Tunable drug loading and release from polypeptide multilayer nanofilms

PubMed Central

Jiang, Bingbing; Li, Bingyun

2009-01-01

Polypeptide multilayer nanofilms were prepared using electrostatic layer-by-layer self-assembly nanotechnology. Small charged drug molecules (eg, cefazolin, gentamicin, and methylene blue) were loaded in polypeptide multilayer nanofilms. Their loading and release were found to be pH-dependent and could also be controlled by changing the number of film layers and drug incubation time, and applying heat-treatment after film formation. Antibioticloaded polypeptide multilayer nanofilms showed controllable antibacterial properties against Staphylococcus aureus. The developed biodegradable polypeptide multilayer nanofilms are capable of loading both positively- and negatively-charged drug molecules and promise to serve as drug delivery systems on biomedical devices for preventing biomedical device-associated infection, which is a significant clinical complication for both civilian and military patients. PMID:19421369

Systems for the expression of orthogonal translation components in eubacterial host cells

DOEpatents

Ryu, Youngha; Schultz, Peter G.

2013-01-22

The invention related to compositions and methods for the in vivo production of polypeptides comprising one or more unnatural amino acids. Specifically, the invention provides plasmid systems for the efficient eubacterial expression of polypeptides comprising one or more unnatural acids at genetically-programmed positions.

Systems for the expression of orthogonal translation components in eubacterial host cells

DOEpatents

Ryu, Youngha [San Diego, CA; Schultz, Peter G [La Jolla, CA

2011-06-14

The invention relates to compositions and methods for the in vivo production of polypeptides comprising one or more unnatural amino acids. Specifically, the invention provides plasmid systems for the efficient eubacterial expression of polypeptides comprising one or more unnatural amino acids at genetically-programmed positions.

Systems for the expression of orthogonal translation components eubacterial host cells

DOEpatents

Ryu, Youngha [San Diego, CA; Schultz, Peter G [La Jolla, CA

2012-06-12

The invention relates to compositions and methods for the in vivo production of polypeptides comprising one or more unnatural amino acids. Specifically, the invention provides plasmid systems for the efficient eubacterial expression of polypeptides comprising one or more unnatural amino acids at genetically-programmed positions.

Selective posttranslational modification of phage-displayed polypeptides

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tsao, Meng-Lin; Tian, Feng; Schultz, Peter

The invention relates to posttranslational modification of phage-displayed polypeptides. These displayed polypeptides comprise at least one unnatural amino acid, e.g., an aryl-azide amino acid such as p-azido-L-phenylalanine, or an alkynyl-amino acid such as para-propargyloxyphenylalanine, which are incorporated into the phage-displayed fusion polypeptide at a selected position by using an in vivo orthogonal translation system comprising a suitable orthogonal aminoacyl-tRNA synthetase and a suitable orthogonal tRNA species. These unnatural amino acids advantageously provide targets for posttranslational modifications such as azide-alkyne [3+2] cycloaddition reactions and Staudinger modifications.

Selective posttranslational modification of phage-displayed polypeptides

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tsao, Meng-Lin; Tian, Feng; Schultz, Peter

The invention relates to posttranslational modification of phage-displayed polypeptides. These displayed polypeptides comprise at least one unnatural amino acid, e.g., an aryl-azide amino acid such as p-azido-L-phenylalanine, or an alkynyl-amino acid such as para-propargyloxyphenylalanine, which are incorporated into the phage-displayed fusion polypeptide at a selected position by using an in vivo orthogonal translation system comprising a suitable orthogonal aminoacyl-tRNA synthetase and a suitable orthogonal tRNA species. These unnatural amino acids advantageously provide targets for posttranslational modifications such as azide-alkyne [3+2]cycloaddition reactions and Staudinger modifications.

Improvement of Learning and Memory Induced by Cordyceps Polypeptide Treatment and the Underlying Mechanism

PubMed Central

2018-01-01

Our previous research revealed that Cordyceps militaris can improve the learning and memory, and although the main active ingredient should be its polypeptide complexes, the underlying mechanism of its activity remains poorly understood. In this study, we explored the mechanisms by which Cordyceps militaris improves learning and memory in a mouse model. Mice were given scopolamine hydrobromide intraperitoneally to establish a mouse model of learning and memory impairment. The effects of Cordyceps polypeptide in this model were tested using the Morris water maze test; serum superoxide dismutase activity; serum malondialdehyde levels; activities of acetyl cholinesterase, Na+-k+-ATPase, and nitric oxide synthase; and gamma aminobutyric acid and glutamate contents in brain tissue. Moreover, differentially expressed genes and the related cellular signaling pathways were screened using an mRNA expression profile chip. The results showed that the genes Pik3r5, Il-1β, and Slc18a2 were involved in the effects of Cordyceps polypeptide on the nervous system of these mice. Our findings suggest that Cordyceps polypeptide may improve learning and memory in the scopolamine-induced mouse model of learning and memory impairment by scavenging oxygen free radicals, preventing oxidative damage, and protecting the nervous system. PMID:29736181

Molecular description of the LCST behavior of an elastin-like polypeptide.

PubMed

Li, Nan K; García Quiroz, Felipe; Hall, Carol K; Chilkoti, Ashutosh; Yingling, Yaroslava G

2014-10-13

Elastin-like polypeptides (ELPs) with the repeat sequence of VPGVG are widely used as a model system for investigation of lower critical solution temperature (LCST) transition behavior. In this paper, the effect of temperature on the structure, dynamics and association of (VPGVG)18 in aqueous solution is investigated using atomistic molecular dynamics simulations. Our simulations show that as the temperature increases the ELP backbones undergo gradual conformational changes, which are attributed to the formation of more ordered secondary structures such as β-strands. In addition, increasing temperature changes the hydrophobicity of the ELP by exposure of hydrophobic valine-side chains to the solvent and hiding of proline residues. Based on our simulations, we conclude that the transition behavior of (VPGVG)18 can be attributed to a combination of thermal disruption of the water network that surrounds the polypeptide, reduction of solvent accessible surface area of the polypeptide, and increase in its hydrophobicity. Simulations of the association of two (VPGVG)18 molecules demonstrated that the observed gradual changes in the structural properties of the single polypeptide chain are enough to cause the aggregation of polypeptides above the LCST. These results lead us to propose that the LCST phase behavior of poly(VPGVG) is a collective phenomenon that originates from the correlated gradual changes in single polypeptide structure and the abrupt change in properties of hydration water around the peptide and is a result of a competition between peptide-peptide and peptide-water interactions. This is a computational study of an important intrinsically disordered peptide system that provides an atomic-level description of structural features and interactions that are relevant in the LCST phase behavior.

In vivo unnatural amino acid expression in the methylotrophic yeast Pichia pastoris

DOEpatents

Young, Travis; Schultz, Peter G.

2017-08-15

The invention provides orthogonal translation systems for the production of polypeptides comprising unnatural amino acids in methylotrophic yeast such as Pichia pastoris. Methods for producing polypeptides comprising unnatural amino acids in methylotrophic yeast such as Pichia pastoris are also provided.

In vivo unnatural amino acid expression in the methylotrophic yeast Pichia pastoris

DOEpatents

Young, Travis [San Diego, CA; Schultz, Peter G [La Jolla, CA

2014-02-11

The invention provides orthogonal translation systems for the production of polypeptides comprising unnatural amino acids in methyltrophic yeast such as Pichia pastoris. Methods for producing polypeptides comprising unnatural amino acids in methyltrophic yeast such as Pichia pastoris are also provided.

NASA Tech Briefs, May 2004

NASA Technical Reports Server (NTRS)

2004-01-01

Topics include: Embedded Heaters for Joining or Separating Plastic Parts; Curing Composite Materials Using Lower-Energy Electron Beams; Aluminum-Alloy-Matrix/Alumina-Reinforcement Composites; Fibrous-Ceramic/Aerogel Composite Insulating Tiles; Urethane/Silicone Adhesives for Bonding Flexing Metal Parts; Scalable Architecture for Multihop Wireless ad Hoc Networks; Improved Thermoplastic/Iron-Particle Transformer Cores; Cooperative Lander-Surface/Aerial Microflyer Missions for Mars Exploration Dual-Frequency Airborne Scanning Rain Radar Antenna System Eight-Channel Continuous Timer Reduction of Phase Ambiguity in an Offset-QPSK Receiver Ambient-Light-Canceling Camera Using Subtraction of Frames Lightweight, Flexible, Thin, Integrated Solar-Power Packs Windows(Registered Trademark)-Based Software Models Cyclic Oxidation Behavior Software for Analyzing Sequences of Flow-Related Images Improved Ball-and-Socket Docking Mechanism Two-Stage Solenoid Ordered Nanostructures Made Using Chaperonin Polypeptides Low-Temperature Plasma Functionalization of Carbon Nanotubes Improved Cryostat for Cooling a Wide Panel Current Pulses Momentarily Enhance Thermoelectric Cooling Hand-Held Color Meters Based on Interference Filters Calculating Mass Diffusion in High-Pressure Binary Fluids Fresnel Lenses for Wide-Aperture Optical Receivers Increasing Accuracy in Computed Inviscid Boundary Conditions Higher-Order Finite Elements for Computing Thermal Radiation Radar for Monitoring Hurricanes from Geostationary Orbit Time-Transfer System for Two Orbiting Spacecraft

Chronic changes in pituitary adenylate cyclase-activating polypeptide and related receptors in response to repeated chemical dural stimulation in rats.

PubMed

Han, Xun; Ran, Ye; Su, Min; Liu, Yinglu; Tang, Wenjing; Dong, Zhao; Yu, Shengyuan

2017-01-01

Background Preclinical experimental studies revealed an acute alteration of pituitary adenylate cyclase-activating polypeptide in response to a single activation of the trigeminovascular system, which suggests a potential role of pituitary adenylate cyclase-activating polypeptide in the pathogenesis of migraine. However, changes in pituitary adenylate cyclase-activating polypeptide after repeated migraine-like attacks in chronic migraine are not clear. Therefore, the present study investigated chronic changes in pituitary adenylate cyclase-activating polypeptide and related receptors in response to repeated chemical dural stimulations in the rat. Methods A rat model of chronic migraine was established by repeated chemical dural stimulations using an inflammatory soup for a different numbers of days. The pituitary adenylate cyclase-activating polypeptide levels were quantified in plasma, the trigeminal ganglia, and the trigeminal nucleus caudalis using radioimmunoassay and Western blotting in trigeminal ganglia and trigeminal nucleus caudalis tissues. Western blot analysis and real-time polymerase chain reaction were used to measure the protein and mRNA expression of pituitary adenylate cyclase-activating polypeptide-related receptors (PAC1, VPAC1, and VPAC2) in the trigeminal ganglia and trigeminal nucleus caudalis to identify changes associated with repetitive applications of chemical dural stimulations. Results All rats exhibited significantly decreased periorbital nociceptive thresholds to repeated inflammatory soup stimulations. Radioimmunoassay and Western blot analysis demonstrated significantly decreased pituitary adenylate cyclase-activating polypeptide levels in plasma and trigeminal ganglia after repetitive chronic inflammatory soup stimulation. Protein and mRNA analyses of pituitary adenylate cyclase-activating polypeptide-related receptors demonstrated significantly increased PAC1 receptor protein and mRNA expression in the trigeminal ganglia, but not in the trigeminal nucleus caudalis, and no significant differences were found in the expression of the VPAC1 and VPAC2 receptors. Conclusions This study demonstrated the chronic alteration of pituitary adenylate cyclase-activating polypeptide and related receptors in response to repeated chemical dural stimulation in the rat, which suggests the crucial involvement of pituitary adenylate cyclase-activating polypeptide in the development of migraine. The selective increase in pituitary adenylate cyclase-activating polypeptide-related receptors suggests that the PAC1 receptor pathway is a novel target for the treatment of migraine.

Highly stable beta-class carbonic anhydrases useful in carbon capture systems

DOEpatents

Alvizo, Oscar; Benoit, Mike; Novick, Scott

2013-04-16

The present disclosure relates to .beta.-class carbonic anhydrase polypeptides having improved properties including increased thermostability and/or stability in the presence of amine compounds, ammonia, or carbonate ion. The present disclosure also provides formulations and uses of the polypeptides for accelerating the absorption of carbon dioxide from a gas stream into a solution as well as for the release of the absorbed carbon dioxide for further treatment and/or sequestering. Also provided are polynucleotides encoding the carbonic anhydrase polypeptides and host cells capable of expressing them.

