGF-β1 or with TGF-β1-releasing microspheres. Microsphere incorporation may bypass the need for extended in vitro culture, potentially enabling hASC sheets to be implanted more rapidly into defects to regenerate cartilage in vivo. PMID:24873753

  17. Spontaneous Formation of Oligomers and Fibrils in Large-Scale Molecular Dynamics Simulations of A-beta Peptides

    NASA Astrophysics Data System (ADS)

    Hall, Carol


    Protein aggregation is associated with serious and eventually-fatal neurodegenerative diseases including Alzheimer's and Parkinson's. While atomic resolution molecular dynamics simulations have been useful in this regard, they are limited to examination of either oligomer formation by a small number of peptides or analysis of the stability of a moderate number of peptides placed in trial or known experimental structures. We describe large scale intermediate-resolution molecular dynamics simulations of the spontaneous formation of fibrils by systems containing large numbers (48) of peptides including A-beta (16-22), and A-beta (17-42) peptides. We trace out the aggregation process from an initial configuration of random coils to proto-filaments with cross- β structures and demonstrate how kinetics dictates the structural details of the fully formed fibril. Fibrillization kinetics depends strongly on the temperature. Nucleation and templated growth via monomer addition occur at and near a transition temperature above which fibrils are unlikely to form. Oligomeric merging and structural rearrangement are observed at lower temperatures. In collaboration with Mookyung Cheon, Iksoo Chang, Pusan University; and David Latshaw, North Carolina State University.

  18. Formation of alpha and beta tantalum at the variation of magnetron sputtering conditions

    NASA Astrophysics Data System (ADS)

    Nasakina, E. O.; Sevostyanov, M. A.; Mikhaylova, A. B.; Baikin, A. S.; Sergienko, K. V.; Leonov, A. V.; Kolmakov, A. G.


    Nano- and microdimensional surface layers of α and β tantalum on flat NiTi, Ti, glass, etc. substrates were created. Structure and composition of samples were defined by SEM, AES and x-ray diffractometry. With increase in deposition time surface layer thickness not linearly increases. The transitional layer provide high adhesion of a surface layer to a substrate. Irrespective of summary sputtering time the β phase is formed in the beginning and at sputtering time more than 20 min on it α tantalum is deposited, while temperature remains below 150°C. Keywords: composite materials, surface layer, tantalum, alpha and beta phase, nitinol, corrosion resistance.

  19. The cognitive effects of trauma: reversal of alpha function and the formation of a beta screen.


    Brown, Lawrence J


    Following a brief review of Freud's writings on trauma, the author discusses relevant theories of Bion, and in particular the concepts of the alpha function and the beta screen. A clinical example is presented in which the patient's relatively recent trauma in adulthood had become fused with prior related experiences, leading to a propensity for repeated enactments in analysis and a failure to learn from experience. Drawing on the analyst's alpha function, the patient was gradually able to use mentalization to transform her rigidly structured traumatic organization. The author highlights the roles of dreams/dream associations and of screen memories in the patient's analysis. PMID:15889686

  20. Formation of deglycosylated alpha-L-fucosidase by endo-beta-N-acetylglucosaminidase in Fusarium oxysporum.

    PubMed Central

    Tsuji, Y; Yamamoto, K; Tochikura, T


    Two forms of alpha-L-fucosidase, deglycosylated and glycosylated, were found in the fucose-inducing culture broth of Fusarium oxysporum. Endo-beta-N-acetylglucosaminidase was also found in the same culture broth. The deglycosylated alpha-L-fucosidase was purified from the culture broth to homogeneity on polyacrylamide disc gel electrophoresis and analytical ultracentrifugation. Purified deglycosylated alpha-L-fucosidase was compared in chemical composition and immunological homology with glycosylated alpha-L-fucosidase which had been reported previously (K. Yamamoto, Y. Tsuji, H. Kumagai, and T. Tochikura, Agric. Biol. Chem. 50: 1689, 1986). Both enzymes had nearly the same amino acid compositions and were immunologically identical. Glycosylated alpha-L-fucosidase had mannose, galactose, and N-acetylglucosamine residues. In contrast, the deglycosylated enzyme had only N-acetylglucosamine residues. These results suggest that the deglycosylated alpha-L-fucosidase is formed by the release of sugar chains from the glycosylated form by Fusarium endo-beta-N-acetylglucosaminidase. Furthermore, various enzymatic properties were compared: the two alpha-L-fucosidases were found to exhibit similar catalytic activities and thermal stability profiles. The deglycosylated enzyme, however, was slightly unstable in the acidic pH range compared with the glycosylated enzyme. Images PMID:2111117

  1. Formation of discontinuities and expansion waves in the outflow region of magnetic reconnection in an asymmetric current sheet

    NASA Astrophysics Data System (ADS)

    Lee, L. C.; Hsupeng, B. Y.; Lee, K. H.; Chao, J. K.


    The current sheets observed in the solar wind, magnetopause, and nightside plasma sheet can be asymmetric, in which the plasma densities and/or magnetic field magnitudes on the two sides of the current sheet are not equal. A hybrid code is used to simulate the 1-D Riemann problem for the generation and evolution of MHD discontinuities and expansion waves in the outflow region of magnetic reconnection in an asymmetric current sheet. In a symmetric current sheet, four types of compound structures are found: (a) RD-SS compound structure: show shock (SS) is attached to the downstream of rotational discontinuity (RD), (b) SS-RD: SS is followed by an adjacent RD, (c) SS-RD-SS: RD is trapped inside SS, and (d) switch-off slow shock (SSS). In the asymmetric current sheet, the rotational angle of magnetic field across an RD on the side with a higher plasma density is usually larger than that with a lower plasma density. In the asymmetric cases, a pure RD, a single SS, or a pure slow expansion wave (SE) may appear. When the asymmetry is further increased, RD may become absent in the low density side. For a highly asymmetric current sheet, a slow expansion wave (SE) is formed behind the SS-RD compound structure on the side with a very high plasma density.

  2. Astrocyte transforming growth factor beta 1 promotes inhibitory synapse formation via CaM kinase II signaling.


    Diniz, Luan Pereira; Tortelli, Vanessa; Garcia, Matheus Nunes; Araújo, Ana Paula Bérgamo; Melo, Helen M; Silva, Gisele S Seixas da; Felice, Fernanda G De; Alves-Leon, Soniza Vieira; Souza, Jorge Marcondes de; Romão, Luciana Ferreira; Castro, Newton Gonçalves; Gomes, Flávia Carvalho Alcantara


    The balance between excitatory and inhibitory synaptic inputs is critical for the control of brain function. Astrocytes play important role in the development and maintenance of neuronal circuitry. Whereas astrocytes-derived molecules involved in excitatory synapses are recognized, molecules and molecular mechanisms underlying astrocyte-induced inhibitory synapses remain unknown. Here, we identified transforming growth factor beta 1 (TGF-β1), derived from human and murine astrocytes, as regulator of inhibitory synapse in vitro and in vivo. Conditioned media derived from human and murine astrocytes induce inhibitory synapse formation in cerebral cortex neurons, an event inhibited by pharmacologic and genetic manipulation of the TGF-β pathway. TGF-β1-induction of inhibitory synapse depends on glutamatergic activity and activation of CaM kinase II, which thus induces localization and cluster formation of the synaptic adhesion protein, Neuroligin 2, in inhibitory postsynaptic terminals. Additionally, intraventricular injection of TGF-β1 enhanced inhibitory synapse number in the cerebral cortex. Our results identify TGF-β1/CaMKII pathway as a novel molecular mechanism underlying astrocyte control of inhibitory synapse formation. We propose here that the balance between excitatory and inhibitory inputs might be provided by astrocyte signals, at least partly achieved via TGF-β1 downstream pathways. Our work contributes to the understanding of the GABAergic synapse formation and may be of relevance to further the current knowledge on the mechanisms underlying the development of various neurological disorders, which commonly involve impairment of inhibitory synapse transmission. PMID:25042347

  3. Direct Monitoring of β-Sheet Formation in the Outer Membrane Protein TtoA Assisted by TtOmp85.


    Henke, Katharina; Welte, Wolfram; Hauser, Karin


    Attenuated total reflection Fourier-transform infrared (ATR-FTIR) spectroscopy was applied to investigate the folding of an outer membrane protein, TtoA, assisted by TtOmp85, both from the thermophilic eubacterium Thermus thermophilus. To directly monitor the formation of β-sheet structure in TtoA and to analyze the function of TtOmp85, we immobilized unfolded TtoA on an ATR crystal. Interaction with TtOmp85 initiated TtoA folding as shown by time-dependent spectra recorded during the folding process. Our ATR-FTIR experiments prove that TtOmp85 possesses specific functionality to assist β-sheet formation of TtoA. We demonstrate the potential of this spectroscopic approach to study the interaction of outer membrane proteins in vitro and in a time-resolved manner. PMID:27400268

  4. Rubella - Fact Sheet for Parents


    ... this page: About . Redirect for the Rubella fact sheet page. The current fact sheet can ... Print page Share Compartir File Formats Help: ...

  5. Inhibition of beta-amyloid aggregation by fluorescent dye labels

    SciTech Connect

    Amaro, Mariana; Wellbrock, Thorben; Birch, David J. S.; Rolinski, Olaf J.


    The fluorescence decay of beta-amyloid's (Aβ) intrinsic fluorophore tyrosine has been used for sensing the oligomer formation of dye-labelled Aβ monomers and the results compared with previously studied oligomerization of the non-labelled Aβ peptides. It has been demonstrated that two different sized, covalently bound probes 7-diethylaminocoumarin-3-carbonyl and Hilyte Fluor 488 (HLF), alter the rate and character of oligomerization to different extents. The ability of HLF to inhibit formation of highly ordered structures containing beta-sheets was also shown. The implications of our findings for using fluorescence methods in amyloidosis research are discussed and the advantages of this auto-fluorescence approach highlighted.

  6. Inhibition of beta-amyloid aggregation by fluorescent dye labels

    NASA Astrophysics Data System (ADS)

    Amaro, Mariana; Wellbrock, Thorben; Birch, David J. S.; Rolinski, Olaf J.


    The fluorescence decay of beta-amyloid's (Aβ) intrinsic fluorophore tyrosine has been used for sensing the oligomer formation of dye-labelled Aβ monomers and the results compared with previously studied oligomerization of the non-labelled Aβ peptides. It has been demonstrated that two different sized, covalently bound probes 7-diethylaminocoumarin-3-carbonyl and Hilyte Fluor 488 (HLF), alter the rate and character of oligomerization to different extents. The ability of HLF to inhibit formation of highly ordered structures containing beta-sheets was also shown. The implications of our findings for using fluorescence methods in amyloidosis research are discussed and the advantages of this auto-fluorescence approach highlighted.

  7. Beta- Lactam Antibiotics Stimulate Biofilm Formation in Non-Typeable Haemophilus influenzae by Up-Regulating Carbohydrate Metabolism

    PubMed Central

    Wu, Siva; Li, Xiaojin; Gunawardana, Manjula; Maguire, Kathleen; Guerrero-Given, Debbie; Schaudinn, Christoph; Wang, Charles; Baum, Marc M.; Webster, Paul


    Non-typeable Haemophilus influenzae (NTHi) is a common acute otitis media pathogen, with an incidence that is increased by previous antibiotic treatment. NTHi is also an emerging causative agent of other chronic infections in humans, some linked to morbidity, and all of which impose substantial treatment costs. In this study we explore the possibility that antibiotic exposure may stimulate biofilm formation by NTHi bacteria. We discovered that sub-inhibitory concentrations of beta-lactam antibiotic (i.e., amounts that partially inhibit bacterial growth) stimulated the biofilm-forming ability of NTHi strains, an effect that was strain and antibiotic dependent. When exposed to sub-inhibitory concentrations of beta-lactam antibiotics NTHi strains produced tightly packed biofilms with decreased numbers of culturable bacteria but increased biomass. The ratio of protein per unit weight of biofilm decreased as a result of antibiotic exposure. Antibiotic-stimulated biofilms had altered ultrastructure, and genes involved in glycogen production and transporter function were up regulated in response to antibiotic exposure. Down-regulated genes were linked to multiple metabolic processes but not those involved in stress response. Antibiotic-stimulated biofilm bacteria were more resistant to a lethal dose (10 µg/mL) of cefuroxime. Our results suggest that beta-lactam antibiotic exposure may act as a signaling molecule that promotes transformation into the biofilm phenotype. Loss of viable bacteria, increase in biofilm biomass and decreased protein production coupled with a concomitant up-regulation of genes involved with glycogen production might result in a biofilm of sessile, metabolically inactive bacteria sustained by stored glycogen. These biofilms may protect surviving bacteria from subsequent antibiotic challenges, and act as a reservoir of viable bacteria once antibiotic exposure has ended. PMID:25007395

  8. The Role of Plasma Sheet Conditions in Ring Current Formation and Energetic Neutral Atom Emissions: TWINS Results and CRCM Comparison

    NASA Astrophysics Data System (ADS)

    Fok, M.; Buzulukova, N.; McComas, D.; Brandt, P.; Goldstein, J.; Valek, P.; Alquiza, J.


    The dynamics of the ring current is sensitive to plasma sheet density and temperature. The situation is further complicated by ionospheric feedback and the existence of electric shielding at low latitudes. Most of the ring current pressure is carried by ions with energies of ~5-50 keV. In this energy range, H-H+ charge exchange cross section falls sharply with increasing energy. As a result, the intensity of energetic neutral atoms (ENA) emitted from the ring current is very sensitive to the ion energy distribution, which, in turn, is controlled by the plasma sheet temperature. Using the Comprehensive Ring Current Model (CRCM) with different plasma sheet models, we calculate ENA emissions during several moderate storms in years 2008 and 2009. We compare the simulated images with those from the TWINS imagers and study the effects of plasma sheet conditions on the ring current and the associated ENA emissions.

  9. Chimeric DNA-RNA hammerhead ribozyme targeting transforming growth factor-beta 1 mRNA inhibits neointima formation in rat carotid artery after balloon injury.


    Ando, Hideyuki; Fukuda, Noboru; Kotani, Motoko; Yokoyama, Shin ichiro; Kunimoto, Satoshi; Matsumoto, Koichi; Saito, Satoshi; Kanmatsuse, Katsuo; Mugishima, Hideo


    We designed and synthesized a chimeric DNA-RNA hammerhead ribozyme targeting transforming growth factor (TGF)-beta 1 mRNA and found that this ribozyme effectively and specifically inhibited growth of vascular smooth muscle cells. We examined the effects of the chimeric DNA-RNA hammerhead ribozyme targeting TGF-beta 1 mRNA on neointima formation and investigated the underlying mechanism to develop a possible gene therapy for coronary artery restenosis after percutaneous transluminal coronary angioplasty. Expression of mRNAs encoding TGF-beta 1, p27kip1, and connective tissue growth factor (CTGF) in carotid artery increased after balloon injury. Fluorescein-isothiocyanate (FITC)-labeled ribozyme was taken up into the midlayer smooth muscle of the injured carotid artery. Both 2 and 5 mg of ribozyme reduced neointima formation by 65% compared to that of controls. Ribozyme markedly decreased expression of TGF-beta 1 mRNA and protein in injured vessel. Mismatch ribozyme had no effect on expression of TGF-beta 1 mRNA protein in injured vessel. Ribozyme markedly decreased expression of fibronectin, p27kip1, and CTGF mRNAs in injured vessel, whereas a mismatch ribozyme had no effect on these mRNAs. These findings indicate that the chimeric DNA-RNA hammerhead ribozyme targeting TGF-beta 1 mRNA inhibits neointima formation in rat carotid artery after balloon injury with suppression of TGF-beta 1 and inhibition of extracellular matrix and CTGF. In conclusion, the hammerhead ribozyme against TGF-beta 1 may have promise as a therapy for coronary artery restenosis after percutaneous transluminal coronary angioplasty. PMID:14729108

  10. Formation of high-{beta} plasma and stable confinement of toroidal electron plasma in Ring Trap 1

    SciTech Connect

    Saitoh, H.; Yoshida, Z.; Morikawa, J.; Furukawa, M.; Yano, Y.; Kawai, Y.; Kobayashi, M.; Vogel, G.; Mikami, H.


    Formation of high-{beta} electron cyclotron resonance heating plasma and stable confinement of pure electron plasma have been realized in the Ring Trap 1 device, a magnetospheric configuration generated by a levitated dipole field magnet. The effects of coil levitation resulted in drastic improvements of the confinement properties, and the maximum local {beta} value has exceeded 70%. Hot electrons are major component of electron populations, and its particle confinement time is 0.5 s. Plasma has a peaked density profile in strong field region [H. Saitoh et al., 23rd IAEA Fusion Energy Conference EXC/9-4Rb (2010)]. In pure electron plasma experiment, inward particle diffusion is realized, and electrons are stably trapped for more than 300 s. When the plasma is in turbulent state during beam injection, plasma flow has a shear, which activates the diocotron (Kelvin-Helmholtz) instability. The canonical angular momentum of the particle is not conserved in this phase, realizing the radial diffusion of charged particles across closed magnetic surfaces. [Z. Yoshida et al., Phys Rev. Lett. 104, 235004 (2010); H. Saitoh et al., Phys. Plasmas 17, 112111 (2010).].

  11. The influence of beta subunit structure on the interaction of Na+/K(+)-ATPase complexes with Na+. A chimeric beta subunit reduces the Na+ dependence of phosphoenzyme formation from ATP.


    Eakle, K A; Lyu, R M; Farley, R A


    High-affinity ouabain binding to Na+/K(+)-ATPase (sodium- and potassium-transport adenosine triphosphatase (EC requires phosphorylation of the alpha subunit of the enzyme either by ATP or by inorganic phosphate. For the native enzyme (alpha/beta 1), the ATP-dependent reaction proceeds about 4-fold more slowly in the absence of Na+ than when saturating concentrations of Na+ are present. Hybrid pumps were formed from either the alpha 1 or the alpha 3 subunit isoforms of Na+/K(+)-ATPase and a chimeric beta subunit containing the transmembrane segment of the Na+/K(+)-ATPase beta 1 isoform and the external domain of the gastric H+/K(+)-ATPase beta subunit (alpha/NH beta 1 complexes). In the absence of Na+, these complexes show a rate of ATP-dependent ouabain binding from approximately 75-100% of the rate seen in the presence of Na+ depending on buffer conditions. Nonhydrolyzable nucleotides or treatment of ATP with apyrase abolishes ouabain binding, demonstrating that ouabain binding to alpha/NH beta 1 complexes requires phosphorylation of the protein. Buffer ions inhibit ouabain binding by alpha/NH beta 1 in the absence of Na+ rather than promote ouabain binding, indicating that they are not substituting for sodium ions in the phosphorylation reaction. The pH dependence of ATP-dependent ouabain binding in the presence or absence of Na+ is similar, suggesting that protons are probably not substituting for Na+. Hybrid alpha/NH beta 1 pumps also show slightly higher apparent affinities (2-3-fold) for ATP, Na+, and ouabain; however, these are not sufficient to account for the increase in ouabain binding in the absence of Na+. In contrast to phosphoenzyme formation and ouabain binding by alpha/NH beta 1 complexes in the absence of Na+, ATPase activity, measured as release of phosphate from ATP, requires Na+. These data suggest that the transition from E1P to E2P during the catalytic cycle does not occur when the sodium binding sites are not occupied. Thus, the

  12. A cylinder-shaped double ribbon structure formed by an amyloid hairpin peptide derived from the beta-sheet of murine PrP: an X-ray and molecular dynamics simulation study.


    Croixmarie, Vincent; Briki, Fatma; David, Gabriel; Coïc, Yves-Marie; Ovtracht, Ludmila; Doucet, Jean; Jamin, Nadège; Sanson, A


    A structural model of the murine PrP small beta-sheet was obtained by synthesizing the RGYMLGSADPNGNQVYYRG peptide comprising the two beta-strands 127-133 and 159-164 linked by a four-residue sequence of high turn propensity. The DPNG turn sequence is a "short circuit" replacing the original protein sequence between the two strands. This 19-residue peptide spontaneously forms very long single fibrils as observed by electron microscopy. The X-ray diffraction patterns of a partially oriented sample reveals an average arrangement of the hairpin peptides into a structure which can be geometrically approximated by an empty-core cylinder. The hairpins are oriented perpendicular to the cylinder axis and a 130 A helix period is observed. Based on X-ray diffraction constraints and on more indirect general protein structure considerations, a precise and consistent fibril model was built. The structure consists of two beta-sheet ribbons wound around a cylinder and assembled into a single fibril with a hairpin orientation perpendicular to the fibril axis. Subsequent implicit and explicit solvent molecular dynamics simulations provided the final structure at atomic resolution and further insights into the stabilizing interactions. Particularly important are the zipper-like network of polar interactions between the edges of the two ribbons, including the partially buried water molecules. The hydrophobic core is not optimally compact explaining the low density of this region seen by X-ray diffraction. The present findings provide also a simple model for further investigating the sequence-stability relationship using a mutational approach with a quasi-independent consideration of the polar and apolar interactions. PMID:15890277

  13. Complex formation equilibria of some beta-amino-alcohols with lead(II) and cadmium(II) in aqueous solution.


    Canepari, S; Carunchio, V; Castellano, P; Messina, A


    A study of complex formation equilibria of some beta-amino-alcohols with lead(II) and cadmium(II) ions at 25 degrees C and in 0.5 M KNO(3) is reported. The amino-alcohols considered are 2-amino-1-propanol, 2-amino-1-butanol, 2-amino-1-pentanol and 2-amino-1,3-propanediol. sec-Buthylamine and 2-amino-1-methoxy-propane have been also considered for comparison. The results are discussed in terms of ligand structure, paying attention to the number of hydroxyl groups and to the length of the alkyl residual. A weak contribution of the alcoholic oxygen in the coordination of cadmium(II) and the presence of a mixed hydroxyl species in lead(II) containing systems are hypothesized. PMID:18967412

  14. Pattern formation in icosahedral virus capsids: the papova viruses and Nudaurelia capensis beta virus.

    PubMed Central

    Marzec, C J; Day, L A


    The capsids of the spherical viruses all show underlying icosahedral symmetry, yet they differ markedly in capsomere shape and in capsomere position and orientation. The capsid patterns presented by the capsomere shapes, positions, and orientations of three viruses (papilloma, SV40, and N beta V) have been generated dynamically through a bottom-up procedure which provides a basis for understanding the patterns. A capsomere shape is represented in two-dimensional cross-section by a mass or charge density on the surface of a sphere, given by an expansion in spherical harmonics, and referred to herein as a morphological unit (MU). A capsid pattern is represented by an icosahedrally symmetrical superposition of such densities, determined by the positions and orientations of its MUs on the spherical surface. The fitness of an arrangement of MUs is measured by an interaction integral through which all capsid elements interact with each other via an arbitrary function of distance. A capsid pattern is generated by allowing the correct number of approximately shaped MUs to move dynamically on the sphere, positioning themselves until an extremum of the fitness function is attained. The resulting patterns are largely independent of the details of both the capsomere representation and the interaction function; thus the patterns produced are generic. The simplest useful fitness function is sigma 2, the average square of the mass (or charge) density, a minimum of which corresponds to a "uniformly spaced" MU distribution; to good approximation, the electrostatic free energy of charged capsomeres, calculated from the linearized Poisson-Boltzmann equation, is proportional to sigma 2. With disks as MUs, the model generates the coordinated lattices familiar from the quasi-equivalence theory, indexed by triangulation numbers. Using fivefold MUs, the model generates the patterns observed at different radii within the T = 7 capsid of papilloma and at the surface of SV40; threefold MUs

  15. Influence of Interleukin-1 Beta on Platelet-Poor Plasma Clot Formation: A Potential Impact on Early Bone Healing

    PubMed Central

    Masci, Paul P.; Crawford, Ross; Xiao, Yin


    Objectives Hematoma quality (especially the fibrin matrix) plays an important role in the bone healing process. Here, we investigated the effect of interleukin-1 beta (IL-1β) on fibrin clot formation from platelet-poor plasma (PPP). Methods Five-milliliter of rat whole-blood samples were collected from the hepatic portal vein. All blood samples were firstly standardized via a thrombelastograph (TEG), blood cell count, and the measurement of fibrinogen concentration. PPP was prepared by collecting the top two-fifths of the plasma after centrifugation under 400 × g for 10 min at 20°C. The effects of IL-1β cytokines on artificial fibrin clot formation from PPP solutions were determined by scanning electronic microscopy (SEM), confocal microscopy (CM), turbidity, and clot lysis assays. Results The lag time for protofibril formation was markedly shortened in the IL-1β treatment groups (243.8 ± 76.85 in the 50 pg/mL of IL-1β and 97.5 ± 19.36 in the 500 pg/mL of IL-1β) compared to the control group without IL-1β (543.8 ± 205.8). Maximal turbidity was observed in the control group. IL-1β (500 pg/mL) treatment significantly decreased fiber diameters resulting in smaller pore sizes and increased density of the fibrin clot structure formed from PPP (P < 0.05). The clot lysis assay revealed that 500 pg/mL IL-1β induced a lower susceptibility to dissolution due to the formation of thinner and denser fibers. Conclusion IL-1β can significantly influence PPP fibrin clot structure, which may affect the early bone healing process. PMID:26909757

  16. MMS Spacecraft Observation of Near Tail Thin Current Sheets: Their Locations, Conditions for Formation and Relation to Geomagnetic Activity

    NASA Astrophysics Data System (ADS)

    Zhao, C.; Russell, C. T.; Strangeway, R. J.; Anderson, B. J.; Baumjohann, W.; Bromund, K. R.; Chutter, M.; Fischer, D.; Kepko, L.; Le Contel, O.; Leinweber, H. K.; Magnes, W.; Nakamura, R.; Plaschke, F.; Slavin, J. A.; Torbert, R. B.


    During the commissioning phase of the MMS mission, when the apogee (~12Re) of MMS orbit swept from the pre-midnight to the dusk section of the magnetosphere, the four spacecraft probed the dynamic region of the near-Earth magnetotail. The MMS fleet encountered many structures with unambiguously small-scale spatial gradient in magnetic field (comparable to the separation of the fleet), indicating the existence of very thin current sheets in this near-tail region. During this commissioning phase, the MMS spacecraft were in a string of pearls configuration, not ideally suitable for "curlometer" determination of the current density. Thus the current density and thickness of the sheets are only roughly determined using reasonable assumptions. In this study we correlate the current sheet's location and thickness with solar wind conditions and the ground magnetic field records.

  17. Natalizumab plus interferon beta-1a reduces lesion formation in relapsing multiple sclerosis.


    Radue, Ernst-Wilhelm; Stuart, William H; Calabresi, Peter A; Confavreux, Christian; Galetta, Steven L; Rudick, Richard A; Lublin, Fred D; Weinstock-Guttman, Bianca; Wynn, Daniel R; Fisher, Elizabeth; Papadopoulou, Athina; Lynn, Frances; Panzara, Michael A; Sandrock, Alfred W


    The SENTINEL study showed that the addition of natalizumab improved outcomes for patients with relapsing multiple sclerosis (MS) who had experienced disease activity while receiving interferon beta-1a (IFNbeta-1a) alone. Previously unreported secondary and tertiary magnetic resonance imaging (MRI) measures are presented here. Patients received natalizumab 300 mg (n=589) or placebo (n=582) intravenously every 4 weeks plus IFNbeta-1a 30 microg intramuscularly once weekly. Annual MRI scans allowed comparison of a range of MRI end points versus baseline. Over 2 years, 67% of patients receiving natalizumab plus IFNbeta-1a remained free of new or enlarging T2-lesions compared with 30% of patients receiving IFNbeta-1a alone. The mean change from baseline in T2 lesion volume over 2 years decreased in patients receiving natalizumab plus IFNbeta-1a and increased in those receiving IFNbeta-1a alone (-277.5mm(3) versus 525.6mm(3); p<0.001). Compared with IFNbeta-1a alone, add-on natalizumab therapy resulted in a smaller increase in mean T1-hypointense lesion volume after 2 years (1821.3mm(3) versus 2210.5mm(3); p<0.001), a smaller mean number of new T1-hypointense lesions over 2 years (2.3 versus 4.1; p<0.001), and a slower rate of brain atrophy during the second year of therapy (-0.31% versus -0.40%; p=0.020). Natalizumab add-on therapy reduced gadolinium-enhancing, T1-hypointense, and T2 MRI lesion activity and slowed brain atrophy progression in patients with relapsing MS who experienced disease activity despite treatment with IFNbeta-1a alone. PMID:20236661

  18. Sub-100 nm Si nanowire and nano-sheet array formation by MacEtch using a non-lithographic InAs nanowire mask

    NASA Astrophysics Data System (ADS)

    Shin, Jae Cheol; Zhang, Chen; Li, Xiuling


    We report a non-lithographical method for the fabrication of ultra-thin silicon (Si) nanowire (NW) and nano-sheet arrays through metal-assisted-chemical-etching (MacEtch) with gold (Au). The mask used for metal patterning is a vertical InAs NW array grown on a Si substrate via catalyst-free, strain-induced, one-dimensional heteroepitaxy. Depending on the Au evaporation angle, the shape and size of the InAs NWs are transferred to Si by Au-MacEtch as is (NWs) or in its projection (nano-sheets). The Si NWs formed have diameters in the range of ˜25-95 nm, and aspect ratios as high as 250 in only 5 min etch time. The formation process is entirely free of organic chemicals, ensuring pristine Au-Si interfaces, which is one of the most critical requirements for high yield and reproducible MacEtch.

  19. Sub-100 nm Si nanowire and nano-sheet array formation by MacEtch using a non-lithographic InAs nanowire mask.


    Shin, Jae Cheol; Zhang, Chen; Li, Xiuling


    We report a non-lithographical method for the fabrication of ultra-thin silicon (Si) nanowire (NW) and nano-sheet arrays through metal-assisted-chemical-etching (MacEtch) with gold (Au). The mask used for metal patterning is a vertical InAs NW array grown on a Si substrate via catalyst-free, strain-induced, one-dimensional heteroepitaxy. Depending on the Au evaporation angle, the shape and size of the InAs NWs are transferred to Si by Au-MacEtch as is (NWs) or in its projection (nano-sheets). The Si NWs formed have diameters in the range of ∼25-95 nm, and aspect ratios as high as 250 in only 5 min etch time. The formation process is entirely free of organic chemicals, ensuring pristine Au-Si interfaces, which is one of the most critical requirements for high yield and reproducible MacEtch. PMID:22781145

  20. A single disulfide bond differentiates aggregation pathways of beta2-microglobulin.


    Chen, Yiwen; Dokholyan, Nikolay V


    Deposition of wild-type beta2-microglobulin (beta2m) into amyloid fibrils is a complication in patients undergoing long-term hemodialysis. The native beta-sandwich fold of beta2m has a highly conserved disulfide bond linking Cys25 and Cys80. Oxidized beta2m forms needle-like amyloid fibrils at pH 2.5 in vitro, whereas reduced beta2m, at acid pH, in which the intra-chain disulfide bond is disrupted, cannot form typical fibrils. Instead, reduced beta2m forms thinner and more flexible filaments. To uncover the difference in molecular mechanisms underlying the aggregation of the oxidized and reduced beta2m, we performed molecular dynamics simulations of beta2m oligomerization under oxidized and reduced conditions. We show that, consistent with experimental observations, the oxidized beta2m forms domain-swapped dimer, in which the two proteins exchange their N-terminal segments complementing each other. In contrast, both dimers and trimers, formed by reduced beta2m, are comprised of parallel beta-sheets between monomers and stabilized by the hydrogen bond network along the backbone. The oligomerized monomers are in extended conformations, capable of further aggregation. We find that both reduced and oxidized dimers are thermodynamically less stable than their corresponding monomers, indicating that beta2m oligomerization is not accompanied by the formation of a thermodynamically stable dimer. Our studies suggest that the different aggregation pathways of oxidized and reduced beta2m are dictated by the formation of distinct precursor oligomeric species that are modulated by Cys25-Cys80 disulfide-bonds. We propose that the propagation of domain swapping is the aggregation mechanism for the oxidized beta2m, while "parallel stacking" of partially unfolded beta2m is the aggregation mechanism for the reduced beta2m. PMID:16242719

  1. Specific collapse followed by slow hydrogen-bond formation of β-sheet in the folding of single-chain monellin

    PubMed Central

    Kimura, Tetsunari; Uzawa, Takanori; Ishimori, Koichiro; Morishima, Isao; Takahashi, Satoshi; Konno, Takashi; Akiyama, Shuji; Fujisawa, Tetsuro


    Characterization of the conformational landscapes for proteins with different secondary structures is important in elucidating the mechanism of protein folding. The folding trajectory of single-chain monellin composed of a five-stranded β-sheet and a helix was investigated by using a pH-jump from the alkaline unfolded to native state. The kinetic changes in the secondary structures and in the overall size and shape were measured by circular dichroism spectroscopy and small-angle x-ray scattering, respectively. The formation of the tertiary structure was monitored by intrinsic and extrinsic fluorescence. A significant collapse was observed within 300 μs after the pH-jump, leading to the intermediate with a small amount of secondary and tertiary structures but with an overall oblate shape. Subsequently, the stepwise formation of secondary and tertiary structures was detected. The current observation was consistent with the theoretical prediction that a more significant collapse precedes the formation of secondary structures in the folding of β-sheet proteins than that of helical proteins [Shea, J. E., Onuchic, J. N. & Brooks, C. L., III (2002) Proc. Natl. Acad. Sci. USA 99, 16064–16068]. Furthermore, it was implied that the initial collapse was promoted by the formation of some specific structural elements, such as tight turns, to form the oblate shape. PMID:15710881

  2. Effects of transforming growth factor beta and epidermal growth factor on cell proliferation and the formation of bone nodules in isolated fetal rat calvaria cells.


    Antosz, M E; Bellows, C G; Aubin, J E


    When cells enzymatically isolated from fetal rat calvaria (RC cells) are cultured in vitro in the presence of ascorbic acid and Na beta-glycerophosphate, discrete three-dimensional nodules form with the histologic, immunohistochemical, and ultrastructural characteristics of bone (Bellows et al; Calcified Tissue International 38:143-154, 1986; Bhargava et al., Bone, 9:155-163, 1988). Quantitation of the number of bone nodules that forms provides a colony assay for osteoprogenitor cells present in the RC population (Bellows and Aubin, Develop. Biol., 133:8-13, 1989). Continuous culture with either epidermal growth factor (EGF) or transforming growth factor beta (TGF-beta) results in dose-dependent inhibition of bone nodule formation; however, the former causes increased proliferation and saturation density, while the latter reduces both parameters. Addition of EGF (48 h pulse, 2-200 ng/ml) to RC cells at day 1 after plating results in increased proliferation and population saturation density and an increased number of bone nodules formed. Similar pulses at confluence and in postconfluent multilayered cultures when nodules first begin forming (approx. day 11) inhibited bone nodule formation and resulted in a smaller stimulation of cell proliferation. Forty-eight hour pulses of TGF-beta (0.01-1 ng/ml) reduced bone nodule formation and proliferation at all times examined, with pulses on day 1 causing maximum inhibition. The effects of pulses with TGF-beta and EGF on inhibition of nodule formation are independent of the presence of serum in the culture medium during the pulse. The data suggest that whereas EGF can either stimulate or inhibit the formation of bone nodules depending upon the time and duration of exposure, TGF-B inhibits bone nodule formation under all conditions tested. Moreover, these effects on osteoprogenitor cell differentiation do not always correlate with the effects of the growth factors on RC cell proliferation. PMID:2787326

  3. Roles of magnetic reconnection and buoyancy in the formation of dipolarization fronts: three-dimensional particle simulations of two-dimensional current sheet equilibria

    NASA Astrophysics Data System (ADS)

    Knizhnik, K.; Sitnov, M. I.; Swisdak, M. M.


    Unsteady magnetic reconnection in the magnetosphere and in the solar corona involves the formation of localized ejecta, such as the magnetotail dipolarization fronts (DFs) and coronal supra-arcade downflowing loops (SADLs). Both DFs and SADLs move in the direction opposite to the initial magnetic field stretching with a speed comparable to the Alfven speed. However, the DF scales are comparable to the ion gyro radius and therefore their analysis requires kinetic theory and simulations. Recent kinetic theory and PIC simulations of 2D magnetotail equilibria revealed two possible mechanisms of the DF formation, namely mutual attraction of parallel current filaments in thin current sheets causing magnetic reconnection via the tearing instability and magnetic buoyancy resulting in the ballooning-interchange instability. Both mechanisms are most efficient in the geometries with accumulation of magnetic flux at the tailward end of a thin current sheet. To understand the roles of magnetic reconnection and buoyancy in the formation and evolution of DFs we perform 3D PIC simulations of 2D current sheets, where two magnetotails are separated by an equilibrium X-line. To justify modeling the long terrestrial magnetotail in a relatively small simulation box: Lx x Ly x Lz= 40d x 20d x 5d (d is the ion inertial length; GSM coordinate system is used) open boundary conditions are employed in the x-direction. The magnetotail parts of the 2D equilibrium include regions of accumulated magnetic flux, consistent with the Geotail observations of similar signatures prior to substorm onset. We investigate which of the mechanisms is responsible for the formation of DF-like structures in 3D configurations and discuss their subsequent motion and structure. Simulations are compared with recent THEMIS observations of DFs and ballooning-interchange oscillations in the magnetotail, as well as SDO observations of solar flares.

  4. Evidence for adduct formation at the semiconductor-solution interface. Photoluminescent properties of cadmium selenide in the presence of lanthanide. beta. -diketonate complexes

    SciTech Connect

    Murphy, C.J.; Ellis, A.B. )


    Photoluminescence (PL) measurements of etched, single-crystal n-CdSe demonstrate that the semiconductor surface engages in adduct formation with a family of lanthanide {beta}-diketonate complexes, Ln(fod){sub 3} (Ln = lanthanide; fod = 6,6,7,7,8,8,8-heptafluoro-2,2-dimethyl-3,5-octanedionato anion), in isooctane ambient.

  5. Metal ion-dependent, reversible, protein filament formation by designed beta-roll polypeptides

    PubMed Central

    Scotter, Andrew J; Guo, Meng; Tomczak, Melanie M; Daley, Margaret E; Campbell, Robert L; Oko, Richard J; Bateman, David A; Chakrabartty, Avijit; Sykes, Brian D; Davies, Peter L


    Background A right-handed, calcium-dependent β-roll structure found in secreted proteases and repeat-in-toxin proteins was used as a template for the design of minimal, soluble, monomeric polypeptides that would fold in the presence of Ca2+. Two polypeptides were synthesised to contain two and four metal-binding sites, respectively, and exploit stacked tryptophan pairs to stabilise the fold and report on the conformational state of the polypeptide. Results Initial analysis of the two polypeptides in the presence of calcium suggested the polypeptides were disordered. The addition of lanthanum to these peptides caused aggregation. Upon further study by right angle light scattering and electron microscopy, the aggregates were identified as ordered protein filaments that required lanthanum to polymerize. These filaments could be disassembled by the addition of a chelating agent. A simple head-to-tail model is proposed for filament formation that explains the metal ion-dependency. The model is supported by the capping of one of the polypeptides with biotin, which disrupts filament formation and provides the ability to control the average length of the filaments. Conclusion Metal ion-dependent, reversible protein filament formation is demonstrated for two designed polypeptides. The polypeptides form filaments that are approximately 3 nm in diameter and several hundred nm in length. They are not amyloid-like in nature as demonstrated by their behaviour in the presence of congo red and thioflavin T. A capping strategy allows for the control of filament length and for potential applications including the "decoration" of a protein filament with various functional moieties. PMID:17908326

  6. Co-translational formation and pharmacological characterization of beta1-adrenergic receptor/nanodisc complexes with different lipid environments.


    Rues, Ralf-Bernhardt; Dötsch, Volker; Bernhard, Frank


    G protein-coupled receptors are of key significance for biomedical research. Streamlined approaches for their efficient recombinant production are of pivotal interest in order to explore their intrinsic conformational dynamics and complex ligand binding behavior. We have systematically optimized the co-translational association and folding of G protein-coupled receptors with defined membranes of nanodiscs by cell-free expression approaches. Each optimization step was quantified and the ligand binding active fraction of the receptor samples could drastically be improved. The strategy was exemplified with a stabilized and a non-stabilized derivative of the turkey beta1-adrenergic receptor. Systematic lipid screens with preformed nanodiscs revealed that generation of ligand binding active conformations of the analyzed beta1-adrenergic receptors strongly depends on lipid charge, flexibility and chain length. The lipid composition of the nanodisc membranes modulates the affinities to a variety of ligands of both receptor derivatives. In addition, the thermostabilization procedure had a significant impact on specific ligand affinities of the receptor and abolished or reduced the binding of certain antagonists. Both receptors were highly stable after purification with optimized nanodisc membranes. The procedure avoids any detergent contact of the receptors and sample production takes less than two days. Moreover, even non-stabilized receptors can be analyzed and their prior purification is not necessary for the formation of nanodisc complexes. The established process appears therefore to be suitable as a new platform for the functional or even structural characterization of recombinant G protein-coupled receptors associated with defined lipid environments. PMID:26922884

  7. Beta-radiation-induced resistance to MNNG initiation of papilloma but not carcinoma formation in mouse skin

    SciTech Connect

    Mitchel, R.E.; Gragtmans, N.J.; Morrison, D.P. )


    We have shown previously that the risk of tumor initiation, promotion, and progression in animals initiated with alkylating agents can be drastically altered by hyperthermia treatments. We show here that ionizing radiation can also alter the risk of tumor initiation by alkylating agents. Using a two-step skin tumorigenesis protocol in female SENCAR mice (initiation by MNNG, promotion with TPA), we exposed the dorsal skin of the mice to various doses of 90Sr/90Y beta radiation near the time of initiation. The radiation produced a dose-dependent reduction in the number of papillomas which appeared after TPA promotion, with about a 20% reduction in animals receiving 0.5 Gy surface dose just before initiation, about 50% reduction after 2.5 Gy, and greater than 80% at doses above 5 Gy. A dose of 2.5 Gy in animals initiated with DMBA produced no significant reduction. One skin hyperthermia treatment along with radiation in MNNG-initiated animals partially blocked the protective effect of radiation and increased the papilloma frequency. Radiation (2.5 Gy) given either 6 days before or after MNNG initiation was less effective but still reduced papilloma frequency about 20%. In sharp contrast to the marked reduction in papilloma formation, these same animals showed no change in carcinoma frequency with any of the doses or schedules of beta radiation. MNNG initiation alone produced three types of initiated cells. One type, produced in low yield, was promotion-independent with a high probability of progression to a carcinoma and appeared unaffected by the radiation. A second type, produced in intermediate yield, was promotion-dependent and also had a high progression probability, but was likewise unaffected by the radiation. The third and most abundant type was promotion-dependent with a very low progression probability.

  8. TGF-{beta} signals the formation of a unique NF1/Smad4-dependent transcription repressor-complex in human diploid fibroblasts

    SciTech Connect

    Luciakova, Katarina; Kollarovic, Gabriel; Kretova, Miroslava; Sabova, Ludmila; Nelson, B. Dean


    Highlights: {yields} TGF-{beta} induces the formation of unique nuclear NF1/Smad4 complexes that repress expression of the ANT-2 gene. {yields} Repression is mediated through an NF1-dependent repressor element in the promoter. {yields} The formation of NF1/Smad4 complexes and the repression of ANT2 are prevented by inhibitors of p38 kinase and TGF-{beta} RI. {yields} NF1/Smad complexes implicate novel role for NF1 and Smad proteins in the regulation of growth. -- Abstract: We earlier reported the formation of a unique nuclear NF1/Smad complex in serum-restricted fibroblasts that acts as an NF1-dependent repressor of the human adenine nucleotide translocase-2 gene (ANT2) [K. Luciakova, G. Kollarovic, P. Barath, B.D. Nelson, Growth-dependent repression of human adenine nucleotide translocator-2 (ANT2) transcription: evidence for the participation of Smad and Sp family proteins in the NF1-dependent repressor complex, Biochem. J. 412 (2008) 123-130]. In the present study, we show that TGF-{beta}, like serum-restriction: (a) induces the formation of NF1/Smad repressor complexes, (b) increases binding of the complexes to the repressor elements (Go elements) in the ANT2 promoter, and (c) inhibits ANT2 expression. Repression of ANT2 by TGF-{beta} is eliminated by mutating the NF1 binding sites in the Go repressor elements. All of the above responses to TGF-{beta} are prevented by inhibitors of TGF-{beta} RI and MAPK p38. These inhibitors also prevent NF1/Smad4 repressor complex formation and repression of ANT2 expression in serum-restricted cells, suggesting that similar signaling pathways are initiated by TGF-{beta} and serum-restriction. The present finding that NF1/Smad4 repressor complexes are formed through TGF-{beta} signaling pathways suggests a new, but much broader, role for these complexes in the initiation or maintenance of the growth-inhibited state.


    SciTech Connect

    Watanabe, Y.; Morishita, K.; Kohyama, Akira; Heinisch, Howard L.; Gao, Fei


    Molecular dynamics and molecular statics calculations have been performed to evaluate the formation energy of self-interstitial atom (SIA) clusters in -SiC. For SIA-clusters with stoichiometric composition, an attempt has been made to fit the calculated data points to a polynomial function of cluster size n. The resultant equation EF=1.01n1+2.04n1/2 may indicate the applicability to a wide range of cluster sizes. This formalization will be useful for the development of accurate model on nucleation and growth of SIA-clusters, which is required for the modeling on irradiation-induced microstructural evolutions of materials in nuclear fusion reactors.

  10. Formation and evolution of high-plasma-pressure region in the near-Earth plasma sheet: Precursor and postcursor of substorm expansion onset

    NASA Astrophysics Data System (ADS)

    Yao, Y.; Ebihara, Y.; Tanaka, T.


    Cause of substorm expansion onset is one of the major problems in the magnetospheric study. On the basis of a global magnetohydrodynamic (MHD) simulation, Tanaka et al. (2010) suggested that formation and evolution of a high-pressure region (HPR) in the near-Earth plasma sheet could result in sudden intensification of the Region 1 field-aligned current and the westward auroral electrojet. In this sense, the formation and evolution of the HPR are a key in understanding the cause of the onset. On 5 April 2009, three probes of the Time History of Events and Macroscale Interactions during Substorms (THEMIS) were located at XGSM~-11 Re around the equator, which provide unique opportunity to investigate the spatial-temporal evolution of the HPR near the substorm expansion onset. Just before the onset, a positive excursion of the plasma pressure appeared at the outermost probe first, followed by the inner ones. Just after the onset, the opposite sequence took place. A positive excursion of the Y component of the current density was observed near the onset by the THEMIS probes and followed by a decrease trend. A similar variation was also found in the MHD simulation. All these features are consistent with the simulation result that a squeeze of the plasma from the plasma sheet results in the formation of the HPR before the onset and that the accumulated plasma spreads outward after the onset. The HPR is shown to be important for the dynamics of the magnetosphere during a substorm.