Highly stable beta-class carbonic anhydrases useful in carbon capture systems

DOEpatents

Alvizo, Oscar; Benoit, Michael R; Novick, Scott J

2013-08-20

The present disclosure relates to .beta.-class carbonic anhydrase polypeptides having improved properties including increased thermostability and/or stability in the presence of amine compounds, ammonia, or carbonate ion. The present disclosure also provides formulations and uses of the polypeptides for accelerating the absorption of carbon dioxide from a gas stream into a solution as well as for the release of the absorbed carbon dioxide for further treatment and/or sequestering. Also provided are polynucleotides encoding the carbonic anhydrase polypeptides and host cells capable of expressing them.

Self-assemble nanoparticles based on polypeptides containing C-terminal luminescent Pt-cysteine complex

NASA Astrophysics Data System (ADS)

Vlakh, E. G.; Grachova, E. V.; Zhukovsky, D. D.; Hubina, A. V.; Mikhailova, A. S.; Shakirova, J. R.; Sharoyko, V. V.; Tunik, S. P.; Tennikova, T. B.

2017-02-01

The growing attention to the luminescent nanocarriers is strongly stimulated by their potential application as drug delivery systems and by the necessity to monitor their distribution in cells and tissues. In this communication we report on the synthesis of amphiphilic polypeptides bearing C-terminal phosphorescent label together with preparation of nanoparticles using the polypeptides obtained. The approach suggested is based on a unique and highly technological process where the new phosphorescent Pt-cysteine complex serves as initiator of the ring-opening polymerization of α-amino acid N-carboxyanhydrides to obtain the polypeptides bearing intact the platinum chromophore covalently bound to the polymer chain. It was established that the luminescent label retains unchanged its emission characteristics not only in the polypeptides but also in more complicated nanoaggregates such as the polymer derived amphiphilic block-copolymers and self-assembled nanoparticles. The phosphorescent nanoparticles display no cytotoxicity and hemolytic activity in the tested range of concentrations and easily internalize into living cells that makes possible in vivo cell visualization, including prospective application in time resolved imaging and drug delivery monitoring.

Cellobiohydrolase I enzymes

DOEpatents

Adney, William S; Himmel, Michael E; Decker, Stephen R; Knoshaug, Eric P; Nimlos, Mark R; Crowley, Michael F; Jeoh, Tina

2014-01-28

Provided herein is an isolated Cel7A polypeptide comprising mutations in the catalytic domain of the polypeptide relative to the catalytic domain of a wild type Cel7A polypeptide, wherein the mutations reduce N-linked glycosylation of the isolated polypeptide relative to the wild type polypeptide. Also provided herein is an isolated Cel7A polypeptide comprising increased O-linked glycosylation of the linker domain relative to a linker domain of a wild type Cel7A polypeptide. The increased O-linked glycosylation is a result of the addition of and/or substitution of one or more serine and/or threonine residues to the linker domain relative to the linker domain of the wild type polypeptide. In some embodiments, the isolated Cel7A polypeptide comprising mutations in the catalytic domain of the polypeptide relative to the catalytic domain of a wild type Cel7A polypeptide further comprises increased O-linked glycosylation of the linker domain relative to a linker domain of a wild type Cel7A polypeptide. The mutations in the catalytic domain reduce N-linked glycosylation of the isolated polypeptide relative to the wild type polypeptide. The addition of and/or substitution of one or more serine and/or threonine residues to the linker domain relative to the linker domain of the wild type polypeptide increases O-linked glycosylation of the isolated polypeptide. Further provided are compositions comprising such polypeptides and nucleic acids encoding such polypeptides. Still further provided are methods for making such polypeptides.

Aqueous cholesteric liquid crystals using uncharged rodlike polypeptides. Polypeptide vesicles by conformation-specific assembly. Ordered chiral macroporous hybrid silica-polypeptide composites

NASA Astrophysics Data System (ADS)

Bellomo, Enrico Giuseppe

2005-07-01

Aqueous cholesteric liquid crystals using uncharged rodlike polypeptides . The aqueous, lyotropic liquid-crystalline phase behavior of an alpha helical polypeptide, has been studied using optical microscopy and X-ray scattering. Solutions of optically pure polypeptide were found to form cholesteric liquid crystals at volume fractions that decreased with increasing average chain length. At very high volume fractions, the formation of a hexagonal mesophase was observed. The pitch of the cholesteric phase could be varied by a mixture of enantiomeric samples, where the pitch increased as the mixture approached equimolar. The cholesteric phases could be untwisted, using either magnetic field or shear flow, into nematic phases, which relaxed into cholesterics upon removal of field or shear. We have found that the phase diagram of this polypeptide in aqueous solution parallels that of poly(gamma-benzyl glutamate) in organic solvents, thus providing a useful system for liquid-crystal applications requiring water as solvent. Polypeptide vesicles by conformation-specific assembly. We have found that block copolymers composed of polypeptide segments provide significant advantages in controlling both the function and supramolecular structure of bioinspired self-assemblies. Incorporation of the stable chain conformations found in proteins into block copolymers was found to provide an additional element of control, beyond amphiphilicity and composition that defines self-assembled architecture. The abundance of functionality present in amino acids, and the ease by which they can be incorporated into these materials, also provides a powerful mechanism to impart block copolypeptides with function. This combination of structure and function work synergistically to enable significant advantages in the preparation of therapeutic agents as well as provide insight into design of self-assemblies beginning to approach the complexity of natural structures such as virus capsids. Ordered chiral macroporous hybrid silica-polypeptide composites. The mineralization of organic templates has been investigated as an effective way to control the size and structure of inorganic frameworks. Hybrid structures incorporating polypeptide with silica have been prepared and characterized using X-ray scattering, TGA, SEM and TEM. The results support the interaction between silica and polymer to form ordered chiral macroporous structures that can be easily controlled by polymer molecular weight and volume fraction.

Polypeptide Synthesis in Simian Virus 5-Infected Cells

PubMed Central

Peluso, Richard W.; Lamb, Robert A.; Choppin, Purnell W.

1977-01-01

Polypeptide synthesis in three different cell types infected with simian virus 5 has been examined using high-resolution polyacrylamide slab gel electrophoresis, and all of the known viral polypeptides have been identified above the host cell background. The polypeptides were synthesized in infected cells in unequal proportions, which are approximately the same as they are found in virions, suggesting that their relative rates of synthesis are controlled. The nucleocapsid polypeptide (NP) was the first to be detected in infected cells, and by 12 to 14 h the other virion structural polypeptides were identified, except for the polypeptides comprising the smaller glycoprotein (F). However, a glycosylated precursor (F0) with a molecular weight of 66,000 was found in each cell type, and pulse-chase experiments suggested that this precursor was cleaved to yield polypeptides F1 and F2. No other proteolytic processing was found. In addition to the structural polypeptides, the synthesis of five other polypeptides, designated I through V, has been observed in simian virus 5-infected cells. One of these (V), with a molecular weight of 24,000, was found in all cells examined and may be a nonstructural viral polypeptide. In contrast, there are polypeptides present in uninfected cells that correspond in size to polypeptides I through IV, and similar polypeptides have also been detected in increased amounts in cells infected with Sendai virus. These findings, and the fact that the synthesis of all four of these polypeptides is not increased in every cell type, suggest that they represent host polypeptides whose synthesis may be enhanced upon infection. When a high salt concentration was used to decrease host cell protein synthesis in infected cells, polypeptides IV and (to a lesser extent) I were synthesized in relatively greater amounts than other cellular polypeptides, as were the viral polypeptides. The possibility that these polypeptides may play some role in virus replication is discussed. Images PMID:196101

Cooperative polymerization of α-helices induced by macromolecular architecture

NASA Astrophysics Data System (ADS)

Baumgartner, Ryan; Fu, Hailin; Song, Ziyuan; Lin, Yao; Cheng, Jianjun

2017-07-01

Catalysis observed in enzymatic processes and protein polymerizations often relies on the use of supramolecular interactions and the organization of functional elements in order to gain control over the spatial and temporal elements of fundamental cellular processes. Harnessing these cooperative interactions to catalyse reactions in synthetic systems, however, remains challenging due to the difficulty in creating structurally controlled macromolecules. Here, we report a polypeptide-based macromolecule with spatially organized α-helices that can catalyse its own formation. The system consists of a linear polymeric scaffold containing a high density of initiating groups from which polypeptides are grown, forming a brush polymer. The folding of polypeptide side chains into α-helices dramatically enhances the polymerization rate due to cooperative interactions of macrodipoles between neighbouring α-helices. The parameters that affect the rate are elucidated by a two-stage kinetic model using principles from nucleation-controlled protein polymerizations; the key difference being the irreversible nature of this polymerization.

A few positively charged residues slow movement of a polypeptide chain across the endoplasmic reticulum membrane.

PubMed

Yamagishi, Marifu; Onishi, Yukiko; Yoshimura, Shotaro; Fujita, Hidenobu; Imai, Kenta; Kida, Yuichiro; Sakaguchi, Masao

2014-08-26

Many polypeptide chains are translocated across and integrated into the endoplasmic reticulum membrane through protein-conducting channels. During the process, amino acid sequences of translocating polypeptide chains are scanned by the channels and classified to be retained in the membrane or translocated into the lumen. We established an experimental system with which the kinetic effect of each amino acid residue on the polypeptide chain movement can be analyzed with a time resolution of tens of seconds. Positive charges greatly slow movement; only two lysine residues caused a remarkable slow down, and their effects were additive. The lysine residue was more effective than arginine. In contrast, clusters comprising three residues of each of the other 18 amino acids had little effect on chain movement. We also demonstrated that a four lysine cluster can exert the effect after being fully exposed from the ribosome. We concluded that as few as two to three residues of positively charged amino acids can slow the movement of the nascent polypeptide chain across the endoplasmic reticulum membrane. This effect provides a fundamental basis of the topogenic function of positively charged amino acids.

Effects of cholesterol on pore formation in lipid bilayers induced by human islet amyloid polypeptide fragments: A coarse-grained molecular dynamics study

NASA Astrophysics Data System (ADS)

Xu, Weixin; Wei, Guanghong; Su, Haibin; Nordenskiöld, Lars; Mu, Yuguang

2011-11-01

Disruption of the cellular membrane by the amyloidogenic peptide, islet amyloid polypeptide (IAPP), has been considered as one of the mechanisms of β-cell death during type 2 diabetes. The N-terminal region (residues 1-19) of the human version of IAPP is suggested to be primarily responsible for the membrane-disrupting effect of the full-length hIAPP peptide. However, the detailed assembly mode of hIAPP1-19 with membrane remains unclear. To gain insight into the interactions of hIAPP1-19 oligomer with the model membrane, we have employed coarse-grained molecular dynamics self-assembly simulations to study the aggregation of hIAPP1-19 fragments in the binary lipid made of zwitterionic dipalmitoylphosphatidylcholine (DPPC) and anionic dipalmitoylphosphatidylserine (DPPS) in the presence and absence of different levels of cholesterol content. The membrane-destabilizing effect of hIAPP1-19 is found to be modulated by the presence of cholesterol. In the absence of cholesterol, hIAPP1-19 aggregates prefer to locate inside the bilayer, forming pore-like assemblies. While in the presence of cholesterol molecules, the lipid bilayer becomes more ordered and stiff, and the hIAPP1-19 aggregates are dominantly positioned at the bilayer-water interface. The action of cholesterol may suggest a possible way to maintain the membrane integrity by small molecule interference.

Compositions and methods for making selenocysteine containing polypeptides

DOEpatents

Soll, Dieter; Aldag, Caroline; Hohn, Michael

2016-10-11

Non-naturally occurring tRNA.sup.Sec and methods of using them for recombinant expression of proteins engineered to include one or more selenocysteine residues are disclosed. The non-naturally occurring tRNA.sup.Sec can be used for recombinant manufacture of selenocysteine containing polypeptides encoded by mRNA without the requirement of an SECIS element. In some embodiments, selenocysteine containing polypeptides are manufactured by co-expressing a non-naturally occurring tRNA.sup.Sec a recombinant expression system, such as E. coli, with SerRS, EF-Tu, SelA, or PSTK and SepSecS, and an mRNA with at least one codon that recognizes the anticodon of the non-naturally occurring tRNA.sup.Sec.