  11. Molecular description of the formation and structure of plasticized globular protein films.


    Lefèvre, Thierry; Subirade, Muriel; Pézolet, Michel


    To optimize the properties of plasticized globular proteins films, a clear comprehension of the structure and molecular events occurring during film formation is required. In this work, the structural organization of beta-lactoglobulin (beta-lg) films plasticized with diethyelene glycol are investigated for the first time during the entire film formation process by attenuated total reflectance and transmission infrared spectroscopy. The films are made by a common two-step procedure consisting of a first heat treatment (80 degrees C/30 min) followed by the casting of the film-forming solution for dehydration. Heating at 80 degrees C leads to the self-aggregation of the proteins with a conversion of regular secondary structures into antiparallel beta-sheets. The kinetics of the conformational conversion shows that approximately 10% of the amino acids are involved in beta-sheets after the first step. Dehydration induces a further aggregation, with approximately 46% of the amino acids involved in beta-sheets in the final film. Water evaporation results in the association of the aggregates formed during the heating step. The presence of the plasticizer during water removal is essential as it allows specific conformational rearrangements into extended beta-sheets and ordering of the polypeptide chains. This work underlines that the assembly of building blocks is common in beta-lg networks and it emphasizes the widespread occurrence of beta-structures in synthetic and natural protein networks. PMID:16283748

  12. Quantitative analysis of co-oligomer formation by amyloid-beta peptide isoforms

    NASA Astrophysics Data System (ADS)

    Iljina, Marija; Garcia, Gonzalo A.; Dear, Alexander J.; Flint, Jennie; Narayan, Priyanka; Michaels, Thomas C. T.; Dobson, Christopher M.; Frenkel, Daan; Knowles, Tuomas P. J.; Klenerman, David


    Multiple isoforms of aggregation-prone proteins are present under physiological conditions and have the propensity to assemble into co-oligomers with different properties from self-oligomers, but this process has not been quantitatively studied to date. We have investigated the amyloid-β (Aβ) peptide, associated with Alzheimer’s disease, and the aggregation of its two major isoforms, Aβ40 and Aβ42, using a statistical mechanical modelling approach in combination with in vitro single-molecule fluorescence measurements. We find that at low concentrations of Aβ, corresponding to its physiological abundance, there is little free energy penalty in forming co-oligomers, suggesting that the formation of both self-oligomers and co-oligomers is possible under these conditions. Our model is used to predict the oligomer concentration and size at physiological concentrations of Aβ and suggests the mechanisms by which the ratio of Aβ42 to Aβ40 can affect cell toxicity. An increased ratio of Aβ42 to Aβ40 raises the fraction of oligomers containing Aβ42, which can increase the hydrophobicity of the oligomers and thus promote deleterious binding to the cell membrane and increase neuronal damage. Our results suggest that co-oligomers are a common form of aggregate when Aβ isoforms are present in solution and may potentially play a significant role in Alzheimer’s disease.

  13. Quantitative analysis of co-oligomer formation by amyloid-beta peptide isoforms

    PubMed Central

    Iljina, Marija; Garcia, Gonzalo A.; Dear, Alexander J.; Flint, Jennie; Narayan, Priyanka; Michaels, Thomas C. T.; Dobson, Christopher M.; Frenkel, Daan; Knowles, Tuomas P. J.; Klenerman, David


    Multiple isoforms of aggregation-prone proteins are present under physiological conditions and have the propensity to assemble into co-oligomers with different properties from self-oligomers, but this process has not been quantitatively studied to date. We have investigated the amyloid-β (Aβ) peptide, associated with Alzheimer’s disease, and the aggregation of its two major isoforms, Aβ40 and Aβ42, using a statistical mechanical modelling approach in combination with in vitro single-molecule fluorescence measurements. We find that at low concentrations of Aβ, corresponding to its physiological abundance, there is little free energy penalty in forming co-oligomers, suggesting that the formation of both self-oligomers and co-oligomers is possible under these conditions. Our model is used to predict the oligomer concentration and size at physiological concentrations of Aβ and suggests the mechanisms by which the ratio of Aβ42 to Aβ40 can affect cell toxicity. An increased ratio of Aβ42 to Aβ40 raises the fraction of oligomers containing Aβ42, which can increase the hydrophobicity of the oligomers and thus promote deleterious binding to the cell membrane and increase neuronal damage. Our results suggest that co-oligomers are a common form of aggregate when Aβ isoforms are present in solution and may potentially play a significant role in Alzheimer’s disease. PMID:27346247

  14. Quantitative analysis of co-oligomer formation by amyloid-beta peptide isoforms.


    Iljina, Marija; Garcia, Gonzalo A; Dear, Alexander J; Flint, Jennie; Narayan, Priyanka; Michaels, Thomas C T; Dobson, Christopher M; Frenkel, Daan; Knowles, Tuomas P J; Klenerman, David


    Multiple isoforms of aggregation-prone proteins are present under physiological conditions and have the propensity to assemble into co-oligomers with different properties from self-oligomers, but this process has not been quantitatively studied to date. We have investigated the amyloid-β (Aβ) peptide, associated with Alzheimer's disease, and the aggregation of its two major isoforms, Aβ40 and Aβ42, using a statistical mechanical modelling approach in combination with in vitro single-molecule fluorescence measurements. We find that at low concentrations of Aβ, corresponding to its physiological abundance, there is little free energy penalty in forming co-oligomers, suggesting that the formation of both self-oligomers and co-oligomers is possible under these conditions. Our model is used to predict the oligomer concentration and size at physiological concentrations of Aβ and suggests the mechanisms by which the ratio of Aβ42 to Aβ40 can affect cell toxicity. An increased ratio of Aβ42 to Aβ40 raises the fraction of oligomers containing Aβ42, which can increase the hydrophobicity of the oligomers and thus promote deleterious binding to the cell membrane and increase neuronal damage. Our results suggest that co-oligomers are a common form of aggregate when Aβ isoforms are present in solution and may potentially play a significant role in Alzheimer's disease. PMID:27346247

  15. Anatomy and controlling factors of a Late Cretaceous Aeolian sand sheet: The Marília and the Adamantina formations, NW Bauru Basin, Brazil

    NASA Astrophysics Data System (ADS)

    Basilici, Giorgio; Führ Dal'Bó, Patrick Francisco


    Few previous studies have given significant consideration to the palaeosols in aeolian sand sheet sedimentary successions and, mainly, to their palaeoenvironmental and stratigraphic meaning in interaction with the deposits. These themes are considered in this study that deals with the depositional architecture and the factors controlling the construction, accumulation and preservation of an ancient aeolian sand sheet, that forms part of the Adamantina and Marília formations, in the Bauru Basin (Late Cretaceous, Brazil). In the NW portion of the Bauru Basin, these two units, ca 220 m thick, consist of sandstone, and secondarily of sandy conglomerate and mudstone, and are characterised by vertically alternated palaeosols and deposits. Facies analyses of the deposits and macroscopic characterisation of the palaeosols in 45 outcrops were integrated with laboratory analyses that consisted in descriptions of slabs of rock samples, petrographic analyses, clay mineralogy determination, geochemical analyses of the major oxides, and micromorphological characterisation of the palaeosols. Three architectural elements were recognised: palaeosols, wind-ripple-dominated aeolian sand sheet deposits, and ephemeral river deposits. The palaeosols constitute 66% of the entire sedimentary succession, and consist principally of Aridisols and, subordinately, of Alfisols, Vertisols, and Entisols. The wind-ripple-dominated aeolian sand sheet deposits (25%) are composed of sandstone, organised in translatent climbing wind-ripple strata, and secondarily of sandstone and mudstone deposited by infrequent floods. The ephemeral river deposits (9%) consist of sandy conglomerates 4 m thick and ca 2 km wide. Wind-ripple-dominated aeolian sand sheet deposits formed during relatively dry climate period on an unstable topographic surface of an aeolian sand sheet, where aeolian deposition or erosion prevailed. Palaeosols and ephemeral river deposits formed in a more humid climate period on a stable

  16. Using ice-penetrating radars to date ice-rise formation and Late Holocene ice-sheet retreat in the Ronne Ice Shelf region, West Antarctica

    NASA Astrophysics Data System (ADS)

    Kingslake, Jonathan; Hindmarsh, Richard; King, Edward; Corr, Hugh


    The history of the West Antarctic Ice Sheet in the region currently occupied by the Ronne Ice Shelf is poorly known. This reflects a lack of accessible recently deglaciated surfaces, which prohibits conventional paleo glaciological techniques that can provide evidence of past ice-sheet extent and retreat, for example ocean coring or exposure-dating of geological material. We use a glaciological technique, Raymond Effect Dating, to constrain the retreat of the ice sheet through the Ronne Ice Shelf region. During two Antarctic field seasons, we used a pulse-echo ice-penetrating radar to image the base and internal stratigraphy of four ice rises - areas of grounded ice containing ice divides. Towing the radar with skidoos, we conducted over 2000 km of surveys on the Skytrain, Korff, Henry and Fowler Ice Rises and the ice shelf between them. We also used a step-frequency radar called pRES to measure the vertical ice flow in the vicinity of each ice divide. Isochronal ice layers imaged during the surveys deforming in a predictable way with ice flow, meaning that their shape contains information about past ice flow. Directly beneath ice divides the downward motion of the ice is impeded by an ice-dynamical phenomenon called the Raymond Effect. This causes layers beneath the divides to form 'Raymond Arches' that grow over time. We will present the data and simulate the growth of the Raymond Arches using our pRES-measured vertical ice velocities and date the onset of ice-divide flow at each ice rise by comparing the size of simulated arches to the arches imaged during our radar surveys. We consider the main sources of uncertainty associated with these ice-rise formation dates and discuss what they can tell us about the retreat of the West Antarctic Ice Sheet through this region during the last few thousand years.

  17. Formation of. beta. ,. gamma. -methylene-7,8-dihydroneopterin 3'-triphosphate from. beta. ,. gamma. -methyleneguanosine 5'-triphosphate by GTP cyclohydrolase I of Escherichia coli

    SciTech Connect

    Ferre, J.; Jacobson, K.B.


    GTP cyclohydrolase I of Escherichia coli converts (..beta..,..gamma..-methylene)GTP to a fluorescent product that is characterized as (..beta..,..gamma..-methylene)dihydroneopterin triphosphate. Interaction between the GTP analog and the enzyme gave a K/sub i/ of 3.0, which may be compared to the K/sub m/ of 0.1 for GTP. This new analog of dihydroneopterin triphosphate may, in turn, be converted to the same greenish-yellow pteridines (compounds X, X1, and X2) that are obtained from dihydroneopterin triphosphate. Because of its stability to phosphatase action, this analog may be useful for studies in pteridine metabolism. 14 references, 5 figures.

  18. Formation of bcc non-equilibrium La, Gd, and Dy alloys and the magnetic structure of Mg-stabilized. beta. Gd and. beta. Dy

    SciTech Connect

    Herchenroeder, J.W.


    The high temperature bcc allotrope of a rare earth metal has the potential for substantially different magnetic properties than the room temperature hexagonal (hcp or dcp) counterpart because of its more symmetrical crystal field. The stabilization by alloying and quenching of this bcc phase was studied for La-M alloys where M is a non-rare earth metal from Group II or III. The factors influencing the stabilization, such as size of M and quench rate, are discussed. {gamma}La (bcc) could be retained over a composition range around the eutectoid composition by Mg or Cd alloying. A comparison of T{sub o} curves of the various alloy systems suggest that the eutectoid temperature of the La-M system must be approximately equal to or less than a critical T{sub o} temperature of 515{degree}C if the bcc phase is to be retained by quenching. The thermal stability of {beta}Gd (bcc) was investigated by DTA and isothermal annealing. It was found to transform to an intermediate phase before reverting to the equilibrium phases in contrast to {gamma}La alloys which decompose directly on heating to the equilibrium phases. Bcc {beta}Gd and {beta}Dy stabilized by Mg additions exhibit spin glass-like behavior. Both systems show field cooling effects in the magnetic susceptibility which is indicative of spin freezing reactions.

  19. Soluble penicillin-binding protein 2a: beta-lactam binding and inhibition by non-beta-lactams using a 96-well format.


    Toney, J H; Hammond, G G; Leiting, B; Pryor, K D; Wu, J K; Cuca, G C; Pompliano, D L


    High level methicillin resistance in Staphylococcus aureus is dependent upon the acquisition of the mecA gene encoding penicillin-binding protein 2a (PBP2a). PBP2a is a member of a family of peptidoglycan biosynthetic enzymes involved in assembly of the cell wall in bacteria and is poorly inactivated by beta-lactam antibiotics. We describe a 96-well-filter binding assay using recombinant, soluble PBP2a which allows for kinetic measurement of penicillin binding. The deacylation rate constant for the PBP2a-penicillin G covalent complex was found to be 5.7 +/- 1.0 x 10(-5) s-1 at 30 degrees C (half-life of approximately 200 min). For the PBP2a acylation reaction, the value of K(m) (penicillin G) = 0.5 +/- 0.1 mM and kcat = 1 x 10(-3) s-1, which yields a second-order rate constant (kcat/K(m)) for inactivation of 2.0 M-1 s-1. Using this assay, several non-beta-lactam inhibitors including Cibacron blue have been found which exhibit IC50 values between 10 and 30 microM. The binding affinities of several carbapenems and beta-lactams correlated well between the filter binding assay described in this report and an electrophoretic assay for PBP2a using membranes prepared form methicillin-resistant S. aureus. PMID:9448849

  20. AmrZ Beta-Sheet Residues Are Essential for DNA Binding and Transcriptional Control of Pseudomonas aeruginosa Virulence Genes ▿ †

    PubMed Central

    Waligora, Elizabeth A.; Ramsey, Deborah M.; Pryor, Edward E.; Lu, Haiping; Hollis, Thomas; Sloan, Gina P.; Deora, Rajendar; Wozniak, Daniel J.


    AmrZ is a putative ribbon-helix-helix (RHH) transcriptional regulator. RHH proteins utilize residues within the β-sheet for DNA binding, while the α-helices promote oligomerization. AmrZ is of interest due to its dual roles as a transcriptional activator and as a repressor, regulating genes encoding virulence factors associated with both chronic and acute Pseudomonas aeruginosa infection. In this study, cross-linking revealed that AmrZ forms oligomers in solution but that the amino terminus, containing an unordered region and a β-sheet, were not required for oligomerization. The first 12 unordered residues (extended amino terminus) contributed minimally to DNA binding. Mutagenesis of the AmrZ β-sheet demonstrated that residues 18, 20, and 22 were essential for DNA binding at both activation and repressor sites, suggesting that AmrZ utilizes a similar mechanism for binding to these sites. Mice infected with amrZ mutants exhibited reduced bacterial burden, morbidity, and mortality. Direct in vivo competition assays showed a 5-fold competitive advantage for the wild type over an isogenic amrZ mutant. Finally, the reduced infection phenotype of the amrZ-null strain was similar to that of a strain expressing a DNA-binding-deficient AmrZ variant, indicating that DNA binding and transcriptional regulation by AmrZ is responsible for the in vivo virulence defect. These recent infection data, along with previously identified AmrZ-regulated virulence factors, suggest the necessity of AmrZ transcriptional regulation for optimal virulence during acute infection. PMID:20709902

  1. Multiprotein complex formation at the beta myosin heavy chain distal muscle CAT element correlates with slow muscle expression but not mechanical overload responsiveness.


    Vyas, D R; McCarthy, J J; Tsika, G L; Tsika, R W


    To examine the role of the beta-myosin heavy chain (betaMyHC) distal muscle CAT (MCAT) element in muscle fiber type-specific expression and mechanical overload (MOV) responsiveness, we conducted transgenic and in vitro experiments. In adult transgenic mice, mutation of the distal MCAT element led to significant reductions in chloramphenicol acetyltransferase (CAT) specific activity measured in control soleus and plantaris muscles when compared with wild type transgene beta293WT but did not abolish MOV-induced CAT specific activity. Electrophoretic mobility shift assay revealed the formation of a specific low migrating nuclear protein complex (LMC) at the betaMyHC MCAT element that was highly enriched only when using either MOV plantaris or control soleus nuclear extract. Scanning mutagenesis of the betaMyHC distal MCAT element revealed that only the nucleotides comprising the core MCAT element were essential for LMC formation. The proteins within the LMC when using either MOV plantaris or control soleus nuclear extracts were antigenically related to nominal transcription enhancer factor 1 (NTEF-1), poly(ADP-ribose) polymerase (PARP), and Max. Only in vitro translated TEF-1 protein bound to the distal MCAT element, suggesting that this multiprotein complex is tethered to the DNA via TEF-1. Protein-protein interaction assays revealed interactions between nominal TEF-1, PARP, and Max. Our studies show that for transgene beta293 the distal MCAT element is not required for MOV responsiveness but suggest that a multiprotein complex likely comprised of nominal TEF-1, PARP, and Max forms at this element to contribute to basal slow fiber expression. PMID:11010974

  2. An RGD spacing of 440 nm is sufficient for integrin alpha V beta 3- mediated fibroblast spreading and 140 nm for focal contact and stress fiber formation

    PubMed Central


    The synthetic peptide Gly-Arg-Gly-Asp-Tyr (GRGDY), which contains the RGD sequence of several adhesion molecules, was covalently grafted to the surface of otherwise poorly adhesive glass substrates and was used to determine the minimal number of ligand-receptor interactions required for complete spreading of human foreskin fibroblasts. Well- defined adhesion substrates were prepared with GRGDY between 10(-3) fmol/cm2 and 10(4) fmol/cm2. As the adhesion ligand surface concentration was varied, several distinct morphologies of adherent cells were observed and categorized. The population of fully spread cells at 4 h reached a maximum at 1 fmol/cm2, with no further increases up to 10(4) fmol/cm2. Although maximal cell spreading was obtained at 1 fmol/cm2, focal contacts and stress fibers failed to form at RGD surface concentrations below 10 fmol/cm2. The minimal peptide spacings obtained in this work correspond to 440 nm for spreading and 140 nm for focal contact formation, and are much larger than those reported in previous studies with adsorbed adhesion proteins, adsorbed RGD-albumin conjugates, or peptide-grafted polyacrylamide gels. Vitronectin receptor antiserum specific for integrin alpha V beta 3 blocked cell adhesion and spreading on substrates containing 100 fmol/cm2 of surface- bound GRGDY, while fibronectin receptor antiserum specific for alpha 5 beta 1 did not. Furthermore, alpha V beta 3 was observed to cluster into focal contacts in spread cells, but alpha 5 beta 1 did not. It was thus concluded that a peptide-to-peptide spacing of 440 nm was required for alpha V beta 3-mediated cellular spreading, while 140 nm was required for alpha V beta 3-mediated focal contact formation and normal stress fiber organization in human foreskin fibroblasts; these spacings represent much fewer ligands than were previously thought to be required. PMID:1714913

  3. Intrastriatal injection of interleukin-1 beta triggers the formation of neuromyelitis optica-like lesions in NMO-IgG seropositive rats

    PubMed Central


    Background Neuromyelitis optica (NMO) is a severe, disabling disease of the central nervous system (CNS) characterized by the formation of astrocyte-destructive, neutrophil-dominated inflammatory lesions in the spinal cord and optic nerves. These lesions are initiated by the binding of pathogenic aquaporin 4 (AQP4)-specific autoantibodies to astrocytes and subsequent complement-mediated lysis of these cells. Typically, these lesions form in a setting of CNS inflammation, where the blood–brain barrier is open for the entry of antibodies and complement. However, it remained unclear to which extent pro-inflammatory cytokines and chemokines contribute to the formation of NMO lesions. To specifically address this question, we injected the cytokines interleukin-1 beta, tumor necrosis factor alpha, interleukin-6, interferon gamma and the chemokine CXCL2 into the striatum of NMO-IgG seropositive rats and analyzed the tissue 24 hours later by immunohistochemistry. Results All injected cytokines and chemokines led to profound leakage of immunoglobulins into the injected hemisphere, but only interleukin-1 beta induced the formation of perivascular, neutrophil-infiltrated lesions with AQP4 loss and complement-mediated astrocyte destruction distant from the needle tract. Treatment of rat brain endothelial cells with interleukin-1 beta, but not with any other cytokine or chemokine applied at the same concentration and over the same period of time, caused profound upregulation of granulocyte-recruiting and supporting molecules. Injection of interleukin-1 beta caused higher numbers of blood vessels with perivascular, cellular C1q reactivity than any other cytokine tested. Finally, the screening of a large sample of CNS lesions from NMO and multiple sclerosis patients revealed large numbers of interleukin-1 beta-reactive macrophages/activated microglial cells in active NMO lesions but not in MS lesions with comparable lesion activity and location. Conclusions Our data strongly

  4. [Beta]-Adrenergic Receptors in the Insular Cortex are Differentially Involved in Aversive vs. Incidental Context Memory Formation

    ERIC Educational Resources Information Center

    Miranda, Maria Isabel; Sabath, Elizabeth; Nunez-Jaramillo, Luis; Puron-Sierra, Liliana


    The goal of this research was to determine the effects of [beta]-adrenergic antagonism in the IC before or after inhibitory avoidance (IA) training or context pre-exposure in a latent inhibition protocol. Pretraining intra-IC infusion of the [beta]-adrenergic antagonist propranolol disrupted subsequent IA retention and impaired latent inhibition…

  5. Double Mantle Plume Upwelling—A Possible Formation Mechanism of Beta Plateau and Devana Chasma,Venus

    NASA Astrophysics Data System (ADS)

    Ding, N.


    Ning Ding,Zuoxun Zeng,China University of Geosciences,Wuhan,430074,China Introduction:Venus represents a‘one plate planet’[1],and the uplift,fractures and volcanism in Beta Regio on Venus are considered to be formed by lithosphere uplift driven by a hot plume[2]. Based on the double peaking saddle landform,we suggest the tectonic pattern of double mantle plume upwelling to interpret the formation mechanism of Beta Plateau and Devana Chasma.We take a physical modeling to validate this possibility. Model:There is no ductile shear in Venus[3],so we use quartz sands to simulate the crust of Venus.We use two wood stickes 1.5cm in diameter rising from the rubber canvas slowly and straight till about half of the model,then falling down slowly and straight.The base is a hard rubber plate,in the center of which,there are two holes 3cm in diameter,and the distance between them is 5cm.The holes are covered by rubber canvas.We use the quartz sands in colours of white, red and black with particle size of 70 mess as the model materials. Result:Fig.1:At the beginning of the wood stickes upwelling,only fine radial cracks are formed above the upwelling from central to outside.With the upwelling continue,surface energy of the fine radial cracks increase and make the cracks unstable,finally,the fine radial cracks connect each other and form a fracture zone.And then the two mantle plume downwelling,the fracture zone is developed to form a chasma at the end. Fig.2:The four profiles all form reverse faults outside and normal faults inside.But the difference is the faults in the middle of the chasma goes deeper than others.It is the pattern of Beta Plateau where the tectonic rising is cut by Devana Chasma zone in the topographic features. Fig.3:From the tow fig., we can see two points similar:a.the elevation is high and distribution area is large around the area of two upwelling and it is high around the area of chasma,but the distribution area is small

  6. Efficient triple helix formation by oligodeoxyribonucleotides containing alpha- or beta-2-amino-5-(2-deoxy-D-ribofuranosyl) pyridine residues.

    PubMed Central

    Bates, P J; Laughton, C A; Jenkins, T C; Capaldi, D C; Roselt, P D; Reese, C B; Neidle, S


    Triple helices containing C+xGxC triplets are destabilised at physiological pH due to the requirement for base protonation of 2'-deoxycytidine (dC), which has a pKa of 4.3. The C nucleoside 2-amino-5-(2'-deoxy-beta-D-ribofuranosyl)pyridine (beta-AP) is structurally analogous to dC but is considerably more basic, with a pKa of 5.93. We have synthesised 5'-psoralen linked oligodeoxyribonucleotides (ODNs) containing thymidine (dT) and either beta-AP or its alpha-anomer (alpha-AP) and have assessed their ability to form triplexes with a double-stranded target derived from standard deoxynucleotides (i.e. beta-anomers). Third strand ODNs derived from dT and beta-AP were found to have considerably higher binding affinities for the target than the corresponding ODNs derived from dT and either dC or 5-methyl-2'-deoxycytidine (5-Me-dC). ODNs containing dT and alpha-AP also showed enhanced triplex formation with the duplex target and, in addition are more stable in serum-containing medium than standard oligopyrimidine-derived ODNs or ODNs derived from dT and beta-AP. Molecular modelling studies showed that an alpha-anomeric AP nucleotide can be accommodated within an otherwise beta-anomeric triplex with only minor perturbation of the triplex structure. Molecular dynamics (MD) simulations on triplexes containing either the alpha- or beta-anomer of (N1-protonated) AP showed that in both cases the base retained two standard hydrogen bonds to its associated guanine when the 'A-type' model of the triplex was used as the start-point for the simulation, but that bifurcated hydrogen bonds resulted when the alternative 'B-type' triplex model was used. The lack of a differential stability between alpha-AP- and beta-AP-containing triplexes at pH >7, predicted from the behaviour of the B-type models, suggests that the A-type models are more appropriate. PMID:8932369

  7. Stability of single sheet GNNQQNY aggregates analyzed by replica exchange molecular dynamics: Antiparallel versus parallel association

    SciTech Connect

    Vitagliano, Luigi; Esposito, Luciana; Pedone, Carlo; De Simone, Alfonso


    Protein and peptide aggregation into amyloid plaques is associated with a large variety of neurodegenerative diseases. The definition of the molecular bases of these pathologies is hampered by the transient nature of pre-fibrillar small-oligomers that are considered the toxic species. The ability of the peptide GNNQQNY to form amyloid-like structures makes it a good model to investigate the complex processes involved into amyloid fiber formation. By employing full atomistic replica exchange molecular dynamics simulations, we constructed the free energy surface of small assemblies of GNNQQNY to gain novel insights into the fiber formation process. The calculations suggest that the peptide exhibits a remarkable tendency to form both parallel and antiparallel {beta}-sheets. The data show that GNNQQNY preference for parallel or antiparallel {beta}-sheets is governed by a subtle balance of factors including assemblies' size, sidechain-sidechain interactions and pH. The samplings analysis provides a rationale to the observed trends.

  8. Formation of {beta}-nickel hydroxide plate-like structures under mild conditions and their optical properties

    SciTech Connect

    Moura, A.P. de; Lima, R.C.; Paris, E.C.; Li, M.S.; Varela, J.A.; Longo, E.


    Nanostructural {beta}-nickel hydroxide ({beta}-Ni(OH){sub 2}) plates were prepared using the microwave-hydrothermal (MH) method at a low temperature and short reaction times. An ammonia solution was employed as the coordinating agent, which reacts with [Ni(H{sub 2}O){sub 6}]{sup 2+} to control the growth of {beta}-Ni(OH){sub 2} nuclei. A trigonal {beta}-Ni(OH){sub 2} single phase was observed by X-ray diffraction (XRD) analyses, and the crystal cell was constructed with structural parameters and atomic coordinates obtained from Rietveld refinement. Field emission scanning electron microscopy (FE-SEM) images revealed that the samples consisted of hexagonal-shaped nanoplates with a different particle size distribution. Broad absorption bands assigned as transitions of Ni{sup 2+} in oxygen octahedral sites were revealed by UV-vis spectra. Photoluminescence (PL) properties observed with a maximum peak centered in the blue-green region were attributed to different defects, which were produced during the nucleation process. We present a growth process scheme of the {beta}-Ni(OH){sub 2} nanoplates. - Graphical abstract: Nanostructural {beta}-Ni(OH){sub 2} crystalline powders were prepared by rapid microwave-hydrothermal method for 1, 8 and 32 min. The hexagonal-shaped nanoplates obtained presented PL emission in the blue-green region and each decomposed component represents a different type of electronic transition, which can be linked to the structural arrangement or surface defects. Highlights: > Ammonia solution to control the growth of {beta}-Ni(OH){sub 2} nuclei. > Regular plates-shape related to crystallization-dissolution-recrystallization. > The surface states and lattice defects generated in growth mechanism of crystals. > Different defects produced in the growth process responsible by photoluminescence. > Each component of photoluminescence curve linked to structural arrangement or surface defects.

  9. Till formation under a soft-bedded palaeo-ice stream of the Scandinavian Ice Sheet, constrained using qualitative and quantitative microstructural analyses

    NASA Astrophysics Data System (ADS)

    Narloch, Włodzimierz; Piotrowski, Jan A.; Wysota, Wojciech; Tylmann, Karol


    This study combines micro- and macroscale studies, laboratory experiments and quantitative analyses to decipher processes of till formation under a palaeo-ice stream and the nature of subglacial sediment deformation. Till micromorphology (grain lineations, grain stacks, turbate structures, crushed grains, intraclasts and domains), grain-size and till fabric data are used to investigate a basal till generated by the Vistula Ice Stream of the Scandinavian Ice Sheet during the last glaciation in north-central Poland. A comparison of microstructures from the in situ basal till and laboratory-sheared till experiments show statistical relationships between the number of grain lineations and grain stacks; and between the number of grain lineations and turbate structures. Microstructures in the in situ till document both brittle and ductile styles of deformation, possibly due to fluctuating basal water pressures beneath the ice stream. No systematic vertical and lateral trends are detected in the parameters investigated in the in situ till, which suggests a subglacial mosaic of relatively stable and unstable areas. This situation can be explained by an unscaled space-transgressive model of subglacial till formation whereby at any given point in time different processes operated in different places under the ice sheet, possibly related to the distance from the ice margin and water pressure at the ice-bed interface. A new quantitative measure reflecting the relationship between the number of grain lineations and grain stacks may be helpful in discriminating between pervasive and non-pervasive deformation and constraining the degree of stress heterogeneity within a deformed bed. Independent strain magnitude estimations revealed by a quantitative analysis of micro- and macro-particle data show low cumulative strain in the ice-stream till in the order of 10-102.

  10. Calcium ion-induced formation of β-sheet/-turn structure leading to alteration of osteogenic activity of bone morphogenetic protein-2

    PubMed Central

    Zhang, Wenjing; He, Hongyan; Tian, Yu; Gan, Qi; Zhang, Jing; Yuan, Yuan; Liu, Changsheng


    Preserving bioactivity of bone morphogenetic protein 2 (BMP-2) still remains a challenge in protein-based therapy. It is not known how Ca2+ released from extracellular matrix or existing in physiological environment influences bioactivity in situ till now. Here, effects of extracellular Ca2+ on conformation and osteogenic bioactivity of recombinant human BMP-2 (rhBMP-2) were investigated systematically. In vitro results indicated that Ca2+ could bind rhBMP-2 rapidly and had no obvious effect on cell behaviors. Low concentration of Ca2+ (0.18 mM) enhanced rhBMP-2-induced osteogenic differentiation, while high Ca2+ concentration (>1.80 mM) exerted negative effect. In vivo ectopic bone formation exhibited similar trend. Further studies by circular dichroism spectroscopy, fluorescence spectroscopy, together with cell culture experiments revealed at low concentration, weak interaction of Ca2+ and rhBMP-2 slightly increased β-sheet/-turn content and facilitated recognition of BMP-2 and BMPRIA. But, high Ca2+ concentration (>1.8 mM) induced formation of Ca-rhBMP-2 complex and markedly increased content of β-sheet/-turn, which led to inhibition binding of rhBMP-2 and BMPRIA and thus suppression of downstream Smad1/5/8, ERK1/2 and p38 mitogen-associated protein kinase signaling pathways. Our work suggests osteogenic bioactivity of BMP-2 can be adjusted via extracellular Ca2+, which should provide guide and assist for development of BMP-2-based materials for bone regeneration. PMID:26212061

  11. Fibril stability in solutions of twisted Format="TEX"/>-sheet peptides: a new kind of micellization in chiral systems

    NASA Astrophysics Data System (ADS)

    Nyrkova, I. A.; Semenov, A. N.; Aggeli, A.; Boden, N.


    The problem of fibril (fibre) formation in chiral systems is explored theoretically being supported by experiments on synthetic de novo 11-mer peptide forming self-assembled -sheet tapes. Experimental data unambiguously indicate that the tapes form fibrils of nearly monodisperse thickness ca. 8-10 nm. Fibril formation and stabilisation are attributed to inter-tape face-to-face attraction and their intrinsic twist, correspondingly. The proposed theory is capable of predicting the fibril aggregation number and its equilibrium twist in terms of molecular parameters of the primary tapes. The suggested novel mechanism of twist stabilisation of finite aggregates (fibrils) is different to the well-known stabilisation of micelles in amphiphilic systems, and it is likely to explain the formation and stability of fibrils in a wide variety of systems including proteinaceous amyloid fibres, sickle-cell hemoglobin fibres responsible for HbS anemia, corkscrew threads found in chromonics in the presence of chiral additives and native cellulose microfibrillar crystallites. The theory also makes it possible to extract the basic molecular parameters of primary tapes (inter-tape attraction energy, helical twist step, elastic moduli) from the experimental data.

  12. Whooping Cough (Pertussis) - Fact Sheet for Parents


    ... this page: About . Redirect for the Pertussis fact sheet page. The current fact sheet can ... Print page Share Compartir File Formats Help: ...

  13. Formation of bcc non-equilibrium La, Gd and Dy alloys and the magnetic structure of Mg-stabilized. beta. Gd and. beta. Dy

    SciTech Connect

    Herchenroeder, J.W.


    The high temperature bcc allotrope of a rare earth metal has the potential for substantially different magnetic properties than the room temperature hexagonal (hcp or dhcp) counterpart because of its more symmetrical crystal field. The stabilization by alloying and quenching of this bcc phase was studied for La-M alloys where M is an non-rare earth metal from Group II or III. The factors influencing the stabilization, such as size of M and quench rate, are discussed. ..gamma..La (bcc) could be retained over a composition range around the eutectoid composition by Mg or Cd alloying. A comparison of T/sub o/ curves of the various alloy systems suggest that the eutectoid temperature of the La-M system must be approximately equal to or less than a critical T/sub o/ temperature of 515/degree/C if the bcc phase is to be retained by quenching. The thermal stability of ..beta..Gd (bcc) was investigated by DTA and isothermal annealing. It was found to transform to an intermediate phase before reverting to the equilibrium phases in contrast to ..gamma..La alloys which decompose directly on heating to the equilibrium phases. 71 refs., 52 figs., 7 tabs.

  14. The Influence of Welding Parameters on the Nugget Formation of Resistance Spot Welding of Inconel 625 Sheets

    NASA Astrophysics Data System (ADS)

    Rezaei Ashtiani, Hamid Reza; Zarandooz, Roozbeh


    A 2D axisymmetric electro-thermo-mechanical finite element (FE) model is developed to investigate the effect of current intensity, welding time, and electrode tip diameter on temperature distributions and nugget size in resistance spot welding (RSW) process of Inconel 625 superalloy sheets using ABAQUS commercial software package. The coupled electro-thermal analysis and uncoupled thermal-mechanical analysis are used for modeling process. In order to improve accuracy of simulation, material properties including physical, thermal, and mechanical properties have been considered to be temperature dependent. The thickness and diameter of computed weld nuggets are compared with experimental results and good agreement is observed. So, FE model developed in this paper provides prediction of quality and shape of the weld nuggets and temperature distributions with variation of each process parameter, suitably. Utilizing this FE model assists in adjusting RSW parameters, so that expensive experimental process can be avoided. The results show that increasing welding time and current intensity lead to an increase in the nugget size and electrode indentation, whereas increasing electrode tip diameter decreases nugget size and electrode indentation.

  15. Heterotopic endochondrial ossification with mixed tumor formation in C3(1)/Tag transgenic mice is associated with elevated TGF-beta1 and BMP-2 expression.


    Maroulakou, I G; Shibata, M A; Anver, M; Jorcyk, C L; Liu, M l; Roche, N; Roberts, A B; Tsarfaty, I; Reseau, J; Ward, J; Green, J E


    Transgenic mice which express the simian virus 40 large T-antigen (Tag) under the regulatory control of the hormone responsive rat C3(1) gene develop unusual lesions of heterotopic bone growth associated with mixed tumor formation arising from eccrine sweat glands found only in the foot pads of mice, ischiocavernosus muscle adjacent to bulbourethral glands and occasionally the salivary and mammary glands. These lesions are very similar to mixed tumors arising in several types of human cancers. Based upon electron microscopic examination and immunocytochemical analyses of cellular differentiation markers, the mixed proliferative lesions in this transgenic mouse model begin with the Tag-induced proliferation of epithelial and myoepithelial cells. The proliferation of these two types of cells results in hyperplasia and adenomatous transformation of the epithelial component, whereas the proliferating myoepithelial cells undergo metaplasia to form chondrocytes which deposit extracellular matrix, including collagen fibers. Cartilage develops focally between areas of epithelial proliferation and subsequently ossifies through a process of endochondrial bone formation. The metaplasia of myoepithelial cells to chondrocytes appears to require the inductive interaction of factors produced by the closely associated proliferating epithelial cells, including members of the TGF-beta superfamily. We demonstrate that TGF-beta1 protein accumulates in the extracellular matrix of the lesions, whereas RNA in situ hybridization reveals that BMP-2, another strong inducer of heterotopic bone formation, is overexpressed by the proliferating epithelial cells during the development of ectopic bone. The formation of sarcomatous tumors within the mixed tumors appears to be androgen-dependent and more frequent in mice lacking a normal allele of p53. This process of cartilage and bone induction may mimic epithelial-mesenchymal interactions which occur during embryonic bone formation. These

  16. Beta-blocker drug therapy reduces secondary cancer formation in breast cancer and improves cancer specific survival.


    Powe, Desmond G; Voss, Melanie J; Zänker, Kurt S; Habashy, Hany O; Green, Andrew R; Ellis, Ian O; Entschladen, Frank


    Laboratory models show that the beta-blocker, propranolol, can inhibit norepinephrine-induced breast cancer cell migration. We hypothesised that breast cancer patients receiving beta-blockers for hypertension would show reduced metastasis and improved clinical outcome. Three patient subgroups were identified from the medical records of 466 consecutive female patients (median age 57, range 28-71) with operable breast cancer and follow-up (>10 years). Two subgroups comprised 43 and 49 hypertensive patients treated with beta-blockers or other antihypertensives respectively, prior to cancer diagnosis. 374 patients formed a non-hypertensive control group. Metastasis development, disease free interval, tumour recurrence and hazards risk were statistically compared between groups. Kaplan-Meier plots were used to model survival and DM. Beta-blocker treated patients showed a significant reduction in metastasis development (p=0.026), tumour recurrence (p=0.001), and longer disease free interval (p=0.01). In addition, there was a 57% reduced risk of metastasis (Hazards ratio=0.430; 95% CI=0.200-0.926, p=0.031), and a 71% reduction in breast cancer mortality after 10 years (Hazards ratio=0.291; 95% CI=0.119-0.715, p=0.007). This proof-of-principle study showed beta-blocker therapy significantly reduces distant metastases, cancer recurrence, and cancer-specific mortality in breast cancer patients suggesting a novel role for beta-blocker therapy. A larger epidemiological study leading to randomised clinical trials is needed for breast and other cancer types including colon, prostate and ovary. PMID:21317458

  17. Late Noachian and early Hesperian ridge systems in the south circumpolar Dorsa Argentea Formation, Mars: Evidence for two stages of melting of an extensive late Noachian ice sheet

    NASA Astrophysics Data System (ADS)

    Kress, Ailish M.; Head, James W.


    The Dorsa Argentea Formation (DAF), extending from 270°-100° E and 70°-90° S, is a huge circumpolar deposit surrounding and underlying the Late Amazonian South Polar Layered Deposits (SPLD) of Mars. Currently mapped as Early-Late Hesperian in age, the Dorsa Argentea Formation has been interpreted as volatile-rich, possibly representing the remnants of an ancient polar ice cap. Uncertain are its age (due to the possibility of poor crater retention in ice-related deposits), its mode of origin, the origin of the distinctive sinuous ridges and cavi that characterize the unit, and its significance in the climate history of Mars. In order to assess the age of activity associated with the DAF, we examined the ridge populations within the Dorsa Argentea Formation, mapping and characterizing seven different ridge systems (composed of nearly 4,000 ridges covering a total area of ~300,000 km2, with a cumulative length of ridges of ~51,000 km) and performing crater counts on them using the method of buffered crater counting to determine crater retention ages of the ridge populations. We examined the major characteristics of the ridge systems and found that the majority of them were consistent with an origin as eskers, sediment-filled subglacial drainage channels. Ridge morphologies reflect both distributed and channelized esker systems, and evidence is also seen that some ridges form looping moraine-like termini distal to some distributed systems. The ridge populations fall into two age groups: ridge systems between 270° and 0° E date to the Early Hesperian, but to the east, the Promethei Planum and the Chasmata ridge systems date to the Late Noachian. Thus, these ages, and esker and moraine-like morphologies, support the interpretation that the DAF is a remnant ice sheet deposit, and that the esker systems represent evidence of significant melting and drainage of meltwater from portions of this ice sheet, thus indicating at least some regions and/or periods of wet

  18. The region of formation of the ultraviolet high temperature resonance lines in the eclipsing binary Beta Persei (Algol)

    NASA Technical Reports Server (NTRS)

    Brandi, E.; Garcia, L. G.; Kondo, Y.; Sahade, J.


    A new series of IUE observations of Beta Persei has shown that the high temperature resonance lines of Si IV and C IV arise in a region that surrounds the brighter, early-type component of the system. The continuum spectrum corresponds to that of a B8V object, and the value of E(B-V) that yielded the best match between the two IUE regions was 0.06, the value quoted for Beta Per in Jamar et al.'s (1976) Catalog.

  19. Sensitivity enhanced (14)N/(14)N correlations to probe inter-beta-sheet interactions using fast magic angle spinning solid-state NMR in biological solids.


    Pandey, Manoj Kumar; Amoureux, Jean-Paul; Asakura, Tetsuo; Nishiyama, Yusuke


    observation of inter-β-sheet correlations. PMID:27477057

  20. Influence of Water Content on the β-Sheet Formation, Thermal Stability, Water Removal, and Mechanical Properties of Silk Materials.


    Yazawa, Kenjiro; Ishida, Kana; Masunaga, Hiroyasu; Hikima, Takaaki; Numata, Keiji


    Silk, which has excellent mechanical toughness and is lightweight, is used as a structural material in nature, for example, in silkworm cocoons and spider draglines. However, the industrial use of silk as a structural material has garnered little attention. For silk to be used as a structural material, its thermal processability and associated properties must be well understood. Although water molecules influence the glass transition of silk, the effects of water content on the other thermal properties of silks are not well understood. In this study, we prepared Bombyx mori cocoon raw fibers, degummed fibers, and films with different water contents and then investigated the effects of water content on crystallization, degradation, and water removal during thermal processing. Thermal gravimetric analyses of the silk materials showed that water content did not affect the thermal degradation temperature but did influence the water removal behavior. By increasing the water content of silk, the water molecules were removed at lower temperatures, indicating that the amount of free water in silk materials increased; additionally, the glass transition temperature decreased with increasing water plasticization. Differential scanning calorimetry and wide-angle X-ray scattering of the silk films also suggested that the water molecules in the amorphous regions of the silk films acted as a plasticizer and induced β-sheet crystallization. The plasticizing effect of water was not detected in silk fibers, owing to their lower amorphous content and mobility. The structural and mechanical characterizations of the silk films demonstrated the silk film prepared at RH 97% realized both crystallinity and ductility simultaneously. Thus, the thermal stability, mechanical, and other properties of silk materials are regulated by their water content and crystallinity. PMID:26835719


    EPA Science Inventory

    beta2.gif" BORDER=0 ALIGN="middle">-Hydroxycarbonyls can be formed from the gas-phase
    reactions of alkenes with the OH radical, both in the presence
    and in the absence of NO. To date, because of analytical
    difficulties, few data have been r...

  2. A Simple Lattice Model That Captures Protein Folding, Aggregation and Amyloid Formation

    PubMed Central

    Abeln, Sanne; Vendruscolo, Michele; Dobson, Christopher M.; Frenkel, Daan


    The ability of many proteins to convert from their functional soluble state to amyloid fibrils can be attributed to inter-molecular beta strand formation. Such amyloid formation is associated with neurodegenerative disorders like Alzheimer's and Parkinson's. Molecular modelling can play a key role in providing insight into the factors that make proteins prone to fibril formation. However, fully atomistic models are computationally too expensive to capture the length and time scales associated with fibril formation. As the ability to form fibrils is the rule rather than the exception, much insight can be gained from the study of coarse-grained models that capture the key generic features associated with amyloid formation. Here we present a simple lattice model that can capture both protein folding and beta strand formation. Unlike standard lattice models, this model explicitly incorporates the formation of hydrogen bonds and the directionality of side chains. The simplicity of our model makes it computationally feasible to investigate the interplay between folding, amorphous aggregation and fibril formation, and maintains the capability of classic lattice models to simulate protein folding with high specificity. In our model, the folded proteins contain structures that resemble naturally occurring beta-sheets, with alternating polar and hydrophobic amino acids. Moreover, fibrils with intermolecular cross-beta strand conformations can be formed spontaneously out of multiple short hydrophobic peptide sequences. Both the formation of hydrogen bonds in folded structures and in fibrils is strongly dependent on the amino acid sequence, indicating that hydrogen-bonding interactions alone are not strong enough to initiate the formation of beta sheets. This result agrees with experimental observations that beta sheet and amyloid formation is strongly sequence dependent, with hydrophobic sequences being more prone to form such structures. Our model should open the way to a

  3. Shear flow promotes amyloid-{beta} fibrilization.


    Dunstan, Dave E; Hamilton-Brown, Paul; Asimakis, Peter; Ducker, William; Bertolini, Joseph


    The rate of formation of amyloid fibrils in an aqueous solution of amyloid-beta (Abeta) is greatly increased when the solution is sheared. When Abeta solution is stirred with a magnetic stirrer bar at 37 degrees C, a rapid increase in thioflavin T fluorescence is observed. Atomic Force Microscopy (AFM) images show the formation of aggregates, the growth of fibrils and the intertwining of the fibrils with time. Circular dichroism (CD) spectroscopy of samples taken after stirring shows a transition from random coil to alpha-helix to beta-sheet secondary structure over 20 h at 37 degrees C. The fluorescence, AFM and CD measurements are all consistent with the formation of amyloid fibrils. Quiescent, non-stirred solutions incubated at 37 degrees C showed no evidence of amyloid formation over a period of 3 days. Couette flow was found to accelerate the formation of amyloid fibrils demonstrating that the primary effect of stirring is not mixing but shearing. Only very small shear forces are applied to individual molecules in our experiments. Simple calculation suggests that the force is too small to support a hypothesis that shearing promotes partial unfolding of the protein as is observed. PMID:19850675

  4. The effect of glutamic acid side chain on acidity constant of lysine in beta-sheet: A density functional theory study

    NASA Astrophysics Data System (ADS)

    Sargolzaei, M.; Afshar, M.; Sadeghi, M. S.; Kavee, M.


    In this work, the possibility of proton transfer between side chain of lysine and glutamic acid in peptide of Glu--Ala-Lys+ was demonstrated using density functional theory (DFT). We have shown that the proton transfer takes place between side chain of glutamic and lysine residues through the hydrogen bond formation. The structures of transition state for proton transfer reaction were detected in gas and solution phases. Our kinetic studies show that the proton transfer reaction rate in gas phase is higher than solution phase. The ionization constant (p K a) value of lysine residue in peptide was estimated 1.039 which is lower than intrinsic p K a of lysine amino acid.

  5. Mechanism of formation of the C-terminal beta-hairpin of the B3 domain of the immunoglobulin binding protein G from Streptococcus. I. Importance of hydrophobic interactions in stabilization of beta-hairpin structure.


    Skwierawska, Agnieszka; Makowska, Joanna; Ołdziej, Stanisław; Liwo, Adam; Scheraga, Harold A


    We previously studied a 16-amino acid-residue fragment of the C-terminal beta-hairpin of the B3 domain (residues 46-61), [IG(46-61)] of the immunoglobulin binding protein G from Streptoccocus, and found that hydrophobic interactions and the turn region play an important role in stabilizing the structure. Based on these results, we carried out systematic structural studies of peptides derived from the sequence of IG (46-61) by systematically shortening the peptide by one residue at a time from both the C- and the N-terminus. To determine the structure and stability of two resulting 12- and 14-amino acid-residue peptides, IG(48-59) and IG(47-60), respectively, we carried out circular dichroism, NMR, and calorimetric studies of these peptides in pure water. Our results show that IG(48-59) possesses organized three-dimensional structure stabilized by hydrophobic interactions (Tyr50-Phe57 and Trp48-Val59) at T = 283 and 305 K. At T = 313 K, the structure breaks down because of increased chain entropy, but the turn region is preserved in the same position observed for the structure of the whole protein. The breakdown of structure occurs near the melting temperature of this peptide (T(m) = 310 K) measured by differential scanning calorimetry (DSC). The melting temperature of IG(47-60) determined by DSC is T(m) = 330 K and its structure is similar to that of the native beta-hairpin at all (lower) temperatures examined (283-313 K). Both of these truncated sequences are conserved in all known amino acid sequences of the B domains of the immunoglobulin binding protein G from bacteria. Thus, this study contributes to an understanding of the mechanism of folding of this whole family of proteins, and provides information about the mechanism of formation and stabilization of a beta-hairpin structural element. PMID:19089955

  6. (1-(4-(Naphthalen-2-yl)pyrimidin-2-yl)piperidin-4-yl)methanamine: a wingless beta-catenin agonist that increases bone formation rate.


    Pelletier, Jeffrey C; Lundquist, Joseph T; Gilbert, Adam M; Alon, Nipa; Bex, Frederick J; Bhat, Bheem M; Bursavich, Mattew G; Coleburn, Valerie E; Felix, Luciana A; Green, Daniel M; Green, Paula; Hauze, Diane B; Kharode, Yogendra P; Lam, Ho-Sun; Lockhead, Susan R; Magolda, Ronald L; Matteo, Jeanne J; Mehlmann, John F; Milligan, Colleen; Murrills, Richard J; Pirrello, Jennifer; Selim, Sally; Sharp, Michael C; Unwalla, Ray J; Vera, Matthew D; Wrobel, Jay E; Yaworsky, Paul; Bodine, Peter V N


    A high-throughput screening campaign to discover small molecule leads for the treatment of bone disorders concluded with the discovery of a compound with a 2-aminopyrimidine template that targeted the Wnt beta-catenin cellular messaging system. Hit-to-lead in vitro optimization for target activity and molecular properties led to the discovery of (1-(4-(naphthalen-2-yl)pyrimidin-2-yl)piperidin-4-yl)methanamine (5, WAY-262611). Compound 5 has excellent pharmacokinetic properties and showed a dose dependent increase in the trabecular bone formation rate in ovariectomized rats following oral administration. PMID:19856966

  7. TGF{beta}-mediated formation of pRb-E2F complexes in human myeloid leukemia cells

    SciTech Connect

    Hu Xiaotang


    TGF{beta} is well known for its inhibitory effect on cell cycle G1 checkpoint kinases. However, its role in the control of pRb-E2F complexes is not well established. TGF{beta} inhibits phosphorylation of pRb at several serine and threonine residues and regulates the association of E2F transcription factors with pRb family proteins. Recent studies found that predominantly E2F-4, p130, and histone deacetylase (HDAC) are found to bind to corresponding E2F-responsive promoters in G0/G1 phase. As cells progress through mid-G1, p130-E2F4 complex are replaced by p107-E2F4 followed by activators E2F1, 2, and 3. pRb was not detectable in the promoters containing the E2F-responsive site in cycling cells but was associated with E2F4-p130 complexes or E2F4-p107 complexes during G0/G1 phase. In human myeloid leukemia cell line, MV4-11, TGF{beta} upregulated pRb-E2F-4 and p130-E2F-4, and downregulated p107-E2F-4 complexes. However, pRB-E2F1 and pRb-E2F3 complexes were found in proliferating cells but not in TGF{beta} arrested G1 cells. In addition, electrophoretic gel mobility shift assay (EMSA) could not detect pRb-E2F DNA-binding activities either in S or G1 phase but exhibited the existence of p107-E2F4 in proliferating cells and p130-E2F4 complexes in TGF{beta}-arrested G1 cells, respectively. Our data suggest that p107 and p130, but not pRb, and the repressor E2F, but not activator E2Fs, play a critical role in regulating E2F-responsive gene expression in TGF{beta}-mediated cell cycle control in human myeloid leukemia cells.

  8. Overexpression of granulocyte-macrophage colony-stimulating factor induces pulmonary granulation tissue formation and fibrosis by induction of transforming growth factor-beta 1 and myofibroblast accumulation.

    PubMed Central

    Xing, Z.; Tremblay, G. M.; Sime, P. J.; Gauldie, J.


    We have previously reported that transfer to rat lung of the granulocyte-macrophage colony-stimulating factor (GM-CSF) gene leads to high expression of GM-CSF between days 1 and 4 and granulation tissue formation followed by an irreversible fibrotic response starting from day 12 onward. In the current study, we investigated the underlying mechanisms. We found that GM-CSF overexpression did not enhance production of tumor necrosis factor-alpha in a significant manner at any time after GM-CSF gene transfer. However, the content of transforming growth factor-beta 1 in bronchoalveolar lavage fluid was markedly induced at day 4 and appeared to be maximal around day 7 and remained high at day 12. Macrophages purified from bronchoalveolar lavage fluid 7 days after GM-CSF gene transfer spontaneously released significant quantities of transforming growth factor-beta 1 protein in vitro. After peak transforming growth factor-beta 1 production was the emergence of alpha-smooth muscle actin-rich myofibroblasts. Accumulation of these cells was most prominent at day 12 within the granulation tissues and they were still present in fibrotic areas between days 12 and 24 and diminished markedly afterward. Thus, we provide the first in vivo evidence that tumor necrosis factor-alpha may be dissociated from participation in a fibrotic process in the lung and GM-CSF may play a more direct role in pulmonary fibrogenesis at least in part through its capability to induce transforming growth factor-beta 1 in macrophages and the subsequent emergence of myofibroblast phenotypes. This GM-CSF transgene lung model is useful for a stepwise dissection of both cellular and molecular events involved in pulmonary fibrosis. Images Figure 2 Figure 5 Figure 6 PMID:9006322

  9. A calorimetric determination of the enthalpy of formation and a description of the defect structure of the ordered beta-phase /Ni, Cu/ /1-x/ Al/x/

    NASA Technical Reports Server (NTRS)

    Henig, E. T.; Lukas, H. L.


    In order to describe thermodynamically the defect structure of an ordered B-Hume-Rothery phase, the heat of formation of (Ni,Cu)(1-x)Al(x) was measured at 1100 K as a function of concentration in the range x (sub Al) = 0.4 and 0.55 for three substitution rations x (sub Ni)/x (sub Cu) = infinity; 11; 5. The heat of formation of the NiAl beta-phase is strongly negative. For the stoichiometric composition it is -72.2 kJ/g-atom. On both the nickel-rich side and the aluminum-rich side the magnitude of the enthalpy of formation decreases linearly with concentration. Substitution of nickel for copper decreases the magnitude of the enthalpy of formation over the entire homogeneity range for the phase (Ni,Cu)(1-x)Al(x). The curve for the enthalpy of formation as well as the literature values for the chemical potential of aluminum are described with great accuracy by the disorder model of Wagner-Schottky.

  10. Polyalanine and Abeta Aggregation Kinetics: Probing Intermediate Oligomer Formation and Structure Using Computer Simulations

    NASA Astrophysics Data System (ADS)

    Phelps, Erin Melissa


    The aggregation of proteins into stable, well-ordered structures known as amyloid fibrils has been associated with many neurodegenerative diseases. Amyloid fibrils are long straight, and un-branched structures containing several proto-filaments, each of which exhibits "cross beta structure," -- ribbon-like layers of large beta sheets whose strands run perpendicular to the fibril axis. It has been suggested in the literature that the pathway to fibril formation has the following steps: unfolded monomers associate into transient unstable oligomers, the oligomers undergo a rearrangement into the cross-beta structure and form into proto-filaments, these proto-filaments then associate and grow into fully formed fibrils. Recent experimental studies have determined that the unstable intermediate structures are toxic to cells and that their presence may play a key role in the pathogenesis of the amyloid diseases. Many efforts have been made to determine the structure of intermediate oligomer aggregates that form during the fibrillization process. The goal of this work is to provide details about the structure and formation kinetics of the unstable oligomers that appear in the fibril formation pathway. The specific aims of this work are to determine the steps in the fibril formation pathway and how the kinetics of fibrillization changes with variations in temperature and concentration. The method used is the application of discontinuous molecular dynamics to large systems of peptides represented with an intermediate resolution model, PRIME, that was previously developed in our group. Three different peptide sequences are simulated: polyalanine (KA14K), Abeta17-40, and Abeta17-42; the latter two are truncated sequences of the Alzheimer's peptide. We simulate the spontaneous assembly of these peptide chains from a random initial configuration of random coils. We investigate aggregation kinetics and oligomer formation of a system of 192 polyalanine (KA14K) chains over a

  11. Beta transition and stress-induced phase separation in the spinning of spider dragline silk.


    Knight, D P; Knight, M M; Vollrath, F


    Spider dragline silk is formed as the result of a remarkable transformation in which an aqueous dope solution is rapidly converted into an insoluble protein filament with outstanding mechanical properties. Microscopy on the spinning duct in Nephila edulis spiders suggests that this transformation involves a stress-induced formation of anti-parallel beta-sheets induced by extensional flow. Measurements of draw stress at different draw rates during silking confirm that a stress-induced phase transition occurs. PMID:10828366

  12. Synthesis of porous sheet-like Co{sub 3}O{sub 4} microstructure by precipitation method and its potential applications in the thermal decomposition of ammonium perchlorate

    SciTech Connect

    Lu Shanshan; Jing Xiaoyan; Liu Jingyuan; Wang Jun; Liu Qi; Zhao Yanhua; Jamil, Saba; Zhang Milin; Liu Lianhe


    Porous sheet-like cobalt oxide (Co{sub 3}O{sub 4}) were successfully synthesized by precipitation method combined with calcination of cobalt hydroxide precursors. The structure, morphology and porosity properties of the products were characterized by X-ray powder diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and nitrogen adsorption-desorption measurement. The as-prepared sheet-like microstructures were approximately 2-3 {mu}m in average diameter, and the morphology of the cobalt hydroxide precursors was retained after the calcination process. However, it appeared a large number of uniform pores in the sheets after calcination. In order to calculate the potential catalytic activity, the thermal decomposition of ammonium perchlorate (AP) has been analyzed, in which cobalt oxide played a role of an additive and the porous sheet-like Co{sub 3}O{sub 4} microstructures exhibited high catalytic performance and considerable decrease in the thermal decomposition temperature of AP. Moreover, a formation mechanism for the sheet-like microstructures has been discussed. - Graphical abstract: Porous sheet-like Co{sub 3}O{sub 4} were synthesized by facile precipitation method combined with calcination of {beta}-Co(OH){sub 2} precursors. Thermogravimetric-differential scanning calorimetric analysis indicates potential catalytic activity in the thermal decomposition of ammonium perchlorate. Highlights: Black-Right-Pointing-Pointer Synthesis of sheet-like {beta}-Co(OH){sub 2} precursors by precipitation method. Black-Right-Pointing-Pointer Porous sheet-like Co{sub 3}O{sub 4} were obtained by calcining {beta}-Co(OH){sub 2} precursors. Black-Right-Pointing-Pointer The possible formation mechanism of porous sheet-like Co{sub 3}O{sub 4} has been discussed. Black-Right-Pointing-Pointer Porous sheet-like Co{sub 3}O{sub 4} decrease the thermal decomposition temperature of ammonium perchlorate.

  13. Beta amyloid and hyperphosphorylated tau deposits in the pancreas in type 2 diabetes

    SciTech Connect

    Miklossy, J.; Miller, L.; Qing, H.; Radenovic, A.; Kis, A.; Vileno, B.; Laszlo, F.; Martins, R.N.; Waeber, G.; Mooser, V.; Bosman, F.; Khalili, K.; Darbinian, N.; McGeer, P.L.


    Strong epidemiologic evidence suggests an association between Alzheimer disease (AD) and type 2 diabetes. To determine if amyloid beta (A{beta}) and hyperphosphorylated tau occurs in type 2 diabetes, pancreas tissues from 21 autopsy cases (10 type 2 diabetes and 11 controls) were analyzed. APP and tau mRNAs were identified in human pancreas and in cultured insulinoma beta cells (INS-1) by RT-PCR. Prominent APP and tau bands were detected by Western blotting in pancreatic extracts. Aggregated A{beta}, hyperphosphorylated tau, ubiquitin, apolipoprotein E, apolipoprotein(a), IB1/JIP-1 and JNK1 were detected in Langerhans islets in type 2 diabetic patients. A{beta} was co-localized with amylin in islet amyloid deposits. In situ beta sheet formation of islet amyloid deposits was shown by infrared microspectroscopy (SIRMS). LPS increased APP in non-neuronal cells as well. We conclude that A{beta} deposits and hyperphosphorylated tau are also associated with type 2 diabetes, highlighting common pathogenetic features in neurodegenerative disorders, including AD and type 2 diabetes and suggesting that A{beta} deposits and hyperphosphorylated tau may also occur in other organs than the brain.

  14. A Theoretical Model of a Thinning Current Sheet in the Low-β Plasmas

    NASA Astrophysics Data System (ADS)

    Takeshige, Satoshi; Takasao, Shinsuke; Shibata, Kazunari


    Magnetic reconnection is an important physical process in various explosive phenomena in the universe. In previous studies, it was found that fast reconnection takes place when the thickness of a current sheet becomes on the order of a microscopic length such as the ion Larmor radius or the ion inertial length. In this study, we investigated the pinching process of a current sheet by the Lorentz force in a low-β plasma using one-dimensional magnetohydrodynamics (MHD) simulations. It is known that there is an exact self-similar solution for this problem that neglects gas pressure. We compared the non-linear MHD dynamics with the analytic self-similar solution. From the MHD simulations, we found that with the gas pressure included the implosion process deviates from the analytic self-similar solution as t\\to {t}0, where t0 is the explosion time when the thickness of a current sheet of the analytic solution becomes 0. We also found that a pair of MHD fast-mode shocks is generated and propagates after the formation of the pinched current sheet as t\\to {t}0. On the basis of the Rankine-Hugoniot relations, we derived the scaling law of the physical quantities with respect to the initial plasma beta in the pinched current sheet. Our study could help us estimate the physical quantities in the pinched current sheet formed in a low-β plasma.

  15. Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through β-sheet formation.


    Wybenga-Groot, Leanne E; McGlade, C Jane


    The Src-like adaptor proteins (SLAP/SLAP2) are key components of Cbl-dependent downregulation of antigen receptor, cytokine receptor, and receptor tyrosine kinase signaling in hematopoietic cells. SLAP and SLAP2 consist of adjacent SH3 and SH2 domains that are most similar in sequence to Src family kinases (SFKs). Notably, the SH3-SH2 connector sequence is significantly shorter in SLAP/SLAP2 than in SFKs. To understand the structural implication of a short SH3-SH2 connector sequence, we solved the crystal structure of a protein encompassing the SH3 domain, SH3-SH2 connector, and SH2 domain of SLAP2 (SLAP2-32). While both domains adopt typical folds, the short SH3-SH2 connector places them in close association. Strand βe of the SH3 domain interacts with strand βA of the SH2 domain, resulting in the formation of a continuous β sheet that spans the length of the protein. Disruption of the SH3/SH2 interface through mutagenesis decreases SLAP-32 stability in vitro, consistent with inter-domain binding being an important component of SLAP2 structure and function. The canonical peptide binding pockets of the SH3 and SH2 domains are fully accessible, in contrast to other protein structures that display direct interaction between SH3 and SH2 domains, in which either peptide binding surface is obstructed by the interaction. Our results reveal potential sites of novel interaction for SH3 and SH2 domains, and illustrate the adaptability of SH2 and SH3 domains in mediating interactions. As well, our results suggest that the SH3 and SH2 domains of SLAP2 function interdependently, with implications on their mode of substrate binding. PMID:24018043

  16. Sfrp1, Sfrp2, and Sfrp5 regulate the Wnt/beta-catenin and the planar cell polarity pathways during early trunk formation in mouse.


    Satoh, Wataru; Matsuyama, Makoto; Takemura, Hiromasa; Aizawa, Shinichi; Shimono, Akihiko


    Sfrp is a secreted Wnt antagonist that directly interacts with Wnt ligand. We show here that inactivation of Sfrp1, Sfrp2, and Sfrp5 leads to fused somites formation in early-somite mouse embryos, simultaneously resulting in defective convergent extension (CE), which causes severe shortening of the anteroposterior axis. These observations indicate the redundant roles of Sfrp1, Sfrp2, and Sfrp5 in early trunk formation. The roles of the Sfrps were genetically distinguished in terms of the regulation of Wnt pathways. Genetic analysis combining Sfrps mutants and Loop-tail mice revealed the involvement of Sfrps in CE through the regulation of the planar cell polarity pathway. Furthermore, Dkk1-deficient embryos carrying Sfrp1 homozygous and Sfrp2 heterozygous mutations display irregular somites and indistinct intersomitic boundaries, which indicates that Sfrps-mediated inhibition of the Wnt/beta-catenin pathway is necessary for somitogenesis. Our results suggest that Sfrps regulation of the canonical and noncanonical pathways is essential for proper trunk formation. PMID:18257070

  17. Ablation of MMP9 gene ameliorates paracellular permeability and fibrinogen-amyloid beta complex formation during hyperhomocysteinemia.


    Muradashvili, Nino; Tyagi, Reeta; Metreveli, Naira; Tyagi, Suresh C; Lominadze, David


    Increased blood level of homocysteine (Hcy), called hyperhomocysteinemia (HHcy) accompanies many cognitive disorders including Alzheimer's disease. We hypothesized that HHcy-enhanced cerebrovascular permeability occurs via activation of matrix metalloproteinase-9 (MMP9) and leads to an increased formation of fibrinogen-β-amyloid (Fg-Aβ) complex. Cerebrovascular permeability changes were assessed in C57BL/6J (wild type, WT), cystathionine-β-synthase heterozygote (Cbs+/-, a genetic model of HHcy), MMP9 gene knockout (Mmp9-/-), and Cbs and Mmp9 double knockout (Cbs+/-/Mmp9-/-) mice using a dual-tracer probing method. Expression of vascular endothelial cadherin (VE-cadherin) and Fg-Aβ complex formation was assessed in mouse brain cryosections by immunohistochemistry. Short-term memory of mice was assessed with a novel object recognition test. The cerebrovascular permeability in Cbs+/- mice was increased via mainly the paracellular transport pathway. VE-cadherin expression was the lowest and Fg-Aβ complex formation was the highest along with the diminished short-term memory in Cbs+/- mice. These effects of HHcy were ameliorated in Cbs+/-/Mmp9-/- mice. Thus, HHcy causes activation of MMP9 increasing cerebrovascular permeability by downregulation of VE-cadherin resulting in an enhanced formation of Fg-Aβ complex that can be associated with loss of memory. These data may lead to the identification of new targets for therapeutic intervention that can modulate HHcy-induced cerebrovascular permeability and resultant pathologies. PMID:24865997

  18. Beta-hydroxybutyrate abrogates formation of bovine neutrophil extracellular traps and bactericidal activity against mammary pathogenic Escherichia coli.


    Grinberg, Navit; Elazar, Sharon; Rosenshine, Ilan; Shpigel, Nahum Y


    Escherichia coli is an important bacterial species isolated from bovine mastitis. The rate of neutrophil recruitment into the mammary gland and their bactericidal activity largely affect the severity and outcome of the disease. Ketosis is a common metabolic disease, and affected dairy cows are known to have increased risk for mastitis and other infectious conditions. The disease is associated with high blood and milk levels of beta-hydroxybutyrate (BHBA), previously shown to negatively affect neutrophil function by unknown mechanisms. We show here that the mammary pathogenic E. coli strain P4 activates normal bovine neutrophils to form neutrophil extracellular traps (NETs), which are highly bactericidal against this organism. Preincubation of these neutrophils with increasing concentrations (0.1 to 8 mmol/liter) of BHBA caused a fivefold decrease of E. coli P4 phagocytosis, though intracellular killing was unaffected. Furthermore, BHBA caused a 10-fold decrease in the NETs formed by E. coli P4-activated neutrophils and a similar decrease in NET bactericidal activity against this organism. These negative effects of BHBA on bovine neutrophils might explain the increased susceptibility of ketotic cows to mastitis and other infectious conditions. PMID:18411287

  19. Neuroprotective approaches in experimental models of beta-amyloid neurotoxicity: relevance to Alzheimer's disease.


    Harkany, T; Hortobágyi, T; Sasvári, M; Kónya, C; Penke, B; Luiten, P G; Nyakas, C


    critical role for N-methyl-D-aspartate (NMDA) receptors was postulated in the neurotoxic processes. Additionally, A beta s might become internalized, either after their selective binding to cell-surface receptors or after membrane association in consequence of their highly lipophilic nature, and induce free radical generation and subsequent oxidative injury. Ca(2+)-mediated neurotoxic events and generation of oxygen free radicals may indeed potentiate each other, or even converge to the same neurotoxic events, leading to cell death. 6. Neuroprotection against A beta toxicity was achieved by both pre- and post-treatment with NMDA receptor channel antagonists. Moreover, direct radical-scavengers, such as vitamin E or vitamin C, attenuated A beta toxicity with high efficacy. Interestingly, combined drug treatments did not necessarily result in additive enhanced neuroprotection. 7. Similarly to the blockade of NMDA receptors, the neurotoxic action of A beta s could be markedly decreased by pharmacological manipulation of voltage-dependent Ca(2+)-channels, serotonergic IA or adenosine A1 receptors, and by drugs eliciting membrane hyperpolarization or indirect blockade of Ca(2+)-mediated intracellular consequences of intracerebral A beta infusions. 8. A beta neurotoxicity might be dose-dependently modulated by trace metals. In spite of the fact that zinc (Zn) may act as a potent inhibitor of the NMDA receptor channel, high Zn doses accelerate A beta fibril formation, stabilize the beta-sheet conformation and thereby potentiate A beta neurotoxicity. Combined trace element supplementation with Se, Mn, or Mg, which prevails over the expression of detoxifying enzymes or counteracts intracellular elevations of Ca2+, may reduce the neurotoxic impact of A beta s. 9. Alterations in the regulatory functions of the hypothalamo-pituitary-adrenal axis may contribute significantly to neurodegenerative changes in the brain. Furthermore, AD patients exhibit substantially increased circadia

  20. Structural modifications of human beta 2 microglobulin treated with oxygen-derived radicals.

    PubMed Central

    Capeillere-Blandin, C; Delaveau, T; Descamps-Latscha, B


    Treatment of human beta 2 microglobulin (beta 2m) with defined oxygen-derived species generated by treatment with gamma-radiation was studied. As assessed by SDS/PAGE, the hydroxyl radicals (.OH) caused the disappearance of the protein band at 12 kDa that represents beta 2m, and cross-linked the protein into protein bands stable to both SDS and reducing conditions. However, when .OH was generated under oxygen in equimolar combination with the superoxide anion radical (O2.-), the high-molecular-mass protein products were less represented, and fragmented derivatives were not obviously detectable. Exposure to .OH alone, or to .OH + O2.- in the presence of O2, induced the formation of beta 2m protein derivatives with a more acidic net electrical charge than the parent molecule. In contrast, O2.- alone had virtually no effect on molecular mass or pI. Changes in u.v. fluorescence during .OH attack indicated changes in conformation, as confirmed by c.d. spectrometry. A high concentration of radicals caused the disappearance of the beta-pleated sheet structure and the formation of a random coil structure. Loss of tryptophan and significant production of dityrosine (2,2'-biphenol type) were noted, exhibiting a clear dose-dependence with .OH alone or with .OH + O2.-. The combination of .OH + O2.- induced a pattern of changes similar to that with .OH alone, but more extensive for c.d. and tryptophan oxidation (2 Trp/beta 2m molecule), and more limited for dityrosine formation. Lower levels of these oxidative agents caused the reproducible formation of species at 18 and 25 kDa which were recognized by antibodies against native beta 2m. These findings provide a model for the protein pattern observed in beta 2m amyloidosis described in the literature. Images Fig. 4. Fig. 5. PMID:1649598

  1. Nuclear magnetic resonance evidence for the dimer formation of beta amyloid peptide 1-42 in 1,1,1,3,3,3-hexafluoro-2-propanol.


    Shigemitsu, Yoshiki; Iwaya, Naoko; Goda, Natsuko; Matsuzaki, Mizuki; Tenno, Takeshi; Narita, Akihiro; Hoshi, Minako; Hiroaki, Hidekazu


    Alzheimer's disease involves accumulation of senile plaques in which filamentous aggregates of amyloid beta (Aβ) peptides are deposited. Recent studies demonstrate that oligomerization pathways of Aβ peptides may be complicated. To understand the mechanisms of Aβ(1-42) oligomer formation in more detail, we have established a method to produce (15)N-labeled Aβ(1-42) suited for nuclear magnetic resonance (NMR) studies. For physicochemical studies, the starting protein material should be solely monomeric and all Aβ aggregates must be removed. Here, we succeeded in fractionating a "precipitation-resistant" fraction of Aβ(1-42) from an "aggregation-prone" fraction by high-performance liquid chromatography (HPLC), even from bacterially overexpressed Aβ(1-42). However, both Aβ(1-42) fractions after 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP) treatment formed amyloid fibrils. This indicates that the "aggregation seed" was not completely monomerized during HFIP treatment. In addition, Aβ(1-42) dissolved in HFIP was found to display a monomer-dimer equilibrium, as shown by two-dimensional (1)H-(15)N NMR. We demonstrated that the initial concentration of Aβ during the HFIP pretreatment altered the kinetic profiles of Aβ fibril formation in a thioflavin T fluorescence assay. The findings described here should ensure reproducible results when studying the Aβ(1-42) peptide. PMID:26772162

  2. Soluble amyloid beta oligomers block the learning-induced increase in hippocampal sharp wave-ripple rate and impair spatial memory formation

    PubMed Central

    Nicole, Olivier; Hadzibegovic, Senka; Gajda, Judyta; Bontempi, Bruno; Bem, Tiaza; Meyrand, Pierre


    Post-learning hippocampal sharp wave-ripples (SWRs) generated during slow wave sleep are thought to play a crucial role in memory formation. While in Alzheimer’s disease, abnormal hippocampal oscillations have been reported, the functional contribution of SWRs to the typically observed spatial memory impairments remains unclear. These impairments have been related to degenerative synaptic changes produced by soluble amyloid beta oligomers (Aβos) which, surprisingly, seem to spare the SWR dynamics during routine behavior. To unravel a potential effect of Aβos on SWRs in cognitively-challenged animals, we submitted vehicle- and Aβo-injected mice to spatial recognition memory testing. While capable of forming short-term recognition memory, Aβ mice exhibited faster forgetting, suggesting successful encoding but an inability to adequately stabilize and/or retrieve previously acquired information. Without prior cognitive requirements, similar properties of SWRs were observed in both groups. In contrast, when cognitively challenged, the post-encoding and -recognition peaks in SWR occurrence observed in controls were abolished in Aβ mice, indicating impaired hippocampal processing of spatial information. These results point to a crucial involvement of SWRs in spatial memory formation and identify the Aβ-induced impairment in SWRs dynamics as a disruptive mechanism responsible for the spatial memory deficits associated with Alzheimer’s disease. PMID:26947247

  3. Molecular basis for amyloid-[beta] polymorphism

    SciTech Connect

    Colletier, Jacques-Philippe; Laganowsky, Arthur; Landau, Meytal; Zhao, Minglei; Soriaga, Angela B.; Goldschmidt, Lukasz; Flot, David; Cascio, Duilio; Sawaya, Michael R.; Eisenberga, David


    Amyloid-beta (A{beta}) aggregates are the main constituent of senile plaques, the histological hallmark of Alzheimer's disease. A{beta} molecules form {beta}-sheet containing structures that assemble into a variety of polymorphic oligomers, protofibers, and fibers that exhibit a range of lifetimes and cellular toxicities. This polymorphic nature of A{beta} has frustrated its biophysical characterization, its structural determination, and our understanding of its pathological mechanism. To elucidate A{beta} polymorphism in atomic detail, we determined eight new microcrystal structures of fiber-forming segments of A{beta}. These structures, all of short, self-complementing pairs of {beta}-sheets termed steric zippers, reveal a variety of modes of self-association of A{beta}. Combining these atomic structures with previous NMR studies allows us to propose several fiber models, offering molecular models for some of the repertoire of polydisperse structures accessible to A{beta}. These structures and molecular models contribute fundamental information for understanding A{beta} polymorphic nature and pathogenesis.

  4. Solid-state NMR analysis of the {beta}-strand orientation of the protofibrils of amyloid {beta}-protein

    SciTech Connect

    Doi, Takashi; Masuda, Yuichi; Irie, Kazuhiro; Akagi, Ken-ichi; Monobe, Youko; Imazawa, Takayoshi; Takegoshi, K.


    Highlights: Black-Right-Pointing-Pointer The supramolecular structure of A{beta}42 protofibrils was analyzed by solid-state NMR. Black-Right-Pointing-Pointer The Ala-21 residue in the A{beta}42 protofibrils is included in a slightly disordered {beta}-strand. Black-Right-Pointing-Pointer The A{beta}42 protofibrils do not form intermolecular in-register parallel {beta}-sheets. -- Abstract: Alzheimer's disease (AD) is caused by abnormal deposition (fibrillation) of a 42-residue amyloid {beta}-protein (A{beta}42) in the brain. During the process of fibrillation, the A{beta}42 takes the form of protofibrils with strong neurotoxicity, and is thus believed to play a crucial role in the pathogenesis of AD. To elucidate the supramolecular structure of the A{beta}42 protofibrils, the intermolecular proximity of the Ala-21 residues in the A{beta}42 protofibrils was analyzed by {sup 13}C-{sup 13}C rotational resonance experiments in the solid state. Unlike the A{beta}42 fibrils, an intermolecular {sup 13}C-{sup 13}C correlation was not found in the A{beta}42 protofibrils. This result suggests that the {beta}-strands of the A{beta}42 protofibrils are not in an in-register parallel orientation. A{beta}42 monomers would assemble to form protofibrils with the {beta}-strand conformation, then transform into fibrils by forming intermolecular parallel {beta}-sheets.

  5. Oncoprotein E7 from Beta Human Papillomavirus 38 Induces Formation of an Inhibitory Complex for a Subset of p53-Regulated Promoters

    PubMed Central

    Saidj, Djamel; Cros, Marie-Pierre; Hernandez-Vargas, Hector; Guarino, Francesca; Sylla, Bakary S.; Tommasino, Massimo


    Our previous studies on cutaneous beta human papillomavirus 38 (HPV38) E6 and E7 oncoproteins highlighted a novel activity of IκB kinase beta (IKKβ) in the nucleus of human keratinocytes, where it phosphorylates and stabilizes ΔNp73α, an antagonist of p53/p73 functions. Here, we further characterize the role of the IKKβ nuclear form. We show that IKKβ nuclear translocation and ΔNp73α accumulation are mediated mainly by HPV38 E7 oncoprotein. Chromatin immunoprecipitation (ChIP)/Re-ChIP experiments showed that ΔNp73α and IKKβ are part, together with two epigenetic enzymes DNA methyltransferase 1 (DNMT1) and the enhancer of zeste homolog 2 (EZH2), of a transcriptional regulatory complex that inhibits the expression of some p53-regulated genes, such as PIG3. Recruitment to the PIG3 promoter of EZH2 and DNMT1 resulted in trimethylation of histone 3 on lysine 27 and in DNA methylation, respectively, both events associated with gene expression silencing. Decreases in the intracellular levels of HPV38 E7 or ΔNp73α strongly affected the recruitment of the inhibitory transcriptional complex to the PIG3 promoter, with consequent restoration of p53-regulated gene expression. Finally, the ΔNp73α/IKKβ/DNMT1/EZH2 complex appears to bind a subset of p53-regulated promoters. In fact, the complex is efficiently recruited to several promoters of genes encoding proteins involved in DNA repair and apoptosis, whereas it does not influence the expression of the prosurvival factor Survivin. In summary, our data show that HPV38 via E7 protein promotes the formation of a multiprotein complex that negatively regulates the expression of several p53-regulated genes. PMID:24006445

  6. Semiflexible Chain Networks Formed via Self-Assembly of Beta-Hairpin Molecules

    NASA Astrophysics Data System (ADS)

    Ozbas, Bulent; Rajagopal, Karthikan


    We present experimental results from a de novo designed oligopeptide that intermolecularly self-assembles into rigid hydrogel networks after an intramolecular folding event. The effect of ionic strength and beta hairpin peptide strand length on beta-sheet formation, self-assembly and resultant rheological properties were studied. The peptide molecules are locally amphiphilic with two linear strands of alternating hydrophobic valine and hydrophilic lysine amino acids flanking a central turn sequence. The beta-sheet formation of 24, 20, 16 and 12 amino acid long beta-hairpin molecules were studied by CD spectroscopy. The network properties and the nanostructure of the hydrogels were studied by rheology, TEM and SANS. The hydrogel network is composed of semiflexible fibrillar assemblies with viscoelastic behavior that follows the theoretical prediction for heavily crosslinked,semi-flexible polymer networks. SANS results show that the cross-sectional diameter of the fibrils, and thus, the bending modulus of the chains can be varied by changing the number of amino acids of strands of the molecules. Rheological measurements reveal that rigidity, creep and relaxation behavior of the hydrogels vary with the magnitude of stimulus and with the cross-section diameter of the chains.

  7. vapor pressure of uranyl beta-diketonates. IV. effect of adduct formation on volatility of uranyl pivaloyltrifluoroacetonate

    SciTech Connect

    Sidorenko, G.V.; Suglobov, D.N.


    Gas-phase adduct formation of uranyl pivaloyltrifluoroacetonate (I) with donor active materials such as trimethyl phosphate (TMP), pyridine (Py), tetrahydrofuran (THF), and ethanol (EtOH) was demonstrated by IR spectroscopy. Vapor pressure of the I-TMF adduct was measured by the flow method. The volatility of I was studied in a stream of helium saturated with vapors of donor-active materials: Py, THF, diethyl ether (Et/sub 2/O), EtOH, and acetonitrile. The temperature dependence of the pressure of saturated I.TMP and I vapor in a stream of neutral ligand vapor is described by log p (Pa) = -A/T + B. Following are, respectively, neutral ligand, T range (degreeK), and coefficiencts A, B: TMP 383453, 4648 +/- 48, 12.06 +/- 0.18; Py, 383-463, 5277 +/- 87, 13.36 +/- 0.21; THF, 363453, 4662 +/- 69, 12.66 +/- 0.17; Et/sub 2/O, 353-423, 4864 +/- 110, 13.29 +/- 0.28; EtOH, 363-443, 4509 +/- 89, 12.18 +/- 0.22. Adduct formation with these neutral ligands decreases the volatility of I significantly. A tendency to increase of adduct volatility was observed when the donor properties of the neutral ligand decrease.

  8. Combined treatment with parathyroid hormone (1-34) and beta-tricalcium phosphate had an additive effect on local bone formation in a rat defect model.


    Tao, Zhou-Shan; Tu, Kai-Kai; Huang, Zheng-Liang; Zhou, Qiang; Sun, Tao; Xu, Hong-Ming; Zhou, Yu-Long; Lv, Yang-Xun; Cui, Wei; Yang, Lei


    The objective of this study was to evaluate the effect of following combined treatment with parathyroid hormone (1-34) (PTH) and beta-tricalcium phosphate (β-TCP) on local bone formation in a rat 3-mm critical-size defect at distal femur. Twelve weeks after bilateral ovariectomy (OVX) and sham operation (sham), all animals were randomly divided into four groups: group OVX, group OVX + β-TCP, group sham, and group sham + β-TCP, then all rats underwent bone defect in the bilateral distal femurs, and β-TCP were implanted into critical-sized defects for group OVX + β-TCP and group sham + β-TCP. After defect operation, all animals were received following subcutaneous injections with PTH (60 μg/kg, three times a week) until death at 4 and 8 weeks. The defected area in distal femurs of rats was harvested for evaluation by histology, micro-CT, and biomechanics. The results of our study show that systemic usage of PTH or local usage of β-TCP can increase the healing of defects in OVX or sham rats. Furthermore, treatments with PTH and β-TCP showed a stronger effect on accelerating the local bone formation than used alone. Osteoporosis can limit the function of PTH and/or β-TCP. The results from our study demonstrate that combination of PTH and β-TCP had an additive effect on local bone formation in non-osteoporosis and/or osteoporosis rats. PMID:26429350

  9. Beta-escin inhibits colonic aberrant crypt foci formation in rats and regulates the cell cycle growth by inducing p21(waf1/cip1) in colon cancer cells.


    Patlolla, Jagan M R; Raju, Jayadev; Swamy, Malisetty V; Rao, Chinthalapally V


    Extracts of Aesculus hippocastanum (horse chestnut) seed have been used in the treatment of chronic venous insufficiency, edema, and hemorrhoids. Most of the beneficial effects of horse chestnut are attributed to its principal component beta-escin or aescin. Recent studies suggest that beta-escin may possess anti-inflammatory, anti-hyaluronidase, and anti-histamine properties. We have evaluated the chemopreventive efficacy of dietary beta-escin on azoxymethane-induced colonic aberrant crypt foci (ACF). In addition, we analyzed the cell growth inhibitory effects and the induction of apoptosis in HT-29 human colon cancer cell line. To evaluate the inhibitory properties of beta-escin on colonic ACF, 7-week-old male F344 rats were fed experimental diets containing 0%, 0.025%, or 0.05% beta-escin. After 1 week, the rats received s.c. injections of azoxymethane (15 mg/kg body weight, once weekly for 2 weeks) or an equal volume of normal saline (vehicle). Rats were continued on respective experimental diets and sacrificed 8 weeks after the azoxymethane treatment. Colons were evaluated histopathologically for ACF. Administration of dietary 0.025% and 0.05% beta-escin significantly suppressed total colonic ACF formation up to approximately 40% (P < 0.001) and approximately 50% (P < 0.0001), respectively, when compared with control diet group. Importantly, rats fed beta-escin showed dose-dependent inhibition (approximately 49% to 65%, P < 0.0001) of foci containing four or more aberrant crypts. To understand the growth inhibitory effects, HT-29 human colon carcinoma cell lines were treated with various concentrations of beta-escin and analyzed by flow cytometry for apoptosis and cell cycle progression. Beta-escin treatment in HT-29 cells induced growth arrest at the G1-S phase, which was associated with the induction of the cyclin-dependent kinase inhibitor p21(WAF1/CIP1), and this correlated with reduced phosphorylation of retinoblastoma protein. Results also indicate that

  10. Eumelanin kinetics and sheet structure

    NASA Astrophysics Data System (ADS)

    Sutter, J. U.; Bidláková, T.; Karolin, J.; Birch, D. J. S.


    Melanins are common pigments with a non-repeating primary structure that is generally accepted to be composed of dihydroxyindoles. However, despite intensive research the secondary structure defining the minimum functional unit (protomolecule) remains elusive. We have revisited eumelanin formation in-situ during the non-enzymatic auto-oxidation of 3,4-dihydroxy-L-phenylalanine by using the fluorescence of thioflavin T; an extrinsic probe known to report on sheet structure. This approach obviates the complex intrinsic fluorescence and reveals a sigmoidal temporal dependence of assembly that is consistent with protomolecule formation and assembly into a stacked sheet structure rather than a randomized heteropolymer formed by monomer addition.

  11. Formation of non-beta 6.3-helical gramicidin channels between sequence-substituted gramicidin analogues.

    PubMed Central

    Durkin, J T; Providence, L L; Koeppe, R E; Andersen, O S


    Using the linear gramicidins as an example, we have previously shown how the statistical properties of heterodimeric (hybrid) channels (formed between the parent [Val1]gramicidin A (gA) and a sequence-altered analogue) can be used to assess whether the analogue forms channels that are structurally equivalent to the parent channels (Durkin, J. T., R. E. Koeppe II, and O. S. Andersen. 1990. J. Mol. Biol. 211:221-234). Generally, the gramicidins are tolerant of amino acid sequence alterations. We report here an exception. The optically reversed analogue, gramicidin M- (gM-) (Heitz, F., G. Spach, and Y. Trudelle. 1982. Biophys. J. 40:87-89), forms channels that are the mirror-image of [Val1]gA channels; gM- should thus form no hybrid channels with analogues having the same helix sense as [Val1]gA. Surprisingly, however, gM- forms hybrid channels with the shortened analogues des-Val1-[Ala2]gA and des-Val1-gC, but these channels differ fundamentally from the parent channels: (a) the appearance rate of these heterodimers is only approximately 1/10 of that predicted from the random assortment of monomers into conducting dimers, indicating the existence of an energy barrier to their formation (e.g., monomer refolding into a new channel-forming conformation); and (b), once formed, the hybrid channels are stabilized approximately 1,000-fold relative to the parent channels. The increased stability suggests a structure that is joined by many hydrogen bonds, such as one of the double-stranded helical dimers shown to be adopted by gramicidins in organic solvents (Veatch, W. R., E. T. Fossel, and E. R. Blout. 1974. Biochemistry. 13:5249-5256). PMID:1376164

  12. Study of formation of deep trapping mechanism by UV, beta and gamma irradiated Eu(3+) activated SrY2O4 and Y4Al2O9 phosphors.


    Dubey, Vikas; Kaur, Jagjeet; Parganiha, Yogita; Suryanarayana, N S; Murthy, K V R


    This paper reports the thermoluminescence properties of Eu(3+) doped different host matrix phosphors (SrY2O4 and Y4Al2O9). The phosphor is prepared by high temperature solid state reaction method. The method is suitable for large scale production and fixed concentration of boric acid using as a flux. The prepared samples were characterized by X-ray diffraction technique and the crystallite size calculated by Scherer's formula. The prepared phosphor characterized by Scanning Electron Microscopic (SEM), Fourier Transform Infrared (FTIR), Energy Dispersive X-ray analysis (EDX), thermoluminescence (TL) and Transmission Electron Microscopic (TEM) techniques. The prepared phosphors for different concentration of Eu(3+) ions were examined by TL glow curve for UV, beta and gamma irradiation. The UV 254nm source used for UV irradiation, Sr(90) source was used for beta irradiation and Co(60) source used for gamma irradiation. SrY2O4:Eu(3+)and Y4Al2O9:Eu(3+) phosphors which shows both higher temperature peaks and lower temperature peaks for UV, beta and gamma irradiation. Here UV irradiated sample shows the formation of shallow trap (surface trapping) and the gamma irradiated sample shows the formation of deep trapping. The estimation of trap formation was evaluated by knowledge of trapping parameters. The trapping parameters such as activation energy, order of kinetics and frequency factor were calculated by peak shape method. Here most of the peak shows second order of kinetics. The effect of gamma, beta and UV exposure on TL studies was also examined and it shows linear response with dose which indicate that the samples may be useful for TL dosimetry. Formation of deep trapping mechanism by UV, beta and gamma irradiated Eu(3+) activated SrY2O4 and Y4Al2O9 phosphors is discussed in this paper. PMID:26748019

  13. Proteopedia: Rossmann Fold: A Beta-Alpha-Beta Fold at Dinucleotide Binding Sites

    ERIC Educational Resources Information Center

    Hanukoglu, Israel


    The Rossmann fold is one of the most common and widely distributed super-secondary structures. It is composed of a series of alternating beta strand (ß) and alpha helical (a) segments wherein the ß-strands are hydrogen bonded forming a ß-sheet. The initial beta-alpha-beta (ßaß) fold is the most conserved segment of Rossmann folds. As this segment…

  14. An experimental study of multiple zonal jet formation in rotating, thermally driven convective flows on a topographic beta-plane

    NASA Astrophysics Data System (ADS)

    Read, P. L.; Jacoby, T. N. L.; Rogberg, P. H. T.; Wordsworth, R. D.; Yamazaki, Y. H.; Miki-Yamazaki, K.; Young, R. M. B.; Sommeria, J.; Didelle, H.; Viboud, S.