Monoclonal antibodies to the light-harvesting chlorophyll a/b protein complex of photosystem II

PubMed Central

1986-01-01

A collection of 17 monoclonal antibodies elicited against the light- harvesting chlorophyll a/b protein complex which serves photosystem II (LHC-II) of Pisum sativum shows six classes of binding specificity. Antibodies of two of the classes recognize a single polypeptide (the 28- or the 26- kD polypeptides), thereby suggesting that the two proteins are not derived from a common precursor. Other classes of antibodies cross-react with several polypeptides of LHC-II or with polypeptides of both LHC-II and the light-harvesting chlorophyll a/b polypeptides of photosystem I (LHC-I), indicating that there are structural similarities among the polypeptides of LHC-II and LHC-I. The evidence for protein processing by which the 26-, 25.5-, and 24.5-kD polypeptides are derived from a common precursor polypeptide is discussed. Binding studies using antibodies specific for individual LHC- II polypeptides were used to quantify the number of antigenic polypeptides in the thylakoid membrane. 27 copies of the 26-kD polypeptide and two copies of the 28-kD polypeptide were found per 400 chlorophylls. In the chlorina f2 mutant of barley, and in intermittent light-treated barley seedlings, the amount of the 26-kD polypeptide in the thylakoid membranes was greatly reduced, while the amount of 28-kD polypeptide was apparently not affected. We propose that stable insertion and assembly of the 28-kD polypeptide, unlike the 26-kD polypeptide, is not regulated by the presence of chlorophyll b. PMID:3528171

The Ruinous Influence of Close Binary Companions on Planetary Systems

NASA Astrophysics Data System (ADS)

Kraus, Adam L.; Ireland, Michael; Mann, Andrew; Huber, Daniel; Dupuy, Trent J.

2017-01-01

The majority of solar-type stars are found in binary systems, and the dynamical influence of binary companions is expected to profoundly influence planetary systems. However, the difficulty of identifying planets in binary systems has left the magnitude of this effect uncertain; despite numerous theoretical hurdles to their formation and survival, at least some binary systems clearly host planets. We present high-resolution imaging of nearly 500 Kepler Objects of Interest (KOIs) obtained using adaptive-optics imaging and nonredundant aperture-mask interferometry on the Keck II telescope. We super-resolve some binary systems to projected separations of under 5 AU, showing that planets might form in these dynamically active environments. However, the full distribution of projected separations for our planet-host sample more broadly reveals a deep paucity of binary companions at solar-system scales. When the binary population is parametrized with a semimajor axis cutoff a cut and a suppression factor inside that cutoff S bin, we find with correlated uncertainties that inside acut = 47 +59/-23 AU, the planet occurrence rate in binary systems is only Sbin = 0.34 +0.14/-0.15 times that of wider binaries or single stars. Our results demonstrate that a fifth of all solar-type stars in the Milky Way are disallowed from hosting planetary systems due to the influence of a binary companion.

The Ruinous Influence of Close Binary Companions on Planetary Systems

NASA Astrophysics Data System (ADS)

Kraus, Adam L.; Ireland, Michael; Mann, Andrew; Huber, Daniel; Dupuy, Trent J.

2017-06-01

The majority of solar-type stars are found in binary systems, and the dynamical influence of binary companions is expected to profoundly influence planetary systems. However, the difficulty of identifying planets in binary systems has left the magnitude of this effect uncertain; despite numerous theoretical hurdles to their formation and survival, at least some binary systems clearly host planets. We present high-resolution imaging of nearly 500 Kepler Objects of Interest (KOIs) obtained using adaptive-optics imaging and nonredundant aperture-mask interferometry on the Keck II telescope. We super-resolve some binary systems to projected separations of under 5 AU, showing that planets might form in these dynamically active environments. However, the full distribution of projected separations for our planet-host sample more broadly reveals a deep paucity of binary companions at solar-system scales. When the binary population is parametrized with a semimajor axis cutoff a cut and a suppression factor inside that cutoff S bin, we find with correlated uncertainties that inside acut = 47 +59/-23 AU, the planet occurrence rate in binary systems is only Sbin = 0.34+0.14/-0.15 times that of wider binaries or single stars. Our results demonstrate that a fifth of all solar-type stars in the Milky Way are disallowed from hosting planetary systems due to the influence of a binary companion.

Targeted polypeptide degradation

DOEpatents

Church, George M [Brookline, MA; Janse, Daniel M [Brookline, MA

2008-05-13

This invention pertains to compositions, methods, cells and organisms useful for selectively localizing polypeptides to the proteasome for degradation. Therapeutic methods and pharmaceutical compositions for treating disorders associated with the expression and/or activity of a polypeptide by targeting these polypeptides for degradation, as well as methods for targeting therapeutic polypeptides for degradation and/or activating therapeutic polypeptides by degradation are provided. The invention provides methods for identifying compounds that mediate proteasome localization and/or polypeptide degradation. The invention also provides research tools for the study of protein function.

Generation of polypeptide-templated gold nanoparticles using ionizing radiation.

PubMed

Walker, Candace Rae; Pushpavanam, Karthik; Nair, Divya Geetha; Potta, Thrimoorthy; Sutiyoso, Caesario; Kodibagkar, Vikram D; Sapareto, Stephen; Chang, John; Rege, Kaushal

2013-08-13

Ionizing radiation, including γ rays and X-rays, are high-energy electromagnetic radiation with diverse applications in nuclear energy, astrophysics, and medicine. In this work, we describe the use of ionizing radiation and cysteine-containing elastin-like polypeptides (C(n)ELPs, where n = 2 or 12 cysteines in the polypeptide sequence) for the generation of gold nanoparticles. In the presence of C(n)ELPs, ionizing radiation doses higher than 175 Gy resulted in the formation of maroon-colored gold nanoparticle dispersions, with maximal absorbance at 520 nm, from colorless metal salts. Visible color changes were not observed in any of the control systems, indicating that ionizing radiation, gold salt solution, and C(n)ELPs were all required for nanoparticle formation. The hydrodynamic diameters of nanoparticles, determined using dynamic light scattering, were in the range of 80-150 nm, while TEM imaging indicated the formation of gold cores 10-20 nm in diameter. Interestingly, C2ELPs formed 1-2 nm diameter gold nanoparticles in the absence of radiation. Our results describe a facile method of nanoparticle formation in which nanoparticle size can be tailored based on radiation dose and C(n)ELP type. Further improvements in these polypeptide-based systems can lead to colorimetric detection of ionizing radiation in a variety of applications.

The disruption of multiplanet systems through resonance with a binary orbit.

PubMed

Touma, Jihad R; Sridhar, S

2015-08-27

Most exoplanetary systems in binary stars are of S-type, and consist of one or more planets orbiting a primary star with a wide binary stellar companion. Planetary eccentricities and mutual inclinations can be large, perhaps forced gravitationally by the binary companion. Earlier work on single planet systems appealed to the Kozai-Lidov instability wherein a sufficiently inclined binary orbit excites large-amplitude oscillations in the planet's eccentricity and inclination. The instability, however, can be quenched by many agents that induce fast orbital precession, including mutual gravitational forces in a multiplanet system. Here we report that orbital precession, which inhibits Kozai-Lidov cycling in a multiplanet system, can become fast enough to resonate with the orbital motion of a distant binary companion. Resonant binary forcing results in dramatic outcomes ranging from the excitation of large planetary eccentricities and mutual inclinations to total disruption. Processes such as planetary migration can bring an initially non-resonant system into resonance. As it does not require special physical or initial conditions, binary resonant driving is generic and may have altered the architecture of many multiplanet systems. It can also weaken the multiplanet occurrence rate in wide binaries, and affect planet formation in close binaries.

Hydrogenase polypeptide and methods of use

DOEpatents

Adams, Michael W.W.; Hopkins, Robert C.; Jenney, JR, Francis E.; Sun, Junsong

2016-02-02

Provided herein are polypeptides having hydrogenase activity. The polypeptide may be multimeric, and may have hydrogenase activity of at least 0.05 micromoles H.sub.2 produced min.sup.-1 mg protein.sup.-1. Also provided herein are polynucleotides encoding the polypeptides, genetically modified microbes that include polynucleotides encoding one or more subunits of the multimeric polypeptide, and methods for making and using the polypeptides.

Terrestrial Planet Formation in Binary Star Systems

NASA Technical Reports Server (NTRS)

Lissauer, Jack J.; Quintana, Elisa V.; Chambers, John; Duncan, Martin J.; Adams, Fred

2003-01-01

Most stars reside in multiple star systems; however, virtually all models of planetary growth have assumed an isolated single star. Numerical simulations of the collapse of molecular cloud cores to form binary stars suggest that disks will form within such systems. Observations indirectly suggest disk material around one or both components within young binary star systems. If planets form at the right places within such circumstellar disks, they can remain in stable orbits within the binary star systems for eons. We are simulating the late stages of growth of terrestrial planets within binary star systems, using a new, ultrafast, symplectic integrator that we have developed for this purpose. We show that the late stages of terrestrial planet formation can indeed take place in a wide variety of binary systems and we have begun to delineate the range of parameter space for which this statement is true. Results of our initial simulations of planetary growth around each star in the alpha Centauri system and other 'wide' binary systems, as well as around both stars in very close binary systems, will be presented.

Analysis of polypeptide composition and antigenic components of Rickettsia tsutsugamushi by polyacrylamide gel electrophoresis and immunoblotting.

PubMed Central

Tamura, A; Ohashi, N; Urakami, H; Takahashi, K; Oyanagi, M

1985-01-01

Polyacrylamide gel electrophoresis of lysates of purified Rickettsia tsutsugamushi revealed as many as 30 polypeptide bands, including major bands corresponding to molecular sizes of 70, 60, 54 to 56, and 46 to 47 kilodaltons. Compared with the polypeptide composition of the rickettsiae of Gilliam, Karp, and Kato strains and a newly isolated Shimokoshi strain, the major polypeptide in the Kato strain (54-56K) and in the Karp strain (46-47K) migrated a little faster and slower, respectively, than the corresponding polypeptides in the other strains. The largest major polypeptide (54-56K) was digestible by the treatment of intact rickettsiae with trypsin and variable in content in separate preparations, suggesting that the polypeptide exists on the rickettsial surface and is easily degraded during the handling of these microorganisms. Several surface polypeptides of rickettsiae, including the 54-56K and 46-47K polypeptides, were detected by radioiodination of intact rickettsiae followed by polyacrylamide gel electrophoresis of the lysate; however, the 70K and 60K polypeptides were not labeled. Immunoblotting experiments with hyperimmune sera prepared in guinea pigs against each strain demonstrated that the 70K, 54-56K, and 46-47K polypeptides showed antigenic activities. The 54-56K polypeptide appeared to be strain specific, whereas the 70K and 46-47K polypeptides cross-reacted with the heterologous antisera. Images PMID:3922893

Equilibrium points and associated periodic orbits in the gravity of binary asteroid systems: (66391) 1999 KW4 as an example

NASA Astrophysics Data System (ADS)

Shi, Yu; Wang, Yue; Xu, Shijie

2018-04-01

The motion of a massless particle in the gravity of a binary asteroid system, referred as the restricted full three-body problem (RF3BP), is fundamental, not only for the evolution of the binary system, but also for the design of relevant space missions. In this paper, equilibrium points and associated periodic orbit families in the gravity of a binary system are investigated, with the binary (66391) 1999 KW4 as an example. The polyhedron shape model is used to describe irregular shapes and corresponding gravity fields of the primary and secondary of (66391) 1999 KW4, which is more accurate than the ellipsoid shape model in previous studies and provides a high-fidelity representation of the gravitational environment. Both of the synchronous and non-synchronous states of the binary system are considered. For the synchronous binary system, the equilibrium points and their stability are determined, and periodic orbit families emanating from each equilibrium point are generated by using the shooting (multiple shooting) method and the homotopy method, where the homotopy function connects the circular restricted three-body problem and RF3BP. In the non-synchronous binary system, trajectories of equivalent equilibrium points are calculated, and the associated periodic orbits are obtained by using the homotopy method, where the homotopy function connects the synchronous and non-synchronous systems. Although only the binary (66391) 1999 KW4 is considered, our methods will also be well applicable to other binary systems with polyhedron shape data. Our results on equilibrium points and associated periodic orbits provide general insights into the dynamical environment and orbital behaviors in proximity of small binary asteroids and enable the trajectory design and mission operations in future binary system explorations.

Polypeptide synthesis induced in Nicotiana clevelandii protoplasts by infection with raspberry ringspot nepovirus.

PubMed

Acosta, O; Mayo, M A

1993-01-01

Infection of Nicotiana clevelandii protoplasts by raspberry ringspot nepovirus resulted in the accumulation of about 24 polypeptides that differed in M(r) and pI from polypeptides accumulating in mock-inoculated protoplasts. Similar polypeptides accumulated in protoplasts infected with the S and E strains of RRV but different infection-specific polypeptides were detected in protoplasts infected with tobacco ringspot nepovirus. The M(r) of RRV-specific polypeptides ranged from 210,000 to 18,000 and most are presumed to be derived from others by proteolytic cleavage. No evidence was found for marked changes in polypeptide abundance with time after inoculation or for any virus-specific polypeptide becoming disproportionately abundant in the medium during culture.

Polypeptides having laccase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Tang, Lan; Duan, Junxin

The present invention relates to isolated polypeptides having laccase activity and polynucleotides encoding the polypeptides and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

The Impact of Binary Companions on Planetary Systems

NASA Astrophysics Data System (ADS)

Kraus, Adam L.; Ireland, Michael; Dupuy, Trent; Mann, Andrew; Huber, Daniel

2018-01-01

The majority of solar-type stars are found in binary systems, and the dynamical influence of binary companions is expected to profoundly influence planetary systems. However, the difficulty of identifying planets in binary systems has left the magnitude of this effect uncertain; despite numerous theoretical hurdles to their formation and survival, at least some binary systems clearly host planets. We present high-resolution imaging of nearly 500 Kepler Objects of Interest (KOIs) obtained using adaptive-optics imaging and nonredundant aperture-mask interferometry on the Keck II telescope. We super-resolve some binary systems to projected separations of under 5 AU, showing that planets might form in these dynamically active environments. However, the full distribution of projected separations for our planet-host sample more broadly reveals a deep paucity of binary companions at solar-system scales. Our results demonstrate that a fifth of all solar-type stars in the Milky Way are disallowed from hosting planetary systems due to the influence of a binary companion. We now update these results with multi-epoch imaging to reject non-comoving background stars and securely identify even the least massive stellar companions, as well as tracing out the orbital motion of stellar companions. These results are beginning to reveal not just the fraction of binaries that do not host planets, but also potential explanations for planet survival even in some very close, dynamically active binary systems.

Pulsars in binary systems: probing binary stellar evolution and general relativity.

PubMed

Stairs, Ingrid H

2004-04-23

Radio pulsars in binary orbits often have short millisecond spin periods as a result of mass transfer from their companion stars. They therefore act as very precise, stable, moving clocks that allow us to investigate a large set of otherwise inaccessible astrophysical problems. The orbital parameters derived from high-precision binary pulsar timing provide constraints on binary evolution, characteristics of the binary pulsar population, and the masses of neutron stars with different mass-transfer histories. These binary systems also test gravitational theories, setting strong limits on deviations from general relativity. Surveys for new pulsars yield new binary systems that increase our understanding of all these fields and may open up whole new areas of physics, as most spectacularly evidenced by the recent discovery of an extremely relativistic double-pulsar system.

Polypeptide having an amino acid replaced with N-benzylglycine

DOEpatents

Mitchell, Alexander R.; Young, Janis D.

1996-01-01

The present invention relates to one or more polypeptides having useful biological activity in a mammal, which comprise: a polypeptide related to bradykinin of four to ten amino acid residues wherein one or more specific amino acids in the polypeptide chain are replaced with achiral N-benzylglycine. These polypeptide analogues have useful potent agonist or antagonist pharmacological properties depending upon the structure. A preferred polypeptide is (N-benzylglycine.sup.7)-bradykinin.

R144: a very massive binary likely ejected from R136 through a binary-binary encounter

NASA Astrophysics Data System (ADS)

Oh, Seungkyung; Kroupa, Pavel; Banerjee, Sambaran

2014-02-01

R144 is a recently confirmed very massive, spectroscopic binary which appears isolated from the core of the massive young star cluster R136. The dynamical ejection hypothesis as an origin for its location is claimed improbable by Sana et al. due to its binary nature and high mass. We demonstrate here by means of direct N-body calculations that a very massive binary system can be readily dynamically ejected from an R136-like cluster, through a close encounter with a very massive system. One out of four N-body cluster models produces a dynamically ejected very massive binary system with a mass comparable to R144. The system has a system mass of ≈355 M⊙ and is located at 36.8 pc from the centre of its parent cluster, moving away from the cluster with a velocity of 57 km s-1 at 2 Myr as a result of a binary-binary interaction. This implies that R144 could have been ejected from R136 through a strong encounter with another massive binary or single star. In addition, we discuss all massive binaries and single stars which are ejected dynamically from their parent cluster in the N-body models.

Elastomeric Polypeptides

PubMed Central

van Eldijk, Mark B.; McGann, Christopher L.

2013-01-01

Elastomeric polypeptides are very interesting biopolymers and are characterized by rubber-like elasticity, large extensibility before rupture, reversible deformation without loss of energy, and high resilience upon stretching. Their useful properties have motivated their use in a wide variety of materials and biological applications. This chapter focuses on elastin and resilin – two elastomeric biopolymers – and the recombinant polypeptides derived from them (elastin-like polypeptides and resilin-like polypeptides). This chapter also discusses the applications of these recombinant polypeptides in the fields of purification, drug delivery, and tissue engineering. PMID:21826606

The OGLE Collection of Variable Stars. Over 450 000 Eclipsing and Ellipsoidal Binary Systems Toward the Galactic Bulge

NASA Astrophysics Data System (ADS)

Soszyński, I.; Pawlak, M.; Pietrukowicz, P.; Udalski, A.; Szymański, M. K.; Wyrzykowski, Ł.; Ulaczyk, K.; Poleski, R.; Kozłowski, S.; Skowron, D. M.; Skowron, J.; Mróz, P.; Hamanowicz, A.

2016-12-01

We present a collection of 450 598 eclipsing and ellipsoidal binary systems detected in the OGLE fields toward the Galactic bulge. The collection consists of binary systems of all types: detached, semi-detached, and contact eclipsing binaries, RS CVn stars, cataclysmic variables, HW Vir binaries, double periodic variables, and even planetary transits. For all stars we provide the I- and V-band time-series photometry obtained during the OGLE-II, OGLE-III, and OGLE-IV surveys. We discuss methods used to identify binary systems in the OGLE data and present several objects of particular interest.

Methods for engineering polypeptide variants via somatic hypermutation and polypeptide made thereby

DOEpatents

Tsien, Roger Y; Wang, Lei

2015-01-13

Methods using somatic hypermutation (SHM) for producing polypeptide and nucleic acid variants, and nucleic acids encoding such polypeptide variants are disclosed. Such variants may have desired properties. Also disclosed are novel polypeptides, such as improved fluorescent proteins, produced by the novel methods, and nucleic acids, vectors, and host cells comprising such vectors.

Design of a single-chain polypeptide tetrahedron assembled from coiled-coil segments.

PubMed

Gradišar, Helena; Božič, Sabina; Doles, Tibor; Vengust, Damjan; Hafner-Bratkovič, Iva; Mertelj, Alenka; Webb, Ben; Šali, Andrej; Klavžar, Sandi; Jerala, Roman

2013-06-01

Protein structures evolved through a complex interplay of cooperative interactions, and it is still very challenging to design new protein folds de novo. Here we present a strategy to design self-assembling polypeptide nanostructured polyhedra based on modularization using orthogonal dimerizing segments. We designed and experimentally demonstrated the formation of the tetrahedron that self-assembles from a single polypeptide chain comprising 12 concatenated coiled coil-forming segments separated by flexible peptide hinges. The path of the polypeptide chain is guided by a defined order of segments that traverse each of the six edges of the tetrahedron exactly twice, forming coiled-coil dimers with their corresponding partners. The coincidence of the polypeptide termini in the same vertex is demonstrated by reconstituting a split fluorescent protein in the polypeptide with the correct tetrahedral topology. Polypeptides with a deleted or scrambled segment order fail to self-assemble correctly. This design platform provides a foundation for constructing new topological polypeptide folds based on the set of orthogonal interacting polypeptide segments.

Improving geothermal power plants with a binary cycle

NASA Astrophysics Data System (ADS)

Tomarov, G. V.; Shipkov, A. A.; Sorokina, E. V.

2015-12-01

The recent development of binary geothermal technology is analyzed. General trends in the introduction of low-temperature geothermal sources are summarized. The use of single-phase low-temperature geothermal fluids in binary power plants proves possible and expedient. The benefits of power plants with a binary cycle in comparison with traditional systems are shown. The selection of the working fluid is considered, and the influence of the fluid's physicochemical properties on the design of the binary power plant is discussed. The design of binary power plants is based on the chemical composition and energy potential of the geothermal fluids and on the landscape and climatic conditions at the intended location. Experience in developing a prototype 2.5 MW Russian binary power unit at Pauzhetka geothermal power plant (Kamchatka) is outlined. Most binary systems are designed individually for a specific location. Means of improving the technology and equipment at binary geothermal power plants are identified. One option is the development of modular systems based on several binary systems that employ the heat from the working fluid at different temperatures.

Contact Binaries on Their Way Towards Merging

NASA Astrophysics Data System (ADS)

Gazeas, K.

2015-07-01

Contact binaries are the most frequently observed type of eclipsing star system. They are small, cool, low-mass binaries belonging to a relatively old stellar population. They follow certain empirical relationships that closely connect a number of physical parameters with each other, largely because of constraints coming from the Roche geometry. As a result, contact binaries provide an excellent test of stellar evolution, specifically for stellar merger scenarios. Observing campaigns by many authors have led to the cataloging of thousands of contact binaries and enabled statistical studies of many of their properties. A large number of contact binaries have been found to exhibit extraordinary behavior, requiring follow-up observations to study their peculiarities in detail. For example, a doubly-eclipsing quadruple system consisting of a contact binary and a detached binary is a highly constrained system offering an excellent laboratory to test evolutionary theories for binaries. A new observing project was initiated at the University of Athens in 2012 in order to investigate the possible lower limit for the orbital period of binary systems before coalescence, prior to merging.

Dynamics of rotationally fissioned asteroids: Source of observed small asteroid systems

NASA Astrophysics Data System (ADS)

Jacobson, Seth A.; Scheeres, Daniel J.

2011-07-01

We present a model of near-Earth asteroid (NEA) rotational fission and ensuing dynamics that describes the creation of synchronous binaries and all other observed NEA systems including: doubly synchronous binaries, high- e binaries, ternary systems, and contact binaries. Our model only presupposes the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect, "rubble pile" asteroid geophysics, and gravitational interactions. The YORP effect torques a "rubble pile" asteroid until the asteroid reaches its fission spin limit and the components enter orbit about each other (Scheeres, D.J. [2007]. Icarus 189, 370-385). Non-spherical gravitational potentials couple the spin states to the orbit state and chaotically drive the system towards the observed asteroid classes along two evolutionary tracks primarily distinguished by mass ratio. Related to this is a new binary process termed secondary fission - the secondary asteroid of the binary system is rotationally accelerated via gravitational torques until it fissions, thus creating a chaotic ternary system. The initially chaotic binary can be stabilized to create a synchronous binary by components of the fissioned secondary asteroid impacting the primary asteroid, solar gravitational perturbations, and mutual body tides. These results emphasize the importance of the initial component size distribution and configuration within the parent asteroid. NEAs may go through multiple binary cycles and many YORP-induced rotational fissions during their approximately 10 Myr lifetime in the inner Solar System. Rotational fission and the ensuing dynamics are responsible for all NEA systems including the most commonly observed synchronous binaries.

Close binary systems among very low-mass stars and brown dwarfs

NASA Astrophysics Data System (ADS)

Jeffries, R. D.; Maxted, P. F. L.