    A series of rotating, thermal convection experiments were carried out on the Coriolis platform in Grenoble, France, to investigate the formation and energetics of systems of zonal jets through nonlinear eddy/wave-zonal flow interactions on a topographic β-plane. The latter was produced by a combination of a rigid, conically sloping bottom and the rotational deformation of the free upper surface. Convection was driven by a system of electrical heaters laid under the (thermally conducting) sloping bottom and led to the production of intense, convective vortices. These were observed to grow in size as each experiment proceeded and led to the development of weak but clear azimuthal jet-like flows, with a radial scale that varied according to the rotation speed of the platform. Detailed analyses reveal that the kinetic energy-weighted radial wavenumber of the zonal jets, kJy, scales quite closely either with the Rhines wavenumber as kJy ≃ 2(βT/2urms)1/2, where urms is the rms total or eddy velocity and βT is the vorticity gradient produced by the sloping topography, or the anisotropy wavenumber as k J y ≃ 1 . 25 ( βT 3 / ɛ ) 1 / 5 , where ɛ is the upscale turbulent energy transfer rate. Jets are primarily produced by the direct quasi-linear action of horizontal Reynolds stresses produced by trains of topographic Rossby waves. The nonlinear production rate of zonal kinetic energy is found to be strongly unsteady, however, with fluctuations of order 10-100 times the amplitude of the mean production rate for all cases considered. The time scale of such fluctuations is found to scale consistently with either an inertial time scale, τ p ˜ 1 . / √{ u r m s β T } , or the Ekman spin-down time scale. Kinetic energy spectra show some evidence for a k-5/3 inertial subrange in the isotropic component, suggestive of a classical Kolmogorov-Batchelor-Kraichnan upscale energy cascade and a steeper spectrum in the zonal mean flow, though not as steep as k-5, as

  15. Polymorphic C-terminal β-Sheet Interactions Determine the Formation of Fibril or Amyloid β-derived Diffusible Ligand-like Globulomer for the Alzheimer Aβ42 Dodecamer*

    PubMed Central

    Ma, Buyong; Nussinov, Ruth


    The relationship between amyloid deposition and cellular toxicity is still controversial. In addition to fibril-forming oligomers, other soluble Aβ forms (amyloid β-derived diffusible ligands (ADDLs)) were also suggested to form and to present different morphologies and mechanisms of toxicity. One ADDL type, the “globulomer,” apparently forms independently of the fibril aggregation pathway. Even though many studies argue that such soluble Aβ oligomers are off fibril formation pathways, they may nonetheless share some structural similarity with protofibrils. NMR data of globulomer intermediates, “preglobulomers,” suggested parallel in-register C-terminal β-sheets, with different N-terminal conformations. Based on experimental data, we computationally investigate four classes of Aβ dodecamers: fibril, fibril oligomer, prefibril/preglobulomer cluster, and globulomer models. Our simulations of the solvent protection of double-layered fibril and globulomer models reproduce experimental observations. Using a single layer Aβ fibril oligomer β-sheet model, we found that the C-terminal β-sheet in the fibril oligomer is mostly curved, preventing it from quickly forming a fibril and leading to its breaking into shorter pieces. The simulations also indicate that β-sheets packed orthogonally could be the most stable species for Aβ dodecamers. The major difference between fibril-forming oligomers and ADDL-like oligomers (globulomers) could be the exposure of Met-35 patches. Although the Met-35 patches are necessarily exposed in fibril-forming oligomers to allow their maturation into fibrils, the Met-35 patches in the globulomer are covered by other residues in the orthogonally packed Aβ peptides. Our results call attention to the possible existence of certain “critical intermediates” that can lead to both seeds and other soluble ADDL-like oligomers. PMID:20847046

  16. Effect of formation and state of interface on joint strength in friction stir spot welding for advanced high strength steel sheets

    NASA Astrophysics Data System (ADS)

    Taniguchi, Koichi; Matsushita, Muneo; Ikeda, Rinsei; Oi, Kenji


    The tensile shear strength and cross tension strength of friction stir spot welded joints were evaluated in the cases of lap joints of 270 N/mm2 grade and 980 N/mm2 grade cold rolled steel sheets with respect to the stir zone area, hardness distribution, and interface condition between the sheets. The results suggested that both the tensile shear strength and cross tension strength were based on the stir zone area and its hardness in both grades of steel. The "hook" shape of the interface also affected the joint strength. However, the joining that occurred across the interfaces had a significant influence on the value of the joint strength in the case of the 270 N/mm2 grade steel.

  17. Glacial landforms on German Bank, Scotian Shelf: evidence for Late Wisconsinan ice-sheet dynamics and implications for the formation of De Geer moraines

    USGS Publications Warehouse

    Todd, Brian J.; Valentine, Page C.; Longva, Oddvar; Shaw, John


    The extent and behaviour of the southeast margin of the Laurentide Ice Sheet in Atlantic Canada is of significance in the study of Late Wisconsinan ice sheet-ocean interactions. Multibeam sonar imagery of subglacial, ice-marginal and glaciomarine landforms on German Bank, Scotian Shelf, provides evidence of the pattern of glacial-dynamic events in the eastern Gulf of Maine. Northwest-southeast trending drumlins and megaflutes dominate northern German Bank. On southern German Bank, megaflutes of thin glacial deposits create a distinct northwest-southeast grain. Lobate regional moraines (>10km long) are concave to the northwest, up-ice direction and strike southwest-northeast, normal to the direction of ice flow. Ubiquitous, overlying De Geer moraines (

  18. Beta experiment

    NASA Technical Reports Server (NTRS)


    A focused laser doppler velocimeter (LDV) system was developed for the measurement of atmospheric backscatter (beta) from aerosols at infrared wavelengths. A Doppler signal generator was used in mapping the coherent sensitive focal volume of a focused LDV system. System calibration data was analyzed during the flight test activity scheduled for the Beta system. These analyses were performed to determine the acceptability of the Beta measurement system's performance.

  19. Enhanced tumor formation in cyclin D1 x transforming growth factor beta1 double transgenic mice with characterization by magnetic resonance imaging.


    Deane, Natasha G; Lee, Haakil; Hamaamen, Jalal; Ruley, Anna; Washington, M Kay; LaFleur, Bonnie; Thorgeirsson, Snorri S; Price, Ronald; Beauchamp, R Daniel


    Transgenic mice that overexpress cyclin D1 protein in the liver develop liver carcinomas with high penetrance. Transforming growth factor beta (TGF-beta) serves as either an epithelial cell growth inhibitor or a tumor promoter, depending on the cellular context. We interbred LFABP-cyclin D1 and Alb-TGF-beta1 transgenic mice to produce cyclin D1/TGF-beta1 double transgenic mice and followed the development of liver tumors over time, characterizing cellular and molecular changes, tumor incidence, tumor burden, and tumor physiology noninvasively by magnetic resonance imaging. Compared with age-matched LFABP-cyclin D1 single transgenic littermates, cyclin D1/TGF-beta1 mice exhibited a significant increase in tumor incidence. Tumor multiplicity, tumor burden, and tumor heterogeneity were higher in cyclin D1/TGF-beta1 mice compared with single transgenic littermates. Characteristics of cyclin D1/TGF-beta1 livers correlated with a marked induction of the peripheral periductal oval cell/stem cell compartment of the liver. A number of cancerous lesions from cyclin D1/TGF-beta1 mice exhibited unique features such as ductal plate malformations and hemorrhagic nodules. Some lesions were contiguous with the severely diseased background liver and, in some cases, replaced the normal architecture of the entire organ. Cyclin D1/TGF-beta1 lesions, in particular, were associated with malignant features such as areas of vascular invasion by hepatocytes and heterogeneous hyperintensity of signal on T2-weighted magnetic resonance imaging. These findings demonstrate that TGF-beta1 promotes stem cell activation and tumor progression in the context of cyclin D1 overexpression in the liver. PMID:14973059

  20. Support vector machines for prediction and analysis of beta and gamma-turns in proteins.


    Pham, Tho Hoan; Satou, Kenji; Ho, Tu Bao


    Tight turns have long been recognized as one of the three important features of proteins, together with alpha-helix and beta-sheet. Tight turns play an important role in globular proteins from both the structural and functional points of view. More than 90% tight turns are beta-turns and most of the rest are gamma-turns. Analysis and prediction of beta-turns and gamma-turns is very useful for design of new molecules such as drugs, pesticides, and antigens. In this paper we investigated two aspects of applying support vector machine (SVM), a promising machine learning method for bioinformatics, to prediction and analysis of beta-turns and gamma-turns. First, we developed two SVM-based methods, called BTSVM and GTSVM, which predict beta-turns and gamma-turns in a protein from its sequence. When compared with other methods, BTSVM has a superior performance and GTSVM is competitive. Second, we used SVMs with a linear kernel to estimate the support of amino acids for the formation of beta-turns and gamma-turns depending on their position in a protein. Our analysis results are more comprehensive and easier to use than the previous results in designing turns in proteins. PMID:15852509

  1. The cytological changes of tobacco zygote and proembryo cells induced by beta-glucosyl Yariv reagent suggest the involvement of arabinogalactan proteins in cell division and cell plate formation

    PubMed Central


    Background In dicotyledonous plant, the first asymmetric zygotic division and subsequent several cell divisions are crucial for proembryo pattern formation and later embryo development. Arabinogalactan proteins (AGPs) are a family of extensively glycosylated cell surface proteins that are thought to have important roles in various aspects of plant growth and development, including embryogenesis. Previous results from our laboratory show that AGPs are concerned with tobacco egg cell fertilization and zygotic division. However, how AGPs interact with other factors involved in zygotic division and proembryo development remains unknown. Results In this study, we used the tobacco in vitro zygote culture system and series of meticulous cell biology techniques to investigate the roles of AGPs in zygote and proembryo cell division. For the first time, we examined tobacco proembryo division patterns detailed to every cell division. The bright-field images and statistical results both revealed that with the addition of an exogenous AGPs inhibitor, beta-glucosyl Yariv (beta-GlcY) reagent, the frequency of aberrant division increased remarkably in cultured tobacco zygotes and proembryos, and the cell plate specific locations of AGPs were greatly reduced after beta-GlcY treatment. In addition, the accumulations of new cell wall materials were also significantly affected by treating with beta-GlcY. Detection of cellulose components by Calcofluor white stain showed that strong fluorescence was located in the newly formed wall of daughter cells after the zygotic division of in vivo samples and the control samples from in vitro culture without beta-GlcY treatment; while there was only weak fluorescence in the newly formed cell walls with beta-GlcY treatment. Immunocytochemistry examination with JIM5 and JIM7 respectively against the low- and high-esterified pectins displayed that these two pectins located in opposite positions of zygotes and proembryos in vivo and the polarity was

  2. Betaxanthin formation and free amino acids in hairy roots of Beta vulgaris var. lutea depending on nutrient medium and glutamate or glutamine feeding.


    Böhm, Hartmut; Mäck, Gisela


    Feeding of amino acids to hairy roots of the yellow beet (Beta vulgaris var. lutea) usually results in the formation of the respective betaxanthins. One exception is (S)-glutamate whose feeding leads to an increase in the betaxanthin vulgaxanthin I (glutamine as amino-acid moiety) instead of vulgaxanthin II (glutamate as amino-acid moiety). To elucidate this phenomenon, hairy roots were cultivated in modified standard medium and (S)-glutamate was fed. Under most nutrient conditions tested, glutamine and vulgaxanthin I in the tissue dominated over glutamate and vulgaxanthin II. Glutamate, opposed to glutamine, was readily metabolized so that its concentration was lower than that of glutamine. Maximum concentrations of glutamate were reached when the activity of glutamine synthetase was low. Even then, however, vulgaxanthin II stayed on a low level. In contrast, the level of vulgaxanthin I increased with increasing concentrations of glutamine in the tissue. Also 4-aminobutyric acid (GABA) was a major amino acid in the hairy roots. Its concentration reached maximum levels when (S)-glutamate, a GABA precursor, was fed, or when sucrose, the C source of the roots, was replaced by glucose. The respective GABA-betaxanthin, however, was hardly detectable. When both (S)-glutamate and glucose were supplied, the GABA concentration exceeded that of all other amino acids. Only then the GABA-betaxanthin could be characterized in small amounts. Interestingly, the level of the main betaxanthin, miraxanthin V, consisting of betalamic acid and dopamine, was most markedly reduced by a replacement of sucrose with glucose. We conclude that the reaction of betalamic acid with glutamate and GABA was considerably lower than with glutamine and dopamine, irrespective of the concentration of the amino acid in the tissue. Possible reasons will be discussed, also with respect to the occurrence of species-specific patterns of betaxanthins. PMID:15231409

  3. Near-earth Thin Current Sheets and Birkeland Currents during Substorm Growth Phase

    SciTech Connect

    Sorin Zaharia; C.Z. Cheng


    Two important phenomena observed during the magnetospheric substorm growth phase are modeled: the formation of a near-Earth (|X| {approx} 9 R{sub E}) thin cross-tail current sheet, as well as the equatorward shift of the ionospheric Birkeland currents. Our study is performed by solving the 3-D force-balance equation with realistic boundary conditions and pressure distributions. The results show a cross-tail current sheet with large current (J{sub {phi}} {approx} 10 nA/m{sup 2}) and very high plasma {beta} ({beta} {approx} 40) between 7 and 10 R{sub E}. The obtained region-1 and region-2 Birkeland currents, formed on closed field lines due to pressure gradients, move equatorward and become more intense (J{sub {parallel}max} {approx} 3 {micro}A/m{sup 2}) compared to quiet times. Both results are in agreement with substorm growth phase observations. Our results also predict that the cross-tail current sheet maps into the ionosphere in the transition region between the region-1 and region-2 currents.

  4. Aggregation of beta-amyloid fragments.


    Meinke, Jan H; Hansmann, Ulrich H E


    The authors study the folding and aggregation of six chains of the beta-amyloid fragment 16-22 using Monte Carlo simulations. While the isolated fragment prefers a helical form at room temperature, in the system of six interacting fragments one observes both parallel and antiparallel beta sheets below a crossover temperature T(x) approximately equal to 420 K. The antiparallel sheets have lower energy and are therefore more stable. Above the nucleation temperature the aggregate quickly dissolves into widely separated, weakly interacting chains. PMID:17212510

  5. MESSENGER and Venus Express Observations of the Near-tail of Venus: Magnetic Flux Transport, Current Sheet Structure, and Flux Rope Formation

    NASA Technical Reports Server (NTRS)

    Slavin, James A.; Boardsen, S. A.; Sarantos, M.; Acuna, M. H.; Anderson, B. J.; Barabash, S.; Benna, M.; Fraenz, M.; Gloeckler, G.; Gold, R. E.; Ho, G. C.; Korth, H.; Krimigis, S. M.; McNutt, R. L., Jr.; Raines, J. M.; Solomon, S. C.; Zhang, T.-L.; Zurbuchen, T. H.


    At 23:08 UT on 5 June 2007 the MESSENGER spacecraft reached its closest approach altitude (338 km) during its second flyby of Venus en route to its 2011 orbit insertion at Mercury. Whereas no measurements were collected during MESSENGER'S first Venus flyby in October 2006, the Magnetometer (MAG) and the Energetic Particle and Plasma Spectrometer (EPPS) operated successfully throughout this second encounter. Venus provides the solar system's best example to date of a solar wind - ionosphere planetary interaction. We present MESSENGER observations of the near-tail of Venus with emphasis on determining the time scales for magnetic flux transport, the structure of the cross-tail current sheet at very low altitudes (approx. 300 to 1000 km), and the nature and origin of a magnetic flux rope observed in the current sheet. The availability of the simultaneous Venus Express upstream measurements provides a unique opportunity to examine the influence of solar wind plasma and interplanetary magnetic field conditions on this planet's solar wind interaction at solar minimum.


    SciTech Connect

    Sjaardema, Greg


    "IO Subsystem Ver. 1.0 Beta" uses standard object-oriented principles to minimize dependencies between the underlying input or output database format and the client code (i.e., Sierra) using the io subsystem. The interface and priciples are simolar to the Facade pattern described in the "Design Patterns" book by Gamma, The software uses data authentication algorithms to ensure data input/output is consistent with model being defined. "IO Subsystem Ver. 1.0 Beta" is a database independent input/output library for finite element analysis, preprocessing, post processing, and translation programs.



    "IO Subsystem Ver. 1.0 Beta" uses standard object-oriented principles to minimize dependencies between the underlying input or output database format and the client code (i.e., Sierra) using the io subsystem. The interface and priciples are simolar to the Facade pattern described in the "Design Patterns" book by Gamma, The software uses data authentication algorithms to ensure data input/output is consistent with model being defined. "IO Subsystem Ver. 1.0 Beta" is a database independent input/outputmore » library for finite element analysis, preprocessing, post processing, and translation programs.« less

  8. Structural Studies of Copper(I) Complexes of Amyloid-Beta Peptide Fragments: Formation of Two-Coordinate Bis(Histidine) Complexes

    SciTech Connect

    Himes, R.A.; Park, G.Young.; Siluvai, G.Sutha.; Blackburn, N.J.; Karlin, K.D.


    The beta bind: Copper(I) binds to amyloid {beta}-peptide fragments (see structure) as a stable bis(histidine), two-coordinate, near-linear complex, even in the presence of potential additional ligands. As has been proposed or assumed in other studies, the copper(I)-peptide complexes react with dioxygen to form the reactive oxygen species H{sub 2}O{sub 2}, without the need for a third histidine ligand to promote the chemistry.

  9. 4,6-O-[1-cyano-2-(2-iodophenyl)ethylidene] acetals. improved second-generation acetals for the stereoselective formation of beta-D-mannopyranosides and regioselective reductive radical fragmentation to beta-D-rhamnopyranosides. scope and limitations.


    Crich, David; Bowers, Albert A


    The [1-cyano-2-(2-iodophenyl)]ethylidene group is introduced as an acetal-protecting group for carbohydrate thioglycoside donors. The group is easily introduced under mild conditions, over short reaction times, and in the presence of a wide variety of other protecting groups by the reaction of the 4,6-diol with triethyl (2-iodophenyl)orthoacetate and camphorsulfonic acid, followed by trimethylsilyl cyanide and boron trifluoride etherate. The new protecting group conveys strong beta-selectivity with thiomannoside donors and undergoes a tin-mediated radical fragmentation to provide high yields of the synthetically challenging beta-rhamnopyranosides. The method is also applicable to the glucopyranosides when high alpha-selectivity is observed in the coupling reaction and alpha-quinovosides are formed selectively in the radical fragmentation step. In the galactopyranoside series, beta-glycosides are formed selectively on coupling to donors protected by the new system, but the radical fragmentation is unselective and gives mixtures of the 4- and 6-deoxy products. Variable-temperature NMR studies for the glycosylation step, which helped define an optimal protocol, are described. PMID:16626126

  10. Maternal antioxidants prevent beta cell apoptosis and promote formation of dual hormone-expressing endocrine cells in male offspring following fetal and neonatal nicotine exposure

    PubMed Central

    BRUIN, Jennifer E; WOYNILLOWICZ, Amanda K; HETTINGA, Bart P; TARNOPOLSKY, Mark A; MORRISON, Katherine M; GERSTEIN, Hertzel C; HOLLOWAY, Alison C


    Aim Fetal and neonatal nicotine exposure causes beta cell oxidative stress and apoptosis in neonates, leading to adult-onset dysglycemia. The goal of this study was to determine whether an antioxidant intervention could prevent nicotine-induced beta cell loss. Methods Nulliparous female Wistar rats received daily subcutaneous injections of either saline or nicotine bitartrate (1.0 mg/kg/d) for 2 weeks prior to mating until weaning. Nicotine-exposed dams received either normal chow or diet containing antioxidants (1000 IU/kg vitamin E, 0.25% w/w coenzyme Q10 and 0.1% w/w alpha-lipoic acid) during mating, pregnancy and lactation; saline-exposed dams received normal chow. Pancreas tissue was collected from male offspring at 3 weeks of age to measure beta cell fraction, apoptosis, proliferation and the presence of cells co-expressing insulin and glucagon. Results The birth weight of the offspring born to nicotine-exposed dams receiving dietary antioxidants was significantly reduced. Most interestingly, the antioxidant intervention to nicotine-exposed dams prevented the beta cell loss and apoptosis observed in nicotine exposed male offspring whose mothers did not receive antioxidants. Male pups born to nicotine-treated mothers receiving antioxidants also had a trend towards increased beta cell proliferation and a significant increase in islets containing insulin/glucagon bi-hormonal cells relative to the other two treatment groups. Conclusion This study demonstrates that exposure to maternal antioxidants protects beta cells from the damaging effects of nicotine thus preserving beta cell mass. PMID:22385833

  11. Effects of oat bran, processed to different molecular weights of beta-glucan, on plasma lipids and caecal formation of SCFA in mice.


    Immerstrand, Tina; Andersson, Kristina E; Wange, Caroline; Rascon, Ana; Hellstrand, Per; Nyman, Margareta; Cui, Steve W; Bergenståhl, Björn; Trägårdh, Christian; Oste, Rickard


    In the present study, we evaluated the cholesterol-lowering effects of different oat bran (OB) preparations, differing regarding their peak molecular weight (MWp) of beta-glucans (2348, 1311, 241, 56, 21 or < 10 kDa), in C57BL/6NCrl mice. The diets were designed to be atherogenic (0.8 % cholesterol and 0.1 % cholic acid), and they reflected the Western diet pattern (41 % energy fat). All OB preparations that were investigated significantly reduced plasma cholesterol when compared with a cellulose-containing control diet, regardless of the molecular weight of beta-glucan. Moreover, the difference in viscous properties between the processed OB (from 0.11 to 17.7 l/g) did not appear to play a major role in the cholesterol-lowering properties. In addition, there was no correlation between the molecular weight of beta-glucan and the amount of propionic acid formed in caecum. Interestingly, however, there was a significant correlation between the ratio of (propionic acid+butyric acid)/acetic acid and the MWp of beta-glucans: the ratio increased with increasing molecular weight. The results of the present study suggest that the molecular weights and viscous properties of beta-glucan in oat products may not be crucial parameters for their cholesterol-lowering effects. PMID:20334710

  12. The magnetohydrodynamics of current sheets

    NASA Technical Reports Server (NTRS)

    Priest, E. R.


    Examples of current sheets are summarized and their formation is described. A universal phenomenon in cosmic plasmas is the creation of sheets off intense current near X-type neutral points (where the magnetic field vanishes). These sheets are important as sites where the magnetic-field energy is converted efficiently into heat and bulk kinetic energy and where particles can be accelerated to high energies. Examples include disruptions in laboratory tokamaks, substorms in the earth's magnetosphere, and flares on the sun. The basic behavior of a one-dimensional sheet is presented, together with an account of the linear tearing-mode instability that can cause the field lines in such a sheet to reconnect. Such reconnection may develop in different ways: it may arise from a spontaneous instability or it may be driven, either from outside by motions or locally by a resistivity enhancement. Various processes are described that may occur during the nonlinear development of tearing, along with the many numerical and laboratory experiments that are aiding our understanding of this intriguing cosmical process.

  13. Experimental Study of Lower-hybrid Drift Turbulence in a Reconnecting Current Sheet

    SciTech Connect

    Carter, T. A.; Yamada, M.; Ji, H.; Kulsrud, R. M.; Trintchouck, F.


    The role of turbulence in the process of magnetic reconnection has been the subject of a great deal of study and debate in the theoretical literature. At issue in this debate is whether turbulence is essential for fast magnetic reconnection to occur in collisionless current sheets. Some theories claim it is necessary in order to provide anomalous resistivity, while others present a laminar fast reconnection mechanism based on the Hall term in the generalized Ohm's law. In this work, a thorough study of electrostatic potential fluctuations in the current sheet of the Magnetic Reconnection Experiment (MRX) [M. Yamada et al., Phys. Plasmas 4, 1936 (1997)] was performed in order to ascertain the importance of turbulence in a laboratory reconnection experiment. Using amplified floating Langmuir probes, broadband fluctuations in the lower hybrid frequency range (fLH approximately 5-15 MHz) were measured which arise with the formation of the current sheet in MRX. The frequency spectrum, spatial amplitude profile, and spatial correlation characteristics of the measured turbulence were examined carefully, finding consistency with theories of the lower-hybrid drift instability (LHDI). The LHDI and its role in magnetic reconnection has been studied theoretically for decades, but this work represents the first detection and detailed study of the LHDI in a laboratory current sheet. The observation of the LHDI in MRX has provided the unique opportunity to uncover the role of this instability in collisionless reconnection. It was found that: (1) the LHDI fluctuations are confined to the low-beta edge of current sheets in MRX; (2) the LHDI amplitude does not correlate well in time or space with the reconnection electric field, which is directly related to the rate of reconnection; and (3) significant LHDI amplitude persists in high collisionality current sheets where the reconnection rate is classical. These findings suggest that the measured LHDI fluctuations do not play an

  14. Electron Diffraction Evidence for the Ordering of Excess Nickel Atoms by Relation to Stoichiometry in Nickel-Rich Beta'-Nial Formation of a Nickel-Aluminum (Ni2al) Superlattices

    NASA Technical Reports Server (NTRS)

    Reynaud, F.


    In electron diffraction patterns of nickel-rich beta-NiAl alloys, many anomalies are observed. One of these is the appearance of diffuse intensity maxima between the reflexions of the B2 structure. This is explained by the short-range ordering of the excess nickel atoms on the simple cubic sublattice occupied only by aluminum atoms in the stoichiometric, perfectly ordered NiAl alloy. After annealing Ni 37.5 atomic percent Al and Ni 37.75 atomic percent Al for 1 week at 300 and 400 C, the diffuse intensity maxima transformed into sharp superstructure reflexions. These reflexions are explained by the formation of the four possible variants of an ordered hexagonal superstructure corresponding to the Ni2Al composition. This structure is closely related to the Ni2Al3 structure (same space group) formed by the ordering of vacancies on the nickel sublattice in aluminum-rich beta-NiAl alloys.

  15. Secondary structure formation in peptide amphiphile micelles

    NASA Astrophysics Data System (ADS)

    Tirrell, Matthew


    Peptide amphiphiles (PAs) are capable of self-assembly into micelles for use in the targeted delivery of peptide therapeutics and diagnostics. PA micelles exhibit a structural resemblance to proteins by having folded bioactive peptides displayed on the exterior of a hydrophobic core. We have studied two factors that influence PA secondary structure in micellar assemblies: the length of the peptide headgroup and amino acids closest to the micelle core. Peptide length was systematically varied using a heptad repeat PA. For all PAs the addition of a C12 tail induced micellization and secondary structure. PAs with 9 amino acids formed beta-sheet interactions upon aggregation, whereas the 23 and 30 residue peptides were displayed in an apha-helical conformation. The 16 amino acid PA experienced a structural transition from helix to sheet, indicating that kinetics play a role in secondary structure formation. A p53 peptide was conjugated to a C16 tail via various linkers to study the effect of linker chemistry on PA headgroup conformation. With no linker the p53 headgroup was predominantly alpha helix and a four alanine linker drastically changed the structure of the peptide headgroup to beta-sheet, highlighting the importance of hydrogen boding potential near the micelle core.

  16. Identification, classification, and analysis of beta-bulges in proteins.

    PubMed Central

    Chan, A. W.; Hutchinson, E. G.; Harris, D.; Thornton, J. M.


    A beta-bulge is a region of irregularity in a beta-sheet involving two beta-strands. It usually involves two or more residues in the bulged strand opposite to a single residue on the adjacent strand. These irregularities in beta-sheets were identified and classified automatically, extending the definition of beta-bulges given by Richardson et al. (Richardson, J.S., Getzoff, E.D., & Richardson, D.C., 1978, Proc. Natl. Acad. Sci. USA 75, 2574-2578). A set of 182 protein chains (170 proteins) was used, and a total of 362 bulges were extracted. Five types of beta-bulges were found: classic, G1, wide, bent, and special. Their characteristic amino acid preferences were found for most classes of bulges. Basically, bulges occur frequently in proteins; on average there are more than two bulges per protein. In general, beta-bulges produce two main changes in the structure of a beta-sheet: (1) disrupt the normal alternation of side-chain direction; (2) accentuate the twist of the sheet, altering the direction of the surrounding strands. PMID:8251933

  17. Thinning of current sheets and magnetic reconnection

    NASA Astrophysics Data System (ADS)

    Singh, N.; Deverapalli, C.

    Using three-dimensional particle-in-cell (3DPIC) simulations, we study the formation of a thin current sheet. The processes associated with thin current sheets reported here include its thinning, associated potential well in its central part, ion acceleration into the well, current-driven ion mode instabilities, electron and ion heating, current sheet re- broadening, current disruption in the central part of the current sheet and magnetic reconnection. It is shown that current driven instabilities become explosive when the preferential heating of electrons by the ions make electron temperature higher than that of the ions. This explosive stage is associated with high plasma resistivity, current disruption and bifurcated current sheets. The current disruption is linked to the magnetic reconnection.

  18. Minimalist design of water-soluble cross-[beta] architecture

    SciTech Connect

    Biancalana, Matthew; Makabe, Koki; Koide, Shohei


    Demonstrated successes of protein design and engineering suggest significant potential to produce diverse protein architectures and assemblies beyond those found in nature. Here, we describe a new class of synthetic protein architecture through the successful design and atomic structures of water-soluble cross-{beta} proteins. The cross-{beta} motif is formed from the lamination of successive {beta}-sheet layers, and it is abundantly observed in the core of insoluble amyloid fibrils associated with protein-misfolding diseases. Despite its prominence, cross-{beta} has been designed only in the context of insoluble aggregates of peptides or proteins. Cross-{beta}'s recalcitrance to protein engineering and conspicuous absence among the known atomic structures of natural proteins thus makes it a challenging target for design in a water-soluble form. Through comparative analysis of the cross-{beta} structures of fibril-forming peptides, we identified rows of hydrophobic residues ('ladders') running across {beta}-strands of each {beta}-sheet layer as a minimal component of the cross-{beta} motif. Grafting a single ladder of hydrophobic residues designed from the Alzheimer's amyloid-{beta} peptide onto a large {beta}-sheet protein formed a dimeric protein with a cross-{beta} architecture that remained water-soluble, as revealed by solution analysis and x-ray crystal structures. These results demonstrate that the cross-{beta} motif is a stable architecture in water-soluble polypeptides and can be readily designed. Our results provide a new route for accessing the cross-{beta} structure and expanding the scope of protein design.

  19. Zika Virus Fact Sheet


    ... 2014 Fact sheets Features Commentaries 2014 Multimedia Contacts Zika virus Fact sheet Updated 6 September 2016 Key facts ... and last for 2-7 days. Complications of Zika virus disease After a comprehensive review of evidence, there ...

  20. Structural Biology Fact Sheet


    ... Home > Science Education > Structural Biology Fact Sheet Structural Biology Fact Sheet Tagline (Optional) Middle/Main Content Area What is structural biology? Structural biology is a field of science focused ...

  1. Mechanism of formation of the C-terminal beta-hairpin of the B3 domain of the immunoglobulin binding protein G from Streptococcus. III. Dynamics of long-range hydrophobic interactions.


    Lewandowska, Agnieszka; Ołdziej, Stanisław; Liwo, Adam; Scheraga, Harold A


    A 20-residue peptide, IG(42-61), derived from the C-terminal beta-hairpin of the B3 domain of the immunoglobulin binding protein G from Streptoccocus was studied using circular dichroism, nuclear magnetic resonance (NMR) spectroscopy at various temperatures and by differential scanning calorimetry (DSC). Unlike other related peptides studied so far, this peptide displays two heat capacity peaks in DSC measurements (at a scanning rate of 1.5 deg/min at a peptide concentration of 0.07 mM), which suggests a three-state folding/unfolding process. The results from DSC and NMR measurements suggest the formation of a dynamic network of hydrophobic interactions stabilizing the structure, which resembles a beta-hairpin shape over a wide range of temperatures (283-313 K). Our results show that IG (42-61) possesses a well-organized three-dimensional structure stabilized by long-range hydrophobic interactions (Tyr50 ... Phe57 and Trp48 ... Val59) at T = 283 K and (Trp48 ... Val59) at 305 and 313 K. The mechanism of beta-hairpin folding and unfolding, as well as the influence of peptide length on its conformational properties, are also discussed. PMID:19847914

  2. MHD Ballooning Instability in the Plasma Sheet

    SciTech Connect

    C.Z. Cheng; S. Zaharia


    Based on the ideal-MHD model the stability of ballooning modes is investigated by employing realistic 3D magnetospheric equilibria, in particular for the substorm growth phase. Previous MHD ballooning stability calculations making use of approximations on the plasma compressibility can give rise to erroneous conclusions. Our results show that without making approximations on the plasma compressibility the MHD ballooning modes are unstable for the entire plasma sheet where beta (sub)eq is greater than or equal to 1, and the most unstable modes are located in the strong cross-tail current sheet region in the near-Earth plasma sheet, which maps to the initial brightening location of the breakup arc in the ionosphere. However, the MHD beq threshold is too low in comparison with observations by AMPTE/CCE at X = -(8 - 9)R(sub)E, which show that a low-frequency instability is excited only when beq increases over 50. The difficulty is mitigated by considering the kinetic effects of ion gyrorad ii and trapped electron dynamics, which can greatly increase the stabilizing effects of field line tension and thus enhance the beta(sub)eq threshold [Cheng and Lui, 1998]. The consequence is to reduce the equatorial region of the unstable ballooning modes to the strong cross-tail current sheet region where the free energy associated with the plasma pressure gradient and magnetic field curvature is maximum.

  3. Conformational preferences of heterochiral peptides. Crystal structures of heterochiral peptides Boc-(D) Val-(D) Ala-Leu-Ala-OMe and Boc-Val-Ala-Leu-(D) Ala-OMe--enhanced stability of beta-sheet through C-H...O hydrogen bonds.


    Fabiola, G F; Bobde, V; Damodharan, L; Pattabhi, V; Durani, S


    The crystal structures of Boc-(D) Val-(D) Ala-Leu-Ala-OMe (vaLA) and Boc-Val-Ala-Leu-(D) Ala-OMe (VALa) have been determined. vaLA crystallises in space group P2(1),2(1),2(1), with a = 9.401 (4), b = 17.253 (5), c = 36.276 (9)A. V = 5,884 (3) A3, Z = 8, R = 0.086. VALa crystallises in space group P2(1) with a = 9.683 (9), b = 17.355 (7), c = 18.187 (9) A, beta = 95.84 (8) degrees , V = 3,040(4) A3, Z = 4, R = 0.125. There are two molecules in the asymmetric unit in antiparallel beta-sheet arrangement in both the structures. Several of the Calpha hydrogens are in hydrogen bonding contact with the carbonyl oxygen in the adjacent strand. An analysis of the observed conformational feature of D-chiral amino acid residues in oligopeptides, using coordinates of 123 crystal structures selected from the 1998 release of CSD has been carried out. This shows that all the residues except D-isoleucine prefer both extended and alphaL conformation though the frequence of occurence may not be equal. In addition to this, D-leucine, valine, proline and phenylalanine have assumed alphaR conformations in solid state. D-leucine has a strong preference for helical conformation in linear peptides whereas they prefer an extended conformation in cyclic peptides. PMID:11245253

  4. In-situ time-of-flight neutron diffraction of ErD2 (beta phase) formation during D2 loading.

    SciTech Connect

    Browning, James Frederick; Llobet, Anna; Snow, Clark Sheldon; Rodriguez, Mark Andrew; Wixom, Ryan R.


    In an effort to better understand the structural changes occurring during hydrogen loading of erbium target materials, we have performed D{sub 2} loading of erbium metal (powder) with simultaneous neutron diffraction analysis. This experiment tracked the conversion of Er metal to the {alpha} erbium deuteride (solid-solution) phase and then on to the {beta} (fluorite) phase. Complete conversion to ErD{sub 2.0} was accomplished at 10 Torr D{sub 2} pressure with deuterium fully occupying the tetrahedral sites in the fluorite lattice. Increased D{sub 2} pressure (up to 500 Torr at 450 C) revealed {approx}10 % deuterium occupation of the octahedral sites. Subsequent vacuum pumping of the sample at 450 C removed octahedral site occupancy while maintaining tetrahedral deuterium occupancy, thereby yielding stoichiometric ErD{sub 2.0} {beta} phase.

  5. Protein Complex of Drosophila ATRX/XNP and HP1a Is Required for the Formation of Pericentric Beta-heterochromatin in Vivo*

    PubMed Central

    Emelyanov, Alexander V.; Konev, Alexander Y.; Vershilova, Elena; Fyodorov, Dmitry V.


    ATRX belongs to the family of SWI2/SNF2-like ATP-dependent nucleosome remodeling molecular motor proteins. Mutations of the human ATRX gene result in a severe genetic disorder termed X-linked α-thalassemia mental retardation (ATR-X) syndrome. Here we perform biochemical and genetic analyses of the Drosophila melanogaster ortholog of ATRX. The loss of function allele of the Drosophila ATRX/XNP gene is semilethal. Drosophila ATRX is expressed throughout development in two isoforms, p185 and p125. ATRX185 and ATRX125 form distinct multisubunit complexes in fly embryo. The ATRX185 complex comprises p185 and heterochromatin protein HP1a. Consistently, ATRX185 but not ATRX125 is highly concentrated in pericentric beta-heterochromatin of the X chromosome in larval cells. HP1a strongly stimulates biochemical activities of ATRX185 in vitro. Conversely, ATRX185 is required for HP1a deposition in pericentric beta-heterochromatin of the X chromosome. The loss of function allele of the ATRX/XNP gene and mutant allele that does not express p185 are strong suppressors of position effect variegation. These results provide evidence for essential biological functions of Drosophila ATRX in vivo and establish ATRX as a major determinant of pericentric beta-heterochromatin identity. PMID:20154359

  6. Formation of gamma'-Ni3Al via the Peritectoid Reaction: gamma plus beta (+Al2O3) equals gamma'(+Al2O3)

    NASA Technical Reports Server (NTRS)

    Copland, Evan


    The activities of Al and Ni were measured using multi-cell Knudsen effusion-cell mass spectrometry (multi-cell KEMS), over the composition range 8 - 32 at.%Al and temperature range T = 1400 - 1750 K in the Ni-Al-O system. These measurements establish that equilibrium solidification of gamma'-Ni3Al-containing alloys occurs by the eutectic reaction, L (+ Al2O3) = gamma + beta (+ Al2O3), at 1640 plus or minus 1 K and a liquid composition of 24.8 plus or minus 0.2 at.%Al (at an unknown oxygen content). The {gamma + beta + Al2O3} phase field is stable over the temperature range 1633 - 1640 K, and gamma'-Ni3Al forms via the peritectiod, gamma + beta (+ Al2O3) = gamma'(+ Al2O3), at 1633 plus or minus 1 K. This behavior is inconsistent with the current Ni-Al phase diagram and a new diagram is proposed. This new Ni-Al phase diagram explains a number of unusual steady state solidification structures reported previously and provides a much simpler reaction scheme in the vicinity of the gamma'-Ni3Al phase field.

  7. Formation of gamma(sup prime)-Ni3Al via the Peritectoid Reaction: gamma + beta (+ Al2O3)=gamma(sup prime)(+ Al2O3)

    NASA Technical Reports Server (NTRS)

    Copeland, Evan


    The activities of Al and Ni were measured using multi-cell Knudsen effusion-cell mass spectrometry (multi-cell KEMS), over the composition range 8-32 at.%Al and temperature range T=1400-1750 K in the Ni-Al-O system. These measurements establish that equilibrium solidification of gamma(sup prime)-Ni3Al-containing alloys occurs by the eutectic reaction, L (+ Al2O3)=gamma + Beta(+ Al2O3), at 1640 +/- 1 K and a liquid composition of 24.8 +/- 0.2 at.%al (at an unknown oxygen content). The {gamma + Beta (+Al2O3} phase field is stable over the temperature range 1633-1640 K, and gamma(sup prime)-Ni3Al forms via the peritectoid, gamma + Beta (+ Al2O3)=gamma(sup prime) (+ Al2O3), at 1633 +/- 1 K. This behavior is consistent with the current Ni-Al phase diagram and a new diagram is proposed. This new Ni-Al phase diagram explains a number of unusual steady-state solidification structures reported previously and provides a much simpler reaction scheme in the vicinity of the gamma(sup prime)-Ni2Al phase field.

  8. Polymerized collagen inhibits fibroblast proliferation via a mechanism involving the formation of a beta1 integrin-protein phosphatase 2A-tuberous sclerosis complex 2 complex that suppresses S6K1 activity.


    Xia, Hong; Nho, Richard; Kleidon, Jill; Kahm, Judy; Henke, Craig A


    Polymerized type I collagen suppresses fibroblast proliferation. Previous studies have implicated inhibition of fibroblast proliferation with polymerized collagen-mediated suppression of S6K1, but the molecular mechanism of the critical negative feedback loop has not yet been fully elucidated. Here, we demonstrate that polymerized collagen suppresses G(1)/S phase transition and fibroblast proliferation by a novel mechanism involving the formation of a beta1 integrin-protein phosphatase 2A (PP2A)-tuberous sclerosis complex 2 (TSC2) complex that represses S6K1 activity. In response to fibroblast interaction with polymerized collagen, beta1 integrin forms a complex with PP2A that targets TSC2 as a substrate. PP2A represses the level of TSC2 phosphorylation and maintains TSC2 in an activated state. Activated TSC2 negatively regulates the downstream kinase S6K1 and inhibits G(1)/S transit. Knockdown of TSC2 enables fibroblasts to overcome the anti-proliferative properties of polymerized collagen. Furthermore, we show that this reduction in TSC2 and S6K1 phosphorylation occurs largely independent of Akt. Although S6K1 activity was markedly suppressed by polymerized collagen, we found that minimal changes in Akt activity occurred. We demonstrate that up-regulation of Akt by overexpression of constitutively active phosphatidylinositol 3-kinase p110 subunit had minor effects on TSC2 and S6K1 phosphorylation. These findings demonstrate that polymerized collagen represses fibroblast proliferation by a mechanism involving the formation of a beta1 integrin-PP2A-TSC2 complex that negatively regulates S6K1 and inhibits G(1)/S phase transition. PMID:18487611

  9. 24 CFR 1710.117 - Cost sheet, signature of Senior Executive Officer.

    Code of Federal Regulations, 2010 CFR


    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Cost sheet, signature of Senior... REGISTRATION Reporting Requirements § 1710.117 Cost sheet, signature of Senior Executive Officer. (a) Cost sheet—Format. (1) The cost sheet shall be prepared in accordance with the following format and...

  10. Expansion of polyglutamine induces the formation of quasi-aggregate in the early stage of protein fibrillization.


    Tanaka, Motomasa; Machida, Yoko; Nishikawa, Yukihiro; Akagi, Takumi; Hashikawa, Tsutomu; Fujisawa, Tetsuro; Nukina, Nobuyuki


    We examined the effects of the expansion of glutamine repeats on the early stage of protein fibrillization. Small-angle x-ray scattering (SAXS) and electron microscopic studies revealed that the elongation of polyglutamine from 35 to 50 repeats in protein induced a large assembly of the protein upon incubation at 37 degrees C and that its formation was completed in approximately 3 h. A bead modeling procedure based on SAXS spectra indicated that the largely assembled species of the protein, quasi-aggregate, is composed of 80 to approximately 90 monomers and a bowl-like structure with long and short axes of 400 and 190 A, respectively. Contrary to fibril, the quasi-aggregate did not show a peak at S = 0.21 A-1 corresponding to the 4.8-A spacing of beta-pleated sheets in SAXS spectra, and reacted with a monoclonal antibody specific to expanded polyglutamine. These results imply that beta-sheets of expanded polyglutamines in the quasi-aggregate are not orderly aligned and are partially exposed, in contrast to regularly oriented and buried beta-pleated sheets in fibril. The formation of non-fibrillary quasi-aggregate in the early phase of fibril formation would be one of the major characteristics of the protein containing an expanded polyglutamine. PMID:12815051

  11. The iA{beta}5p {beta}-breaker peptide regulates the A{beta}(25-35) interaction with lipid bilayers through a cholesterol-mediated mechanism

    SciTech Connect

    Vitiello, Giuseppe; Grimaldi, Manuela; D'Ursi, Anna Maria; D'Errico, Gerardino


    Highlights: Black-Right-Pointing-Pointer iA{beta}5p shows a significant tendency to deeply penetrates the hydrophobic core of lipid membrane. Black-Right-Pointing-Pointer A{beta}(25-35) locates in the external region of the membrane causing a re-positioning of CHOL. Black-Right-Pointing-Pointer iA{beta}5p withholds cholesterol in the inner hydrophobic core of the lipid membrane. Black-Right-Pointing-Pointer iA{beta}5p prevents the A{beta}(25-35) release from the lipid membrane. -- Abstract: Alzheimer's disease is characterized by the deposition of aggregates of the {beta}-amyloid peptide (A{beta}) in the brain. A potential therapeutic strategy for Alzheimer's disease is the use of synthetic {beta}-sheet breaker peptides, which are capable of binding A{beta} but unable to become part of a {beta}-sheet structure, thus inhibiting the peptide aggregation. Many studies suggest that membranes play a key role in the A{beta} aggregation; consequently, it is strategic to investigate the interplay between {beta}-sheet breaker peptides and A{beta} in the presence of lipid bilayers. In this work, we focused on the effect of the {beta}-sheet breaker peptide acetyl-LPFFD-amide, iA{beta}5p, on the interaction of the A{beta}(25-35) fragment with lipid membranes, studied by Electron Spin Resonance spectroscopy, using spin-labeled membrane components (either phospholipids or cholesterol). The ESR results show that iA{beta}5p influences the A{beta}(25-35) interaction with the bilayer through a cholesterol-mediated mechanism: iA{beta}5p withholds cholesterol in the inner hydrophobic core of the bilayer, making the interfacial region more fluid and capable to accommodate A{beta}(25-35). As a consequence, iA{beta}5p prevents the A{beta}(25-35) release from the lipid membrane, which is the first step of the {beta}-amyloid aggregation process.

  12. Cosuppression of the alpha subunits of beta-conglycinin in transgenic soybean seeds induces the formation of endoplasmic reticulum-derived protein bodies.


    Kinney, A J; Jung, R; Herman, E M


    The expression of the alpha and alpha' subunits of beta-conglycinin was suppressed by sequence-mediated gene silencing in transgenic soybean seed. The resulting seeds had similar total oil and protein content and ratio compared with the parent line. The decrease in beta-conglycinin protein was apparently compensated by an increased accumulation of glycinin. In addition, proglycinin, the precursor of glycinin, was detected as a prominent polypeptide band in the protein profile of the transgenic seed extract. Electron microscopic analysis and immunocytochemistry of maturing transgenic soybean seeds indicated that the process of storage protein accumulation was altered in the transgenic line. In normal soybeans, the storage proteins are deposited in pre-existing vacuoles by Golgi-derived vesicles. In contrast, in transgenic seed with reduced beta-conglycinin levels, endoplasmic reticulum (ER)-derived vesicles were observed that resembled precursor accumulating-vesicles of pumpkin seeds and the protein bodies accumulated by cereal seeds. Their ER-derived membrane of the novel vesicles did not contain the protein storage vacuole tonoplast-specific protein alpha-TIP, and the sequestered polypeptides did not contain complex glycans, indicating a preGolgi and nonvacuolar nature. Glycinin was identified as a major component of these novel protein bodies and its diversion from normal storage protein trafficking appears to be related to the proglycinin buildup in the transgenic seed. The stable accumulation of proteins in a protein body compartment instead of vacuolar accumulation of proteins may provide an alternative intracellular site to sequester proteins when soybeans are used as protein factories. PMID:11340189

  13. Silver ion high pressure liquid chromatography provides unprecedented separation of sterols: application to the enzymatic formation of cholesta-5,8-dien-3 beta-ol.