2005-12-01

Using Monte Carlo simulations and published radial velocity surveys we have constrained the frequency and separation (a) distribution of very low-mass star (VLM) and brown dwarf (BD) binary systems. We find that simple Gaussian extensions of the observed wide binary distribution, with a peak at 4 AU and 0.6<\\sigma_{\\log(a/AU)}<1.0, correctly reproduce the observed number of close binary systems, implying a close (a<2.6 AU) binary frequency of 17-30 % and overall frequency of 32-45 %. N-body models of the dynamical decay of unstable protostellar multiple systems are excluded with high confidence because they do not produce enough close binary VLMs/BDs. The large number of close binaries and high overall binary frequency are also completely inconsistent with published smoothed particle hydrodynamical modelling and argue against a dynamical origin for VLMs/BDs.

Chemical and quantum simulation of electron transfer through a polypeptide

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ungar, L.W.; Voth, G.A.; Newton, M.D.

1999-08-26

Quantum rate theory, molecular dynamics simulations, and semiempirical electronic structure calculations are used to fully investigate electron transfer mediated by a solvated polypeptide for the first time. Using a stationary-phase approximation, the nonadiabatic electron-transfer rate constant is calculated from the nuclear free energies and the electronic coupling between the initial and final states. The former are obtained from quantum path integral and classical molecular dynamics simulations; the latter are calculated using semiempirical electronic structure calculations and the generalized Mulliken-Hush method. Importantly, no parameters are fit to kinetic data. The simulated system consists of a solvated four-proline polypeptide with a tris(bipyridine)rutheniummore » donor group and an oxypentamminecobalt acceptor group. From the simulation data entropy and energy contributions to the free energies are distinguished. Quantum suppression of the barrier, including important solvent contributions, is demonstrated. Although free energy profiles along the reaction coordinate are nearly parabolic, pronounced departures from harmonic behavior are found for the separate energy and entropy functions. Harmonic models of the system are compared to simulation results in order to quantify anharmonic effects. Electronic structure calculations show that electronic coupling elements vary considerably with system conformation, even when the effective donor-acceptor separation remains roughly constant. The calculations indicate that electron transfer in a significant range of conformations linking the polypeptide to the acceptor may contribute to the overall rate constant. After correction for limitations of the solvent model, the simulations and calculations agree well with the experimental activation energy and Arrhenius prefactor.« less

SIM Lite Detection of Habitable Planets in P-Type Binary-Planetary Systems

NASA Technical Reports Server (NTRS)

Pan, Xiaopei; Shao, Michael; Shaklan, Stuart; Goullioud, Renaud

2010-01-01

Close binary stars like spectroscopic binaries create a completely different environment than single stars for the evolution of a protoplanetary disk. Dynamical interactions between one star and protoplanets in such systems provide more challenges for theorists to model giant planet migration and formation of multiple planets. For habitable planets the majority of host stars are in binary star systems. So far only a small amount of Jupiter-size planets have been discovered in binary stars, whose minimum separations are 20 AU and the median value is about 1000 AU (because of difficulties in radial velocity measurements). The SIM Lite mission, a space-based astrometric observatory, has a unique capability to detect habitable planets in binary star systems. This work analyzed responses of the optical system to the field stop for companion stars and demonstrated that SIM Lite can observe exoplanets in visual binaries with small angular separations. In particular we investigated the issues for the search for terrestrial planets in P-type binary-planetary systems, where the planets move around both stars in a relatively distant orbit.

Characterization of a novel isoform of alpha-nascent polypeptide-associated complex as IgE-defined autoantigen.

PubMed

Mossabeb, Roschanak; Seiberler, Susanne; Mittermann, Irene; Reininger, Renate; Spitzauer, Susanne; Natter, Susanne; Verdino, Petra; Keller, Walter; Kraft, Dietrich; Valenta, Rudolf

2002-10-01

The nascent polypeptide-associated complex is required for intracellular translocation of newly synthesized polypeptides in eukaryotic cells. It may also act as a transcriptional coactivator in humans and various eukaryotic organisms and binds to nucleic acids. Recently, we provided evidence that a component of nascent polypeptide-associated complex, alpha-nascent polypeptide-associated complex, represents an IgE-reactive autoantigen for atopic dermatitis patients. By oligonucleotide screening we isolated a complete cDNA coding for a so far unknown alpha-nascent polypeptide-associated complex isoform from a human epithelial cDNA library. Southern blot hybridization experiments provided further evidence that alpha-nascent polypeptide-associated complex is encoded by a gene family. Recombinant alpha-nascent polypeptide-associated complex was expressed in Escherichia coli as a soluble, His-tagged protein, and purified via nickel affinity chromatography. By circular dichroism analysis it is demonstrated that purified recombinant alpha-nascent polypeptide-associated complex represents a folded protein of mixed alpha-helical and beta-sheet conformation with unusual high thermal stability and remarkable refolding capacity. Complete recombinant alpha-nascent polypeptide-associated complex (215 amino acids) and its 86 amino acid C-terminal fragment specifically bound IgE autoantibodies. Recombinant alpha-nascent polypeptide-associated complex also inhibited IgE binding to natural alpha-nascent polypeptide-associated complex, demonstrating the presence of common IgE epitopes between the recombinant and natural protein. Furthermore, recombinant alpha-nascent polypeptide-associated complex induced specific lymphoproliferative responses in peripheral blood mononuclear cells of a sensitized atopic dermatitis patient. As has been proposed for environmental allergens it is possible that T cell responses to IgE-defined autoantigens may contribute to the chronic skin manifestations in atopic dermatitis.

Polypeptides having catalase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Duan, Junxin; Zhang, Yu

Provided are isolated polypeptides having catalase activity and polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Two novel genes, fanA and fanB, involved in the biogenesis of K99 fimbriae.

PubMed

Roosendaal, E; Boots, M; de Graaf, F K

1987-08-11

The nucleotide sequence of the region located transcriptionally upstream of the K99 fimbrial subunit gene (fanC) was determined. Several putative transcription signals and two open reading frames, designated fanA and fanB, became apparent. Frameshift mutations in fanA and fanB reduced K99 fimbriae expression 8-fold and 16-fold, respectively. Complementation of the mutants in trans restored the K99 expression to about 75% of the wild type level, indicating that fanA and fanB code for transacting polypeptides involved in the biogenesis of K99 fimbriae. The fanA and fanB gene products FanA and FanB were not detectable in minicell preparations, indicating that both polypeptides are synthesized in very small amounts. However, in an in vitro DNA directed translation system FanA and FanB could be identified. The deduced amino acid sequences of FanA and FanB showed that both polypeptides contain no signal peptides, indicating a cytoplasmic location. Furthermore, the polypeptides are very hydrophilic, mainly basic, and exhibit remarkable homology to each other and to a regulatory protein (papB) encoded by the pap-operon (1). Some of these features are characteristics of nucleic acid binding proteins, which suggests that FanA and FanB have a regulatory function in the synthesis of FanC and the auxiliary polypeptides FanD-H.

The extraneous eclipses on binary light curves: KIC 5255552, KIC 10091110, and KIC 11495766

NASA Astrophysics Data System (ADS)

Zhang, J.; Qian, S. B.; Wang, S. M.; Sun, L. L.; Wu, Y.; Jiang, L. Q.

2018-03-01

Aims: We aim to find more eclipsing multiple systems and obtain their parameters, thus increasing our understanding of multiple systems. Methods: The extraneous eclipses on the Kepler binary light curves indicating extraneous bodies were searched. The binary light curves were analyzed using the binary model, and the extraneous eclipses were studied on their periodicity and shape changes. Results: Three binaries with extraneous eclipses on the binary light curves were found and studied based on the Kepler observations. The object KIC 5255552 is an eclipsing triple system with a fast changing inner binary and an outer companion uncovered by three groups of extraneous eclipses of 862.1(±0.1) d period. The KIC 10091110 is suggested to be a double eclipsing binary system with several possible extraordinary coincidences: the two binaries share similar extremely small mass ratios (0.060(13) and 0.0564(18)), similar mean primary densities (0.3264(42) ρ⊙ and 0.3019(28) ρ⊙), and, most notably, the ratio of the two binaries' periods is very close to integer 2 (8.5303353/4.2185174 = 2.022). The KIC 11495766 is a probable triple system with a 120.73 d period binary and (at least) one non-eclipse companion. Furthermore, very close to it in the celestial sphere, there is a blended background stellar binary of 8.3404432 d period. A first list of 25 eclipsing multiple candidates is presented, with the hope that it will be beneficial for study of eclipsing multiples.

Secretion of pancreatic polypeptide in patients with pancreatic endocrine tumors.

PubMed

Adrian, T E; Uttenthal, L O; Williams, S J; Bloom, S R

1986-07-31

Pancreatic polypeptide is often secreted by pancreatic endocrine tumors and is considered a marker for such tumors. To investigate the diagnostic value of this marker, we studied 323 patients with proved pancreatic endocrine tumors. We found plasma concentrations of pancreatic polypeptide to be elevated (more than 300 pmol per liter) in 144 patients (diagnostic sensitivity, 45 percent). However, plasma levels of pancreatic polypeptide can also be elevated in the absence of a pancreatic tumor. To ascertain whether the administration of atropine could distinguish between normal and tumor-associated polypeptide secretion, we studied 30 patients with pancreatic tumors and high plasma levels of pancreatic polypeptide, 18 patients without tumors who had elevated levels of pancreatic polypeptide, and eight normal controls. Polypeptide levels in the 18 patients without tumors were substantially lower than in the 30 patients with tumors. Atropine (1 mg intramuscularly) did not suppress polypeptide levels in patients with tumors, but did suppress plasma levels by more than 50 percent in all subjects without tumors. Thus, although its diagnostic sensitivity is low, pancreatic polypeptide appears to be a useful adjunctive marker of many pancreatic endocrine tumors, and the atropine suppression test can be used to distinguish normal from tumor-related secretion of the polypeptide. Identification of the type of pancreatic endocrine tumor still requires measurement of the hormone that is specific for the tumor.

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Duan, Junxin; Zhang, Yu

Provided are isolated polypeptides having beta-glucosidase activity and polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang, Yu; Liu, Ye; Duan, Junxin

Provided are isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-xylosidase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Tang, Lan; Zhang, Yu

Provided are isolated polypeptides having beta-xylosidase activity and polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Hybrid polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Shaghasi, Tarana

2016-11-01

The present invention provides hybrid polypeptides having cellobiohydrolase activity. The present invention also provides polynucleotides encoding the hybrid polypeptides; nucleic acid constructs, vectors and host cells comprising the polynucleotides; and processes of using the hybrid polypeptides.

Radial Velocities of 41 Kepler Eclipsing Binaries

NASA Astrophysics Data System (ADS)

Matson, Rachel A.; Gies, Douglas R.; Guo, Zhao; Williams, Stephen J.

2017-12-01

Eclipsing binaries are vital for directly determining stellar parameters without reliance on models or scaling relations. Spectroscopically derived parameters of detached and semi-detached binaries allow us to determine component masses that can inform theories of stellar and binary evolution. Here we present moderate resolution ground-based spectra of stars in close binary systems with and without (detected) tertiary companions observed by NASA’s Kepler mission and analyzed for eclipse timing variations. We obtain radial velocities and spectroscopic orbits for five single-lined and 35 double-lined systems, and confirm one false positive eclipsing binary. For the double-lined spectroscopic binaries, we also determine individual component masses and examine the mass ratio {M}2/{M}1 distribution, which is dominated by binaries with like-mass pairs and semi-detached classical Algol systems that have undergone mass transfer. Finally, we constrain the mass of the tertiary component for five double-lined binaries with previously detected companions.

Hybrid polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Shaghasi, Tarana

The present invention relates to hybrid polypeptides having cellobiohydrolase activity. The present invention also relates to polynucleotides encoding the hybrid polypeptides; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and processes of using the hybrid polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Zhang, Yu; Duan, Junxin; Tang, Lan; Wu, Wenping

2015-06-09

Provided are isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. Also provided are nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Duan, Junxin; Tang, Lan

2015-09-22

The present invention provides isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cell comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activitiy and polynucleotides encoding same

DOEpatents

Liu, Ye; Tang, Lan; Duan, Junxin

2015-12-15

The present invention provides isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Isolation of Polypeptide Sample and Measurement of Its Concentration.