    PubMed Central

    Ruan, B; Shey, J; Gerst, N; Wilson, W K; Schroepfer, G J


    We report that silver ion HPLC provides remarkable separations of C27 sterols differing only in the number or location of olefinic double bonds. This technique has been extended to LC-MS, analysis of purified components by GC, GC-MS, and 1H NMR, and to its use on a semipreparative scale. The application of this methodology for the demonstration of the catalysis, by rat liver microsomes, of the conversion of 7-dehydrocholesterol to cholesta-5,8-dien-3 beta-ol is also presented. PMID:8876182

  14. Effect of β-sheet propensity on peptide aggregation

    NASA Astrophysics Data System (ADS)

    Bellesia, Giovanni; Shea, Joan-Emma


    The effect of β-sheet propensity on the structural features of peptide aggregates was investigated using an off-lattice coarse-grained peptide model. A phase diagram as a function of temperature and β-sheet propensity reveals a diverse family of supramolecular assemblies. Highly rigid peptides (peptides with high β-sheet propensity) are seen to assemble predominantly into fibrillar structures. Increasing the flexibility of the peptide (reducing β-sheet propensity) leads to a variety of structures, including fibrils, β-barrel structures, and amorphous aggregates. Nonfibrillar entities have been suggested as primary causative agents in amyloid diseases and our simulations indicate that mutations that decrease β-sheet propensity will decrease fibril formation and favor the formation of such toxic oligomers. Parallels between β-sheet aggregates and nematic liquid crystals are discussed.

  15. W-Band Sheet Beam Klystron Design

    SciTech Connect

    Scheitrum, G.; Caryotakis, G.; Burke, A.; Jensen, A.; Jongewaard, E.a Krasnykh, A.; Neubauer, M.; Phillips, R.; Rauenbuehler, K.; /SLAC


    Sheet beam devices provide important advantages for very high power, narrow bandwidth RF sources like accelerator klystrons [1]. Reduced current density and increased surface area result in increased power capabi1ity, reduced magnetic fields for focusing and reduced cathode loading. These advantages are offset by increased complexity, beam formation and transport issues and potential for mode competition in the ovennoded cavities and drift tube. This paper will describe the design issues encountered in developing a 100 kW peak and 2 kW average power sheet beam k1ystron at W-band including beam formation, beam transport, circuit design, circuit fabrication and mode competition.

  16. Perforating Thin Metal Sheets

    NASA Technical Reports Server (NTRS)

    Davidson, M. E.


    Sheets only few mils thick bonded together, punched, then debonded. Three-step process yields perforated sheets of metal. (1): Individual sheets bonded together to form laminate. (2): laminate perforated in desired geometric pattern. (3): After baking, laminate separates into individual sheets. Developed for fabricating conductive layer on blankets that collect and remove ions; however, perforated foils have other applications - as conductive surfaces on insulating materials; stiffeners and conductors in plastic laminates; reflectors in antenna dishes; supports for thermal blankets; lightweight grille cover materials; and material for mockup of components.

  17. Structure of beta-crystallite assemblies formed by Alzheimer beta-amyloid protein analogues: analysis by x-ray diffraction.

    PubMed Central

    Inouye, H.; Fraser, P. E.; Kirschner, D. A.


    To elucidate the relation between amyloid fibril formation in Alzheimer disease and the primary structure of the beta/A4 protein, which is the major component of the amyloid, we have been investigating the ability of peptides sharing sequences with beta/A4 to form fibrils in vitro. In previous studies we focused on the macroscopic morphology of the assemblies formed by synthetic peptides corresponding in sequence to different regions of this protein. In the present study we analyze the x-ray diffraction patterns obtained from these assemblies. All specimens showed wide angle reflections that could be indexed by an orthogonal lattice of beta-crystallites having unit cell dimensions a = 9.4 A, b = 7 A, and c = 10 A, where a refers to hydrogen bonding direction, b to polypeptide chain direction, and c to intersheet direction. Given the amino acid sequence of beta/A4 as NH2-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT-COOH, we found that, based on their orientation and assembly, the analogues could be classified into three groups: Group A, residues 19-28, 13-28, 12-28, 11-28, 9-28, 1-28, 1-38, 1-40, 6-25, 11-25 and 34-42; Group B, residues 18-28, 17-28, and 15-28; and Group C, residues 22-35 and 26-33. For Groups A and C, the sharpest reflections were (h00), indicating that the assemblies were fibrillar, i.e., elongated in a single direction. Lateral alignment of the crystallites in Group A account for its cross-beta pattern, in which the hydrogen bonding (H-bonding) direction is the fiber (rotation) axis. By comparison, the beta-crystallites of Group C had no preferential orientation, thus giving circular scattering. For Group B, the sharpest reflections were (h0l) on the meridian, indicating that the assemblies were plate-like, i.e., extended in two directions. A series of equatorial Bragg reflections having a 40 A period indicated regular stacking of the plates, and the rotation axis was normal to the surface of the plates. Of the Group A peptides, the analogues 11

  18. Ellagic acid promotes A{beta}42 fibrillization and inhibits A{beta}42-induced neurotoxicity

    SciTech Connect

    Feng, Ying; Yang, Shi-gao; Du, Xue-ting; Zhang, Xi; Sun, Xiao-xia; Zhao, Min; Sun, Gui-yuan; Liu, Rui-tian


    Smaller, soluble oligomers of {beta}-amyloid (A{beta}) play a critical role in the pathogenesis of Alzheimer's disease (AD). Selective inhibition of A{beta} oligomer formation provides an optimum target for AD therapy. Some polyphenols have potent anti-amyloidogenic activities and protect against A{beta} neurotoxicity. Here, we tested the effects of ellagic acid (EA), a polyphenolic compound, on A{beta}42 aggregation and neurotoxicity in vitro. EA promoted A{beta} fibril formation and significant oligomer loss, contrary to previous results that polyphenols inhibited A{beta} aggregation. The results of transmission electron microscopy (TEM) and Western blot displayed more fibrils in A{beta}42 samples co-incubated with EA in earlier phases of aggregation. Consistent with the hypothesis that plaque formation may represent a protective mechanism in which the body sequesters toxic A{beta} aggregates to render them harmless, our MTT results showed that EA could significantly reduce A{beta}42-induced neurotoxicity toward SH-SY5Y cells. Taken together, our results suggest that EA, an active ingredient in many fruits and nuts, may have therapeutic potential in AD.

  19. Formability of type 304 stainless steel sheet

    SciTech Connect

    Coubrough, G.J.; Matlock, D.K.; VanTyne, C.J.


    Punch-stretch tests to determine formability of type 304 stainless steel sheet were conducted using a hemispherical dome test. Sheets of 19.1 mm width and 177.8 mm width were stretched on a 101.6 mm diameter punch at punch rates between 0.042 to 2.12 mm/s with three lubricant systems: a mineral seal oil, thin polytetrafluoroethelyne sheet with mineral seal oil, and silicone rubber with mineral seal oil. The resulting strain distributions were measured and the amount of martensite was determined by magnetic means. Increasing lubricity resulted in more uniform strain distributions while increased punch rates tended to decrease both strain and transformation distributions. High forming limit values were related to the formation of high and uniformly distributed martensite volume fractions during deformation. The results of this study are interpreted with an analysis of the effects of strain and temperature on strain induced martensite formation in metastable austenitic stainless steels.

  20. Formability of type 304 stainless steel sheet

    SciTech Connect

    Coubrough, G.J. . Rocky Flats Plant); Matlock, D.K.; VanTyne, C.J. )


    Punch-stretch tests to determine formability of type 304 stainless steel sheet were conducted using a hemispherical dome test. Sheets of 19.1 mm width and 177.8 mm width were stretched on a 101.6 mm diameter punch at punch rates between 0.042 to 2.12 mm/s with three lubricant systems: a mineral seal oil, thin polytetrafluoroethelyne sheet with mineral seal oil, and silicone rubber with mineral seal oil. The resulting strain distributions were measured and the amount of martensite was determined by magnetic means. Increasing lubricity resulted in more uniform strain distributions while increased punch rates tended to decrease both strain and transformation distributions. High forming limit values were related to the formation of high and uniformly distributed martensite volume fractions during deformation. The results of this study are interpreted with an analysis of the effects of strain and temperature on strain induced martensite formation in metastable austenitic stainless steels.

  1. Effects of increased anionic charge in the beta-globin chain on assembly of hemoglobin in vitro.


    Adachi, K; Yamaguchi, T; Pang, J; Surrey, S


    Studies on assembly in vitro of alpha-globin chains with recombinant beta16 Gly-->Asp, beta95 Lys-->Glu, beta120 Lys-->Glu and beta16 Gly-->Asp, 120 Lys-->Glu human beta-globin chain variants in addition to human betaA- and betaS-globin chains were performed to evaluate effects of increased anionic charge in the beta chain on hemoglobin assembly using soluble recombinant beta-globin chains expressed in bacteria. A beta112 Cys-->Asp change was also engineered to monitor effects on assembly of increased negative charge at alpha1beta1 interaction sites. Order of tetramer formation in vitro under limiting alpha-globin chain conditions showed Hb betaG16D, K120E = Hb betaK120E = Hb betaK95E > Hb betaG16D > Hb A > Hb S > Hb betaC112D. In addition, beta112 Cys-->Asp chains exist as monomers rather than beta4 tetramers in the absence of alpha chains, and the beta chain in Hb betaC112D tetramers was readily exchanged by addition of betas. These results suggest that affinity between alpha and beta chains is promoted by negatively-charged beta chains up to a maximum of two additional net negative charges and is independent of location on the surface except at the alpha1beta1 interaction site. In addition, our findings show that beta112 Cys on the G helix is critical for facilitating formation of stable alphabeta dimers, which then form functional hemoglobin tetramers, and that beta112 Cys-->Asp inhibits formation of stable alpha1beta1 and beta1beta2 interactions in alpha2beta2 and beta4 tetramers, respectively. PMID:9454775

  2. Quasihomogeneous nucleation of amyloid beta yields numerical bounds for the critical radius, the surface tension, and the free energy barrier for nucleus formation

    NASA Astrophysics Data System (ADS)

    Garai, K.; Sahoo, B.; Sengupta, P.; Maiti, S.


    Amyloid aggregates are believed to grow through a nucleation mediated pathway, but important aggregation parameters, such as the nucleation radius, the surface tension of the aggregate, and the free energy barrier toward aggregation, have remained difficult to measure. Homogeneous nucleation theory, if applicable, can directly relate these parameters to measurable quantities. We employ fluorescence correlation spectroscopy to measure the particle size distribution in an aggregating solution of Alzheimer's amyloid beta molecule (Aβ1-40) and analyze the data from a homogeneous nucleation theory perspective. We observe a reproducible saturation concentration and a critical dependence of various aspects of the aggregation process on this saturation concentration, which supports the applicability of the nucleation theory to Aβ aggregation. The measured size distributions show a valley between two peaks ranging from 5to50nm, which defines a boundary for the value of the nucleation radius. By carefully controlling the conditions to inhibit heterogeneous nucleation, we can hold off nucleation in a 25 times supersaturated solution for at least up to 3h at room temperature. This quasi-homogeneous kinetics implies that at room temperature, the surface energy of the Aβ /water interface is ⩾4.8mJ/m2, the free energy barrier to nucleation (at 25 times supersaturation) is ⩾1.93×10-19J, and the number of monomers in the nucleus is ⩾29.

  3. Current status of liquid sheet radiator research

    NASA Technical Reports Server (NTRS)

    Chubb, Donald L.; Calfo, Frederick D.; Mcmaster, Matthew S.


    Initial research on the external flow, low mass liquid sheet radiator (LSR), has been concentrated on understanding its fluid mechanics. The surface tension forces acting at the edges of the sheet produce a triangular planform for the radiating surface of width, W, and length, L. It has been experimentally verified that (exp L)/W agrees with the theoretical result, L/W = (We/8)exp 1/2, where We is the Weber number. Instability can cause holes to form in regions of large curvature such as where the edge cylinders join the sheet of thickness, tau. The W/tau limit that will cause hole formation with subsequent destruction of the sheet has yet to be reached experimentally. Although experimental measurements of sheet emissivity have not yet been performed because of limited program scope, calculations of the emissivity and sheet lifetime is determined by evaporation losses were made for two silicon based oils; Dow Corning 705 and Me(sub 2). Emissivities greater than 0.75 are calculated for tau greater than or equal to 200 microns for both oils. Lifetimes for Me(sub 2) are much longer than lifetimes for 705. Therefore, Me(sub 2) is the more attractive working fluid for higher temperatures (T greater than or equal to 400 K).

  4. Nuclear Data Sheets for A = 193

    SciTech Connect

    Achterberg, E.; Capurro, O.A.; Marti, G.V.; Vanin, V.R.; Castro, R.M.


    The present revision of the properties for the nuclides belonging to the A = 193 mass chain contains many improvements, corrections and additions to the material presented in previous evaluations (1998Ar07, Nucl. Data Sheets 83, 921 (1998); 1990Sh30, Nucl, Data Sheets 61, 519 (1990)). Among these are measurement results for quadrupole moments, angular distribution coefficients, half-lives and g-factors, for both previously known and new transitions and levels. In addition, major changes to the previously known status of this mass chain consist in the inclusion of data for new superdeformed bands in {sup 193}Pb, and the creation of level schemes for {sup 193}Bi, {sup 193}Po and {sup 193}At. The latter were previously unavailable, except for a very limited attempt in the case of {sup 193}Po, which was not confirmed in later work. Furthermore, the {sup 193}Os beta decay was re-evaluated in order to account for new absolute intensity measurements.

  5. Emittance Measurements for a Thin Liquid Sheet Flow

    NASA Technical Reports Server (NTRS)

    Englehart, Amy N.; McConley, Marc W.; Chubb, Donald L.


    The Liquid Sheet Radiator (LSR) is an external flow radiator that uses a triangular-shaped flowing liquid sheet as the radiating surface. It has potentially much lower mass than solid wall radiators such as pumped loop and heat pipe radiators, along with being nearly immune to micrometeoroid penetration. The LSR has an added advantage of simplicity. Surface tension causes a thin (100-300 microns) liquid sheet to coalesce to a point, causing the sheet flow to have a triangular shape. Such a triangular sheet is desirable since it allows for simple collection of the flow at a single point. A major problem for all external flow radiators is the requirement that the working fluid be of very low (approx. 10(sup -8) torr) vapor pressure to keep evaporative losses low. As a result, working fluids are limited to certain oils (such as used in diffusion pumps) for low temperatures (300-400 K) and liquid metals for higher temperatures. Previous research on the LSR has been directed at understanding the fluid mechanics of thin sheet flows and assessing the stability of such flows, especially with regard to the formation of holes in the sheet. Taylor studied extensively the stability of thin liquid sheets both theoretically and experimentally. He showed that thin sheets in a vacuum are stable. The latest research has been directed at determining the emittance of thin sheet flows. The emittance was calculated from spectral transmittance data for the Dow Corning 705 silicone oil. By experimentally setting up a sheet flow, the emittance was also determined as a function of measurable quantities, most importantly, the temperature drop between the top of the sheet and the temperature at the coalescence point of the sheet. Temperature fluctuations upstream of the liquid sheet were a potential problem in the analysis and were investigated.

  6. In-situ Pb isotope analysis of Fe-Ni-Cu sulphides by laser ablation multi-collector ICPMS: New insights into ore formation in the Sudbury impact melt sheet

    NASA Astrophysics Data System (ADS)

    Darling, J. R.; Storey, C. D.; Hawkesworth, C. J.; Lightfoot, P. C.


    Laser-ablation (LA) multi-collector inductively coupled plasma mass spectrometry (MC-ICPMS) is ideally suited to in situ determination of isotope ratios in sulphide minerals. Using samples of magmatic sulphide ore from the Sudbury impact structure, we test LA-MC-ICPMS analytical protocols that aim to meet a range of analytical challenges in the analysis of Pb isotopes. These include: potential matrix sensitive isotopic fractionation; interferences on Pb isotopes; low melting points of many sulphide minerals; the availability of standards. Magmatic sulphides of wide ranging mineralogy (pyrrhotite, pentlandite, chalcopyrite, pyrite and sphalerite) were analysed for Pb isotopic composition, using the silicate glass NIST SRM 610 as an external standard to correct for instrumental mass-fractionation. Despite matrix sensitive melting and re-deposition around ablation pits, several lines of evidence indicate that all analyses are accurate, within typical analytical uncertainties of 0.003-2% (2σ), and that the defined approach is insensitive to compositional diversity in sample matrix: (a) laser ablation and dissolution based measurements of sulphide powders are in agreement; (b) analyses from each sample define isochron ages within uncertainty of the known crystallization age (1850 Ma); (c) the results of sulphide measurements by laser ablation are consistent with age-corrected feldspar analyses from the same samples. The results have important implications for ore formation in Sudbury. The Pb isotope data regressions are consistent with age corrected feldspar analyses from each respective sample, which together with time integrated Th/U ratios that match whole rock values (3.1, 4.0 and 6.1 for the Worthington, Copper Cliff and Parkin Offset Dykes, respectively) indicate chemical equilibrium between the silicate and sulphide systems during ore formation. The sulphides within each respective sample have indistinguishable model initial Pb isotope ratios (207Pb/204Pbm

  7. Beta structures of alternating polypeptides and their possible prebiotic significance

    NASA Technical Reports Server (NTRS)

    Brack, A.; Orgel, L. E.


    A survey of the commonest amino acids formed in prebiotic conditions suggests that the earliest form of genetic coding may have specified polypeptides with a strong tendency to form stable beta-sheet structures. Poly(Val-Lys), like other polypeptides in which hydrophobic and hydrophilic residues alternate, tends to form beta structures. It is shown that bilayers with a hydrophobic interior and a hydrophilic exterior may be present in aqueous solution.

  8. An electron-microscope study of beta-glucuronidase crystals.

    PubMed Central

    Dickson, M R; Stewart, M; Hawley, D E; Marsh, C A


    beta-Glucuronidase from rat preputial glands was crystallized as thin sheets having p6 symmetry in projection with a equal 20.2nm. A filtered image was produced by Fourier methods to a resolution of 2.2 nm by averaging information from six areas. This suggests an approximately triangular molecular outline in projection, and this is taken to indicate a probable tetrahedral arrangement of the four subunits of the beta-glucuronidase molecule. Images PLATE 1 PMID:486146

  9. Interhemispheric ice-sheet synchronicity during the last glacial maximum

    USGS Publications Warehouse

    Weber, M.E.; Clark, P.U.; Ricken, W.; Mitrovica, J.X.; Hostetler, S.W.; Kuhn, G.


    The timing of the last maximum extent of the Antarctic ice sheets relative to those in the Northern Hemisphere remains poorly understood. We develop a chronology for the Weddell Sea sector of the East Antarctic Ice Sheet that, combined with ages from other Antarctic ice-sheet sectors, indicates that the advance to and retreat from their maximum extent was within dating uncertainties synchronous with most sectors of Northern Hemisphere ice sheets. Surface climate forcing of Antarctic mass balance would probably cause an opposite response, whereby a warming climate would increase accumulation but not surface melting. Our new data support teleconnections involving sea-level forcing from Northern Hemisphere ice sheets and changes in North Atlantic deep-water formation and attendant heat flux to Antarctic grounding lines to synchronize the hemispheric ice sheets.

  10. Silicon sheet technologies

    SciTech Connect

    Ciszek, T.F.


    A classification of silicon sheet growth methods by meniscus geometry permits them to be discussed in three groups: short meniscus techniques, high meniscus techniques, and extended meniscus or large solid/liquid interface area techniques. A second parameter, meniscus shaper interaction with the liquid silicon, is also instrumental in determining the characteristics of the various sheet processes. The current status of each process is discussed in the context of meniscus geometry and shaper/melt interaction. One aspect of sheet growth, surface area generation rate, is quantitatively compared with combined ingot growth and wafering surface area generation rates.

  11. Microcomponent sheet architecture


    Wegeng, R.S.; Drost, M.K..; McDonald, C.E.


    The invention is a microcomponent sheet architecture wherein macroscale unit processes are performed by microscale components. The sheet architecture may be a single laminate with a plurality of separate microcomponent sections or the sheet architecture may be a plurality of laminates with one or more microcomponent sections on each laminate. Each microcomponent or plurality of like microcomponents perform at least one unit operation. A first laminate having a plurality of like first microcomponents is combined with at least a second laminate having a plurality of like second microcomponents thereby combining at least two unit operations to achieve a system operation. 14 figs.

  12. Microcomponent sheet architecture


    Wegeng, Robert S.; Drost, M. Kevin; McDonald, Carolyn E.


    The invention is a microcomponent sheet architecture wherein macroscale unit processes are performed by microscale components. The sheet architecture may be a single laminate with a plurality of separate microcomponent sections or the sheet architecture may be a plurality of laminates with one or more microcomponent sections on each laminate. Each microcomponent or plurality of like microcomponents perform at least one unit operation. A first laminate having a plurality of like first microcomponents is combined with at least a second laminate having a plurality of like second microcomponents thereby combining at least two unit operations to achieve a system operation.

  13. Forced crumpling of self-avoiding elastic sheets

    NASA Astrophysics Data System (ADS)

    Vliegenthart, G. A.; Gompper, G.


    Thin elastic sheets are important materials across length scales ranging from mesoscopic (polymerized membranes, clay platelets, virus capsids) to macroscopic (paper, metal foils). The crumpling of such sheets by external forces is characterized by the formation of a complex pattern of folds. We have investigated the role of self-avoidance, the fact that the sheets cannot self-intersect, for the crumpling process by large-scale computer simulations. At moderate compression, the force-compression relations of crumpled sheets for both self-avoiding and phantom sheets are found to obey universal power-law behaviours. However, self-avoiding sheets are much stiffer than phantom sheets and, for a given compression, develop many more folds. Moreover, self-avoidance is relevant already at very small volume fractions. The fold-length distribution for crumpled sheets is determined, and is found to be well-described by a log-normal distribution. The stiffening owing to self-avoidance is reflected in the changing nature of the sheet-to-sheet contacts from line-like to two-dimensionally extended with increasing compression.

  14. Avian Fact Sheet

    SciTech Connect

    NWCC Wildlife Work Group


    OAK-B135 After conducting four national research meetings, producing a document guiding research: Metrics and Methods for Determining or Monitoring Potential Impacts on Birds at Existing and Proposed Wind Energy Sites, 1999, and another paper, Avian Collisions with Wind Turbines: A Summary of Existing Studies and Comparisons to Other Sources of Avian Collision Mortality in the United States, 2001, the subcommittee recognized a need to summarize in a short fact sheet what is known about avian-wind interaction and what questions remain. This fact sheet attempts to summarize in lay terms the result of extensive discussion about avian-wind interaction on land. This fact sheet does not address research conducted on offshore development. This fact sheet is not intended as a conclusion on the subject; rather, it is a summary as of Fall/Winter 2002.

  15. Cerebral Aneurysms Fact Sheet


    ... Awards Enhancing Diversity Find People About NINDS Cerebral Aneurysms Fact Sheet See a list of all NINDS ... I get more information? What is a cerebral aneurysm? A cerebral aneurysm (also known as an intracranial ...

  16. Sheet electron beam tester

    NASA Astrophysics Data System (ADS)

    Spear, Alexander Grenbeaux

    The DARPA HiFIVE project uses a pulsed electron sheet beam gun to power a traveling wave tube amplifier operating at 220 GHz. Presented is a method for characterizing the high current density 0.1 mm by 1 mm sheet electron beam. A tungsten tipped probe was scanned through the cross section of the sheet electron beam inside of a vacuum vessel. The probe was controlled with sub-micron precision using stepper motors and LabView computer control while boxcar averaging hardware sampled the pulsed beam. Matlab algorithms were used to interpret the data, calculate beam dimensions and current density, and create 2-dimensional cross section images. Full characterization of two separate HiFIVE sheet electron guns was accomplished and is also presented.

  17. Global ice sheet modeling

    SciTech Connect

    Hughes, T.J.; Fastook, J.L.


    The University of Maine conducted this study for Pacific Northwest Laboratory (PNL) as part of a global climate modeling task for site characterization of the potential nuclear waste respository site at Yucca Mountain, NV. The purpose of the study was to develop a global ice sheet dynamics model that will forecast the three-dimensional configuration of global ice sheets for specific climate change scenarios. The objective of the third (final) year of the work was to produce ice sheet data for glaciation scenarios covering the next 100,000 years. This was accomplished using both the map-plane and flowband solutions of our time-dependent, finite-element gridpoint model. The theory and equations used to develop the ice sheet models are presented. Three future scenarios were simulated by the model and results are discussed.

  18. Polarised light sheet tomography.


    Reidt, Sascha L; O'Brien, Daniel J; Wood, Kenneth; MacDonald, Michael P


    The various benefits of light sheet microscopy have made it a widely used modality for capturing three-dimensional images. It is mostly used for fluorescence imaging, but recently another technique called light sheet tomography solely relying on scattering was presented. The method was successfully applied to imaging of plant roots in transparent soil, but is limited when it comes to more turbid samples. This study presents a polarised light sheet tomography system and its advantages when imaging in highly scattering turbid media. The experimental configuration is guided by Monte Carlo radiation transfer methods, which model the propagation of a polarised light sheet in the sample. Images of both reflecting and absorbing phantoms in a complex collagenous matrix were acquired, and the results for different polarisation configurations are compared. Focus scanning methods were then used to reduce noise and produce three-dimensional reconstructions of absorbing targets. PMID:27409945

  19. Cereal beta-glucans

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Cereal beta-glucans occur predominantly in oats and barley, but can be found in other cereals. Beta-glucan structure is a mixture of single beta-1,3-linkages and consecutive beta-1,4-linkages, and cellotriosyl and cellotetraosyl units typically make up 90-95% of entire molecule. Lichenase can hydr...

  20. Energy information sheets

    SciTech Connect


    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  1. Biodiesel Basics (Fact Sheet)

    SciTech Connect

    Not Available


    This fact sheet provides a brief introduction to biodiesel, including a discussion of biodiesel blends, which blends are best for which vehicles, where to buy biodiesel, how biodiesel compares to diesel fuel in terms of performance, how biodiesel performs in cold weather, whether biodiesel use will plug vehicle filters, how long-term biodiesel use may affect engines, biodiesel fuel standards, and whether biodiesel burns cleaner than diesel fuel. The fact sheet also dismisses the use of vegetable oil as a motor fuel.

  2. Current sheet model

    NASA Technical Reports Server (NTRS)


    The model of a rectenna based on the current sheet equivalency of a large planar array is described. The model is mathematically characterized by expression for the fraction of the incident plane wave that is reflected from the sheet. The model is conceptually justified for normal incidence by comparing it to the waveguide model in which evanescent modes, present as beyond and cutoff, correspond to the near field components which become negligible at any significant distance from the antenna array.

  3. A comparison of two different methods for formation of the beta phase in nanocomposites based on vinylidene fluoride-hexafluoropropylene copolymer

    NASA Astrophysics Data System (ADS)

    Borisova, Lyudmila; Kiryakova, Dimitrina; Atanassov, Atanas


    Nanocomposite materials based on vinylidene fluoride-hexafluoropropylene copolymer and organically modified montmorillonite Cloisite®15A were prepared by two different methods: melt mixing and co-precipitation. The changes taking place in crystalline structure, tensile strength, thermal behavior and the formation of piezoelectric b-phase as a result of the polymer system dissolution in dimethyl sulfoxide were studied. The technological specificity of each method has certain effect on the properties of the obtained nanocomposites. The highest content of b-phase — 95 % was achieved by co-precipitation from the solution of vinylidene fluoride-hexafluoropropylene copolymer in dimethyl sulfoxide and 6 mass % content of Cloisite®15A. Despite the common view that the use of solvents and prolonged technological procedure lead to overall higher expenses, the obtained nanocomposites could be promising for the preparation of new piezo-materials.

  4. Can prominences form in current sheets

    NASA Technical Reports Server (NTRS)

    Malherbe, J. M.; Forbes, T. G.


    Two-dimensional numerical simulations of the formation of cold condensations in a vertical current sheet have been performed using the radiative, resistive MHD equations with line-tied boundary conditions at one end of the sheet. Prominence-like condensations are observed to appear above and below an X-line produced by the onset of the tearing-mode instability. Cooling in the sheet is initiated by Ohmic decay, with the densest condensations occurring in the region downstream of a fast-mode shock. This shock, which is due to the line-tied boundary conditions, terminates one of the two supermagnetosonic reconnection jets that develop when the tearing is fully developed. The condensation properties of shock waves, which may trigger or considerably enhance the conditions for thermal condensation are emphasized.

  5. Mechanism of inactivation of alanine racemase by beta, beta, beta-trifluoroalanine

    SciTech Connect

    Faraci, W.S.; Walsh, C.T.


    The alanine racemases are a group of PLP-dependent bacterial enzymes that catalyze the racemization of alanine, providing D-alanine for cell wall synthesis. Inactivation of the alanine racemases from the Gram-negative organism Salmonella typhimurium and Gram-positive organism Bacillus stearothermophilus with beta, beta, beta-trifluoroalanine has been studied. The inactivation occurs with the same rate constant as that for formation of a broad 460-490-nm chromophore. Loss of two fluoride ions per mole of inactivated enzyme and retention of (1-/sup 14/C)trifluoroalanine label accompany inhibition, suggesting a monofluoro enzyme adduct. Partial denaturation (1 M guanidine) leads to rapid return of the initial 420-nm chromophore, followed by a slower (t1/2 approximately 30 min-1 h) loss of the fluoride ion and /sup 14/CO/sub 2/ release. At this point, reduction by NaB/sub 3/H/sub 4/ and tryptic digestion yield a single radiolabeled peptide. Purification and sequencing of the peptide reveals that lysine-38 is covalently attached to the PLP cofactor. A mechanism for enzyme inactivation by trifluoroalanine is proposed and contrasted with earlier results on monohaloalanines, in which nucleophilic attack of released aminoacrylate on the PLP aldimine leads to enzyme inactivation. For trifluoroalanine inactivation, nucleophilic attack of lysine-38 on the electrophilic beta-difluoro-alpha, beta-unsaturated imine provides an alternative mode of inhibition for these enzymes.

  6. Divergent effects of 17-{beta}-estradiol on human vascular smooth muscle and endothelial cell function diminishes TNF-{alpha}-induced neointima formation

    SciTech Connect

    Nintasen, Rungrat; Riches, Kirsten; Mughal, Romana S.; Viriyavejakul, Parnpen; Chaisri, Urai; Maneerat, Yaowapa; Turner, Neil A.; Porter, Karen E.


    Highlights: Black-Right-Pointing-Pointer TNF-{alpha} augments neointimal hyperplasia in human saphenous vein. Black-Right-Pointing-Pointer TNF-{alpha} induces detrimental effects on endothelial and smooth muscle cell function. Black-Right-Pointing-Pointer Estradiol exerts modulatory effects on TNF-induced vascular cell functions. Black-Right-Pointing-Pointer The modulatory effects of estradiol are discriminatory and cell-type specific. -- Abstract: Coronary heart disease (CHD) is a condition characterized by increased levels of proinflammatory cytokines, including tumor necrosis factor-{alpha} (TNF-{alpha}). TNF-{alpha} can induce vascular endothelial cell (EC) and smooth muscle cell (SMC) dysfunction, central events in development of neointimal lesions. The reduced incidence of CHD in young women is believed to be due to the protective effects of estradiol (E2). We therefore investigated the effects of TNF-{alpha} on human neointima formation and SMC/EC functions and any modulatory effects of E2. Saphenous vein (SV) segments were cultured in the presence of TNF-{alpha} (10 ng/ml), E2 (2.5 nM) or both in combination. Neointimal thickening was augmented by incubation with TNF-{alpha}, an effect that was abolished by co-culture with E2. TNF-{alpha} increased SV-SMC proliferation in a concentration-dependent manner that was optimal at 10 ng/ml (1.5-fold increase), and abolished by E2 at all concentrations studied (1-50 nM). Surprisingly, E2 itself at low concentrations (1 and 5 nM) stimulated SV-SMC proliferation to a level comparable to that of TNF-{alpha} alone. SV-EC migration was significantly impaired by TNF-{alpha} (42% of control), and co-culture with E2 partially restored the ability of SV-EC to migrate and repair the wound. In contrast, TNF-{alpha} increased SV-SMC migration by 1.7-fold, an effect that was completely reversed by co-incubation with E2. Finally, TNF-{alpha} potently induced ICAM-1 and VCAM-1 expression in both SV-EC and SV-SMC. However there

  7. Effects of mutations in the {beta} subunit hinge domain on ATP synthase F{sub 1} sector rotation: Interaction between Ser 174 and Ile 163

    SciTech Connect

    Kashiwagi, Sachiko; Iwamoto-Kihara, Atsuko; Kojima, Masaki; Nonaka, Takamasa; Futai, Masamitsu Nakanishi-Matsui, Mayumi


    A complex of {gamma}, {epsilon}, and c subunits rotates in ATP synthase (F{sub o}F{sub 1}) coupling with proton transport. Replacement of {beta}Ser174 by Phe in {beta}-sheet4 of the {beta} subunit ({beta}S174F) caused slow {gamma} subunit revolution of the F{sub 1} sector, consistent with the decreased ATPase activity [M. Nakanishi-Matsui, S. Kashiwagi, T. Ubukata, A. Iwamoto-Kihara, Y. Wada, M. Futai, Rotational catalysis of Escherichia coli ATP synthase F1 sector. Stochastic fluctuation and a key domain of the {beta} subunit, J. Biol. Chem. 282 (2007) 20698-20704]. Modeling of the domain including {beta}-sheet4 and {alpha}-helixB predicted that the mutant {beta}Phe174 residue undergoes strong and weak hydrophobic interactions with {beta}Ile163 and {beta}Ile166, respectively. Supporting this prediction, the replacement of {beta}Ile163 in {alpha}-helixB by Ala partially suppressed the {beta}S174F mutation: in the double mutant, the revolution speed and ATPase activity recovered to about half of the levels in the wild-type. Replacement of {beta}Ile166 by Ala lowered the revolution speed and ATPase activity to the same levels as in {beta}S174F. Consistent with the weak hydrophobic interaction, {beta}Ile166 to Ala mutation did not suppress {beta}S174F. Importance of the hinge domain [phosphate-binding loop (P-loop)/{alpha}-helixB/loop/{beta}-sheet4, {beta}Phe148-{beta}Gly186] as to driving rotational catalysis is discussed.

  8. The thermographic nondestructive evaluation of iron aluminide green sheet

    NASA Astrophysics Data System (ADS)

    Watkins, Michael Lee

    The recent development of manufacturing techniques for the fabrication of thin iron aluminide sheet requires advanced quantitative methods for on-line inspection. An understanding of the mechanisms responsible for flaws and the development of appropriate flaw detection methods are key elements in an effective quality management system. The first step in the fabrication of thin FeAl alloy sheet is the formation of a green sheet by cold rolling FeAl powder mixed with organic binding agents. The green sheet composite has a bulk density, which is typically less than about 3.6 g/cc. The finished sheet, with a density of about 6.1 g/cc, is obtained using a series of process steps involving binder elimination, densification, sintering, and annealing. Non-uniformities within the green sheet are the major contributor to material failure in subsequent sheet processing and the production of non-conforming finished sheet. The production environment and physical characteristics of the composite provide for unique challenges in developing a rapid nondestructive inspection capability. The method must be non-contact due to the fragile nature of the composite. Limited access to the material also demands a one-sided inspection technique. An active thermographic method providing for 100% on-line inspection within an industrial, process has been developed. This approach is cost competitive with alternative technologies, such as x-ray imaging systems, and provides the required sensitivity to the variations in material composition. The mechanism of flaw formation and the transformation of green sheet flaws into defects that appear in intermediate and finished sheet products are described. A mathematical model which describes the green sheet heat transfer propagation, in the context of the inspection technique and the compact heterogeneity, is also presented. The potential for feedback within the production process is also discussed.

  9. Characterization of beta-lactoglobulin fibrillar assembly using atomic force microscopy, polyacrylamide gel electrophoresis, and in situ fourier transform infrared spectroscopy.


    Oboroceanu, Daniela; Wang, Lizhe; Brodkorb, André; Magner, Edmond; Auty, Mark A E


    The aggregation process of beta-lactoglobulin (beta-lg) from 0 min to 20 h was studied using atomic force microscopy (AFM), scanning transmission electron microscopy (STEM), sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and in situ attenuated total reflectance-Fourier transform infrared spectroscopy (ATR-FTIR). Fibril assembly was monitored in real time using AFM up to 20 h. From 0 to 85 min, beta-lg monomers deformed and expanded with some aggregation. After 85 min, fibrillar structures were formed, exceeding 10 mum in length. Fibrillar structures were confirmed by STEM. Secondary structural changes occurring during fibril formation were monitored by ATR-FTIR at 80 degrees C and indicated a decrease in alpha-helix content and an increase in beta-sheet content. SDS-PAGE indicated that fibrils were composed of polypeptides and not intact monomers. In this study, beta-lg and whey protein isolate (WPI)-derived fibrils, including some double helices, in water were observed by AFM under ambient conditions and in their native aqueous environment. PMID:20187607

  10. Absorption of Beta Particles in Different Materials: An Undergraduate Experiment

    ERIC Educational Resources Information Center

    La Rocca, Paola; Riggi, Francesco


    The absorption of beta rays from a radioactive source in different materials was investigated by the use of a simple setup based on a Geiger counter and a set of absorber sheets. The number of electrons traversing the material was measured as a function of its thickness. Detailed GEANT simulations were carried out to reproduce the obtained…

  11. A synopsis of factors regulating beta cell development and beta cell mass.


    Prasadan, Krishna; Shiota, Chiyo; Xiangwei, Xiao; Ricks, David; Fusco, Joseph; Gittes, George


    The insulin-secreting beta cells in the endocrine pancreas regulate blood glucose levels, and loss of functional beta cells leads to insulin deficiency, hyperglycemia (high blood glucose) and diabetes mellitus. Current treatment strategies for type-1 (autoimmune) diabetes are islet transplantation, which has significant risks and limitations, or normalization of blood glucose with insulin injections, which is clearly not ideal. The type-1 patients can lack insulin counter-regulatory mechanism; therefore, hypoglycemia is a potential risk. Hence, a cell-based therapy offers a better alternative for the treatment of diabetes. Past research was focused on attempting to generate replacement beta cells from stem cells; however, recently there has been an increasing interest in identifying mechanisms that will lead to the conversion of pre-existing differentiated endocrine cells into beta cells. The goal of this review is to provide an overview of several of the key factors that regulate new beta cell formation (neogenesis) and beta cell proliferation. PMID:27105622

  12. A comparison of enzymatic phosphorylation and phosphatidylation of beta-L- and beta-D-nucleosides.


    Birichevskaya, Larisa L; Kvach, Sergei V; Sivets, Grigorii G; Kalinichenko, Elena N; Zinchenko, Anatoly I; Mikhailopulo, Igor A


    Enzymatic 5'-monophosphorylation and 5'-phosphatidylation of a number of beta-L- and beta-D-nucleosides was investigated. The first reaction, catalyzed by nucleoside phosphotransferase (NPT) from Erwinia herbicola, consisted of the transfer of the phosphate residue from p-nitrophenylphosphate (p-NPP) to the 5'-hydroxyl group of nucleoside; the second was the phospholipase D (PLD)-catalyzed transphosphatidylation of L-alpha-lecithin with a series of beta-L- and beta-D-nucleosides as the phosphatidyl acceptor resulted in the formation of the respective phospholipid-nucleoside conjugates. Some beta-L-nucleosides displayed similar or even higher substrate activity compared to the beta-D-enantiomers. PMID:17206374

  13. Roles of the {beta} subunit hinge domain in ATP synthase F{sub 1} sector: Hydrophobic network formed by introduced {beta}Phe174 inhibits subunit rotation

    SciTech Connect

    Nakanishi-Matsui, Mayumi; Kashiwagi, Sachiko; Kojima, Masaki; Nonaka, Takamasa; Futai, Masamitsu


    The ATP synthase {beta} subunit hinge domain ({beta}Phe148 {approx} {beta}Gly186, P-loop/{alpha}-helixB/loop/{beta}-sheet4, Escherichia coli residue numbering) dramatically changes in conformation upon nucleotide binding. We previously reported that F{sub 1} with the {beta}Ser174 to Phe mutation in the domain lowered the {gamma} subunit rotation speed, and thus decreased the ATPase activity [M. Nakanishi-Matsui, S. Kashiwagi, T. Ubukata, A. Iwamoto-Kihara, Y. Wada, M. Futai, Rotational catalysis of Escherichia coli ATP synthase F{sub 1} sector. Stochastic fluctuation and a key domain of the {beta} subunit, J. Biol. Chem. 282 (2007) 20698-20704.]. Homology modeling indicates that the amino acid replacement induces a hydrophobic network, in which the {beta}Met159, {beta}Ile163, and {beta}Ala167 residues of the {beta} subunit are involved together with the mutant {beta}Phe174. The network is expected to stabilize the conformation of {beta}{sub DP} (nucleotide-bound form of the {beta} subunit), resulting in increased activation energy for transition to {beta}{sub E} (empty {beta} subunit). The modeling further predicts that replacement of {beta}Met159 with Ala or Ile weakens the hydrophobic network. As expected, these two mutations experimentally suppressed the ATPase activities as well as subunit rotation of {beta}S174F. Furthermore, the rotation rate decreased with the increase of the strength in the hydrophobic network. These results indicate that the smooth conformational change of the {beta} subunit hinge domain is pertinent for the rotational catalysis.

  14. New hydrolysis products of the beta-lactam antibiotic amoxicillin, their pH-dependent formation and search in municipal wastewater.


    Hirte, Kristin; Seiwert, Bettina; Schüürmann, Gerrit; Reemtsma, Thorsten


    Amoxicillin (AMX) is a widespread β-lactam-antibiotic and, together with some of its transformation products (TPs) originating from hydrolysis, a known environmental contaminant. To shed light on the abiotic degradation of AMX and the stability of its known TPs, laboratory hydrolysis experiments of AMX were carried out at pH 3, 7 and 11. Not only the rate of hydrolysis but also the pattern of TPs was strongly pH-dependent. The time courses of the obtained transformation products were analyzed by UPLC-HR-QToF-MS. AMX penicilloic acid (TP 1), AMX 2',5'-diketopiperazine (TP 2), AMX penilloic acid (TP 3) and 3-(4-hydroxyphenyl)pyrazinol (TP 4) were found at neutral pH. Surprisingly, the first three were not stable but transformed into 23 yet unknown TPs within three to four weeks. Seven TPs were tentatively identified, based on their product ion spectra and, where possible, confirmed with reference standards, e.g. penicillamine disulfide, 2-[amino(carboxy)methyl]-5,5-dimethyl-1,3-thiazolidine-4-carboxylic acid and dehydrocarboxylated amoxicillin penilloic acid. Analysis of samples from municipal wastewater treatment plants confirmed these findings with TP 1 being the dominant TP in the influent and a shift towards TP 2, TP 3 and TP 4 in the effluents. The lab experiments predicted up to 13 consecutive TPs from TP 1, TP 2 and TP 3 under neutral conditions. Their detection from surface waters will be difficult, because their large number and slow formation kinetics will lead to comparatively low environmental concentrations. Nevertheless the abiotic degradation of TP 1, TP 2 and TP 3 to further TPs needs to be considered in future studies of the environmental fate of amoxicillin. PMID:26613181

  15. Interhemispheric Ice-Sheet Synchronicity During the Last Glacial Maximum

    NASA Astrophysics Data System (ADS)

    Weber, M. E.; Clark, P. U.; Kuhn, G.; Ricken, W.; Sprenk, D.


    The timing of the last maximum extent of the Antarctic ice sheets relative to those in the Northern Hemisphere remains poorly understood because only a few findings with robust chronologies exist for Antarctic ice sheets. We developed a chronology for the Weddell Sea sector of the East Antarctic ice sheet that, combined with ages from other Antarctic ice-sheet sectors, indicates the advance to and retreat from their maximum extent was nearly synchronous with Northern Hemisphere ice sheets. As for the deglaciation, modeling studies suggest a late ice-sheet retreat starting around 14 ka BP and ending around 7 ka BP with a large impact of an unstable West Antarctic Ice Sheet (WAIS) and a small impact of a stable East Antarctic Ice Sheet (EAIS). However, the Weddell Sea sites studied here, as well as sites from the Scotia Sea, provide evidence that specifically the EAIS responded much earlier, possibly provided a significant contribution to the last sea-level rise, and was much more dynamic than previously thought. Deep-sea sediment sites from the central Scotia Sea "iceberg alley" show four phases of enhanced deposition of ice-rated detritus (IRD) occurred at 19.5, 16.5,14.5, and 12 ka. The first two relate to the two ice-sheet retreat signals documented for the Weddell Sea; the third phase indicates an Antarctic component to meltwater pulse 1a; the fourth phase falls roughly into period of the Younger Dryas. Our modeling studies show that surface climate forcing of Antarctic ice sheets would have likely increased ice mass balance during deglaciation, whereby a warming climate would increase accumulation but not surface melting. We propose that sea-level forcing from Northern Hemisphere ice sheets and changes in North Atlantic deepwater formation and attendant heat flux to Antarctic grounding lines provided the teleconnections to synchronize the hemispheric ice sheets.

  16. Temperature Dependence of Positron Annihilation in beta-Cyclodextrin and beta-Cyclodextrin Complexes

    NASA Astrophysics Data System (ADS)

    Hu, Y.; Hsu Hadley, F. H., Jr.; Trinh, T.


    The effects of temperature on positron annihilation in beta-cyclodextrin and beta-cyclodextrin complexed with benzyl salicylate, benzyl acetate, ethyl salicylate, geraniol, linalool and nerol were studied. Samples were prepared by slurry, air-dried and freeze-dried methods. Lifetime spectra were measured as a function of temperature for each sample. Comparison of the annihilation rate and intensity of the longer-lived component showed that positronium formation was affected by guest molecules, preparation methods and temperature variations. Results can be used to explain beta-cyclodextrin complex formation with different guest molecules.

  17. Ferulic acid destabilizes preformed {beta}-amyloid fibrils in vitro

    SciTech Connect

    Ono, Kenjiro; Hirohata, Mie; Yamada, Masahito . E-mail:


    Inhibition of the formation of {beta}-amyloid fibrils (fA{beta}), as well as the destabilization of preformed fA{beta} in the CNS, would be attractive therapeutic targets for the treatment of Alzheimer's disease (AD). We reported previously that curcumin (Cur) inhibits fA{beta} formation from A{beta} and destabilizes preformed fA{beta} in vitro. Using fluorescence spectroscopic analysis with thioflavin T and electron microscopic studies, we examined the effects of ferulic acid (FA) on the formation, extension, and destabilization of fA{beta} at pH 7.5 at 37 deg C in vitro. We next compared the anti-amyloidogenic activities of FA with Cur, rifampicin, and tetracycline. Ferulic acid dose-dependently inhibited fA{beta} formation from amyloid {beta}-peptide, as well as their extension. Moreover, it destabilized preformed fA{beta}s. The overall activity of the molecules examined was in the order of: Cur > FA > rifampicin = tetracycline. FA could be a key molecule for the development of therapeutics for AD.

  18. Early Events in the Amyloid Formation of the A546T Mutant of Transforming Growth Factor Beta Induced Protein (TGFBIp) in Corneal Dystrophies Compared to the Non-Fibrillating R555W and R555Q Mutants

    PubMed Central

    Koldsø, Heidi; Andersen, Ole Juul; Nikolajsen, Camilla Lund; Scavenius, Carsten; Sørensen, Charlotte S.; Underhaug, Jarl; Runager, Kasper; Nielsen, Niels Chr.; Enghild, Jan J.; Schiøtt, Birgit


    The human transforming growth factor beta induced protein (TGFBIp) is involved in several types of corneal dystrophies where protein aggregation and amyloid fibril formation severely impairs vision. Most disease-causing mutations are located in the last of four homologous fasciclin-1 (FAS1) domains of the protein, and it has been shown that when isolated, the fourth FAS1 domain (FAS1–4) mimics the behavior of full-length TGFBIp. In this study, we use molecular dynamics simulations and principal component analysis to study the wild type FAS1–4 domain along with three disease-causing mutations (R555W, R555Q, and A546T) to decipher any internal difference in dynamical properties of the domains that may explain their varied stabilities and aggregation properties. In addition, we use a protein-protein docking method in combination with chemical cross-linking experiments and mass spectrometry of the cross-linked species to obtain information about interaction faces between identical FAS1–4 domains. The results show that the pathogenic mutations A546T and R555W affect the packing in the hydrophobic core of FAS1–4 in different directions. We further show that the FAS1–4 monomers associate using their β-rich regions consistent with peptides observed to be part of the amyloid fibril core in lattice corneal dystrophy patients. PMID:26305369

  19. Beta-aminopeptidase-catalyzed biotransformations of beta(2)-dipeptides: kinetic resolution and enzymatic coupling.


    Heck, Tobias; Reimer, Artur; Seebach, Dieter; Gardiner, James; Deniau, Gildas; Lukaszuk, Aneta; Kohler, Hans-Peter E; Geueke, Birgit


    We have previously shown that the beta-aminopeptidases BapA from Sphingosinicella xenopeptidilytica and DmpA from Ochrobactrum anthropi can catalyze reactions with non-natural beta(3)-peptides and beta(3)-amino acid amides. Here we report that these exceptional enzymes are also able to utilize synthetic dipeptides with N-terminal beta(2)-amino acid residues as substrates under aqueous conditions. The suitability of a beta(2)-peptide as a substrate for BapA or DmpA was strongly dependent on the size of the C(alpha) substituent of the N-terminal beta(2)-amino acid. BapA was shown to convert a diastereomeric mixture of the beta(2)-peptide H-beta(2)hPhe-beta(2)hAla-OH, but did not act on diastereomerically pure beta(2),beta(3)-dipeptides containing an N-terminal beta(2)-homoalanine. In contrast, DmpA was only active with the latter dipeptides as substrates. BapA-catalyzed transformation of the diastereomeric mixture of H-beta(2)hPhe-beta(2)hAla-OH proceeded along two highly S-enantioselective reaction routes, one leading to substrate hydrolysis and the other to the synthesis of coupling products. The synthetic route predominated even at neutral pH. A rise in pH of three log units shifted the synthesis-to-hydrolysis ratio (v(S)/v(H)) further towards peptide formation. Because the equilibrium of the reaction lies on the side of hydrolysis, prolonged incubation resulted in the cleavage of all peptides that carried an N-terminal beta-amino acid of S configuration. After completion of the enzymatic reaction, only the S enantiomer of beta(2)-homophenylalanine was detected (ee>99 % for H-(S)-beta(2)-hPhe-OH, E>500); this confirmed the high enantioselectivity of the reaction. Our findings suggest interesting new applications of the enzymes BapA and DmpA for the production of enantiopure beta(2)-amino acids and the enantioselective coupling of N-terminal beta(2)-amino acids to peptides. PMID:20340152

  20. BETTY: prediction of beta-strand type from sequence.


    Zimmermann, Olav; Wang, Longhui; Hansmann, Ulrich H E


    Most secondary structure prediction programs do not distinguish between parallel and antiparallel beta-sheets. However, such knowledge would constrain the available topologies of a protein significantly, and therefore aid existing fold recognition algorithms. For this reason, we propose a technique which, in combination with existing secondary structure programs such as PSIPRED, allows one to distinguish between parallel and antiparallel beta-sheets. We propose the use of a support vector machine (SVM) procedure, BETTY, to predict parallel and antiparallel sheets from sequence. We found that there is a strong signal difference in the sequence profiles which SVMs can efficiently extract. With strand type assignment accuracies of 90.7% and 83.3% for antiparallel and parallel strands, respectively, our method adds considerably to existing information on current 3-class secondary structure predictions. BETTY has been implemented as an online service which academic researchers can access from our website PMID:18391242

  1. A Logical OR Redundancy within the Asx-Pro-Asx-Gly Type 1 {Beta}-Turn Motif

    SciTech Connect

    Lee, Jihun; Dubey, Vikash Kumar; Longo, Lian M.; Blaber, Michael


    Turn secondary structure is essential to the formation of globular protein architecture. Turn structures are, however, much more complex than either {alpha}-helix or {beta}-sheet, and the thermodynamics and folding kinetics are poorly understood. Type I {beta}-turns are the most common type of reverse turn, and they exhibit a statistical consensus sequence of Asx-Pro-Asx-Gly (where Asx is Asp or Asn). A comprehensive series of individual and combined Asx mutations has been constructed within three separate type I 3:5 G1 bulge {beta}-turns in human fibroblast growth factor-1, and their effects on structure, stability, and folding have been determined. The results show a fundamental logical OR relationship between the Asx residues in the motif, involving H-bond interactions with main-chain amides within the turn. These interactions can be modulated by additional interactions with residues adjacent to the turn at positions i + 4 and i + 6. The results show that the Asx residues in the turn motif make a substantial contribution to the overall stability of the protein, and the Asx logical OR relationship defines a redundant system that can compensate for deleterious point mutations. The results also show that the stability of the turn is unlikely to be the prime determinant of formation of turn structure in the folding transition state.

  2. Energy information sheets

    SciTech Connect

    Not Available


    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the general public. Written for the general public, the EIA publication Energy Information Sheets was developed to provide information on various aspects of fuel production, prices, consumption and capability. The information contained herein pertains to energy data as of December 1991. Additional information on related subject matter can be found in other EIA publications as referenced at the end of each sheet.

  3. beta-Hexachlorocyclohexane (beta-HCH)

    Integrated Risk Information System (IRIS)

    beta - Hexachlorocyclohexane ( beta - HCH ) ; CASRN 319 - 85 - 7 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Asses

  4. 5. Historic American Buildings Survey Taken from drawing sheet, SHEET ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    5. Historic American Buildings Survey Taken from drawing sheet, SHEET #21, Showing the house as restored since Survey. (Dormer windows omitted as not authentic) - Samuel des Marest House, River Road, New Milford, Bergen County, NJ


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    71. PALMDALE WATER COMPANY, EASTWOOD MULTIPLE-ARCHED DAM: STRESS SHEET, SHEET 3; DECEMBER 20, 1918. Littlerock Water District files. - Little Rock Creek Dam, Little Rock Creek, Littlerock, Los Angeles County, CA

  6. Low-Temperature Forming of Beta Titanium Alloys

    NASA Technical Reports Server (NTRS)

    Kaneko, R. S.; Woods, C. A.


    Low cost methods for titanium structural fabrication using advanced cold-formable beta alloys were investigated for application in a Mach 2.7 supersonic cruise vehicle. This work focuses on improving processing and structural efficiencies as compared with standard hot formed and riveted construction of alpha-beta alloy sheet structure. Mechanical property data and manufacturing parameters were developed for cold forming, brazing, welding, and processing Ti-15V-3Cr-3Sn-3Al sheet, and Ti-3Al-8V-6Cr-4Zr on a more limited basis. Cost and structural benefits were assessed through the fabrication and evaluation of large structural panels. The feasibility of increasing structural efficiency of beta titanium structure by selective reinforcement with metal matrix composite was also explored.

  7. Hypertrophic scar model in the rabbit ear: a reproducible model for studying scar tissue behavior with new observations on silicone gel sheeting for scar reduction.


    Kloeters, Oliver; Tandara, Andrea; Mustoe, Thomas A


    Hypertrophic scarring poses a clinically relevant problem as it can be cosmetically disfiguring and functionally debilitating. A lack of animal models has hindered an understanding of the pathogenesis and development of new treatment strategies therefore has largely been empiric. Our group has developed a unique hypertrophic scar (HS) model in the rabbit ear. The model has been reproducible, quantifiable, and measurable over a time period of 1 month. We describe the development as well as the reliability and responsiveness of this model to different therapeutic agents, such as TGF-beta blockade, silicone occlusion, and application of collagen-synthesis inhibitors. Moreover, it has given insights into the mechanism of action of silicone sheeting occlusive treatment and ultimately suggests that the epidermis plays a critical role in the development of HS. Additionally, we will present new data supporting the importance of the epidermis and further clarify the mechanism of action of silicone sheeting. When a semi-occlusive polyurethane film was left in place for an additional time period, scar formation was reduced. HSs of this model covered with silicone sheets and five layers of Tegaderm showed a significant scar reduction by 80% compared with wounds with only one layer of Tegaderm. The HS model in the rabbit ear is a highly reliable, responsive, and practical model for studying scar tissue behavior. Furthermore, our data suggest that the degree and the duration of occlusion are most important for reducing scar tissue formation. PMID:17727466

  8. Effect of initial stagger selection on the handedness of Amyloid beta helical fibrils

    SciTech Connect

    Ghattyvenkatakrishna, Pavan K; Cheng, Xiaolin; Uberbacher, Edward C


    Various structural models for Amyloid $\\beta$ fibrils derived from a variety of experimental techniques are currently available. However, this data cannot differentiate between the relative position of the two arms of the $\\beta$ hairpin called the stagger. Amyloid fibrils of various heirarchical levels form left--handed helices composed of $\\beta$ sheets. However it is unclear if positive, negative and neutral staggers all form the macroscopic left--handed helices. Studying this is important since the success of computational approaches to develop drugs for amyloidic diseases will depend on selecting the physiologically relevant structure of the sheets. To address this issue we have conducted extensive molecular dynamics simulations of Amyloid$\\beta$ sheets of various staggers and show that only negative staggers generate the experimentally observed left--handed helices while positive staggers generate the incorrect right--handed helices. The implications of this result extend in to all amyloidic--aggregation type diseases.

  9. Simulating Thin Sheets: Buckling, Wrinkling, Folding and Growth

    NASA Astrophysics Data System (ADS)

    Vetter, Roman; Stoop, Norbert; Wittel, Falk K.; Herrmann, Hans J.


    Numerical simulations of thin sheets undergoing large deformations are computationally challenging. Depending on the scenario, they may spontaneously buckle, wrinkle, fold, or crumple. Nature's thin tissues often experience significant anisotropic growth, which can act as the driving force for such instabilities. We use a recently developed finite element model to simulate the rich variety of nonlinear responses of Kirchhoff-Love sheets. The model uses subdivision surface shape functions in order to guarantee convergence of the method, and to allow a finite element description of anisotropically growing sheets in the classical Rayleigh-Ritz formalism. We illustrate the great potential in this approach by simulating the inflation of airbags, the buckling of a stretched cylinder, as well as the formation and scaling of wrinkles at free boundaries of growing sheets. Finally, we compare the folding of spatially confined sheets subject to growth and shrinking confinement to find that the two processes are equivalent.

  10. Quick Information Sheets. 1988.

    ERIC Educational Resources Information Center

    Wisconsin Univ., Madison. Trace Center.

    The Trace Center gathers and organizes information on communication, control, and computer access for handicapped individuals. The information is disseminated in the form of brief sheets describing print, nonprint, and organizational resources and listing addresses and telephone numbers for ordering or for additional information. This compilation…

  11. Quick Information Sheets.

    ERIC Educational Resources Information Center

    Wisconsin Univ., Madison. Trace Center.

    This compilation of "Trace Quick Sheets" provides descriptions, prices, and ordering information for products and services that assist with communication, control, and computer access for disabled individuals. Product descriptions or product sources are included for: adaptive toys and toy modifications; head pointers, light pointers, and…

  12. Insulation Fact Sheet.

    ERIC Educational Resources Information Center

    Conservation and Renewable Energy Inquiry and Referral Service (DOE), Silver Spring, MD.

    Heating and cooling account for 50-70% of the energy consumed in the average American home. Heating water accounts for another 20%. A poorly insulated home loses much of this energy, causing drafty rooms and high energy bills. This fact sheet discusses how to determine if your home needs more insulation, the additional thermal resistance (called…

  13. Ethanol Myths Fact Sheet

    SciTech Connect


    Ethanol is a clean, renewable fuel that is helping to reduce our nation’s dependence on oil and can offer additional economic and environmental benefits in the future. This fact sheet is intended to address some common misconceptions about this important alternative fuel.

  14. GED Testing Fact Sheet

    ERIC Educational Resources Information Center

    GED Testing Service, 2009


    This GED Testing fact sheet provides information on: (1) GED[R] Tests; (2) Versions and Editions of the GED Tests; (3) Earning a Credential; (4) GED Testing Service[R]; (5) History of the GED Tests; (6) Who Accepts the GED Credential; (7) Public/Private Partnership of GEDTS; (8) Renowned GED Credential Recipients; (9) GED Testing Numbers for 2008;…

  15. Algal Biofuels Fact Sheet

    SciTech Connect


    This fact sheet provides information on algal biofuels, which are generating considerable interest around the world. They may represent a sustainable pathway for helping to meet the U.S. biofuel production targets set by the Energy Independence and Security Act of 2007.

  16. Youth Demographics. Fact Sheet

    ERIC Educational Resources Information Center

    Lopez, Mark Hugo; Marcelo, Karlo Barrios


    This fact sheet compares the numbers of 18-25 year-old residents and citizens by gender, race, ethnicity, geographic distribution, marital status, military status, unemployment, educational attainment, and assesses population trends from 1968-2006. It explores such demographic characteristics of young people using data from the March Annual…

  17. Ethanol Basics (Fact Sheet)

    SciTech Connect

    Not Available


    Ethanol is a widely-used, domestically-produced renewable fuel made from corn and other plant materials. More than 96% of gasoline sold in the United States contains ethanol. Learn more about this alternative fuel in the Ethanol Basics Fact Sheet, produced by the U.S. Department of Energy's Clean Cities program.

  18. Reading Recovery. [Fact Sheets].

    ERIC Educational Resources Information Center

    Reading Recovery Council of North America, Columbus, OH.

    This set of 10 fact sheets (each 2 to 4 pages long) addresses aspects of Reading Recovery, a program that helps children to be proficient readers and writers by the end of the first grade. It discusses the basic facts of Reading Recovery; Reading Recovery for Spanish literacy; Reading Recovery lessons; Reading Recovery professional development;…

  19. Fast Light-Sheet Scanner

    NASA Technical Reports Server (NTRS)

    Hunter, William W., Jr.; Humphreys, William M., Jr.; Bartram, Scott M.


    Optomechanical apparatus maintains sheet of pulsed laser light perpendicular to reference axis while causing sheet of light to translate in oscillatory fashion along reference axis. Produces illumination for laser velocimeter in which submicrometer particles entrained in flow illuminated and imaged in parallel planes displaced from each other in rapid succession. Selected frequency of oscillation range upward from tens of hertz. Rotating window continuously shifts sheet of light laterally while maintaining sheet parallel to same plane.

  20. Interhemispheric ice-sheet synchronicity during the Last Glacial Maximum

    NASA Astrophysics Data System (ADS)

    Weber, M. E.; Clark, P. U.; Ricken, W.; Mitrovica, J. X.; Hostetler, S. W.; Kuhn, G.


    The timing of the last maximum extent of the Antarctic ice sheets relative to those in the Northern Hemisphere remains poorly understood because only a few findings with robust chronologies exist for Antarctic ice sheets. We developed a chronology for the Weddell Sea sector of the East Antarctic ice sheet that, combined with ages from other Antarctic ice-sheet sectors, indicates the advance to their maximum extent at 29 -28 ka, and retreat from their maximum extent at 19 ka was nearly synchronous with Northern Hemisphere ice sheets (Weber, M.E., Clark, P. U., Ricken, W., Mitrovica, J. X., Hostetler, S. W., and Kuhn, G. (2011): Interhemispheric ice-sheet synchronicity during the Last Glacial Maximum. - Science, 334, 1265-1269, doi: 10.1126:science.1209299). As for the deglaciation, modeling studies suggest a late ice-sheet retreat starting around 14 ka BP and ending around 7 ka BP with a large impact of an unstable West Antarctic Ice Sheet (WAIS) and a small impact of a stable East Antarctic Ice Sheet (EAIS). However, the Weddell Sea sites studied here, as well as sites from the Scotia Sea, provide evidence that specifically the EAIS responded much earlier, possibly provided a significant contribution to the last sea-level rise, and was much more dynamic than previously thought. Using the results of an atmospheric general circulation we conclude that surface climate forcing of Antarctic ice mass balance would likely cause an opposite response, whereby a warming climate would increase accumulation but not surface melting. Furthermore, our new data support teleconnections involving a sea-level fingerprint forced from Northern Hemisphere ice sheets as indicated by gravitational modeling. Also, changes in North Atlantic Deepwater formation and attendant heat flux to Antarctic grounding lines may have contributed to synchronizing the hemispheric ice sheets.

  1. Fully coupled ice sheet-earth system model: How does the Greenlandic ice sheet interact in a changing climate

    NASA Astrophysics Data System (ADS)

    Rodehacke, C.; Mikolajewicz, U.; Vizcaino, M.


    As ice sheets belong to the slowest climate components, they are usually not interactively coupled in current climate models. Therefore, long-term climate projections are incomplete and only the consideration of ice sheet interactions allows tackling fundamental questions, such as how do ice sheets modify the reaction of the climate systems under a strong CO2 forcing? The earth system model MPI-ESM, with the atmosphere model ECHAM6 and ocean model MPIOM, is coupled to the modified ice sheet model PISM. This ice sheet model, which is developed at the University of Fairbanks, represents the ice sheet of Greenland at a horizontal resolution of 10 km. The coupling is performed by calculating the surface mass balance based on 6-hourly atmospheric data to determine the boundary condition for the ice sheet model. The response of the ice sheet to this forcing, which includes orographic changes and fresh water fluxes, are passed back to the ESM. In contrast to commonly used strategies, we use a mass conserving scheme and do therefore neither apply flux corrections nor utilize anomaly coupling. Under a strong CO2 forcing a disintegrating Greenlandic ice sheet contributes to a rising sea level and has the potential to alter the formation of deep water masses in the adjacent formation sites Labrador Sea and Nordic Seas. We will present results for an idealized forcing with a growing atmospheric CO2 concentration that rises by 1% per year until four-times the pre-industrial level has been reached. We will discuss the reaction of the ice sheet and immediate responses of the ocean to ice loss.

  2. Skill Sheets for Agricultural Mechanics.

    ERIC Educational Resources Information Center

    Iowa State Univ. of Science and Technology, Ames. Dept. of Agricultural Education.

    This set of 33 skill sheets for agricultural mechanics was developed for use in high school and vocational school agricultural mechanics programs. Some sheets teach operational procedures while others are for simple projects. Each skill sheet covers a single topic and includes: (1) a diagram, (2) a step-by-step construction or operational…

  3. Beginning Child Care Fact Sheets.

    ERIC Educational Resources Information Center

    Tweedie, Pat

    These six fact sheets from Child Care Aware are designed to help parents ease their children's transition to child care. The first fact sheet, "Before Your Child's First Day," discusses tips such as: (1) "prepare your child"; (2) read and look at picture books about child care; and (3) "prepare yourself." The second fact sheet, "First Day Tips,"…

  4. The Physics of Ice Sheets

    ERIC Educational Resources Information Center

    Bassis, J. N.


    The great ice sheets in Antarctica and Greenland are vast deposits of frozen freshwater that contain enough to raise sea level by approximately 70 m if they were to completely melt. Because of the potentially catastrophic impact that ice sheets can have, it is important that we understand how ice sheets have responded to past climate changes and…

  5. Transfer of fibroblast sheets cultured on thermoresponsive dishes with membranes.


    Kawecki, Marek; Kraut, Małgorzata; Klama-Baryła, Agnieszka; Łabuś, Wojciech; Kitala, Diana; Nowak, Mariusz; Glik, Justyna; Sieroń, Aleksander L; Utrata-Wesołek, Alicja; Trzebicka, Barbara; Dworak, Andrzej; Szweda, Dawid


    In cell or tissue engineering, it is essential to develop a support for cell-to-cell adhesion, which leads to the generation of cell sheets connected by extracellular matrix. Such supports must be hydrophobic and should result in a detachable cell sheet. A thermoresponsive support that enables the cultured cell sheet to detach using only a change in temperature could be an interesting alternative in regenerative medicine. The aim of this study was to evaluate plates covered with thermoresponsive polymers as supports for the formation of fibroblast sheets and to develop a damage-free procedure for cell sheet transfer with the use of membranes as transfer tools. Human skin fibroblasts were seeded on supports coated with a thermoresponsive polymer: commercial UpCell™ dishes (NUNC™) coated with thermoresponsive poly(N-isopropylacrylamide) (PNIPAM) and dishes coated with thermoresponsive poly(tri(ethylene glycol) monoethyl ether methacrylate) (P(TEGMA-EE)). Confluent fibroblast sheets were effectively cultured and harvested from both commercial PNIPAM-coated dishes and laboratory P(TEGMA-EE)-coated dishes. To transfer a detached cell sheet, two membranes, Immobilon-P(®) and SUPRATHEL(®), were examined. The use of SUPRATHEL for relocating the cell sheets opens a new possibility for the clinical treatment of wounds. This study established the background for implementing thermoresponsive supports for transplanting in vitro cultured fibroblasts. PMID:27153827

  6. Numerical simulation and fabrication of silicon sheet via spin casting.


    Lee, Jaewoo; Kim, Hyunhui; Lee, Changbum; Kim, Joonsoo; Jang, Bo-Yun; Lee, Jinseok; Ahn, Youngsoo; Yoon, Wooyoung


    A spin-casting process for fabricating polycrystalline silicon sheets for use as solar cell wafers is proposed, and the parameters that control the sheet thickness are investigated. A numerical study of the fluidity of molten silicon indicates that the formation of thin silicon sheets without a mold and via spin casting is feasible. The faster the rotation speed of graphite mold, the thinner the thickness of sheet. After the spread of the molten silicon to cover the graphite mold with rotation speed of above 500 rpm, the solidification has to start. Silicon sheets can be produced by using the centrifugal force under appropriate experimental conditions. The spin-cast sheet had a vertical columnar microstructure due to the normal heat extraction to the substrate, and the sheet lifetime varied from 0.1 microS to 0.3 microS measured by using the microwave photoconductance decay (MW-PCD) to confirm that the spin-cast silicon sheet is applicable to photovoltaics. PMID:23858887

  7. Characteristics of liquid sheets formed by splash plate nozzles

    NASA Astrophysics Data System (ADS)

    Ahmed, M.; Amighi, A.; Ashgriz, N.; Tran, H. N.


    An experimental study was conducted to identify the effect of viscosity on the characteristics of liquid sheets formed by a splash plate nozzle. Various mixtures of corn syrup and water are used to obtain viscosities in the range 1-170 mPa.s. Four different splash plates with nozzle diameters of 0.5, 0.75, 1, and 2 mm, with a constant plate angle of 55° were tested. Liquid sheets formed under various operating conditions were directly visualized. The sheet atomization process for the range of parameters studied here is governed by two different mechanisms: Rayleigh-Plateau (R-P) and Rayleigh-Taylor (R-T) instabilities. R-P occurs at the rim and R-T occurs on the thin sheet. The rim instability can be laminar or turbulent, depending on the jet Reynolds number. The R-T instability of the sheet is observed at the outer edges of the radially spreading sheet, where the sheet is the thinnest. It can also occur inside the sheet, due to formation of holes and ruptures.

  8. Binding of cationic peptides (KX)4K to DPPG bilayers. Increasing the hydrophobicity of the uncharged amino acid X drives formation of membrane bound β-sheets: A DSC and FT-IR study.


    Hädicke, André; Blume, Alfred


    The binding of cationic peptides of the sequence (KX)4K to lipid vesicles of negatively charged dipalmitoyl-phosphatidylglycerol (DPPG) was investigated by differential scanning calorimetry (DSC) and temperature dependent Fourier-transformed infrared (FT-IR) spectroscopy. The hydrophobicity of the uncharged amino acid X was changed from G (glycine) over A (alanine), Abu (α-aminobutyric acid), V (valine) to L (leucine). The binding of the peptides caused an increase of the phase transition temperature (Tm) of DPPG by up to 20°C. The shift depended on the charge ratio and on the hydrophobicity of the amino acid X. Unexpectedly, the upward shift of Tm increased with increasing hydrophobicity of X. FT-IR spectroscopy showed a shift of the CH2 stretching vibrations of DPPG to lower frequency, particularly for bilayers in the liquid-crystalline phase, indicating an ordering of the hydrocarbon chains when the peptides were bound. Changes in the lipid C=O vibrational band indicated a dehydration of the lipid headgroup region after peptide binding. (KG)4K was bound in an unordered structure at all temperatures. All other peptides formed intermolecular antiparallel β-sheets, when bound to gel phase DPPG. However, for (KA)4K and (KAbu)4K, the β-sheets converted into an unordered structure above Tm. In contrast, the β-sheet structures of (KV)4K and (KL)4K remained stable even at 80°C when bound to the liquid-crystalline phase of DPPG. Strong aggregation of DPPG vesicles occurred after peptide binding. For the aggregates, we suggest a structure, where aggregated single β-sheets are sandwiched between opposing DPPG bilayers with a dehydrated interfacial region. PMID:26903220

  9. Raman and AFM study of gamma irradiated plastic bottle sheets

    SciTech Connect

    Ali, Yasir; Kumar, Vijay; Dhaliwal, A. S.; Sonkawade, R. G.


    In this investigation, the effects of gamma irradiation on the structural properties of plastic bottle sheet are studied. The Plastic sheets were exposed with 1.25MeV {sup 60}Co gamma rays source at various dose levels within the range from 0-670 kGy. The induced modifications were followed by micro-Raman and atomic force microscopy (AFM). The Raman spectrum shows the decrease in Raman intensity and formation of unsaturated bonds with an increase in the gamma dose. AFM image displays rough surface morphology after irradiation. The detailed Raman analysis of plastic bottle sheets is presented here, and the results are correlated with the AFM observations.

  10. Destabilization of 2D magnetic current sheets by resonance with bouncing electron - a new theory

    NASA Astrophysics Data System (ADS)

    Fruit, Gabriel; Louarn, Philippe; Tur, Anatoly


    In the general context of understanding the possible destabilization of the magnetotail before a substorm, we propose a kinetic model for electromagnetic instabilities in resonant interaction with trapped bouncing electrons. The geometry is clearly 2D and uses Harris sheet profile. Fruit et al. 2013 already used this model to investigate the possibilities of electrostatic instabilities. Tur et al. 2014 generalizes the model for full electromagnetic perturbations. Starting with a modified Harris sheet as equilibrium state, the linearized gyrokinetic Vlasov equation is solved for electromagnetic fluctuations with period of the order of the electron bounce period (a few seconds). The particle motion is restricted to its first Fourier component along the magnetic field and this allows the complete time integration of the non local perturbed distribution functions. The dispersion relation for electromagnetic modes is finally obtained through the quasi neutrality condition and the Ampere's law for the current density. The present talk will focus on the main results of this theory. The electrostatic version of the model may be applied to the near-Earth environment (8-12 R_{E}) where beta is rather low. It is showed that inclusion of bouncing electron motion may enhance strongly the growth rate of the classical drift wave instability. This model could thus explain the generation of strong parallel electric fields in the ionosphere and the formation of aurora beads with wavelength of a few hundreds of km. In the electromagnetic version, it is found that for mildly stretched current sheet (B_{z} > 0.1 B _{lobes}) undamped modes oscillate at typical electron bounce frequency with wavelength of the order of the plasma sheet thickness. As the stretching of the plasma sheet becomes more intense, the frequency of these normal modes decreases and beyond a certain threshold in B_{z}/B _{lobes}, the mode becomes explosive (pure imaginary frequency) with typical growing rate of a few

  11. Cross-talk between integrins {alpha}1{beta}1 and {alpha}2{beta}1 in renal epithelial cells

    SciTech Connect

    Abair, Tristin D.; Sundaramoorthy, Munirathinam; Chen, Dong; Heino, Jyrki; Ivaska, Johanna; Hudson, Billy G.; Sanders, Charles R.; Pozzi, Ambra; Zent, Roy


    The collagen-binding integrins {alpha}1{beta}1 and {alpha}2{beta}1 have profoundly different functions, yet they are often co-expressed in epithelial cells. When both integrins are expressed in the same cell, it has been suggested that {alpha}1{beta}1 negatively regulates integrin {alpha}2{beta}1-dependent functions. In this study we utilized murine ureteric bud (UB) epithelial cells, which express no functionally detectable levels of endogenous integrins {alpha}1{beta}1 and {alpha}2{beta}1, to determine the mechanism whereby this regulation occurs. We demonstrate that UB cells expressing integrin {alpha}2{beta}1, but not {alpha}1{beta}1 adhere, migrate and proliferate on collagen I as well as form cellular cords in 3D collagen I gels. Substitution of the transmembrane domain of the integrin {alpha}2 subunit with that of {alpha}1 results in decreased cell adhesion, migration and cord formation. In contrast, substitution of the integrin {alpha}2 cytoplasmic tail with that of {alpha}1, decreases cell migration and cord formation, but increases proliferation. When integrin {alpha}1 and {alpha}2 subunits are co-expressed in UB cells, the {alpha}1 subunit negatively regulates integrin {alpha}2{beta}1-dependent cord formation, adhesion and migration and this inhibition requires expression of both {alpha}1 and {alpha}2 tails. Thus, we provide evidence that the transmembrane and cytoplasmic domains of the {alpha}2 integrin subunit, as well as the {alpha}1 integrin subunit, regulate integrin {alpha}2{beta}1 cell function.

  12. Functional polymer sheet patterning using microfluidics.


    Li, Minggan; Humayun, Mouhita; Kozinski, Janusz A; Hwang, Dae Kun


    Poly(dimethylsiloxane) (PDMS)-based microfluidics provide a novel approach to advanced material synthesis. While PDMS has been successfully used in a wide range of industrial applications, due to the weak mechanical property channels generally possess low aspect ratios (AR) and thus produce microparticles with similarly low ARs. By increasing the channel width to nearly 1 cm, AR to 267, and implementing flow lithography, we were able to establish the slit-channel lithography. Not only does this allow us to synthesize sheet materials bearing multiscale features and tunable chemical anisotropy but it also allows us to fabricate functional layered sheet structures in a one-step, high-throughput fashion. We showcased the technique's potential role in various applications, such as the synthesis of planar material with micro- and nanoscale features, surface morphologies, construction of tubular and 3D layered hydrogel tissue scaffolds, and one-step formation of radio frequency identification (RFID) tags. The method introduced offers a novel route to functional sheet material synthesis and sheet system fabrication. PMID:24967616



    Henderson, O.A.


    An ion-electron plasma heating apparatus of the pinch tube class was developed wherein a plasma is formed by an intense arc discharge through a gas and is radially constricted by the magnetic field of the discharge. To avoid kink and interchange instabilities which can disrupt a conventional arc shortiy after it is formed, the apparatus is a pinch tube with a flat configuration for forming a sheet of plasma between two conductive plates disposed parallel and adjacent to the plasma sheet. Kink instabilities are suppressed by image currents induced in the conductive plates while the interchange instabilities are neutrally stable because of the flat plasma configuration wherein such instabilities may occur but do not dynamically increase in amplitude. (AEC)

  14. Biomolecular Science (Fact Sheet)

    SciTech Connect

    Not Available


    A brief fact sheet about NREL Photobiology and Biomolecular Science. The research goal of NREL's Biomolecular Science is to enable cost-competitive advanced lignocellulosic biofuels production by understanding the science critical for overcoming biomass recalcitrance and developing new product and product intermediate pathways. NREL's Photobiology focuses on understanding the capture of solar energy in photosynthetic systems and its use in converting carbon dioxide and water directly into hydrogen and advanced biofuels.

  15. Topographical atlas sheets

    USGS Publications Warehouse

    Wheeler, George Montague


    The following topographical atlas sheets, accompanying Appendix J.J. of the Annual Report of the Chief of Engineers, U.S. Army-being Annual Report upon U. S. Geographical Surveys-have been published during the fiscal year ending June 30, 1876, and are a portion of the series projected to embrace the territory of the United States lying west of the 100th meridian.

  16. Silicon sheet surface studies

    NASA Astrophysics Data System (ADS)

    Danyluk, S.


    Results of the program are presented on developing an understanding of the basic mechanisms of abrasion and wear of silicon and on the nondestructive measurement of residual stresses in sheet silicon. Experiments were conducted at various temperatures and in the presence of various fluids. In abrasive wear, it was shown that dislocations, microtwins, and cracks are generated beneath the contact surface. Residual stresses in ribbon by the edge defined film growth process were measured by use of a shadow moire interferometry technique.

  17. Clean Cities Fact Sheet

    SciTech Connect

    Not Available


    This fact sheet explains the Clean Cities Program and provides contact information for all coalitions and regional offices. It answers key questions such as: What is the Clean Cities Program? What are alternative fuels? How does the Clean Cities Program work? What sort of assistance does Clean Cities offer? What has Clean Cities accomplished? What is Clean Cities International? and Where can I find more information?

  18. Latent TGF-[beta] structure and activation

    SciTech Connect

    Shi, Minlong; Zhu, Jianghai; Wang, Rui; Chen, Xing; Mi, Lizhi; Walz, Thomas; Springer, Timothy A.


    Transforming growth factor (TGF)-{beta} is stored in the extracellular matrix as a latent complex with its prodomain. Activation of TGF-{beta}1 requires the binding of {alpha}v integrin to an RGD sequence in the prodomain and exertion of force on this domain, which is held in the extracellular matrix by latent TGF-{beta} binding proteins. Crystals of dimeric porcine proTGF-{beta}1 reveal a ring-shaped complex, a novel fold for the prodomain, and show how the prodomain shields the growth factor from recognition by receptors and alters its conformation. Complex formation between {alpha}v{beta}6 integrin and the prodomain is insufficient for TGF-{beta}1 release. Force-dependent activation requires unfastening of a 'straitjacket' that encircles each growth-factor monomer at a position that can be locked by a disulphide bond. Sequences of all 33 TGF-{beta} family members indicate a similar prodomain fold. The structure provides insights into the regulation of a family of growth and differentiation factors of fundamental importance in morphogenesis and homeostasis.

  19. Method for effectively maintaining the thickness of mouthguards fabricated using EVA sheets and a circle tray: influence of grooved sheet and heating conditions.


    Takahashi, Mutsumi; Koide, Kaoru; Iwasaki, Shin-Ichi


    The shapes of ethylene vinyl acetate (EVA) sheets are mainly square or round. The aim of this study was to elucidate a fabrication method that effectively maintains the thickness of the round sheet. Mouthguards were fabricated using EVA sheets (diameter 125 mm, thickness 4.0 mm) and a vacuum-forming machine. The sheet was pinched at the top and bottom and stabilized by the circle tray. Two heating conditions were compared: (i) the sheet was molded when it sagged 10 mm below the level of the sheet frame at the top of the post under normal conditions (N); and (ii) the sheet frame was lowered to and heated at 50 mm from the level of ordinary use and molded when it sagged 10 mm from the sheet frame (L). Two EVA sheet shapes were compared: an ordinary sheet (O) and a sheet with a horizontal v-shaped groove 30 mm from the anterior end (G). The height of the working model was 20 mm at the incisor point and 15 mm at the first molar. The sheet temperatures of the heating and non-heated surface were measured by the radiation thermometer. Post-molding thickness was determined for the incisal and molar portion. Differences in the thickness were analyzed using two-way anova. The temperature difference among points was smaller under condition L than under condition N. Thickness after formation was higher in condition L than in condition N, and was higher in condition G than in condition O. At the labial surface and the cusp, L-G was thickest. With the present techniques, uneven softening during heating can be improved by lowering the sheet frame and consequently reducing the reduction in the thickness of the sheet. Additionally, the thickness reduction is reduced by creating a horizontal groove on the sheet, establishing the clinical efficacy of this method. PMID:26446254

  20. Dynamics of dikes versus cone sheets in volcanic systems

    NASA Astrophysics Data System (ADS)

    Galland, Olivier; Burchardt, Steffi; Hallot, Erwan; Mourgues, Régis; Bulois, Cédric


    Igneous sheet intrusions of various shapes, such as dikes and cone sheets, coexist as parts of complex volcanic plumbing systems likely fed by common sources. How they form is fundamental regarding volcanic hazards, but yet no dynamic model simulates and predicts satisfactorily their diversity. Here we present scaled laboratory experiments that reproduced dikes and cone sheets under controlled conditions (Galland et al., 2014). Our models show that their formation is governed by a dimensionless ratio (Π1), which describes the shape of the magma source, and a dynamic dimensionless ratio (Π2), which compares the viscous stresses in the flowing magma to the host-rock strength. Plotting our experiments against these two numbers results in a phase diagram evidencing a dike and a cone-sheet field, separated by a sharp transition that fits a power law. This result shows that dikes and cone sheets correspond to distinct physical regimes of magma emplacement in the crust. For a given host-rock strength, cone sheets preferentially form when the source is shallow, relative to its lateral extent, or when the magma influx velocity (or viscosity) is high. Conversely, dikes form when the source is deep compared to its size, or when magma influx rate (or viscosity) is low. Both dikes and cone sheets may form from the same source, the shift from one regime to the other being then controlled by magma dynamics, i.e., different values of Π2. The extrapolated empirical dike-to-cone sheet transition is in good agreement with the occurrence of dikes and cone sheets in various natural volcanic settings. Galland, O., Burchardt, S., Hallot, E., Mourgues, R., Bulois, C., 2014. Dynamics of dikes versus cone sheets in volcanic systems. Journal of Geophysical Research: Solid Earth, 2014JB011059, 10.1002/2014jb011059.

  1. Nuclear Data Sheets for A = 81

    SciTech Connect

    Baglin, Coral M.


    Nuclear structure data pertaining to all nuclei with mass number A = 81 (Zn, Ga, Ge, As, Se, Br, Kr, Rb, Sr, Y, Zr, Nb) have been compiled and evaluated and incorporated into the ENSDF data file. This publication for A = 81 supersedes the previous publication (Coral M. Baglin, Nuclear Data Sheets79, 447 (1996), literature cutoff 1 November 1996) and the subsequent updates by C. Baglin for {sup 81}Y (literature cutoff 8 October 1998) and {sup 81}Zr (literature cutoff 24 March 2000). All literature available prior to 15 August 2008 has been considered. Subsequent to previous A = 81 evaluations, excited states have been reported for the first time in {sup 81}Ga, and knowledge of excited state properties for {sup 81}Y and {sup 81}Zr has been significantly expanded. However, the expected {epsilon}+{beta}{sup +} decay of {sup 81}Zr has yet to be studied.

  2. Luminescence Chronology for the Formation of Glacial Lake Calgary, Southern Alberta, Canada: Age Constraints for the Initiation of the Late Pleistocene Retreat of the Laurentide Ice Sheet from its Western Margin

    NASA Astrophysics Data System (ADS)

    Munyikwa, K.; Rittenour, T. M.


    Glacial Lake Calgary in southern Alberta, Canada, was a Late Pleistocene proglacial lake that formed along the southwest margin of the Laurentide Ice Sheet (LIS), dammed by the retreating ice sheet margin. Attempts to constrain the age of the lake using radiocarbon methods have been hampered by the lack of datable organic material. In an effort to apply an alternative chronometer, this study uses two optically stimulated luminescence (OSL) dating approaches to date fine grained sand and silt that were deposited in the lake during its existence. OSL dating determines the depositional ages of sediments by measuring the energy from ionizing radiation that is stored in mineral grains such as quartz and feldspar. Dividing the stored energy, also referred to as the paleodose, by the rate at which the dose accumulated, allows an age to be ascertained. In one method applied in this study, the paleodose stored in the feldspar component of the sediment is determined using normalized infrared stimulated luminescence signals acquired using a portable OSL reader. In the second method, blue optically stimulated luminescence signals obtained from quartz separates from the sediment by employing a regular OSL reader and standard protocols are used to determine the paleodose. After correcting the feldspar data for anomalous fading, the age results from the two dating approaches are compared. The ages signify a time period by which the LIS had retreated from the study area and, hence, serve as constraints for the initiation of the retreat of the ice sheet from its western limit. Advantages and limitations of the dating methods are briefly discussed. Constraining the chronology of the retreat of the LIS from western Canada allows for a better understanding of the driving forces behind ice sheet retreat. Secondly, assigning a temporal scale to the postglacial evolution of the environment of the region permits a better insight into the dynamics of the physical and biological

  3. Enzymatic conversion of beta-carotene into beta-apo-carotenals and retinoids by human, monkey, ferret, and rat tissues.


    Wang, X D; Tang, G W; Fox, J G; Krinsky, N I; Russell, R M


    Whether the conversion of beta-carotene into retinoids involves an enzymatic excentric cleavage mechanism was examined in vitro with homogenates prepared from human, monkey, ferret, and rat tissue. Using high-performance liquid chromatography, significant amounts of beta-apo-12'-, -10'-, and -8'-carotenals, retinal, and retinoic acid were found after incubation of intestinal homogenates of the four different species with beta-carotene in the presence of NAD+ and dithiothreitol. No beta-apo-carotenals or retinoids were detected in control incubations done without tissue homogenates. The production of beta-apo-carotenals was linear for 30 min and up to tissue protein concentrations of 1.5 mg/ml. The rate of formation of beta-apo-carotenals from 2 microM beta-carotene was about 7- to 14-fold higher than the rate of retinoid formation in intestinal homogenates, and the rate of beta-apo-carotenal production was fivefold greater in primate intestine vs rat or ferret intestine (P less than 0.05). The amounts of beta-apo-carotenals and retinoids formed were markedly reduced when NAD+ was replaced by NADH, or when dithiothreitol and cofactors were deleted from the incubation mixture. Both beta-apo-carotenal and retinoid production from beta-carotene were inhibited completely by adding disulfiram, an inhibitor of sulfhydryl-containing enzymes. Incubation of beta-carotene with liver, kidney, lung, and fat homogenates from each species also resulted in the appearance of beta-apo-carotenals and retinoids. The identification of three unknown compounds which might be excentric cleavage products is ongoing. These data support the existence of an excentric cleavage mechanism for beta-carotene conversion. PMID:1899329

  4. Characterization of Hydrogels Formed via Intramolecular Folding and Consequent Self-Assembly of Beta-HAIRPIN Peptides

    NASA Astrophysics Data System (ADS)

    Ozbas, Bulent; Pakstis, Lisa; Pochan, Darrin J.; Rajagopal, Karthikan; Gill, Juliana; Schneider, Joel P.


    Stimuli-responsive and biocompatible networks formed via self-assembly serve great opportunities in tissue engineering and drug delivery applications. In this work we present the formation of hydrogels via the intramolecular folding and consequent self-assembly of 20 aminoacid long beta-Hairpin peptide molecules. These hairpin molecules are amphiphilic in nature with an alternating sequence of hydrophobic valine and hydrophilic lysine amino acids. These molecules are found to form hydrogels with a unique microstructure and nanostructure at different physical condition at low peptide concentrations ( ˜ 1 wt %). However, gelation is observed at high pH values ( ˜9) and at high salt concentrations ( ˜150 mM) where beta-sheet secondary structure due to hairpin folding is observed. The intimate relationship between beta-Hairpin molecule turn sequence and the consequent materials properties will be discussed. LSCM data reveals that hydrogel structure is heterogeneous at the microscale with water channels in the order of 10 μm. Cryo-TEM technique shows that the network is consists of interconnected fibrillar/tubular networks. The viscoelastic properties of the hydrogels, as measured by rheology. Importantly, the gel is also reversible with pH, returning to a viscosity of water with a drop in pH that unfolds, and disassembles, the hairpin molecules.

  5. Structural and Mechanical Properties of Amyloid Beta Fibrils: A Combined Experimental and Theoretical Approach.


    Paul, Thomas J; Hoffmann, Zachary; Wang, Congzhou; Shanmugasundaram, Maruda; DeJoannis, Jason; Shekhtman, Alexander; Lednev, Igor K; Yadavalli, Vamsi K; Prabhakar, Rajeev


    In this combined experimental (deep ultraviolet resonance Raman (DUVRR) spectroscopy and atomic force microscopy (AFM)) and theoretical (molecular dynamics (MD) simulations and stress-strain (SS)) study, the structural and mechanical properties of amyloid beta (Aβ40) fibrils have been investigated. The DUVRR spectroscopy and AFM experiments confirmed the formation of linear, unbranched and β-sheet rich fibrils. The fibrils (Aβ40)n, formed using n monomers, were equilibrated using all-atom MD simulations. The structural properties such as β-sheet character, twist, interstrand distance, and periodicity of these fibrils were found to be in agreement with experimental measurements. Furthermore, Young's modulus (Y) = 4.2 GPa computed using SS calculations was supported by measured values of 1.79 ± 0.41 and 3.2 ± 0.8 GPa provided by two separate AFM experiments. These results revealed size dependence of structural and material properties of amyloid fibrils and show the utility of such combined experimental and theoretical studies in the design of precisely engineered biomaterials. PMID:27387853

  6. Experimental realization of two-dimensional boron sheets

    NASA Astrophysics Data System (ADS)

    Feng, Baojie; Zhang, Jin; Zhong, Qing; Li, Wenbin; Li, Shuai; Li, Hui; Cheng, Peng; Meng, Sheng; Chen, Lan; Wu, Kehui


    A variety of two-dimensional materials have been reported in recent years, yet single-element systems such as graphene and black phosphorus have remained rare. Boron analogues have been predicted, as boron atoms possess a short covalent radius and the flexibility to adopt sp2 hybridization, features that favour the formation of two-dimensional allotropes, and one example of such a borophene material has been reported recently. Here, we present a parallel experimental work showing that two-dimensional boron sheets can be grown epitaxially on a Ag(111) substrate. Two types of boron sheet, a β12 sheet and a χ3 sheet, both exhibiting a triangular lattice but with different arrangements of periodic holes, are observed by scanning tunnelling microscopy. Density functional theory simulations agree well with experiments, and indicate that both sheets are planar without obvious vertical undulations. The boron sheets are quite inert to oxidization and interact only weakly with their substrate. We envisage that such boron sheets may find applications in electronic devices in the future.