ERIC Educational Resources Information Center

Beanan, Maureen J.

2000-01-01

Introduces a laboratory experiment that isolates a bacterial polypeptide sample and measures the concentration of polypeptides in the sample. Uses Escherichia coli strain MM294 and performs a bio-rad assay to determine the concentration of polypeptides. (YDS)

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Tang, Lan

2015-07-14

The present invention provides isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Terrestrial Planet Formation in Binary Star Systems

NASA Technical Reports Server (NTRS)

Lissauer, J. J.; Quintana, E. V.; Adams, F. C.; Chambers, J. E.

2006-01-01

Most stars reside in binary/multiple star systems; however, previous models of planet formation have studied growth of bodies orbiting an isolated single star. Disk material has been observed around one or both components of various young close binary star systems. If planets form at the right places within such disks, they can remain dynamically stable for very long times. We have simulated the late stages of growth of terrestrial planets in both circumbinary disks around 'close' binary star systems with stellar separations ($a_B$) in the range 0.05 AU $\\le a_B \\le$ 0.4 AU and binary eccentricities in the range $0 \\le e \\le 0.8$ and circumstellar disks around individual stars with binary separations of tens of AU. The initial disk of planetary embryos is the same as that used for simulating the late stages of terrestrial planet growth within our Solar System and around individual stars in the Alpha Centauri system (Quintana et al. 2002, A.J., 576, 982); giant planets analogous to Jupiter and Saturn are included if their orbits are stable. The planetary systems formed around close binaries with stellar apastron distances less than or equal to 0.2 AU with small stellar eccentricities are very similar to those formed in the Sun-Jupiter-Saturn, whereas planetary systems formed around binaries with larger maximum separations tend to be sparser, with fewer planets, especially interior to 1 AU. Likewise, when the binary periastron exceeds 10 AU, terrestrial planets can form over essentially the entire range of orbits allowed for single stars with Jupiter-like planets, although fewer terrestrial planets tend to form within high eccentricity binary systems. As the binary periastron decreases, the radial extent of the terrestrial planet systems is reduced accordingly. When the periastron is 5 AU, the formation of Earth-like planets near 1 AU is compromised.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Liu, Ye; Tang, Lan; Duan, Junxin

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj

The present invention relates to isolated polypeptides having xylanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lopez de Leon, Alfredo; Rey, Michael

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj

The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang, Yu; Liu, Ye; Duan, Junxin

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2012-09-18

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2010-12-14

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Harris, Paul [Carnation, WA; Lopez de Leon, Alfredo [Davis, CA; Rey, Micheal [Davis, CA; Ding, Hanshu [Davis, CA; Vlasenko, Elena [Davis, CA

2012-02-21

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2016-06-28

The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2016-05-31

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2015-02-10

The present invention relates to isolated polypeptides having endoglucanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2016-02-23

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Ding, Hanshu

2013-04-30

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Hanshu, Ding

2012-10-30

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Tang, Lan

2015-11-20

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2015-01-27

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2014-10-21

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2015-03-10

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2017-05-02

The present invention relates to isolated polypeptides having xylanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2015-03-31

The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2015-07-14

The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Brown, Kimberly [Elk Grove, CA; Harris, Paul [Carnation, WA; Lopez De Leon, Alfredo [Davis, CA; Merino, Sandra [West Sacremento, CA

2007-05-22

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Harris, Paul; Tang, Lan; Wu, Wenping

2013-11-19

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Morant, Marc D.; Harris, Paul

2015-10-13

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOEpatents

Liu, Ye; Tang, Lan; Harris, Paul; Wu, Wenping

2012-10-02

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Methods for using polypeptides having cellobiohydrolase activity

DOEpatents

Morant, Marc D; Harris, Paul

2016-08-23

The present invention relates to isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polynucleotides encoding polypeptides having beta-glucosidase activity

DOEpatents

Harris, Paul; Golightly, Elizabeth

2010-03-02

The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo; Rey, Michael

2013-06-18

The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj

2016-12-13

The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj

2014-10-14

The present invention relates to isolated polypeptides having xylanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Zhang, Yu; Tang, Lan; Henriksen, Svend Hostgaard Bang

2016-05-17

The present invention provides isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Nano polypeptide particles reinforced polymer composite fibers.

PubMed

Li, Jiashen; Li, Yi; Zhang, Jing; Li, Gang; Liu, Xuan; Li, Zhi; Liu, Xuqing; Han, Yanxia; Zhao, Zheng

2015-02-25

Because of the intensified competition of land resources for growing food and natural textile fibers, there is an urgent need to reuse and recycle the consumed/wasted natural fibers as regenerated green materials. Although polypeptide was extracted from wool by alkaline hydrolysis, the size of the polypeptide fragments could be reduced to nanoscale. The wool polypeptide particles were fragile and could be crushed down to nano size again and dispersed evenly among polymer matrix under melt extrusion condition. The nano polypeptide particles could reinforce antiultraviolet capability, moisture regain, and mechanical properties of the polymer-polypeptide composite fibers.

The True Ultracool Binary Fraction Using Spectral Binaries

NASA Astrophysics Data System (ADS)

Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris

2018-01-01

Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (< 5 AU) binary systems of brown dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown dwarfs.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schnorr, Kirk; Kramer, Randall

2017-08-08

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tang, Lan; Liu, Ye; Duan, Junxin

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-xylosidase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang, Yu; Liu, Ye; Duan, Junxin

The present invention relates to isolated polypeptides having beta-xylosidase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Lopez de Leon, Alfredo [Davis, CA; Ding, Hanshu [Davis, CA; Brown, Kimberly [Elk Grove, CA

2011-10-25

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOEpatents

Harris, Paul; Golightly, Elizabeth

2012-11-27

The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Zhang, Yu; Duan, Junxin; Tang, Lan; Wu, Wenping

2016-06-14

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Zhang, Yu; Duan, Junxin; Tang, Lan; Wu, Wenping

2016-11-22

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Tang, Lan [Beijing, CN; Liu, Ye [Beijing, CN; Duan, Junxin [Beijing, CN; Zhang, Yu [Beijing, CN; Jorgensen, Christian Isak [Bagsvaerd, DK; Kramer, Randall [Lincoln, CA

2012-04-03

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Duan, Junxin [Beijing, CN; Liu, Ye [Beijing, CN; Tang, Lan [Beijing, CN; Wu, Wenping [Beijing, CN; Quinlan, Jason [Albany, CA; Kramer, Randall [Lincoln, CA

2012-03-27

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Zhang, Yu; Joergensen, Christian; Kramer, Randall

2016-11-29

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Zhang, Yu; Joergensen, Christian; Kramer, Randall

2014-09-16

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having xylanase activity and polynucleotides encoding the same

DOEpatents

Spodsberg, Nikolaj [Bagsvaed, DK

2014-01-07

The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The inventino also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Wu, Wenping; Kramer, Randall

2014-10-21

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Schnorr, Kirk; Kramer, Randall

2016-04-05

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOEpatents

Harris, Paul [Carnation, WA; Golightly, Elizabeth [Reno, NV

2007-07-17

The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Maiyuran, Suchindra; Kramer, Randall; Harris, Paul

2013-10-29

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOEpatents

Harris, Paul [Carnation, WA; Golightly, Elizabeth [Reno, NV

2011-06-14

The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Zhang, Yu; Jorgensen, Christian Isak; Kramer, Randall

2013-04-16

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Duan, Junxin; Tang, Lan; Liu, Ye; Wu, Wenping; Quinlan, Jason; Kramer, Randall

2013-06-18

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Schnorr, Kirk; Kramer, Randall

2016-08-09

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Anthrax Pathogenesis.

PubMed

Moayeri, Mahtab; Leppla, Stephen H; Vrentas, Catherine; Pomerantsev, Andrei P; Liu, Shihui

2015-01-01

Anthrax is caused by the spore-forming, gram-positive bacterium Bacillus anthracis. The bacterium's major virulence factors are (a) the anthrax toxins and (b) an antiphagocytic polyglutamic capsule. These are encoded by two large plasmids, the former by pXO1 and the latter by pXO2. The expression of both is controlled by the bicarbonate-responsive transcriptional regulator, AtxA. The anthrax toxins are three polypeptides-protective antigen (PA), lethal factor (LF), and edema factor (EF)-that come together in binary combinations to form lethal toxin and edema toxin. PA binds to cellular receptors to translocate LF (a protease) and EF (an adenylate cyclase) into cells. The toxins alter cell signaling pathways in the host to interfere with innate immune responses in early stages of infection and to induce vascular collapse at late stages. This review focuses on the role of anthrax toxins in pathogenesis. Other virulence determinants, as well as vaccines and therapeutics, are briefly discussed.

Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

DOEpatents

Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

2012-10-16

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOEpatents

Dotson, William D.; Greenier, Jennifer; Ding, Hanshu

2007-09-18

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated nucleic acids encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the nucleic acids as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding the same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Wu, Wenping; Kramer, Randall

2013-11-19

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

DOEpatents

Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

2014-09-30

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

DOEpatents

Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

2017-09-05

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

DOEpatents

Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

2010-06-22

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having beta-glucosidase activity and polynucleotides encoding the same

DOEpatents

Brown, Kimberly; Harris, Paul

2013-12-17

The present invention relates to isolated polypeptides having beta-glucosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and nucleic acids encoding same

DOEpatents

Brown, Kimberly; Harris, Paul; Zaretsky, Elizabeth; Re, Edward; Vlasenko, Elena; McFarland, Keith; Lopez de Leon, Alfredo

2016-08-09

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.

Polypeptides having cellulolytic enhancing activity and polynucleotides encoding the same

DOEpatents

Tang, Lan; Liu, Ye; Duan, Junxin; Zhang, Yu; Jorgensen, Christian Isak; Kramer, Randall

2013-12-24

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

New spectroscopic binary companions of giant stars and updated metallicity distribution for binary systems

NASA Astrophysics Data System (ADS)

Bluhm, P.; Jones, M. I.; Vanzi, L.; Soto, M. G.; Vos, J.; Wittenmyer, R. A.; Drass, H.; Jenkins, J. S.; Olivares, F.; Mennickent, R. E.; Vučković, M.; Rojo, P.; Melo, C. H. F.

2016-10-01

We report the discovery of 24 spectroscopic binary companions to giant stars. We fully constrain the orbital solution for 6 of these systems. We cannot unambiguously derive the orbital elements for the remaining stars because the phase coverage is incomplete. Of these stars, 6 present radial velocity trends that are compatible with long-period brown dwarf companions. The orbital solutions of the 24 binary systems indicate that these giant binary systems have a wide range in orbital periods, eccentricities, and companion masses. For the binaries with restricted orbital solutions, we find a range of orbital periods of between ~97-1600 days and eccentricities of between ~0.1-0.4. In addition, we studied the metallicity distribution of single and binary giant stars. We computed the metallicity of a total of 395 evolved stars, 59 of wich are in binary systems. We find a flat distribution for these binary stars and therefore conclude that stellar binary systems, and potentially brown dwarfs, have a different formation mechanism than planets. This result is confirmed by recent works showing that extrasolar planets orbiting giants are more frequent around metal-rich stars. Finally, we investigate the eccentricity as a function of the orbital period. We analyzed a total of 130 spectroscopic binaries, including those presented here and systems from the literature. We find that most of the binary stars with periods ≲30 days have circular orbits, while at longer orbital periods we observe a wide spread in their eccentricities. Based on observations collected at La Silla - Paranal Observatory under programs IDs IDs 085.C-0557, 087.C.0476, 089.C-0524, 090.C-0345, 096.A-9020 and through the Chilean Telescope Time under programs IDs CN2012A-73, CN2012B-47, CN2013A-111, CN2013B-51, CN2014A-52 and CN2015A-48.

Identification and Affinity-Quantification of ß-Amyloid and α-Synuclein Polypeptides Using On-Line SAW-Biosensor-Mass Spectrometry

NASA Astrophysics Data System (ADS)

Slamnoiu, Stefan; Vlad, Camelia; Stumbaum, Mihaela; Moise, Adrian; Lindner, Kathrin; Engel, Nicole; Vilanova, Mar; Diaz, Mireia; Karreman, Christiaan; Leist, Marcel; Ciossek, Thomas; Hengerer, Bastian; Vilaseca, Marta; Przybylski, Michael

2014-08-01

Bioaffinity analysis using a variety of biosensors has become an established tool for detection and quantification of biomolecular interactions. Biosensors, however, are generally limited by the lack of chemical structure information of affinity-bound ligands. On-line bioaffinity-mass spectrometry using a surface-acoustic wave biosensor (SAW-MS) is a new combination providing the simultaneous affinity detection, quantification, and mass spectrometric structural characterization of ligands. We describe here an on-line SAW-MS combination for direct identification and affinity determination, using a new interface for MS of the affinity-isolated ligand eluate. Key element of the SAW-MS combination is a microfluidic interface that integrates affinity-isolation on a gold chip, in-situ sample concentration, and desalting with a microcolumn for MS of the ligand eluate from the biosensor. Suitable MS- acquisition software has been developed that provides coupling of the SAW-MS interface to a Bruker Daltonics ion trap-MS, FTICR-MS, and Waters Synapt-QTOF- MS systems. Applications are presented for mass spectrometric identifications and affinity (KD) determinations of the neurodegenerative polypeptides, ß-amyloid (Aß), and pathophysiological and physiological synucleins (α- and ß-synucleins), two key polypeptide systems for Alzheimer's disease and Parkinson's disease, respectively. Moreover, first in vivo applications of αSyn polypeptides from brain homogenate show the feasibility of on-line affinity-MS to the direct analysis of biological material. These results demonstrate on-line SAW-bioaffinity-MS as a powerful tool for structural and quantitative analysis of biopolymer interactions.

Cellulases, nucleic acids encoding them and methods for making and using them

DOEpatents

Blum, David; Gemsch Cuenca, Joslin; Dycaico, Mark

2013-04-23

This invention relates to molecular and cellular biology and biochemistry. In one aspect, the invention provides polypeptides having cellulase activity, e.g., endoglucanase, cellobiohydrolase, mannanase and/or .beta.-glucosidase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In one aspect, the invention is directed to polypeptides cellulase activity, e.g., endoglucanase, cellobiohydrolase, mannanase and/or .beta.-glucosidase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. The polypeptides of the invention can be used in a variety of pharmaceutical, agricultural, food and feed processing and industrial contexts.

On the frequency of close binary systems among very low-mass stars and brown dwarfs

NASA Astrophysics Data System (ADS)

Maxted, P. F. L.; Jeffries, R. D.

2005-09-01

We have used Monte Carlo simulation techniques and published radial velocity surveys to constrain the frequency of very low-mass star (VLMS) and brown dwarf (BD) binary systems and their separation (a) distribution. Gaussian models for the separation distribution with a peak at a= 4au and 0.6 <=σlog(a/au)<= 1.0, correctly predict the number of observed binaries, yielding a close (a < 2.6au) binary frequency of 17-30 per cent and an overall VLMS/BD binary frequency of 32-45 per cent. We find that the available N-body models of VLMS/BD formation from dynamically decaying protostellar multiple systems are excluded at >99 per cent confidence because they predict too few close binary VLMS/BDs. The large number of close binaries and high overall binary frequency are also very inconsistent with recent smoothed particle hydrodynamical modelling and argue against a dynamical origin for VLMS/BDs.

Chimeric polypeptides having cellulolytic enhancing activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wogulis, Mark; Sweeney, Matthew; Heu, Tia

The present invention relates to chimeric GH61 polypeptides having cellulolytic enhancing activity. The present invention also relates to polynucleotides encoding the chimeric GH61 polypeptides; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of using the chimeric GH61 polypeptides.

Recombinant host cells and nucleic acid constructs encoding polypeptides having cellulolytic enhancing activity

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schnorr, Kirk; Kramer, Randall

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Hydrogen-Bond Driven Loop-Closure Kinetics in Unfolded Polypeptide Chains

PubMed Central

Daidone, Isabella; Neuweiler, Hannes; Doose, Sören; Sauer, Markus; Smith, Jeremy C.

2010-01-01

Characterization of the length dependence of end-to-end loop-closure kinetics in unfolded polypeptide chains provides an understanding of early steps in protein folding. Here, loop-closure in poly-glycine-serine peptides is investigated by combining single-molecule fluorescence spectroscopy with molecular dynamics simulation. For chains containing more than 10 peptide bonds loop-closing rate constants on the 20–100 nanosecond time range exhibit a power-law length dependence. However, this scaling breaks down for shorter peptides, which exhibit slower kinetics arising from a perturbation induced by the dye reporter system used in the experimental setup. The loop-closure kinetics in the longer peptides is found to be determined by the formation of intra-peptide hydrogen bonds and transient β-sheet structure, that accelerate the search for contacts among residues distant in sequence relative to the case of a polypeptide chain in which hydrogen bonds cannot form. Hydrogen-bond-driven polypeptide-chain collapse in unfolded peptides under physiological conditions found here is not only consistent with hierarchical models of protein folding, that highlights the importance of secondary structure formation early in the folding process, but is also shown to speed up the search for productive folding events. PMID:20098498

Search for Gravitational Waves from Low Mass Compact Binary Coalescence in LIGO's Sixth Science Run and Virgo's Science Runs 2 and 3

NASA Technical Reports Server (NTRS)

Abadie, J.; Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M.; Accadia, T.; Acernese, F.; Adams, C.; Adhikari, R.; Affeldt, C.;

Search for gravitational waves from low mass compact binary coalescence in LIGO's sixth science run and Virgo's science runs 2 and 3

NASA Astrophysics Data System (ADS)