  7. Eruptive Current Sheets Trailing SOHO/LASCO CMEs

    NASA Astrophysics Data System (ADS)

    Webb, David F.


    Current sheets are important signatures of magnetic reconnection during the eruption of solar magnetic structures. Many models of eruptive flare/Coronal Mass Ejections (CMEs) involve formation of a current sheet connecting the ejecting CME flux rope with the post-eruption magnetic loop arcade. Current sheets have been interpreted in white light images as narrow rays trailing the outward-moving CME, in ultraviolet spectra as narrow, bright hot features, and with different manifestations in other wavebands. This study continues that of Webb et al. (2003), who analyzed SMM white light CMEs having candidate magnetic disconnection features at the base of the CME. About half of those were followed by coaxial, bright rays suggestive of newly formed current sheets, and Webb et al. (2003) presented detailed results of analysis of those structures. In this work we extend the study of white light eruptive current sheets to the more sensitive and extensive SOHO/LASCO coronagraph data on CMEs. We comprehensively examined all LASCO CMEs during two periods that we identify with the minimum and maximum activity of solar cycle 23. We identified ~130 ray/current sheets during these periods, nearly all of which trailed CMEs with concave-outward backs. The occurrence rate of the ray/current sheets is 6-7% of all CMEs, irrespective of the solar cycle. We analyze the rays for durations, speeds, alignments, and motions and compare the observational results with some model predictions.

  8. Experimental realization of two-dimensional boron sheets.


    Feng, Baojie; Zhang, Jin; Zhong, Qing; Li, Wenbin; Li, Shuai; Li, Hui; Cheng, Peng; Meng, Sheng; Chen, Lan; Wu, Kehui


    A variety of two-dimensional materials have been reported in recent years, yet single-element systems such as graphene and black phosphorus have remained rare. Boron analogues have been predicted, as boron atoms possess a short covalent radius and the flexibility to adopt sp(2) hybridization, features that favour the formation of two-dimensional allotropes, and one example of such a borophene material has been reported recently. Here, we present a parallel experimental work showing that two-dimensional boron sheets can be grown epitaxially on a Ag(111) substrate. Two types of boron sheet, a β12 sheet and a χ3 sheet, both exhibiting a triangular lattice but with different arrangements of periodic holes, are observed by scanning tunnelling microscopy. Density functional theory simulations agree well with experiments, and indicate that both sheets are planar without obvious vertical undulations. The boron sheets are quite inert to oxidization and interact only weakly with their substrate. We envisage that such boron sheets may find applications in electronic devices in the future. PMID:27219700

  9. The selectivity of beta-adrenoceptor antagonists at the human beta1, beta2 and beta3 adrenoceptors.


    Baker, Jillian G


    Beta-adrenoceptor antagonists ("beta-blockers") are one of the most widely used classes of drugs in cardiovascular medicine (hypertension, ischaemic heart disease and increasingly in heart failure) as well as in the management of anxiety, migraine and glaucoma. Where known, the mode of action in cardiovascular disease is from antagonism of endogenous catecholamine responses in the heart (mainly at beta1-adrenoceptors), while the worrisome side effects of bronchospasm result from airway beta2-adrenoceptor blockade. The aim of this study was to determine the selectivity of beta-antagonists for the human beta-adrenoceptor subtypes. (3)H-CGP 12177 whole cell-binding studies were undertaken in CHO cell lines stably expressing either the human beta1-, beta2- or the beta3-adrenoceptor in order to determine the affinity of ligands for each receptor subtype in the same cell background. In this study, the selectivity of well-known subtype-selective ligands was clearly demonstrated: thus, the selective beta1 antagonist CGP 20712A was 501-fold selective over beta2 and 4169-fold selective over beta3; the beta2-selective antagonist ICI 118551 was 550- and 661-fold selective over beta1 and beta3, respectively, and the selective beta3 compound CL 316243 was 10-fold selective over beta2 and more than 129-fold selective over beta1. Those beta2-adrenoceptor agonists used clinically for the treatment of asthma and COPD were beta2 selective: 29-, 61- and 2818-fold for salbutamol, terbutaline and salmeterol over beta1, respectively. There was little difference in the affinity of these ligands between beta1 and beta3 adrenoceptors. The clinically used beta-antagonists studied ranged from bisoprolol (14-fold beta1-selective) to timolol (26-fold beta2-selective). However, the majority showed little selectivity for the beta1- over the beta2-adrenoceptor, with many actually being more beta2-selective. This study shows that the beta1/beta2 selectivity of most clinically used beta-blockers is

  10. Looking for a generic inhibitor of amyloid-like fibril formation among flavone derivatives

    PubMed Central

    Šneideris, Tomas; Baranauskienė, Lina; Cannon, Jonathan G.; Rutkienė, Rasa; Meškys, Rolandas


    A range of diseases is associated with amyloid fibril formation. Despite different proteins being responsible for each disease, all of them share similar features including beta-sheet-rich secondary structure and fibril-like protein aggregates. A number of proteins can form amyloid-like fibrils in vitro, resembling structural features of disease-related amyloids. Given these generic structural properties of amyloid and amyloid-like fibrils, generic inhibitors of fibril formation would be of interest for treatment of amyloid diseases. Recently, we identified five outstanding inhibitors of insulin amyloid-like fibril formation among the pool of 265 commercially available flavone derivatives. Here we report testing of these five compounds and of epi-gallocatechine-3-gallate (EGCG) on aggregation of alpha-synuclein and beta-amyloid. We used a Thioflavin T (ThT) fluorescence assay, relying on halftimes of aggregation as the measure of inhibition. This method avoids large numbers of false positive results. Our data indicate that four of the five flavones and EGCG inhibit alpha-synuclein aggregation in a concentration-dependent manner. However none of these derivatives were able to increase halftimes of aggregation of beta-amyloid. PMID:26421240

  11. High Beta Tokamaks

    SciTech Connect

    Cowley, S.


    Perhaps the ideal tokamak would have high {beta} ({beta} {approx}> 1) and classical confinement. Such a tokamak has not been found, and we do not know if one does exist. We have searched for such a possibility, so far without success. In 1990, we obtained analytic equilibrium solutions for large aspect ratio tokamaks at {beta} {approx} {Omicron}(1) [1]. These solutions and the extension at high {beta} poloidal to finite aspect ratio [2] provided a basis for the study of high {beta} tokamaks. We have shown that these configurations can be stable to short scale MHD modes [3], and that they have reduced neoclassical transport [4]. Microinstabilities (such as the {del}T{sub i} mode) seem to be stabilized at high {beta} [5] - this is due to the large local shear [3] and the magnetic well. We have some concerns about modes associated with the compressional branch which may appear at high {beta}. Bill Dorland and Mike Kotschenreuther have studied this issue and our concerns may be unfounded. It is certainly tantalizing, especially given the lowered neoclassical transport values, that these configurations could have no microinstabilities and, one could assume, no anomalous transport. Unfortunately, while this work is encouraging, the key question for high {beta} tokamaks is the stability to large scale kink modes. The MHD {beta} limit (Troyon limit) for kink modes at large aspect ratio is problematically low. There is ample evidence from computations that the limit exists. However, it is not known if stable equilibria exist at much higher {beta}--none have been found. We have explored this question in the asymptotic high {beta} poloidal limit. Unfortunately, we are unable to find stable equilibrium and also unable to show that they don't exist. The results of these calculations will be published when a more definitive answer is found.

  12. Synchrotron-based Infrared and X-ray Imaging Shows Focalized Accumulation of Cu and Zn Co-localized With Beta-amyloid Deposits in Alzheimer's Disease

    SciTech Connect

    Miller,L.; Wang, Q.; Telivala, T.; Smith, R.; Lanzirotti, A.; Miklossy, J.


    Alzheimer's disease (AD) is characterized by the misfolding and plaque-like accumulation of a naturally occurring peptide in the brain called amyloid beta (Abeta). Recently, this process has been associated with the binding of metal ions such as iron (Fe), copper (Cu), and zinc (Zn). It is thought that metal dyshomeostasis is involved in protein misfolding and may lead to oxidative stress and neuronal damage. However, the exact role of the misfolded proteins and metal ions in the degenerative process of AD is not yet clear. In this study, we used synchrotron Fourier transform infrared micro-spectroscopy (FTIRM) to image the in situ secondary structure of the amyloid plaques in brain tissue of AD patients. These results were spatially correlated with metal ion accumulation in the same tissue sample using synchrotron X-ray fluorescence (SXRF) microprobe. For both techniques, a spatial resolution of 5-10 microm was achieved. FTIRM results showed that the amyloid plaques have elevated beta-sheet content, as demonstrated by a strong amide I absorbance at 1625cm(-1). Using SXRF microprobe, we find that AD tissue also contains 'hot spots' of accumulated metal ions, specifically Cu and Zn, with a strong spatial correlation between these two ions. The 'hot spots' of accumulated Zn and Cu were co-localized with beta-amyloid plaques. Thus for the first time, a strong spatial correlation has been observed between elevated beta-sheet content in Abeta plaques and accumulated Cu and Zn ions, emphasizing an association of metal ions with amyloid formation in AD.

  13. A Single Mutation at the Sheet Switch Region Results in Conformational Changes Favoring 6 Light-Chain Fibrillogenesis

    SciTech Connect

    Hernández-Santoyo, A.; Del Pozo Yauner, L; Fuentes-Silva, D; Ortiz, E; Rudiño-Piñera, E; Sánchez-López, R; Horjales, E; Becerril, B; Rodríguez-Romero, A


    Systemic amyloid light-chain (LC) amyloidosis is a disease process characterized by the pathological deposition of monoclonal LCs in tissue. All LC subtypes are capable of fibril formation although {lambda} chains, particularly those belonging to the {lambda}6 type, are overrepresented. Here, we report the thermodynamic and in vitro fibrillogenic properties of several mutants of the {lambda}6 protein 6aJL2 in which Pro7 and/or His8 was substituted by Ser or Pro. The H8P and H8S mutants were almost as stable as the wild-type protein and were poorly fibrillogenic. In contrast, the P7S mutation decreased the thermodynamic stability of 6aJL2 and greatly enhanced its capacity to form amyloid-like fibrils in vitro. The crystal structure of the P7S mutant showed that the substitution induced both local and long-distance effects, such as the rearrangement of the VL (variable region of the light chain)-VL interface. This mutant crystallized in two orthorhombic polymorphs, P2{sub 1}2{sub 1}2{sub 1} and C222{sub 1}. In the latter, a monomer that was not arranged in the typical Bence-Jones dimer was observed for the first time. Crystal-packing analysis of the C222{sub 1} lattice showed the establishment of intermolecular {beta}-{beta} interactions that involved the N-terminus and {beta}-strand B and that these could be relevant in the mechanism of LC fibril formation. Our results strongly suggest that Pro7 is a key residue in the conformation of the N-terminal sheet switch motif and, through long-distance interactions, is also critically involved in the contacts that stabilized the VL interface in {lambda}6 LCs.

  14. Investigation of the beta-cyclodextrin-hydrocortisone inclusion compound.


    Frank, S G; Kavaliunas, D R


    The formation of an inclusion compound by beta-cyclodextrin with hydrocortisone has been studied by proton magnetic resonance (1H-NMR) and phase solubility analysis. The magnitude of the chemical shifts of the interior and exterior beta-cyclodextrin protons in the presence of hydrocortisone indicated that hydrocortisone is included within the beta-cyclodextrin cavity and probably interacts with protons on the edge of the torus. The overall stoichiometry of the inclusion compound was not a single, simple relationship, but was unusual in that it was variable and apparently dependent on the relative amounts of hydrocortisone and beta-cyclodextrin in the system. PMID:6644576

  15. Anthropogenic climate change and the Greenland ice sheet

    NASA Astrophysics Data System (ADS)

    Mikolajewicz, U.; Vizcaíno, M.; Rodehacke, C.; Ziemen, F.


    In the standard CMIP5 simulations the ice sheets are kept fixed. Only few groups have been able to perform CMIP5 simulations with interactively coupled ice sheet models. Beside its importance for the future evolution of global mean sea level, the Greenland ice sheet also has the potential to strongly affect deep water formation, especially in the Labrador Sea, but also in the Nordic Seas. Here we present a set of simulations with two interactively coupled ice sheet models, which allows to assess the uncertainty arising from both the ice sheet model as well as the coupling technique. The climate model ECHAM5/MPIOM is coupled interactively to two different ice sheet models using two different coupling strategies. The ice sheet models are a Greenland set-up of SICOPOLIS with 10 km horizontal resolution and a northern hemisphere set-up of PISM with a horizontal resolution of 20 km. The coupling is done either with a simple positive degree days approach or a mass-balance scheme calculating the surface melting with an energy-balance scheme. The atmospheric forcing is applied directly to the ice sheet model without flux correction or anomaly coupling, which avoids inconsistencies between the models. The resulting net mass loss rates for the Greenland ice sheet in a 1-percent-scenario capped at 4x preindustrial atmospheric CO2 concentrations show a considerable dependence on both ice sheet model and coupling technique. The resulting differences in atmospheric climate, however, are small within the first centuries and restricted to the immediate vicinity of Greenland. The feedbacks between atmosphere, ocean and the Greenland ice sheet are studied in a series of sensitivity experiments, where individual feedbacks were suppressed. It turns out that the future development of the Atlantic overturning and its associated heat transport are quite important for the future evolution of the Greenland ice sheet: The stronger the Atlantic overturning remains, the stronger the mass loss

  16. Beta-Carotene

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Beta-carotene is a pigment that occurs naturally in many photosynthetic plants and organisms and one of the most abundant carotenoids found in human blood. The richest dietary sources of beta-carotene are yellow, orange, and leafy green fruits and vegetables, such as carrots, spinach, sweet potatoes...


    EPA Science Inventory

    This manual provides description and operating instructions for a redesigned Beta Gauge for measuring particles from vehicle exhaust. The improvements and a new control system including a control unit which is radically different from the prior unit, are described. Complete Beta ...


    SciTech Connect

    Gosling, J. T.; Phan, T. D.


    Using Wind 3 s plasma and magnetic field data, we have identified nine reconnection exhausts within a solar wind disturbance on 1998 October 18-20 driven by a moderately fast interplanetary coronal mass ejection (ICME). Three of the exhausts within the ICME were associated with current sheets having local field shear angles, {theta}, ranging from 4 Degree-Sign to 9 Degree-Sign , the smallest reported values of {theta} yet associated with reconnection exhausts in a space plasma. They were observed in plasma characterized by extremely low (0.02-0.04) plasma {beta}, and very high (281-383 km s{sup -1}) Alfven speed, V{sub A}. Low {beta} allows reconnection to occur at small {theta} and high V{sub A} leads to exhaust jets that are fast enough relative to the surrounding solar wind to be readily identified. Very small-{theta} current sheets are common in the solar wind at 1 AU, but typically are not associated with particularly low plasma {beta} or high V{sub A}. On the other hand, small-{theta} current sheets should be common in the lower solar corona, a plasma regime of extremely low {beta} and extremely high V{sub A}. Our observations lend credence to models that predict that reconnection at small-{theta} current sheets is primarily responsible for coronal heating.

  19. Ice sheets and nitrogen

    PubMed Central

    Wolff, Eric W.


    Snow and ice play their most important role in the nitrogen cycle as a barrier to land–atmosphere and ocean–atmosphere exchanges that would otherwise occur. The inventory of nitrogen compounds in the polar ice sheets is approximately 260 Tg N, dominated by nitrate in the much larger Antarctic ice sheet. Ice cores help to inform us about the natural variability of the nitrogen cycle at global and regional scale, and about the extent of disturbance in recent decades. Nitrous oxide concentrations have risen about 20 per cent in the last 200 years and are now almost certainly higher than at any time in the last 800 000 years. Nitrate concentrations recorded in Greenland ice rose by a factor of 2–3, particularly between the 1950s and 1980s, reflecting a major change in NOx emissions reaching the background atmosphere. Increases in ice cores drilled at lower latitudes can be used to validate or constrain regional emission inventories. Background ammonium concentrations in Greenland ice show no significant recent trend, although the record is very noisy, being dominated by spikes of input from biomass burning events. Neither nitrate nor ammonium shows significant recent trends in Antarctica, although their natural variations are of biogeochemical and atmospheric chemical interest. Finally, it has been found that photolysis of nitrate in the snowpack leads to significant re-emissions of NOx that can strongly impact the regional atmosphere in snow-covered areas. PMID:23713125

  20. Twisting of sheet metals

    NASA Astrophysics Data System (ADS)

    Pham, C. H.; Thuillier, S.; Manach, P. Y.


    Twisting of metallic sheets is one particular mode of springback that occurs after drawing of elongated parts, i.e. with one dimension much larger than the two others. In this study, a dedicated device for drawing of elongated part with a U-shaped section has been designed on purpose, in order to obtain reproducible data. Very thin metallic sheet, of thickness 0.15 mm, has been used, so that the maximum length of the part is 100 mm. Two different orientations of the part with respect to the tools have been chosen: either aligned with the tools, or purposefully misaligned by 2°. Several samples were drawn for each configuration, leading to the conclusion that almost no twisting occurs in the first case whereas a significant one can be measured for the second one. In a second step, 2D and 3D numerical simulations within the implicit framework for drawing and springback were carried out. A mixed hardening law associated to von Mises yield criterion represents accurately the mechanical behavior of the material. This paper highlights a comparison of numerical predictions with experiments, e.g. the final shape of the part and the twisting parameter.

  1. On the origin of the beta cell.


    Oliver-Krasinski, Jennifer M; Stoffers, Doris A


    The major forms of diabetes are characterized by pancreatic islet beta-cell dysfunction and decreased beta-cell numbers, raising hope for cell replacement therapy. Although human islet transplantation is a cell-based therapy under clinical investigation for the treatment of type 1 diabetes, the limited availability of human cadaveric islets for transplantation will preclude its widespread therapeutic application. The result has been an intense focus on the development of alternate sources of beta cells, such as through the guided differentiation of stem or precursor cell populations or the transdifferentiation of more plentiful mature cell populations. Realizing the potential for cell-based therapies, however, requires a thorough understanding of pancreas development and beta-cell formation. Pancreas development is coordinated by a complex interplay of signaling pathways and transcription factors that determine early pancreatic specification as well as the later differentiation of exocrine and endocrine lineages. This review describes the current knowledge of these factors as they relate specifically to the emergence of endocrine beta cells from pancreatic endoderm. Current therapeutic efforts to generate insulin-producing beta-like cells from embryonic stem cells have already capitalized on recent advances in our understanding of the embryonic signals and transcription factors that dictate lineage specification and will most certainly be further enhanced by a continuing emphasis on the identification of novel factors and regulatory relationships. PMID:18676806


    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    17. INTAKE PIER, BRIDGE STRESS SHEET, SHEET 8 OF 117, 1920. - Sacramento River Water Treatment Plant Intake Pier & Access Bridge, Spanning Sacramento River approximately 175 feet west of eastern levee on river; roughly .5 mile downstream from confluence of Sacramento & American Rivers, Sacramento, Sacramento County, CA

  3. 9. Photograph of sheet 1 (index and title sheet) of ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    9. Photograph of sheet 1 (index and title sheet) of the State Highway Department of Indiana repair plans of 1957 for the Cicott Street Bridge. Photograph of a 24' by 36' print made from microfilm in the archives of the Indiana Department of Transportation in Indianapolis. - Cicott Street Bridge, Spanning Wabash River at State Road 25, Logansport, Cass County, IN

  4. 13. Photograph of sheet 1 (index and title sheet) of ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    13. Photograph of sheet 1 (index and title sheet) of the Indiana State Highway Commission repair plans of 1969 for the Cicott Street Bridge. Photograph of a 24' by 36' print made from microfilm in the archives of the Indiana Department of Transportation in Indianapolis. - Cicott Street Bridge, Spanning Wabash River at State Road 25, Logansport, Cass County, IN

  5. 10. KIDNER BRIDGE STRUCTURAL STEEL DETAIL SHEET (original plan sheet ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    10. KIDNER BRIDGE STRUCTURAL STEEL DETAIL SHEET (original plan sheet is in possession of Ball State University, Drawings and Documents Archive, COllege of Architecture and Planing, Ball State University, Muncie, Indiana, 47306 - Kidner Bridge, Spanning Mississinewa River at County Road 700 South, Upland, Grant County, IN

  6. Method for heating a glass sheet


    Boaz, P.T.


    A method for heating a glass sheet includes the steps of heating a glass sheet to a first predetermined temperature and applying microwave energy to the glass sheet to heat the glass sheet to at least a second predetermined temperature to allow the glass sheet to be formed. 5 figs.

  7. Method for heating a glass sheet


    Boaz, Premakaran Tucker


    A method for heating a glass sheet includes the steps of heating a glass sheet to a first predetermined temperature and applying microwave energy to the glass sheet to heat the glass sheet to at least a second predetermined temperature to allow the glass sheet to be formed.

  8. Rapid synthesis of beta zeolites

    SciTech Connect

    Fan, Wei; Chang, Chun -Chih; Dornath, Paul; Wang, Zhuopeng


    The invention provides methods for rapidly synthesizing heteroatom containing zeolites including Sn-Beta, Si-Beta, Ti-Beta, Zr-Beta and Fe-Beta. The methods for synthesizing heteroatom zeolites include using well-crystalline zeolite crystals as seeds and using a fluoride-free, caustic medium in a seeded dry-gel conversion method. The Beta zeolite catalysts made by the methods of the invention catalyze both isomerization and dehydration reactions.

  9. Silicone Coating on Polyimide Sheet

    NASA Technical Reports Server (NTRS)

    Park, J. J.


    Silicone coatings applied to polyimide sheeting for variety of space-related applications. Coatings intended to protect flexible substrates of solar-cell blankets from degradation by oxygen atoms, electrons, plasmas, and ultraviolet light in low Earth orbit and outer space. Since coatings are flexible, generally useful in forming flexible laminates or protective layers on polyimide-sheet products.

  10. Cutting Guide for Fibrous Sheets

    NASA Technical Reports Server (NTRS)

    Warren, A., D.


    Tool facilitates repetitive cutting of fibrous sheets. Flexible aluminum tape allows metal strips folded back on themselves, exposing fresh material for cutting. More than one strip folded back, and cutting width therefore increased in multiples of strip width. Developed for cutting strips of alumina-fiber matting, tool also used on such materials as felts, textiles, and sheet metals.

  11. Active volcanism beneath the West Antarctic ice sheet and implications for ice-sheet stability

    USGS Publications Warehouse

    Blankenship, D.D.; Bell, R.E.; Hodge, S.M.; Brozena, J.M.; Behrendt, John C.; Finn, C.A.


    IT is widely understood that the collapse of the West Antarctic ice sheet (WAIS) would cause a global sea level rise of 6 m, yet there continues to be considerable debate about the detailed response of this ice sheet to climate change1-3. Because its bed is grounded well below sea level, the stability of the WAIS may depend on geologically controlled conditions at the base which are independent of climate. In particular, heat supplied to the base of the ice sheet could increase basal melting and thereby trigger ice streaming, by providing the water for a lubricating basal layer of till on which ice streams are thought to slide4,5. Ice streams act to protect the reservoir of slowly moving inland ice from exposure to oceanic degradation, thus enhancing ice-sheet stability. Here we present aerogeophysical evidence for active volcanism and associated elevated heat flow beneath the WAIS near the critical region where ice streaming begins. If this heat flow is indeed controlling ice-stream formation, then penetration of ocean waters inland of the thin hot crust of the active portion of the West Antarctic rift system could lead to the disappearance of ice streams, and possibly trigger a collapse of the inland ice reservoir.

  12. [Clip Sheets from BOCES. Opportunities. Health. Careers. = Oportunidades. Salud. Una Camera En...

    ERIC Educational Resources Information Center

    State Univ. of New York, Geneseo. Coll. at Geneseo. Migrant Center.

    This collection of 83 clip sheets, or classroom handouts, was created to help U.S. migrants learn more about health, careers, and general "opportunities" including education programs. They are written in both English and Spanish and are presented in an easily understandable format. Health clip-sheet topics include the following: Abuse; AIDS;…

  13. Modern processes of production of thin sheets and strips by continuous casting

    NASA Astrophysics Data System (ADS)

    Smirnov, A. N.


    The history of the development of producing thin sheets and strips by continuous casting methods is considered. The mechanism of this sheet formation during casting of steel in a two-roll continuous caster is described. The advantages of this process over the corresponding traditional technologies are discussed.

  14. Treatment of refractory cutaneous ulcers with mixed sheets consisting of peripheral blood mononuclear cells and fibroblasts.


    Ueno, Koji; Takeuchi, Yuriko; Samura, Makoto; Tanaka, Yuya; Nakamura, Tamami; Nishimoto, Arata; Murata, Tomoaki; Hosoyama, Tohru; Hamano, Kimikazu


    The purpose of this study was to confirm the therapeutic effects of mixed sheets consisting of peripheral blood mononuclear cells (PBMNCs) and fibroblasts on cutaneous skin ulcers. Vascular endothelial growth factor (VEGF) secretion in mixed cell sheets was much higher than in PBMNCs and fibroblasts. Concerning the mechanism, transforming growth factor beta 1 and platelet-derived growth factor BB secreted from PBMNCs enhanced VEGF production in fibroblasts. In wounds created on the backs of diabetic mice, the therapeutic effect of mixed cell sheets was similar to that of daily treatment with trafermin, a recombinant human basic fibroblast growth factor. Although abnormal granulation tissue and inflammatory cell infiltration were observed in trafermin-treated wounds, the transplantation of mixed cell sheets resulted in the natural anatomy of subcutaneous tissues. The expression patterns of identical wound-healing factors in wounds were different between mixed sheet-transfected and trafermin-treated animals. Because mixed cell sheets transplanted into full-thickness skin defects were eliminated in hosts by day 21 in syngeneic transplantation models, allogeneic transplantation was performed using mice with different genetic backgrounds. The wound-healing rates were similar between the mixed cell sheet and trafermin groups. Our data indicated that mixed cell sheets represent a promising therapeutic material for cutaneous ulcers. PMID:27329845

  15. Treatment of refractory cutaneous ulcers with mixed sheets consisting of peripheral blood mononuclear cells and fibroblasts

    PubMed Central

    Ueno, Koji; Takeuchi, Yuriko; Samura, Makoto; Tanaka, Yuya; Nakamura, Tamami; Nishimoto, Arata; Murata, Tomoaki; Hosoyama, Tohru; Hamano, Kimikazu


    The purpose of this study was to confirm the therapeutic effects of mixed sheets consisting of peripheral blood mononuclear cells (PBMNCs) and fibroblasts on cutaneous skin ulcers. Vascular endothelial growth factor (VEGF) secretion in mixed cell sheets was much higher than in PBMNCs and fibroblasts. Concerning the mechanism, transforming growth factor beta 1 and platelet-derived growth factor BB secreted from PBMNCs enhanced VEGF production in fibroblasts. In wounds created on the backs of diabetic mice, the therapeutic effect of mixed cell sheets was similar to that of daily treatment with trafermin, a recombinant human basic fibroblast growth factor. Although abnormal granulation tissue and inflammatory cell infiltration were observed in trafermin-treated wounds, the transplantation of mixed cell sheets resulted in the natural anatomy of subcutaneous tissues. The expression patterns of identical wound-healing factors in wounds were different between mixed sheet-transfected and trafermin-treated animals. Because mixed cell sheets transplanted into full-thickness skin defects were eliminated in hosts by day 21 in syngeneic transplantation models, allogeneic transplantation was performed using mice with different genetic backgrounds. The wound-healing rates were similar between the mixed cell sheet and trafermin groups. Our data indicated that mixed cell sheets represent a promising therapeutic material for cutaneous ulcers. PMID:27329845

  16. Cleavage of interleukin 1 beta (IL-1 beta) precursor to produce active IL-1 beta by a conserved extracellular cysteine protease from Streptococcus pyogenes.

    PubMed Central

    Kapur, V; Majesky, M W; Li, L L; Black, R A; Musser, J M


    Streptococcal pyrogenic exotoxin B (SPE B), a conserved extracellular cysteine protease expressed by the human pathogenic bacterium Streptococcus pyogenes, was purified and shown to cleave inactive human interleukin 1 beta precursor (pIL-1 beta) to produce biologically active IL-1 beta. SPE B cleaves pIL-1 beta one residue amino-terminal to the site where a recently characterized endogenous human cysteine protease acts. IL-1 beta resulting from cleavage of pIL-1 beta by SPE B induced nitric oxide synthase activity in vascular smooth muscle cells and killed of the human melanoma A375 line. Two additional naturally occurring SPE B variants cleaved pIL-1 beta in a similar fashion. By demonstrating that SPE B catalyzes the formation of biologically active IL-1 beta from inactive pIL-1 beta, our data add a further dimension to an emerging theme in microbial pathogenesis that bacterial and viral virulence factors act directly on host cytokine pathways. The data also contribute to an enlarging literature demonstrating that microbial extracellular cysteine proteases are important in host-parasite interactions. Images Fig. 1 Fig. 2 Fig. 4 PMID:7689226

  17. Hyperspectral light sheet microscopy.


    Jahr, Wiebke; Schmid, Benjamin; Schmied, Christopher; Fahrbach, Florian O; Huisken, Jan


    To study the development and interactions of cells and tissues, multiple fluorescent markers need to be imaged efficiently in a single living organism. Instead of acquiring individual colours sequentially with filters, we created a platform based on line-scanning light sheet microscopy to record the entire spectrum for each pixel in a three-dimensional volume. We evaluated data sets with varying spectral sampling and determined the optimal channel width to be around 5 nm. With the help of these data sets, we show that our setup outperforms filter-based approaches with regard to image quality and discrimination of fluorophores. By spectral unmixing we resolved overlapping fluorophores with up to nanometre resolution and removed autofluorescence in zebrafish and fruit fly embryos. PMID:26329685

  18. Hyperspectral light sheet microscopy

    NASA Astrophysics Data System (ADS)

    Jahr, Wiebke; Schmid, Benjamin; Schmied, Christopher; Fahrbach, Florian O.; Huisken, Jan


    To study the development and interactions of cells and tissues, multiple fluorescent markers need to be imaged efficiently in a single living organism. Instead of acquiring individual colours sequentially with filters, we created a platform based on line-scanning light sheet microscopy to record the entire spectrum for each pixel in a three-dimensional volume. We evaluated data sets with varying spectral sampling and determined the optimal channel width to be around 5 nm. With the help of these data sets, we show that our setup outperforms filter-based approaches with regard to image quality and discrimination of fluorophores. By spectral unmixing we resolved overlapping fluorophores with up to nanometre resolution and removed autofluorescence in zebrafish and fruit fly embryos.

  19. Hyperspectral light sheet microscopy

    PubMed Central

    Jahr, Wiebke; Schmid, Benjamin; Schmied, Christopher; Fahrbach, Florian O.; Huisken, Jan


    To study the development and interactions of cells and tissues, multiple fluorescent markers need to be imaged efficiently in a single living organism. Instead of acquiring individual colours sequentially with filters, we created a platform based on line-scanning light sheet microscopy to record the entire spectrum for each pixel in a three-dimensional volume. We evaluated data sets with varying spectral sampling and determined the optimal channel width to be around 5 nm. With the help of these data sets, we show that our setup outperforms filter-based approaches with regard to image quality and discrimination of fluorophores. By spectral unmixing we resolved overlapping fluorophores with up to nanometre resolution and removed autofluorescence in zebrafish and fruit fly embryos. PMID:26329685

  20. Ganges Chasma Sand Sheet

    NASA Technical Reports Server (NTRS)


    [figure removed for brevity, see original site]

    Our topic for the weeks of April 4 and April 11 is dunes on Mars. We will look at the north polar sand sea and at isolated dune fields at lower latitudes. Sand seas on Earth are often called 'ergs,' an Arabic name for dune field. A sand sea differs from a dune field in two ways: 1) a sand sea has a large regional extent, and 2) the individual dunes are large in size and complex in form.

    Today's sand sheet is located in the Ganges Chasma portion of Valles Marineris. As with yesterday's image, note that the dune forms are seen only at the margin and that the interior of the sand sheet at this resolution appears to completely lack dune forms.

    Image information: VIS instrument. Latitude -6.4, Longitude 310.7 East (49.3 West). 19 meter/pixel resolution.

    Note: this THEMIS visual image has not been radiometrically nor geometrically calibrated for this preliminary release. An empirical correction has been performed to remove instrumental effects. A linear shift has been applied in the cross-track and down-track direction to approximate spacecraft and planetary motion. Fully calibrated and geometrically projected images will be released through the Planetary Data System in accordance with Project policies at a later time.

    NASA's Jet Propulsion Laboratory manages the 2001 Mars Odyssey mission for NASA's Office of Space Science, Washington, D.C. The Thermal Emission Imaging System (THEMIS) was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing. The THEMIS investigation is led by Dr. Philip Christensen at Arizona State University. Lockheed Martin Astronautics, Denver, is the prime contractor for the Odyssey project, and developed and built the orbiter. Mission operations are conducted jointly from Lockheed Martin and from JPL, a division of the California Institute of Technology in Pasadena.

  1. Current sheet thinning, reconnection onset, and auroral morphology during geomagnetic substorms

    NASA Astrophysics Data System (ADS)

    Otto, A.; Hsieh, M. S.


    Geomagnetic substorms represent a fundamental energy release mechanism for the terrestrial magnetosphere. Specifically, the evolution of thin currents sheets during the substorm growth phase plays a key role for substorms because such current sheets present a much lower threshold for the onset of tearing modes and magnetic reconnection than the usually thick magnetotail current sheet. Here we examine and compare two basic processes for current sheet thinning in the Earth's magnetotail: Current sheet thinning (1) through closed magnetic flux depletion (MFD) in the near Earth magnetotail caused by divergent flux transport to replace closed flux on the dayside and (2) through accumulation of open flux magnetic flux in the tail lobes also caused by dayside reconnection. Both processes are expected to operate during any period of enhanced dayside reconnection. It is demonstrated that closed magnetic flux depletion (MFD) in the near Earth magnetotail and the increase of open lobe magnetic flux can lead to the evolution of two separate thin current sheets in the near Earth and the mid tail regions of the magnetosphere. While the auroral morphology associated with MFD and near Earth current sheet formation is well consistent with typical substorm growth observation, midtail current sheet formation through lobe flux increase shows only a minor influence on the auroral ionosphere. We discuss the physics of the dual current sheet formation and local and auroral properties of magnetic reconnection in either current sheet. It is suggested that only reconnection onset in the near Earth current sheet may be consistent with substorm expansion because the flux tube entropy depletion of mid tail reconnection appears insufficient to cause geosynchronous particle injection and dipolarization. Therefore reconnection in the mid tail current sheet is more likely associated with bursty bulk flows or dipolarization fronts which stop short of geosynchronous distances.

  2. The crowded environment of a reverse micelle induces the formation of β-strand seed structures for nucleating amyloid fibril formation.


    Yeung, Priscilla S-W; Axelsen, Paul H


    A hallmark of Alzheimer's disease is the accumulation of insoluble fibrils in the brain composed of amyloid beta (Aβ) proteins with parallel in-register cross-β-sheet structure. It has been suggested that the aggregation of monomeric Aβ proteins into fibrils is promoted by "seeds" that form within compartments of the brain that have limited solvent due to macromolecular crowding. To characterize these seeds, a crowded macromolecular environment was mimicked by encapsulating Aβ40 monomers into reverse micelles. Fourier-transform infrared spectroscopy revealed that monomeric Aβ proteins form extended β-strands in reverse micelles, while an analogue with a scrambled sequence does not. This is a remarkable finding, because the formation of extended β-strands by monomeric Aβ proteins suggests a plausible mechanism whereby the formation of amyloid fibrils may be nucleated in the human brain. PMID:22448820

  3. The quantitative inspection of iron aluminide green sheet using transient thermography

    NASA Astrophysics Data System (ADS)

    Watkins, Michael L.; Hinders, Mark K.; Scorey, Clive; Winfree, William


    The recent development of manufacturing techniques for the fabrication of thin iron aluminide, FeAl, sheet requires advanced quantitative methods for on-line inspection. An understanding of the mechanisms responsible for flaws and the development of appropriate flaw detection methods are key elements in an effective quality management system. The first step in the fabrication of thin FeAl alloy sheet is the formation of a green sheet, either by cold rolling or tape casting FeAl powder mixed with organic binding agents. The finished sheet is obtained using a series of process steps involving binder elimination, densification, sintering, and annealing. Non-uniformities within the green sheet are the major contributor to material failure in subsequent sheet processing and the production of non-conforming finished sheet. Previous work has demonstrated the advantages of using active thermography to detect the flaws and heterogeneity within green powder composites (1)(2)(3). The production environment and physical characteristics of these composites provide for unique challenges in developing a rapid nondestructive inspection capability. Thermography is non-contact and minimizes the potential damage to the fragile green sheet. Limited access to the material also demands a one-sided inspection technique. In this paper, we will describe the application of thermography for 100% on-line inspection within an industrial process. This approach is cost competitive with alternative technologies, such as x-ray imaging systems, and provides the required sensitivity to the variations in material composition. The formation of green sheet flaws and their transformation into defects within intermediate and finished sheet products will be described. A green sheet conformance criterion will be presented which would significantly reduce the probability of processing poor quality green sheet which contributes to higher waste and inferior bulk alloy sheet.

  4. Vitamin and Mineral Supplement Fact Sheets


    ... Tables Online DRI Tool Daily Value (DV) Tables Vitamin and Mineral Supplement Fact Sheets Search the list ... Supplements: Background Information Botanical Dietary Supplements: Background Information Vitamin and Mineral Fact Sheets Botanical Supplement Fact Sheets ...

  5. Formation of ursodeoxycholic acid from chenodeoxycholic acid by a 7 beta-hydroxysteroid dehydrogenase-elaborating Eubacterium aerofaciens strain cocultured with 7 alpha-hydroxysteroid dehydrogenase-elaborating organisms.

    PubMed Central

    MacDonald, I A; Rochon, Y P; Hutchison, D M; Holdeman, L V


    A gram-positive, anaerobic, chain-forming, rod-shaped anaerobe (isolate G20-7) was isolated from normal human feces. This organism was identified by cellular morphology as well as fermentative and biochemical data as Eubacterium aerofaciens. When isolate G20-7 was grown in the presence of Bacteroides fragilis or Escherichia coli (or another 7 alpha-hydroxysteroid dehydrogenase producer) and chenodeoxycholic acid, ursodeoxycholic acid produced. Time course curves revealed that 3 alpha-hydroxy-7-keto-5 beta-cholanoic acid produced by B. fragilis or E. coli or introduced into the medium as a pure substance was reduced by G20-7 specifically to ursodeoxycholic acid. The addition of glycine- and taurine-conjugated primary bile acids (chenodeoxycholic and cholic acids) and other bile acids to binary cultures of B. fragilis and G20-7 revealed that (i) both conjugates were hydrolyzed to give free bile acids, (ii) ursocholic acid (3 alpha, 7 beta, 12 alpha-trihydroxy-5 beta-cholanoic acid) was produced when conjugated (or free) cholic acid was the substrate, and (iii) the epimerization reaction was at least partially reversible. Corroborating these observations, an NADP-dependent 7 beta-hydroxysteroid dehydrogenase (reacting specifically with 7 beta-OH-groups) was demonstrated in cell-free preparations of isolate G20-7; production of the enzyme was optimal at between 12 and 18 h of growth. This enzyme, when measured in the oxidative direction, was active with ursodeoxycholic acid, ursocholic acid, and the taurine conjugate of ursodeoxycholic acid (but not with chenodeoxycholic, deoxycholic, or cholic acids) and displayed an optimal pH range of 9.8 to 10.2 Images PMID:6758698

  6. Tyrosine residues 654 and 670 in {beta}-cat enin are crucial in regulation of Met-{beta}-catenin interactions

    SciTech Connect

    Zeng, Gang; Apte, Udayan; Micsenyi, Amanda; Bell, Aaron; Monga, Satdarshan P.S. . E-mail:


    {beta}-catenin, a key component of the canonical Wnt pathway, is also regulated by tyrosine phosphorylation that regulates its association to E-cadherin. Previously, we reported its association with the hepatocyte growth factor (HGF) receptor Met at the membrane. HGF induced Met-{beta}-catenin dissociation and nuclear translocation of {beta}-catenin, which was tyrosine-phosphorylation-dependent. Here, we further investigate the Met-{beta}-catenin interaction by selectively mutating several tyrosine residues, alone or in combination, in {beta}-catenin. The mutants were subcloned into FLAG-CMV vector and stably transfected into rat hepatoma cells, which were treated with HGF. All single or double-mutant-transfected cells continued to show HGF-induced nuclear translocation of FLAG-{beta}-catenin except the mutations affecting 654 and 670 simultaneously (Y654/670F), which coincided with the lack of formation of {beta}-catenin-TCF complex and DNA synthesis, in response to the HGF treatment. In addition, the Y654/670F-transfected cells also showed no phosphorylation of {beta}-catenin or dissociation from Met in response to HGF. Thus, intact 654 and 670 tyrosine residues in {beta}-catenin are crucial in HGF-mediated {beta}-catenin translocation, activation and mitogenesis.

  7. {alpha}-Lipoic acid exhibits anti-amyloidogenicity for {beta}-amyloid fibrils in vitro

    SciTech Connect

    Ono, Kenjiro; Hirohata, Mie; Yamada, Masahito . E-mail:


    Inhibition of the formation of {beta}-amyloid fibrils (fA{beta}), as well as the destabilization of preformed fA{beta} in the CNS would be attractive therapeutic targets for the treatment of Alzheimer's disease (AD). Using fluorescence spectroscopic analysis with thioflavin T and electron microscopic studies, we examined the effects of {alpha}-lipoic acid (LA) and the metabolic product of LA, dihydrolipoic acid (DHLA), on the formation, extension, and destabilization of fA{beta} at pH 7.5 at 37 {sup o}C in vitro. LA and DHLA dose-dependently inhibited fA{beta} formation from amyloid {beta}-protein, as well as their extension. Moreover, they destabilized preformed fA{beta}s. LA and DHLA could be key molecules for the development of therapeutics for AD.

  8. West Antarctic Ice Sheet formed earlier than thought

    NASA Astrophysics Data System (ADS)

    Balcerak, Ernie


    About 34 million years ago, Earth transitioned from a warm "greenhouse" climate to a cold "icehouse" climate, marking the transition between the Eocene and Oligocene epochs. This transition has been associated with the formation of a large ice sheet on Antarctica.

  9. Penguin Fact Sheet.

    ERIC Educational Resources Information Center

    Flotsam and Jetsam: A Newsletter for Massachusetts Marine Educators, 1985


    Presents factual information on penguins using an outline format. Includes descriptions of physical characteristics, behavioral mechanisms, geographical distribution, and physiological processes. Provides separate bibliographies for teachers and students. (ML)

  10. Statistical study of plasma sheet dynamics using ISEE 1 and 2 energetic particle flux data

    SciTech Connect

    Dandouras, J.; Re-grave-accentme, H.; Saint-Marc, A.; Sauvaud, J.A.; Parks, G.K.; Anderson, K.A.; Lin, R.P.


    During magnetospheric substorms, satellites embedded in the plasma sheet often detect transient dropouts of plasma and energetic particle fluxes, a phenomemon generally interpreted as indicating the exit of the satellite into the magnetospheric lobe due to a plasma sheet thinning. In order to determine the large-scale dynamics of the near-earth plasma sheet during substorms, three satellite years of ISEE 1 and 2 energetic particle flux data (1.5 and 6 keV), corresponding to 461 particle flux dropouts, have been analyzed. The principal results show that flux dropouts can be observed anywhere in the nightside plasma sheet, independent of the satellite's geocentric distance (for R>12R/sub E/), magnetic local time (except near the magnetospheric flanks) and estimated distance to the neutral sheet. Furthermore, flux dropouts can be observed for any combination of the AE index value and the satellite's distance to the neutral sheet, which shows that the plasma sheet is dynamic even during weak magnetospheric disturbances. Substorms during which the satellites, though situated in the plasma sheet, did not detect any flux dropout, have also been examined, and it is found that the plasma sheet thickness can locally remain unaffected by substorm development for AE index values up to at least 1000 nT. The predictions of the two major plasma sheet thinning models, i.e., the near-tail X-type magnetic neutral line formation model and the MHD rarefaction wave propagation model, are compared to the experimental results, and it is concluded that neither model can account for all of the observations; plasma sheet dynamics are more complex. Phenomenologically, this study suggests that multiple pinching of the plasma sheet and/or large-amplitude three-dimensional plasma sheet oscillations are important in plasma sheet dynamics.

  11. Beta experiment flight report

    NASA Technical Reports Server (NTRS)


    A focused laser Doppler velocimeter system was developed for the measurement of atmospheric backscatter (beta) from aerosols at infrared wavelengths. The system was flight tested at several different locations and the results of these tests are summarized.

  12. Beta-carotene


    ... brain in people who drink alcohol. Preventing abdominal aortic aneurysm, or the enlargement of a large vessel running ... years does not reduce the occurrence of abdominal aortic aneurysm in male smokers. Cancer. Beta-carotene does not ...

  13. Beta-carotene


    ... blindness during pregnancy, as well as diarrhea and fever after giving birth. Some people who sunburn easily, ... seems to reduce the incidence of diarrhea and fever post-childbirth. Pregnancy-related complications. Taking beta-carotene ...

  14. Reduced immunogenicity of beta-lactoglobulin by conjugation with acidic oligosaccharides.


    Hattori, Makoto; Miyakawa, Shunpei; Ohama, Yukie; Kawamura, Hiroyuki; Yoshida, Tadashi; To-o, Kenji; Kuriki, Takashi; Takahashi, Koji


    Bovine beta-lactoglobulin (beta-LG) was conjugated with the acidic oligosaccharides, alginic acid oligosaccharide (ALGO) and phosphoryl oligosaccharides (POs) by the Maillard reaction to reduce the immunogenicity of beta-LG. The molar ratios of beta-LG to ALGO and POs in the conjugates were 1:6 and 1:8. The carbohydrate-binding sites in the beta-LG-ALGO conjugate were partially identified to be (60)Lys, (77)Lys, (100)Lys, (138)Lys, and (141)Lys. The isoelectric point of each conjugate was lower than that of beta-LG. CD spectra indicated that the secondary structure of beta-LG was almost maintained after conjugation. The results of fluorescence studies indicated that the conformation around Trp had not changed in each conjugate and that the surface of each conjugate was covered with a saccharide chain. Structural analyses with monoclonal antibodies indicated that the conformation around (8)Lys-(19)Trp (beta-sheet, random coil, short helix) in the conjugates had changed, whereas the native structure was maintained around (15)Val-(29)Ile (beta-sheet) and (125)Thr-(135)Lys (alpha-helix). The beta-LG-ALGO and beta-LG-POs conjugates maintained 77 and 70% of the retinol binding activity of beta-LG. Conjugation with ALGO and POs substantially enhanced the thermal stability of beta-LG. The anti-beta-LG antibody response was markedly reduced after immunization with both conjugates in BALB/c, C57BL/6, and C3H/He mice. B cell epitopes of beta-LG and the conjugate recognized in these mice were determined with 15-mer multipin peptides, and the linear epitope profiles of the conjugates were found to be similar to those of beta-LG, whereas the antibody response to each epitope was dramatically reduced. In particular, effective reduction of the antibody response was observed in the vicinity of the carbohydrate-binding sites. Conjugation of beta-LG with these acidic oligosaccharides was effective in reducing the immunogenicity of beta-LG. The conjugates obtained in this study are

  15. High beta multipoles

    SciTech Connect

    Prager, S C


    Multipoles are being employed as devices to study fusion issues and plasma phenomena at high values of beta (plasma pressure/magnetic pressure) in a controlled manner. Due to their large volume, low magnetic field (low synchrotron radiation) region, they are also under consideration as potential steady state advanced fuel (low neutron yield) reactors. Present experiments are investigating neoclassical (bootstrap and Pfirsch-Schlueter) currents and plasma stability at extremely high beta.

  16. Rolling Up a Monolayer MoS2 Sheet.


    Meng, Jianling; Wang, Guole; Li, Xiaomin; Lu, Xiaobo; Zhang, Jing; Yu, Hua; Chen, Wei; Du, Luojun; Liao, Mengzhou; Zhao, Jing; Chen, Peng; Zhu, Jianqi; Bai, Xuedong; Shi, Dongxia; Zhang, Guangyu


    MoS2 nanoscrolls are formed by argon plasma treatment on monolayer MoS2 sheet. The nanoscale scroll formation is attributed to the partial removal of top sulfur layer in MoS2 during the argon plasma treatment process. This convenient, solvent-free, and high-yielding nanoscroll formation technique is also feasible for other 2D transition metal dichalcogenides. PMID:27322776

  17. Visco-resistive tearing in thin current sheets.

    NASA Astrophysics Data System (ADS)

    Velli, M. M. C.; Tenerani, A.; Rappazzo, A. F.; Pucci, F.


    How fast magnetic energy release is triggered and occurs in high Lundquist (S) and high Reynolds number ( R ) plasmas such as that of the solar corona is a fundamental problem for understanding phenomena ranging from coronal heating to flares and CMEs. Diffusion or collisional reconnection driven by macroscopic flows in quasi-steady Sweet-Parker (SP) current sheets are processes far too slow to fit observational data. Spontaneous reconnection, driven by the onset of the tearing instability inside current sheets, provides an alternative paradigm to SP reconnection. Nevertheless, as long as macroscopic current layers are considered, the growth of such an instability is also a slow process. Recently it has been shown that SP current sheets are rapidly unstable in high S plasmas, indeed have a growth rate diverging with increasing S. It has been suggested that such instabilities are triggered during the nonlinear stage of the primary tearing instability of a macroscopic layer. The formation of plasmoids in this presumed SP sheet speeds up the reconnection rate to ideal values. Recently, we have suggested that SP sheets can not be realized in quasi-ideal plasmas, and that the plasmoid instability is triggered on a much larger scale (i.e. with current sheets having a much larger ration of thickness to length than SP). Here we present a linear parametric study of the tearing instability for a Harris current sheet, while taking into account both viscosity and current sheets of variable aspect ratios. The present study shows that an explosive growth of the reconnection rate may be reached during the linear stage, once a critical width of the current layer is reached. In the absence of a strong guide field this depends on viscosity and a range of critical aspect ratios can be found for different values of S, R, or S and Prandtl number.

  18. Hypoxia Created Human Mesenchymal Stem Cell Sheet for Prevascularized 3D Tissue Construction.


    Zhang, Lijun; Xing, Qi; Qian, Zichen; Tahtinen, Mitchell; Zhang, Zhaoqiang; Shearier, Emily; Qi, Shaohai; Zhao, Feng


    3D tissue based on human mesenchymal stem cell (hMSC) sheets offers many interesting opportunities for regenerating multiple types of connective tissues. Prevascularizing hMSC sheets with endothelial cells (ECs) will improve 3D tissue performance by supporting cell survival and accelerating integration with host tissue. It is hypothesized that hypoxia cultured hMSC sheets can promote microvessel network formation and preserve stemness of hMSCs. This study investigates the vascularization of hMSC sheets under different oxygen tensions. It is found that the HN condition, in which hMSC sheets formed under physiological hypoxia (2% O2 ) and then cocultured with ECs under normoxia (20% O2 ), enables longer and more branched microvessel network formation. The observation is corroborated by higher levels of angiogenic factors in coculture medium. Additionally, the hypoxic hMSC sheet is more uniform and less defective, which facilitates fabrication of 3D prevascularized tissue construct by layering the prevascularized hMSC sheets and maturing in rotating wall vessel bioreactor. The hMSCs in the 3D construct still maintain multilineage differentiation ability, which indicates the possible application of the 3D construct for various connective tissues regeneration. These results demonstrate that hypoxia created hMSC sheets benefit the microvessel growth and it is feasible to construct 3D prevascularized tissue construct using the prevascularized hMSC sheets. PMID:26663707

  19. Cartilage engineering using chondrocyte cell sheets and its application in reconstruction of microtia

    PubMed Central

    Zhou, Libin; Ding, Ruiying; Li, Baowei; Han, Haolun; Wang, Hongnan; Wang, Gang; Xu, Bingxin; Zhai, Suoqiang; Wu, Wei


    The imperfections of scaffold materials have hindered the clinical application of cartilage tissue engineering. The recently developed cell-sheet technique is adopted to engineer tissues without scaffold materials, thus is considered being potentially able to overcome the problems concerning the scaffold imperfections. This study constructed monolayer and bilayer chondrocyte cell sheets and harvested the sheets with cell scraper instead of temperature-responsive culture dishes. The properties of the cultured chondrocyte cell sheets and the feasibility of cartilage engineering using the chondrocyte cell sheets was further investigated via in vitro and in vivo study. Primary extracellular matrix (ECM) formation and type II collagen expression was detected in the cell sheets during in vitro culture. After implanted into nude mice for 8 weeks, mature cartilage discs were harvested. The morphology of newly formed cartilage was similar in the constructs originated from monolayer and bilayer chondrocyte cell sheet. The chondrocytes were located within evenly distributed ovoid lacunae. Robust ECM formation and intense expression of type II collagen was observed surrounding the evenly distributed chondrocytes in the neocartilages. Biochemical analysis showed that the DNA contents of the neocartilages were higher than native human costal cartilage; while the contents of the main component of ECM, glycosaminoglycan and hydroxyproline, were similar to native human costal cartilage. In conclusion, the chondrocyte cell sheet constructed using the simple and low-cost technique is basically the same with the cell sheet cultured and harvested in temperature-responsive culture dishes, and can be used for cartilage tissue engineering. PMID:25755694

  20. Cartilage engineering using chondrocyte cell sheets and its application in reconstruction of microtia.


    Zhou, Libin; Ding, Ruiying; Li, Baowei; Han, Haolun; Wang, Hongnan; Wang, Gang; Xu, Bingxin; Zhai, Suoqiang; Wu, Wei


    The imperfections of scaffold materials have hindered the clinical application of cartilage tissue engineering. The recently developed cell-sheet technique is adopted to engineer tissues without scaffold materials, thus is considered being potentially able to overcome the problems concerning the scaffold imperfections. This study constructed monolayer and bilayer chondrocyte cell sheets and harvested the sheets with cell scraper instead of temperature-responsive culture dishes. The properties of the cultured chondrocyte cell sheets and the feasibility of cartilage engineering using the chondrocyte cell sheets was further investigated via in vitro and in vivo study. Primary extracellular matrix (ECM) formation and type II collagen expression was detected in the cell sheets during in vitro culture. After implanted into nude mice for 8 weeks, mature cartilage discs were harvested. The morphology of newly formed cartilage was similar in the constructs originated from monolayer and bilayer chondrocyte cell sheet. The chondrocytes were located within evenly distributed ovoid lacunae. Robust ECM formation and intense expression of type II collagen was observed surrounding the evenly distributed chondrocytes in the neocartilages. Biochemical analysis showed that the DNA contents of the neocartilages were higher than native human costal cartilage; while the contents of the main component of ECM, glycosaminoglycan and hydroxyproline, were similar to native human costal cartilage. In conclusion, the chondrocyte cell sheet constructed using the simple and low-cost technique is basically the same with the cell sheet cultured and harvested in temperature-responsive culture dishes, and can be used for cartilage tissue engineering. PMID:25755694

  1. Preformed {beta}-amyloid fibrils are destabilized by coenzyme Q{sub 10} in vitro

    SciTech Connect

    Ono, Kenjiro; Hasegawa, Kazuhiro; Naiki, Hironobu; Yamada, Masahito . E-mail:


    Inhibition of the formation of {beta}-amyloid fibrils (fA{beta}), as well as the destabilization of preformed fA{beta} in the CNS, would be attractive therapeutic targets for the treatment of Alzheimer's disease (AD). We reported previously that nordihydroguaiaretic acid (NDGA) and wine-related polyphenol, myricetin (Myr), inhibit fA{beta} formation from A{beta} and destabilize preformed fA{beta} in vitro. Using fluorescence spectroscopic analysis with thioflavin T and electron microscopic studies, we examined the effects of coenzyme Q{sub 10} (CoQ{sub 10}) on the formation, extension, and destabilization of fA{beta} at pH 7.5 at 37 deg C in vitro. We next compared the anti-amyloidogenic activities of CoQ{sub 10} with NDGA and Myr. CoQ{sub 10} dose-dependently inhibited fA{beta} formation from amyloid {beta}-peptide (A{beta}), as well as their extension. Moreover, it destabilized preformed fA{beta}s. The anti-amyloidogenic effects of CoQ{sub 10} were slightly weaker than those of NDGA and Myr. CoQ{sub 10} could be a key molecule for the development of therapeutics for AD.

  2. Theoretical modeling of the plasma-assisted catalytic growth and field emission properties of graphene sheet

    SciTech Connect

    Sharma, Suresh C.; Gupta, Neha


    A theoretical modeling for the catalyst-assisted growth of graphene sheet in the presence of plasma has been investigated. It is observed that the plasma parameters can strongly affect the growth and field emission properties of graphene sheet. The model developed accounts for the charging rate of the graphene sheet; number density of electrons, ions, and neutral atoms; various elementary processes on the surface of the catalyst nanoparticle; surface diffusion and accretion of ions; and formation of carbon-clusters and large graphene islands. In our investigation, it is found that the thickness of the graphene sheet decreases with the plasma parameters, number density of hydrogen ions and RF power, and consequently, the field emission of electrons from the graphene sheet surface increases. The time evolution of the height of graphene sheet with ion density and sticking coefficient of carbon species has also been examined. Some of our theoretical results are in compliance with the experimental observations.

  3. Microcomponent chemical process sheet architecture


    Wegeng, R.S.; Drost, M.K.; Call, C.J.; Birmingham, J.G.; McDonald, C.E.; Kurath, D.E.; Friedrich, M.


    The invention is a microcomponent sheet architecture wherein macroscale unit processes are performed by microscale components. The sheet architecture may be a single laminate with a plurality of separate microcomponent sections or the sheet architecture may be a plurality of laminates with one or more microcomponent sections on each laminate. Each microcomponent or plurality of like microcomponents perform at least one chemical process unit operation. A first laminate having a plurality of like first microcomponents is combined with at least a second laminate having a plurality of like second microcomponents thereby combining at least two unit operations to achieve a system operation. 26 figs.

  4. Microcomponent chemical process sheet architecture


    Wegeng, Robert S.; Drost, M. Kevin; Call, Charles J.; Birmingham, Joseph G.; McDonald, Carolyn Evans; Kurath, Dean E.; Friedrich, Michele


    The invention is a microcomponent sheet architecture wherein macroscale unit processes are performed by microscale components. The sheet architecture may be a single laminate with a plurality of separate microcomponent sections or the sheet architecture may be a plurality of laminates with one or more microcomponent sections on each laminate. Each microcomponent or plurality of like microcomponents perform at least one chemical process unit operation. A first laminate having a plurality of like first microcomponents is combined with at least a second laminate having a plurality of like second microcomponents thereby combining at least two unit operations to achieve a system operation.

  5. Superfund fact sheet: The removal program. Fact sheet

    SciTech Connect

    Not Available


    The fact sheet describes the Superfund Emergency Response Program, a program specifically designed to respond to multi-media hazardous materials accidents (e.g. illegal disposal or improper handling of materials, transportation accidents, chemical fires) that endanger people and/or the environment. Explanations of how the removal program works and how the affected communities are involved are given. The fact sheet is one in a series providing reference information about Superfund issues and is intended for readers with no scientific training.

  6. Mechanism of formation of the C-terminal beta-hairpin of the B3 domain of the immunoglobulin-binding protein G from Streptococcus. IV. Implication for the mechanism of folding of the parent protein.


    Lewandowska, Agnieszka; Ołdziej, Stanislaw; Liwo, Adam; Scheraga, Harold A


    A 34-residue alpha/beta peptide [IG(28-61)], derived from the C-terminal part of the B3 domain of the immunoglobulin binding protein G from Streptoccocus, was studied using CD and NMR spectroscopy at various temperatures and by differential scanning calorimetry. It was found that the C-terminal part (a 16-residue-long fragment) of this peptide, which corresponds to the sequence of the beta-hairpin in the native structure, forms structure similar to the beta-hairpin only at T = 313 K, and the structure is stabilized by non-native long-range hydrophobic interactions (Val47-Val59). On the other hand, the N-terminal part of IG(28-61), which corresponds to the middle alpha-helix in the native structure, is unstructured at low temperature (283 K) and forms an alpha-helix-like structure at 305 K, and only one helical turn is observed at 313 K. At all temperatures at which NMR experiments were performed (283, 305, and 313 K), we do not observe any long-range connectivities which would have supported packing between the C-terminal (beta-hairpin) and the N-terminal (alpha-helix) parts of the sequence. Such interactions are absent, in contrast to the folding pathway of the B domain of protein G, proposed recently by Kmiecik and Kolinski (Biophys J 2008, 94, 726-736), based on Monte-Carlo dynamics studies. Alternative folding mechanisms are proposed and discussed. PMID:20049918

  7. Characteristics of the aluminum alloy sheets for forming and application examples

    NASA Astrophysics Data System (ADS)

    Uema, Naoyuki; Asano, Mineo


    In this paper, the characteristics and application examples of aluminum alloy sheets developed for automotive parts by Sumitomo Light Metal are described. For the automotive closure panels (ex., hood, back-door), an Al-Mg-Si alloy sheet having an excellent hemming performance was developed. The cause of the occurrence and the propagation of cracks by bending were considered to be the combined effect of the shear bands formed across several crystal grains and the micro-voids formed around the second phase particles. By reducing the shear band formation during bending by controlling the crystallographic texture, the Al-Mg-Si alloy sheets showed an excellent hemming performance. For the automotive outer panels (ex., roof, fender, trunk-lid), an Al-Mg alloy sheet, which has both a good hot blow formability and excellent surface appearance after hot blow forming was developed, and hot blow forming technology was put to practical use using this developed Al-Mg alloy sheet. For automotive heat insulators, a high ductile Al-Fe alloy sheet was developed. The heat insulator, which integrated several panels, was put into practical use using this developed Al-Fe alloy sheet. The textured sheet was often used as a heat insulator in order to reduce the thickness of the aluminum alloy sheet and obtain good press formability. The new textured sheet, which has both high rigidity and good press formability for heat insulators, was developed by FE analysis.

  8. Scrolling of Suspended CVD Graphene Sheets

    NASA Astrophysics Data System (ADS)

    Martynov, Oleg; Yeom, Sinchul; Bockrath, Marc; UC: Riverside Team

    Carbon Nanoscrolls, one dimensional spiral forms of graphitic carbon, have attracted recent interest due to their novel proposed properties. Although various production methods and studies of carbon nanoscrolls have been performed, low yield and poor controllability of their synthesis have slowed progress in this field. Suspended graphene membranes and carbon nanotubes have been predicted as promising systems for the formation of graphene scrolls. We have suspended chemical vapor deposition (CVD)-grown graphene over large holes in a Si/SiO2 substrate to make suspended membranes upon which nanotubes are placed. Initial experiments have been performed showing that tears or cuts of the suspended sheet can initiate scrolling. Our latest progress towards carbon nanotube initiated formation of graphene scrolls and suspended CVD graphene scrolling, along with measurements of these novel structures will be presented.

  9. Selectively reflective transparent sheets

    NASA Astrophysics Data System (ADS)

    Waché, Rémi; Florescu, Marian; Sweeney, Stephen J.; Clowes, Steven K.


    We investigate the possibility to selectively reflect certain wavelengths while maintaining the optical properties on other spectral ranges. This is of particular interest for transparent materials, which for specific applications may require high reflectivity at pre-determined frequencies. Although there exist currently techniques such as coatings to produce selective reflection, this work focuses on new approaches for mass production of polyethylene sheets which incorporate either additives or surface patterning for selective reflection between 8 to 13 μ m. Typical additives used to produce a greenhouse effect in plastics include particles such as clays, silica or hydroxide materials. However, the absorption of thermal radiation is less efficient than the decrease of emissivity as it can be compared with the inclusion of Lambertian materials. Photonic band gap engineering by the periodic structuring of metamaterials is known in nature for producing the vivid bright colors in certain organisms via strong wavelength-selective reflection. Research to artificially engineer such structures has mainly focused on wavelengths in the visible and near infrared. However few studies to date have been carried out to investigate the properties of metastructures in the mid infrared range even though the patterning of microstructure is easier to achieve. We present preliminary results on the diffuse reflectivity using FDTD simulations and analyze the technical feasibility of these approaches.

  10. Beta-cardiotoxin: a new three-finger toxin from Ophiophagus hannah (king cobra) venom with beta-blocker activity.


    Rajagopalan, Nandhakishore; Pung, Yuh Fen; Zhu, Yi Zhun; Wong, Peter Tsun Hon; Kumar, Prakash P; Kini, R Manjunatha


    Snake venoms have provided a number of novel ligands with therapeutic potential. We have constructed a partial cDNA library from the mRNA of Ophiophagus hannah (king cobra) venom gland tissue and identified five new genes encoding proteins belonging to the three-finger toxin family of snake venom proteins. We have isolated and characterized one of these beta-sheet containing proteins with a mass of 7012.43 +/- 0.91 Da from the venom. The protein was nonlethal up to a dose of 10 mg/kg when injected intraperitoneally into Swiss albino mice. However, it induces labored breathing and death at a dose of 100 mg/kg. It does not show any hemolytic or anticoagulant activity. It caused a dose-dependent decrease of heart rate in vivo (anesthetized Sprague-Dawley rats) and also ex vivo (Langendorff isolated rat heart). This is in contrast to classical cardiotoxins from snake venom that increase the heart rate in animals. Radioligand displacement studies showed that this protein targets beta-adrenergic receptors with a binding affinity (Ki) of 5.3 and 2.3 microM toward beta1 and beta2 subtypes, respectively, to bring about its effect, and hence, it was named as beta-cardiotoxin. This is the first report of a natural exogenous beta-blocker. PMID:17616557

  11. Inhaled beta agonists.


    Op't Holt, Timothy B


    The beta(2) adrenoreceptor is a large molecule of some 413 amino acids. The duration of stimulation of this receptor depends on where and for how long a beta(2) adrenergic drug attaches itself to the beta(2) adrenoreceptor. beta(2) adrenergic drugs have been used for over 5,000 years, but only recently have we had the advantage of adrenergic drugs specific to the beta(2) adrenoreceptor. The short-acting beta(2) adrenergic drugs most frequently used include albuterol, pirbuterol, and levalbuterol. Levalbuterol, the R enantiomer of albuterol, has been described by some as a more effective bronchodilator than racemic albuterol, because it contains none of the S enantiomer. Some contend that the S isomer has pro-inflammatory properties. The 2 long-acting beta(2) adrenergic drugs are salmeterol and formoterol. These drugs have a duration of 12 h and reportedly improve forced expiratory volume in the first second, quality of life, and symptoms. Some recent reports indicate that these drugs are associated with higher mortality, but several authors have registered the opinion that it is not the bronchodilator that should be questioned, but instead that the fault lies in the patient recruitment in those studies. Regardless, if these long-acting drugs are effective for a given patient, it would seem inadvisable to withdraw them, given the current state of evidence. Arformoterol tartrate, the R enantiomer of formoterol, was approved by the U.S. Food and Drug Administration in October 2006; it is available as a nebulizer solution, to be administered every 12 h. Several other long-acting R isomers and RR isomers are in the approval pipeline. PMID:17594727

  12. Aromatic Cross-Strand Ladders Control the Structure and Stability of [beta]-Rich Peptide Self-Assembly Mimics

    SciTech Connect

    Biancalana, Matthew; Makabe, Koki; Koide, Akiko; Koide, Shohei


    Though {beta}-rich self-assemblies comprise a major structural class of polypeptides, a detailed understanding of the determinants of their structure and stability is lacking. In particular, the roles of repetitive stretches of side chains running the long axis of these {beta}-sheets, termed 'cross-strand ladders,' remain poorly characterized due to the inherently insoluble and heterogeneous nature of self-assemblies. To overcome these experimental challenges, we have established a complementary experimental system termed 'peptide self-assembly mimics' (PSAMs). The PSAMs capture a defined number of self-assembly-like peptide repeats within a soluble {beta}-rich protein, making structural and energetic studies possible. In this work, we investigated the role of cross-strand ladders containing aromatic residues, which are prominent in self-assembling peptides. A combination of solution data and high-resolution crystal structures revealed that a single cross-strand ladder consisting solely of Tyr significantly stabilized, rigidified, and flattened the PSAM {beta}-sheet. These characteristics would stabilize each {beta}-sheet layer of a self-assembly and direct sheet conformations compatible with lamination. Our results therefore provide a rationale for the abundance of aromatic amino acids in fibril-forming peptides and establish important roles of cross-strand Tyr ladders in the structure and stability of {beta}-rich peptide self-assemblies.

  13. Analysis of a Sheet Silicate.

    ERIC Educational Resources Information Center

    Adams, J. M.; Evans, S.


    Describes a student project in analytical chemistry using sheet silicates. Provides specific information regarding the use of phlogopite in an experiment to analyze samples for silicon, aluminum, magnesium, iron, potassium, and fluoride. (CS)

  14. Concentrating Solar Power (Fact Sheet)

    SciTech Connect

    Not Available


    Fact sheet describing the overall capabilities of the NREL CSP Program: collector/receiver characterization, advanced reflector and absorber materials, thermal storage and advanced heat transfer fluids, and CSP modeling and analysis.

  15. SEER Cancer Stat Fact Sheets

    Cancer Statistical Fact Sheets are summaries of common cancer types developed to provide an overview of frequently-requested cancer statistics including incidence, mortality, survival, stage, prevalence, and lifetime risk.

  16. Measurements and Characterization (Fact Sheet)

    SciTech Connect

    Not Available


    Capabilities fact sheet for the National Center for Photovoltaics: Measurements and Characterization that includes scope, core competencies and capabilities, and contact/web information for Analytical Microscopy, Electro-Optical Characterization, Surface Analysis, and Cell and Module Performance.

  17. Sports Injury Prevention Tip Sheet


    ... Finance Human Resources and Administrative Services Information Technology Marketing and Sales Membership Practice Public Affairs Quality Publishing ... Feedback Recent a a a print email share Facebook Twitter 2016 Sports Injury Prevention Tip Sheet 3/ ...

  18. Deep Space 1 (fact sheet)

    NASA Technical Reports Server (NTRS)

    Fisher, D. K.


    Exerting less force than does a single sheet of paper resting in your hand, Deep Space 1's ion propulsion system will slowly, yet continuously accelerate the spacecraft well beyond speeds attainable by conventional chemical propulsion.

  19. Energy information sheets, July 1998

    SciTech Connect


    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  20. Energy information sheets, September 1996

    SciTech Connect


    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  1. Crib sheets or security blankets?


    Drake, V K; Freed, P; Hunter, J M


    This article describes the sanctioned use of crib sheets as a nursing intervention to decrease test anxiety when the classroom is the practice setting for psychiatric/mental health nursing faculty. The products that the students created offered additional unsuspected benefits. The faculty were convinced that the use of crib sheets can be a sound intervention to reduce students' test-taking anxiety. PMID:9661379

  2. A facile liquid phase exfoliation method to prepare graphene sheets with different sizes expandable graphite

    SciTech Connect

    Zhou, Keqing; Shi, Yongqian; Jiang, Saihua; Song, Lei; Hu, Yuan; Gui, Zhou


    Graphical abstract: - Highlights: • This study presented a novel method for the production of high-quality graphene sheets through the exfoliation of Li-intercalated EG with sonication. • The quality of the graphene sheets produced from different sizes EG was compared for the first time and the formation mechanism was discussed. • The graphene sheets obtained from the small size EG have less layers than the large size EG. - Abstract: In this work, graphene sheets suspension were synthesized directly from expandable graphite (EG) via an intercalation and exfoliation pathway using n-butyl lithium as the intercalating agent, water and N,N-dimethylformamide (DMF) as the exfoliating agent. The quality of the graphene sheets produced from different sizes EG was compared and the formation mechanism was discussed. The formation of the graphene sheets and its formation mechanism were confirmed by transmission electron microscopy (TEM), high-resolution TEM (HRTEM), selected area electron diffraction (SAED), Raman spectroscopy measurement, inductively coupled plasma atomic emission spectrometry (ICP-AES) and thermogravimetric analysis (TGA). The graphene sheets obtained from the small size EG have less layers than the large size EG.

  3. FDTD modeling of thin impedance sheets

    NASA Technical Reports Server (NTRS)

    Luebbers, Raymond J.; Kunz, Karl S.


    Thin sheets of resistive or dielectric material are commonly encountered in radar cross section calculations. Analysis of such sheets is simplified by using sheet impedances. In this paper it is shown that sheet impedances can be modeled easily and accurately using Finite Difference Time Domain (FDTD) methods.

  4. Boosted Beta Regression

    PubMed Central

    Schmid, Matthias; Wickler, Florian; Maloney, Kelly O.; Mitchell, Richard; Fenske, Nora; Mayr, Andreas


    Regression analysis with a bounded outcome is a common problem in applied statistics. Typical examples include regression models for percentage outcomes and the analysis of ratings that are measured on a bounded scale. In this paper, we consider beta regression, which is a generalization of logit models to situations where the response is continuous on the interval (0,1). Consequently, beta regression is a convenient tool for analyzing percentage responses. The classical approach to fit a beta regression model is to use maximum likelihood estimation with subsequent AIC-based variable selection. As an alternative to this established - yet unstable - approach, we propose a new estimation technique called boosted beta regression. With boosted beta regression estimation and variable selection can be carried out simultaneously in a highly efficient way. Additionally, both the mean and the variance of a percentage response can be modeled using flexible nonlinear covariate effects. As a consequence, the new method accounts for common problems such as overdispersion and non-binomial variance structures. PMID:23626706

  5. Osteogenic Matrix Cell Sheet Transplantation Enhances Early Tendon Graft to Bone Tunnel Healing in Rabbits

    PubMed Central

    Uematsu, Kota; Akahane, Manabu; Morita, Yusuke; Ogawa, Munehiro; Ueha, Tomoyuki; Shimizu, Takamasa; Kura, Tomohiko; Kawate, Kenji; Tanaka, Yasuhito


    The objective of this study was to determine whether osteogenic matrix cell sheets (OMCS) could induce bone formation around grafted tendons, thereby enhancing early stage tendon to bone tunnel healing in skeletally mature male Japanese white rabbits. First, the osteogenic potential of rabbit OMCS was evaluated. Then, the OMCS were transplanted into the interface between the grafted tendon and the bone tunnel created at the tibia. Histological assessments and biomechanical tensile testing were performed after 3 weeks. The rabbit OMCS showed high alkaline phosphatase (ALP) activity, positive staining of ALP, and osteogenic potential when transplanted subcutaneously with beta tricalcium phosphate disks. Newly formed bony walls and positive collagen type I staining were seen around the grafted tendon with OMCS transplantation, whereas such bony walls were thinner or less frequent without OMCS transplantation. Micro-computed tomography images showed significantly higher bone volume in the OMCS transplantation group. The pullout strength was significantly higher with OMCS (0.74 ± 0.23 N/mm2) than without OMCS (0.58 ± 0.15 N/mm2). These results show that OMCS enhance early tendon to bone tunnel healing. This method can be applied to cases requiring early tendon to bone tunnel healing after ligament reconstruction surgery. PMID:24106718

  6. Manufacturing Laboratory (Fact Sheet)

    SciTech Connect

    Not Available


    This fact sheet describes the purpose, lab specifications, applications scenarios, and information on how to partner with NREL's Manufacturing Laboratory at the Energy Systems Integration Facility. The Manufacturing Laboratory at NREL's Energy Systems Integration Facility (ESIF) focuses on developing methods and technologies that will assist manufacturers of hydrogen and fuel cell technologies, as well as other renewable energy technologies, to scale up their manufacturing capabilities to volumes that meet DOE and industry targets. Specifically, the manufacturing activity is currently focused on developing and validating quality control techniques to assist manufacturers of low temperature and high temperature fuel cells in the transition from low to high volume production methods for cells and stacks. Capabilities include initial proof-of-concept studies through prototype system development and in-line validation. Existing diagnostic capabilities address a wide range of materials, including polymer films, carbon and catalyst coatings, carbon fiber papers and wovens, and multi-layer assemblies of these materials, as well as ceramic-based materials in pre- or post-fired forms. Work leading to the development of non-contact, non-destructive techniques to measure critical dimensional and functional properties of fuel cell and other materials, and validation of those techniques on the continuous processing line. This work will be supported by materials provided by our partners. Looking forward, the equipment in the laboratory is set up to be modified and extended to provide processing capabilities such as coating, casting, and deposition of functional layers, as well as associated processes such as drying or curing. In addition, continuous processes are used for components of organic and thin film photovoltaics (PV) as well as battery technologies, so synergies with these important areas will be explored.

  7. FDTD modeling of thin impedance sheets

    NASA Technical Reports Server (NTRS)

    Luebbers, Raymond; Kunz, Karl


    Thin sheets of resistive or dielectric material are commonly encountered in radar cross section calculations. Analysis of such sheets is simplified by using sheet impedances. It is shown that sheet impedances can be modeled easily and accurately using Finite Difference Time Domain (FDTD) methods. These sheets are characterized by a discontinuity in the tangential magnetic field on either side of the sheet but no discontinuity in tangential electric field. This continuity, or single valued behavior of the electric field, allows the sheet current to be expressed in terms of an impedance multiplying this electric field.

  8. A circumstellar disk around Beta Pictoris

    NASA Technical Reports Server (NTRS)

    Smith, B. A.; Terrile, R. J.


    A circumstellar disk has been observed optically around the fourth-magnitude star Beta Pictoris. First detected in the infrared by the Infrared Astronomy Satellite last year, the disk is seen to extend to more than 400 astronomical units from the star, or more than twice the distance measured in the infrared by the Infrared Astronomy Satellite. The disk is presented to earth almost edge-on and is composed of solid particles in nearly coplanar orbits. The observed change in surface brightness with distance from the star implies that the mass density of the disk falls off with approximately the third power of the radius. Because the circumstellar material is in the form of a highly flattened disk rather than a spherical shell, it is presumed to be associated with planet formation. It seems likely that the system is relatively young and that planet formation either is occurring now around Beta Pictoris or has recently been completed.

  9. Systematic study of plasma flow during plasma sheet thinnings

    NASA Technical Reports Server (NTRS)

    Lui, A. T. Y.; Frank, L. A.; Ackerson, K. L.; Meng, C.-I.; Akasofu, S.-I.


    On the basis of a study of Imp 6 measurements of plasma flow, it is concluded that there is no clear indication of a predominance of tailward plasma flow beyond about X = -15 R sub E in the midnight sector of the plasma sheet during the expansive phase of a substorm. In fact, it is shown statistically that sunward plasma flow is more frequently observed in the midnight sector within about 30 R sub E from the earth than in any other direction during plasma sheet thinning at the substorm expansion. This result supports the conclusion that there is no definite evidence for the formation of a reconnection neutral line in the near-earth plasma sheet during most substorms.

  10. Dynamic of Current Sheets and Their Associated Particle Energization

    SciTech Connect

    Li, Hui; Guo, Fan; Makwan, Kirit; Li, Xiaocan; Zhandrin, Vladimir; Daughton, William Scott


    Magnetic reconnection in current sheets has relevance to Earth's magnetosphere, solar flares, high-energy astrophysics (pulsar wind nebula (e.g. Crab Nebula), gamma-ray bursts, black hole jets), and laboratory plasma/fusion. Data are shown for several cases with varying values of configuration energy Ec and β. Several conclusions were drawn: Depending on the “configuration energy”, the formation, shape, and lifetime of current sheets can vary. Plasma condition (configuration, β, driving, etc.) strongly affect the efficiency of particle acceleration. For low β and general “configuration energy”, particle heating is expected. For low β, large and long-lived current sheets, it is possible to produce highly non-thermal particles via collisionless plasmoid reconnection.

  11. Younger Dryas interval and outflow from the Laurentide ice sheet

    USGS Publications Warehouse

    Moore, T.C., Jr.; Walker, J.C.G.; Rea, David K.; Lewis, C.F.M.; Shane, L.C.K.; Smith, A.J.


    A boxmodel of the Great Lakes is used to estimate meltwater flow into the North Atlantic between 8000 and 14,000 calendar years B.P. Controls on the model include the oxygen isotopic composition of meltwaters and lake waters as measured in the shells of ostracodes. Outflow rates are highest when oxygen isotopic values of the lake waters are most negative, denoting a maximum glacial meltwater component. Flow rates reach maximum values before the onset of the Younger Dryas and after it ends. These maxima appear to be correlative with the major meltwater pulses MWP 1A and 1B. Although the resumption of North Atlantic Deep Water formation may be tied to the reduction in ice sheet melting, neither the onset nor the end of the Younger Dryas, as recorded in the Greenland Ice Sheet Project (GISP2) records, appear tied to maxima in meltwater outflow from the Laurentide ice sheet. Copyright 2000 by the American Geophysical Union.

  12. The current-voltage relationship in auroral current sheets

    NASA Technical Reports Server (NTRS)

    Weimer, D. R.; Gurnett, D. A.; Goertz, C. K.; Menietti, J. D.; Burch, J. L.


    The current-voltage relation within narrow auroral current sheets is examined through the use of high-resolution data from the high altitude Dynamics Explorer 1 satellite. The north-south perpendicular electric field and the east-west magnetic field are shown for three cases in which there are large amplitude, oppositely directed paired electric fields and narrow current sheets. These data are shown to indicate that there is a linear Ohm's law relationship between the current density and the parallel potential drop within the narrow current sheets. This linear relationship had previously been verified for large-scale auroral formations greater than 20 km wide at the ionosphere. The evidence shown here extends our knowledge down to the scale size of discrete auroral arcs.

  13. Platelet-derived growth factor (BB homodimer), transforming growth factor-beta 1, and basic fibroblast growth factor in dermal wound healing. Neovessel and matrix formation and cessation of repair.

    PubMed Central

    Pierce, G. F.; Tarpley, J. E.; Yanagihara, D.; Mustoe, T. A.; Fox, G. M.; Thomason, A.


    Recombinant platelet-derived growth factor (BB homodimer, rPDGF-BB), transforming growth factor beta 1 (rTGF-beta 1), and basic fibroblast growth factor (rbFGF) can accelerate healing of soft tissues. However, little information is available characterizing the components of wound matrix induced by these growth factors and the molecular mechanisms underlying accelerated repair and wound maturation. In this study, the composition, quantity, and rate of extracellular matrix deposition within growth factor-treated lapine ear excisional wounds were analyzed at different stages of healing using specific histochemical and immunohistochemical stains, coupled with image analysis techniques. Single application of optimal concentrations of each growth factor accelerated normal healing by 30% (P less than 0.0003); rPDGF-BB markedly augmented early glycosaminoglycan (GAG) and fibronectin deposition, but induced significantly greater levels of collagen later in the repair process, compared with untreated wounds rTGF-beta 1 treatment led to rapidly enhanced collagen synthesis and maturation, without increased GAG deposition. In contrast, rbFGF treatment induced a predominantly angiogenic response in wounds, with a marked increase in endothelia and neovessels (P less than 0.0001), and increased wound collagenolytic activity (P less than 0.03). rbFGF-treated wounds did not evolve into collagen-containing scars and continued to accumulate only provisional matrix well past wound closure. These results provide new evidence that growth factors influence wound repair via different mechanisms: 1) rPDGF-BB accelerates deposition of provisional wound matrix; 2) rTGF-beta 1 accelerates deposition and maturation of collagen; and 3) rbFGF induces a profound monocellular angiogenic response which may lead to a marked delay in wound maturation, and the possible loss of the normal signal(s) required to stop repair. These results suggest that specific growth factors may selectively regulate

  14. Global ice-sheet system interlocked by sea level

    SciTech Connect

    Denton, G.H.; Hughes, T.J.; Karlen, W.


    Denton and Hughes postulated that sea level linked a global ice-sheet system with both terrestrial and grounded marine components during later Quaternary ice ages. Summer temperature changes near Northern Hemisphere melting margins initiated sea-level fluctuations that controlled marine components in both polar hemispheres. It was further proposed that variations of this ice-sheet system amplified and transmitted Milankovitch summer half-year insolation changes between 45 and 75/sup 0/N into global climatic changes. New tests of this hypothesis implicate sea level as a major control of the areal extent of grounded portions of the Antarctic Ice Sheet. But factors other than areal changes of the grounded Antarctic Ice Sheet may have strongly influenced Southern Hemisphere climate and terminated the last ice age simultaneously in both polar hemispheres. Atmospheric carbon dioxide linked to high-latitude oceans is the most likely candidate, but another potential influence was high-frequency climatic oscillations. It is postulated that variations in atmospheric carbon dioxide acted through an Antarctic ice shelf linked to the grounded ice sheet to produce and terminate Southern Hemisphere ice-age climate. It is further postulated that Milankovitch summer insolation combined with a warm-high frequency oscillation caused marked recession of Northern Hemisphere ice-sheet melting margins and the North Atlantic polar front about 14,000 /sup 14/C yr B.P. This permitted renewed formation of North Atlantic Deep Water, which could well have controlled atmospheric carbon dioxide. Combined melting and consequent sea-level rise from the three warming factors initiated irreversible collapse of the interlocked global ice-sheet system, which was at its largest but most vulnerable configuration.

  15. Horizontal electromagnetic casting of thin metal sheets


    Hull, John R.; Lari, Robert J.; Praeg, Walter F.; Turner, Larry R.


    Thin metal sheets are cast by magnetically suspending molten metal deposited within a ferromagnetic yoke and between AC conducting coils and linearly displacing the magnetically levitated liquid metal while it is being cooled to form a solid metal sheet. Magnetic flux increases as the molten metal sheet moves downward and decreases as the molten metal sheet moves upward to stabilize the sheet and maintain it in equilibrium as it is linearly displaced and solidified by cooling gases. A conducting shield is electrically coupled to the molten metal sheet by means of either metal sheet engaging rollers or brushes on the solidified metal, and by means of an electrode in the vessel containing the molten metal thereby providing a return path for the eddy currents induced in the metal sheet by the AC coil generated magnetic flux. Variation in the geometry of the conducting shield allows the magnetic flux between the metal sheet and the conducting shield to be varied and the thickness in surface quality of the metal sheet to be controlled. Side guards provide lateral containment for the molten metal sheet and stabilize and shape the magnetic field while a leader sheet having electromagnetic characteristics similar to those of the metal sheet is used to start the casting process and precedes the molten metal sheet through the magnet and forms a continuous sheet therewith. The magnet may be either U-shaped with a single racetrack coil or may be rectangular with a pair of facing bedstead coils.

  16. Horizontal electromagnetic casting of thin metal sheets


    Hull, John R.; Lari, Robert J.; Praeg, Walter F.; Turner, Larry R.


    Thin metal sheets are cast by magnetically suspending molten metal deposited within a ferromagnetic yoke and between AC conducting coils and linearly displacing the magnetically levitated liquid metal while it is being cooled to form a solid metal sheet. Magnetic flux increases as the molten metal sheet moves downward and decreases as the molten metal sheet moves upward to stabilize the sheet and maintain it in equilibrium as it is linearly displaced and solidified by cooling gases. A conducting shield is electrically coupled to the molten metal sheet by means of either metal sheet engaging rollers or brushes on the solidified metal, and by means of an electrode in the vessel containing the molten metal thereby providing a return path for the eddy currents induced in the metal sheet by the AC coil generated magnetic flux. Variation in the geometry of the conducting shield allows the magnetic flux between the metal sheet and the conducting shield to be varied and the thickness in surface quality of the metal sheet to be controlled. Side guards provide lateral containment for the molten metal sheet and stabilize and shape the magnetic field while a leader sheet having electromagnetic characteristics similar to those of the metal sheet is used to start the casting process and precedes the molten metal sheet through the magnet and forms a continuous sheet therewith. The magnet may be either U-shaped with a single racetrack coil or may be rectangular with a pair of facing bedstead coils.

  17. Transforming growth factor-beta activation in irradiated murine mammary gland.

    PubMed Central

    Barcellos-Hoff, M H; Derynck, R; Tsang, M L; Weatherbee, J A


    The biological activity of TGF-beta, an important modulator of cell proliferation and extracellular matrix formation, is governed by dissociation of mature TGF-beta from an inactive, latent TGF-beta complex in a process that is critical to its role in vivo. So far, it has not been possible to monitor activation in vivo since conventional immunohistochemical detection does not accurately discriminate latent versus active TGF-beta, nor have events associated with activation been defined well enough to serve as in situ markers of this process. We describe here a modified immunodetection method using differential antibody staining that allows the specific detection of active versus latent TGF-beta. Under these conditions, we report that an antibody raised to latency-associated peptide detects latent TGF-beta, and we demonstrate that LC(1-30) antibodies specifically recognize active TGF-beta 1 in tumor xenografts overproducing active TGF-beta 1, without cross-reactivity in tumors expressing similar levels of latent TGF-beta 1. We previously reported that TGF-beta immunoreactivity increases in murine mammary gland after whole-body 60Co-gamma radiation exposure. Using differential antibody staining we now show that radiation exposure specifically generates active TGF-beta 1. While latent TGF-beta 1 was widely distributed in unirradiated tissue, active TGF-beta 1 distribution was restricted. Active TGF-beta 1 increased significantly within 1 h of irradiation concomitant with decreased latent TGF-beta immunoreactivity. This rapid shift in immunoreactivity provides the first evidence for activation of TGF-beta in situ. This reciprocal pattern of expression persisted for 3 d and was accompanied by decreased recovery of latent TGF-beta 1 from irradiated tissue. Radiation-induced activation of TGF-beta may have profound implications for understanding tissue effects caused by radiation therapy. Images PMID:8113421

  18. Immobilization of TiO2 nanofibers on reduced graphene sheets: Novel strategy in electrospinning.


    Pant, Hem Raj; Adhikari, Surya Prasad; Pant, Bishweshwar; Joshi, Mahesh K; Kim, Han Joo; Park, Chan Hee; Kim, Cheol Sang


    A simple and efficient approach is developed to immobilize TiO2 nanofibers onto reduced graphene oxide (RGO) sheets. Here, TiO2 nanofiber-intercalated RGO sheets are readily produced by two-step procedure involving the use of electrospinning process to fabricate TiO2 precursor containing polymeric fibers on the surface of GO sheets, followed by simultaneous TiO2 nanofibers formation and GO reduction by calcinations. GO sheets deposited on the collector during electrospinning/electrospray can act as substrate on to which TiO2 precursor containing polymer nanofibers can be deposited which give TiO2 NFs doped RGO sheets on calcinations. Formation of corrugated structure cavities of graphene sheets decorated with TiO2 nanofibers on their surface demonstrates that our method constitutes an alternative top-down strategy toward fabricating verities of nanofiber-decorated graphene sheets. It was found that the synthesized TiO2/RGO composite revealed a remarkable increased in photocatalytic activity compared to pristine TiO2 nanofibers. Therefore, engineering of TiO2 nanofiber-intercalated RGO sheets using proposed facile technique can be considered a promising method for catalytic and other applications. PMID:26164250

  19. Nuclear Data Sheets for A = 178

    SciTech Connect

    Achterberg, E.; Capurro, O.A.; Marti, G.V.


    The present revision of the nuclear structure properties for the nuclides belonging to the A = 178 mass chain contains many improvements and additions to the material presented in the previous evaluation (1994Br18, Nucl. Data Sheets 72, 221 (1994)). Besides updating many values, and including supplementary data for already known levels, transitions and level schemes, the most noteworthy modifications with respect to the prior evaluation are extensive additions to the level schemes of {sup 178}Yb, {sup 178}Hf, {sup 178}Ta, {sup 178}W. {sup 178}Ir, {sup 178}Pt and {sup 178}Hg, based on HI reaction works performed after the last cutoff date (July 1993), and to {sup 178}Hf due to new data from recent Coulomb excitation experiments. Light ion ({sup 3}He, {alpha}) beam experiments have added many data for {sup 178}Ta. Beta decay studies have also provided significant data for {sup 178}W and {sup 178}Pt. Lastly the first report of the identification of {sup 178}Tl and {sup 178}Pb is included.

  20. Nuclear Data Sheets for A = 229

    SciTech Connect

    Browne, E.; Tuli, J.K.


    The evaluators present in this publication spectroscopic data and level schemes from radioactive decay and nuclear reaction studies for all nuclei with mass number A = 229. These nuclei belong to a region of coexisting quadrupole with possible octupole deformations. The latter have been observed in {sup 229}Ra, but in {sup 229}Pa the experimental evidence is inconclusive. The present evaluation of A = 229, which includes all data received by June 2008, supersedes the 1989 evaluation by Y.A. Akovali, published in Nuclear Data Sheets58, 555 (1989). Highlights of this publication are given below: A comprehensive spectroscopic study of {sup 229}Fr(50.2 s) {beta}- decay using mass-separated sources have provided the first evidence of parity doublets in {sup 229}Ra due to nuclear octupole deformation (1999Fr33). In {sup 229}Th a level at 7.6 5 eV - the closest level to the ground state ever known - has been confirmed through extremely precise measurements of {gamma}-ray energies from {sup 233}U {alpha} decay (1994He08, 2007Be16). A nuclear level at such low energy may be used for studying a large variety of atomic properties associated to nuclear decay. The level structure in {sup 229}Pa has been interpreted in terms of the rotational model (1994Le22). Some authors, however, have proposed the existence of parity doublets as evidence of octupole nuclear deformation (1982Ah08). This interpretation has not been confirmed.