Abadie, J.; Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M.; Accadia, T.; Acernese, F.; Adams, C.; Adhikari, R.; Affeldt, C.; Agathos, M.; Ajith, P.; Allen, B.; Allen, G. S.; Amador Ceron, E.; Amariutei, D.; Amin, R. S.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Arain, M. A.; Araya, M. C.; Aston, S. M.; Astone, P.; Atkinson, D.; Aufmuth, P.; Aulbert, C.; Aylott, B. E.; Babak, S.; Baker, P.; Ballardin, G.; Ballmer, S.; Barker, D.; Barone, F.; Barr, B.; Barriga, P.; Barsotti, L.; Barsuglia, M.; Barton, M. A.; Bartos, I.; Bassiri, R.; Bastarrika, M.; Basti, A.; Batch, J.; Bauchrowitz, J.; Bauer, Th. S.; Bebronne, M.; Behnke, B.; Beker, M. G.; Bell, A. S.; Belletoile, A.; Belopolski, I.; Benacquista, M.; Berliner, J. M.; Bertolini, A.; Betzwieser, J.; Beveridge, N.; Beyersdorf, P. T.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Biswas, R.; Bitossi, M.; Bizouard, M. A.; Black, E.; Blackburn, J. K.; Blackburn, L.; Blair, D.; Bland, B.; Blom, M.; Bock, O.; Bodiya, T. P.; Bogan, C.; Bondarescu, R.; Bondu, F.; Bonelli, L.; Bonnand, R.; Bork, R.; Born, M.; Boschi, V.; Bose, S.; Bosi, L.; Bouhou, B.; Braccini, S.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Breyer, J.; Briant, T.; Bridges, D. O.; Brillet, A.; Brinkmann, M.; Brisson, V.; Britzger, M.; Brooks, A. F.; Brown, D. A.; Brummit, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Burguet–Castell, J.; Burmeister, O.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Calloni, E.; Camp, J. B.; Campsie, P.; Cannizzo, J.; Cannon, K.; Canuel, B.; Cao, J.; Capano, C. D.; Carbognani, F.; Caride, S.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C.; Cesarini, E.; Chaibi, O.; Chalermsongsak, T.; Chalkley, E.; Charlton, P.; Chassande-Mottin, E.; Chelkowski, S.; Chen, Y.; Chincarini, A.; Chiummo, A.; Cho, H.; Christensen, N.; Chua, S. S. Y.; Chung, C. T. Y.; Chung, S.; Ciani, G.; Clara, F.; Clark, D. E.; Clark, J.; Clayton, J. H.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colacino, C. N.; Colas, J.; Colla, A.; Colombini, M.; Conte, A.; Conte, R.; Cook, D.; Corbitt, T. R.; Cordier, M.; Cornish, N.; Corsi, A.; Costa, C. A.; Coughlin, M.; Coulon, J.-P.; Couvares, P.; Coward, D. M.; Coyne, D. C.; Creighton, J. D. E.; Creighton, T. D.; Cruise, A. M.; Cumming, A.; Cunningham, L.; Cuoco, E.; Cutler, R. M.; Dahl, K.; Danilishin, S. L.; Dannenberg, R.; D'Antonio, S.; Danzmann, K.; Dattilo, V.; Daudert, B.; Daveloza, H.; Davier, M.; Davies, G.; Daw, E. J.; Day, R.; Dayanga, T.; De Rosa, R.; DeBra, D.; Debreczeni, G.; Degallaix, J.; Del Pozzo, W.; del Prete, M.; Dent, T.; Dergachev, V.; DeRosa, R.; DeSalvo, R.; Dhurandhar, S.; Di Fiore, L.; Di Lieto, A.; Di Palma, I.; Di Paolo Emilio, M.; Di Virgilio, A.; Díaz, M.; Dietz, A.; DiGuglielmo, J.; Donovan, F.; Dooley, K. L.; Dorsher, S.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Dumas, J.-C.; Dwyer, S.; Eberle, T.; Edgar, M.; Edwards, M.; Effler, A.; Ehrens, P.; Endrőczi, G.; Engel, R.; Etzel, T.; Evans, K.; Evans, M.; Evans, T.; Factourovich, M.; Fafone, V.; Fairhurst, S.; Fan, Y.; Farr, B. F.; Farr, W.; Fazi, D.; Fehrmann, H.; Feldbaum, D.; Ferrante, I.; Fidecaro, F.; Finn, L. S.; Fiori, I.; Fisher, R. P.; Flaminio, R.; Flanigan, M.; Foley, S.; Forsi, E.; Forte, L. A.; Fotopoulos, N.; Fournier, J.-D.; Franc, J.; Frasca, S.; Frasconi, F.; Frede, M.; Frei, M.; Frei, Z.; Freise, A.; Frey, R.; Fricke, T. T.; Friedrich, D.; Fritschel, P.; Frolov, V. V.; Fulda, P. J.; Fyffe, M.; Galimberti, M.; Gammaitoni, L.; Ganija, M. R.; Garcia, J.; Garofoli, J. A.; Garufi, F.; Gáspár, M. E.; Gemme, G.; Geng, R.; Genin, E.; Gennai, A.; Gergely, L. Á.; Ghosh, S.; Giaime, J. A.; Giampanis, S.; Giardina, K. D.; Giazotto, A.; Gill, C.; Goetz, E.; Goggin, L. M.; González, G.; Gorodetsky, M. L.; Goßler, S.; Gouaty, R.; Graef, C.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Gray, N.; Greenhalgh, R. J. S.; Gretarsson, A. M.; Greverie, C.; Grosso, R.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guido, C.; Gupta, R.; Gustafson, E. K.; Gustafson, R.; Ha, T.; Hage, B.; Hallam, J. M.; Hammer, D.; Hammond, G.; Hanks, J.; Hanna, C.; Hanson, J.; Hardt, A.; Harms, J.; Harry, G. M.; Harry, I. W.; Harstad, E. D.; Hartman, M. T.; Haughian, K.; Hayama, K.; Hayau, J.-F.; Heefner, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hendry, M. A.; Heng, I. S.; Heptonstall, A. W.; Herrera, V.; Hewitson, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Holt, K.; Hong, T.; Hooper, S.; Hosken, D. J.; Hough, J.; Howell, E. J.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Ingram, D. R.; Inta, R.; Isogai, T.; Ivanov, A.; Izumi, K.; Jacobson, M.; Jang, H.; Jaranowski, P.; Johnson, W. W.; Jones, D. I.; Jones, G.; Jones, R.; Ju, L.; Kalmus, P.; Kalogera, V.; Kamaretsos, I.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Katsavounidis, E.; Katzman, W.; Kaufer, H.; Kawabe, K.; Kawamura, S.; Kawazoe, F.; Kells, W.; Keppel, D. G.; Keresztes, Z.; Khalaidovski, A.; Khalili, F. Y.; Khazanov, E. A.; Kim, B.; Kim, C.; Kim, D.; Kim, H.; Kim, K.; Kim, N.; Kim, Y.-M.; King, P. J.; Kinsey, M.; Kinzel, D. L.; Kissel, J. S.; Klimenko, S.; Kokeyama, K.; Kondrashov, V.; Kopparapu, R.; Koranda, S.; Korth, W. Z.; Kowalska, I.; Kozak, D.; Kringel, V.; Krishnamurthy, S.; Krishnan, B.; Królak, A.; Kuehn, G.; Kumar, R.; Kwee, P.; Lam, P. K.; Landry, M.; Lang, M.; Lantz, B.; Lastzka, N.; Lawrie, C.; Lazzarini, A.; Leaci, P.; Lee, C. H.; Lee, H. M.; Leindecker, N.; Leong, J. R.; Leonor, I.; Leroy, N.; Letendre, N.; Li, J.; Li, T. G. F.; Liguori, N.; Lindquist, P. E.; Lockerbie, N. A.; Lodhia, D.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Luan, J.; Lubinski, M.; Lück, H.; Lundgren, A. P.; Macdonald, E.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Mageswaran, M.; Mailand, K.; Majorana, E.; Maksimovic, I.; Man, N.; Mandel, I.; Mandic, V.; Mantovani, M.; Marandi, A.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A.; Maros, E.; Marque, J.; Martelli, F.; Martin, I. W.; Martin, R. M.; Marx, J. N.; Mason, K.; Masserot, A.; Matichard, F.; Matone, L.; Matzner, R. A.; Mavalvala, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McGuire, S. C.; McIntyre, G.; McIver, J.; McKechan, D. J. A.; Meadors, G. D.; Mehmet, M.; Meier, T.; Melatos, A.; Melissinos, A. C.; Mendell, G.; Menendez, D.; Mercer, R. A.; Meshkov, S.; Messenger, C.; Meyer, M. S.; Miao, H.; Michel, C.; Milano, L.; Miller, J.; Minenkov, Y.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Miyakawa, O.; Moe, B.; Moesta, P.; Mohan, M.; Mohanty, S. D.; Mohapatra, S. R. P.; Moraru, D.; Moreno, G.; Morgado, N.; Morgia, A.; Mori, T.; Mosca, S.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Mukherjee, S.; Mullavey, A.; Müller-Ebhardt, H.; Munch, J.; Murphy, D.; Murray, P. G.; Mytidis, A.; Nash, T.; Naticchioni, L.; Nawrodt, R.; Necula, V.; Nelson, J.; Newton, G.; Nishizawa, A.; Nocera, F.; Nolting, D.; Nuttall, L.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Oldenburg, R. G.; O'Reilly, B.; O'Shaughnessy, R.; Osthelder, C.; Ott, C. D.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Page, A.; Pagliaroli, G.; Palladino, L.; Palomba, C.; Pan, Y.; Pankow, C.; Paoletti, F.; Papa, M. A.; Parisi, M.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patel, P.; Pedraza, M.; Peiris, P.; Pekowsky, L.; Penn, S.; Peralta, C.; Perreca, A.; Persichetti, G.; Phelps, M.; Pickenpack, M.; Piergiovanni, F.; Pietka, M.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Pletsch, H. J.; Plissi, M. V.; Poggiani, R.; Pöld, J.; Postiglione, F.; Prato, M.; Predoi, V.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prix, R.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Quetschke, V.; Raab, F. J.; Rabeling, D. S.; Rácz, I.; Radkins, H.; Raffai, P.; Rakhmanov, M.; Ramet, C. R.; Rankins, B.; Rapagnani, P.; Raymond, V.; Re, V.; Redwine, K.; Reed, C. M.; Reed, T.; Regimbau, T.; Reid, S.; Reitze, D. H.; Ricci, F.; Riesen, R.; Riles, K.; Robertson, N. A.; Robinet, F.; Robinson, C.; Robinson, E. L.; Rocchi, A.; Roddy, S.; Rodriguez, C.; Rodruck, M.; Rolland, L.; Rollins, J.; Romano, J. D.; Romano, R.; Romie, J. H.; Rosińska, D.; Röver, C.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Ryll, H.; Sainathan, P.; Sakosky, M.; Salemi, F.; Samblowski, A.; Sammut, L.; Sancho de la Jordana, L.; Sandberg, V.; Sankar, S.; Sannibale, V.; Santamaría, L.; Santiago-Prieto, I.; Santostasi, G.; Sassolas, B.; Sathyaprakash, B. S.; Sato, S.; Saulson, P. R.; Savage, R. L.; Schilling, R.; Schlamminger, S.; Schnabel, R.; Schofield, R. M. S.; Schulz, B.; Schutz, B. F.; Schwinberg, P.; Scott, J.; Scott, S. M.; Searle, A. C.; Seifert, F.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sergeev, A.; Shaddock, D. A.; Shaltev, M.; Shapiro, B.; Shawhan, P.; Shoemaker, D. H.; Sibley, A.; Siemens, X.; Sigg, D.; Singer, A.; Singer, L.; Sintes, A. M.; Skelton, G.; Slagmolen, B. J. J.; Slutsky, J.; Smith, J. R.; Smith, M. R.; Smith, N. D.; Smith, R. J. E.; Somiya, K.; Sorazu, B.; Soto, J.; Speirits, F. C.; Sperandio, L.; Stefszky, M.; Stein, A. J.; Steinert, E.; Steinlechner, J.; Steinlechner, S.; Steplewski, S.; Stochino, A.; Stone, R.; Strain, K. A.; Strigin, S.; Stroeer, A. S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sung, M.; Susmithan, S.; Sutton, P. J.; Swinkels, B.; Tacca, M.; Taffarello, L.; Talukder, D.; Tanner, D. B.; Tarabrin, S. P.; Taylor, J. R.; Taylor, R.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Thüring, A.; Titsler, C.; Tokmakov, K. V.; Toncelli, A.; Tonelli, M.; Torre, O.; Torres, C.; Torrie, C. I.; Tournefier, E.; Travasso, F.; Traylor, G.; Trias, M.; Tseng, K.; Tucker, E.; Ugolini, D.; Urbanek, K.; Vahlbruch, H.; Vajente, G.; Vallisneri, M.; van den Brand, J. F. J.; Van Den Broeck, C.; van der Putten, S.; van Veggel, A. A.; Vass, S.; Vasuth, M.; Vaulin, R.; Vavoulidis, M.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Veltkamp, C.; Verkindt, D.; Vetrano, F.; Viceré, A.; Villar, A. E.; Vinet, J.-Y.; Vitale, S.; Vitale, S.; Vocca, H.; Vorvick, C.; Vyatchanin, S. P.; Wade, A.; Waldman, S. J.; Wallace, L.; Wan, Y.; Wang, X.; Wang, Z.; Wanner, A.; Ward, R. L.; Was, M.; Wei, P.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Wen, L.; Wen, S.; Wessels, P.; West, M.; Westphal, T.; Wette, K.; Whelan, J. T.; Whitcomb, S. E.; White, D.; Whiting, B. F.; Wilkinson, C.; Willems, P. A.; Williams, H. R.; Williams, L.; Willke, B.; Winkelmann, L.; Winkler, W.; Wipf, C. C.; Wiseman, A. G.; Wittel, H.; Woan, G.; Wooley, R.; Worden, J.; Yablon, J.; Yakushin, I.; Yamamoto, H.; Yamamoto, K.; Yang, H.; Yeaton-Massey, D.; Yoshida, S.; Yu, P.; Yvert, M.; Zadroźny, A.; Zanolin, M.; Zendri, J.-P.; Zhang, F.; Zhang, L.; Zhang, W.; Zhang, Z.; Zhao, C.; Zotov, N.; Zucker, M. E.; Zweizig, J.

2012-04-01

We report on a search for gravitational waves from coalescing compact binaries using LIGO and Virgo observations between July 7, 2009, and October 20, 2010. We searched for signals from binaries with total mass between 2 and 25M⊙; this includes binary neutron stars, binary black holes, and binaries consisting of a black hole and neutron star. The detectors were sensitive to systems up to 40 Mpc distant for binary neutron stars, and further for higher mass systems. No gravitational-wave signals were detected. We report upper limits on the rate of compact binary coalescence as a function of total mass, including the results from previous LIGO and Virgo observations. The cumulative 90% confidence rate upper limits of the binary coalescence of binary neutron star, neutron star-black hole, and binary black hole systems are 1.3×10-4, 3.1×10-5, and 6.4×10-6Mpc-3yr-1, respectively. These upper limits are up to a factor 1.4 lower than previously derived limits. We also report on results from a blind injection challenge.

Auxin-Regulated Polypeptide Changes at Different Stages of Strawberry Fruit Development 1

PubMed Central

Veluthambi, K.; Poovaiah, B. W.

1984-01-01

The pattern of polypeptides at different stages of strawberry (Fragaria ananassa Duch. cv Ozark Beauty) fruit development was studied by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. An 81,000-dalton polypeptide appeared between 5 and 10 days after pollination. Polypeptides with molecular weights of 76,000 and 37,000 daltons were formed after 10 days. The control exerted by auxin in the stage-specific formation of polypeptides was investigated by stopping fruit growth after removing the achenes and reinitiating fruit growth by the application of a synthetic auxin, α-naphthaleneacetic acid (NAA). When the achenes were removed from the 5- and 10-day-old fruits, the fruits failed to grow, the 81,000 dalton polypeptide was not formed between 5 and 10 days, and the 76,000- and 37,000-dalton polypeptides were not formed between 10 and 20 days. Application of NAA to fruits deprived of auxin by removal of achenes resulted in the resumption of growth and also in the appearance of these polypeptides. Removal of achenes of the 5- or 10-day-old fruits and growing them without auxin resulted in the formation of 52,000- and 57,000-dalton polypeptides. These two polypeptides were not formed when NAA was applied to fruits after removal of achenes. Supply of NAA to auxin-deprived fruits 5 days after removal of achenes resulted in resumption of growth and also in the disappearance of these two polypeptides, pointing out their possible relation to the inhibition of fruit growth. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:16663624

Contact binaries in the Trans-neptunian Belt

NASA Astrophysics Data System (ADS)

Thirouin, Audrey; Sheppard, Scott S.

2017-10-01

A contact binary is made up of two objects that are almost touching or in contact with each other. These systems have been found in the Near-Earth Object population, the main belt of asteroids, the Jupiter Trojans, the comet population and even in the Trans-neptunian belt.Several studies suggest that up to 30% of the Trans-Neptunian Objects (TNOs) could be contact binaries (Sheppard & Jewitt 2004, Lacerda 2011). Contact binaries are not resolvable with the Hubble Space Telescope because of the small separation between the system's components (Noll et al. 2008). Only lightcurves with a characteristic V-/U-shape at the minimum/maximum of brightness and a large amplitude can identify these contact binaries. Despite an expected high fraction of contact binaries, 2001 QG298 is the only confirmed contact binary in the Trans-Neptunian belt, and 2003 SQ317 is a candidate to this class of systems (Sheppard & Jewitt 2004, Lacerda et al. 2014).Recently, using the Lowell’s 4.3m Discovery Channel Telescope and the 6.5m Magellan Telescope, we started a search for contact binaries at the edge of our Solar System. So far, our survey focused on about 40 objects in different dynamical groups of the Trans-Neptunian belt for sparse or complete lightcurves. We report the discovery of 5 new potential contact binaries converting the current estimate of potential/confirmed contact binaries to 7 objects. With one epoch of observations per object, we are not able to model in detail the systems, but we derive estimate for basic information such as shape, size, density of both objects as well as the separation between the system’s components. In this work, we will present these new systems, their basic characteristics, and we will discuss the potential main reservoir of contact binaries in the Trans-neptunian belt.

Photometric binary stars in Praesepe and the search for globular cluster binaries

NASA Technical Reports Server (NTRS)

Bolte, Michael

1991-01-01

A radial velocity study of the stars which are located on a second sequence above the single-star zero-age main sequence at a given color in the color-magnitude diagram of the open cluster Praesepe, (NGC 2632) shows that 10, and possibly 11, of 17 are binary systems. Of the binary systems, five have full amplitudes for their velocity variations that are greater than 50 km/s. To the extent that they can be applied to globular clusters, these results suggests that (1) observations of 'second-sequence' stars in globular clusters would be an efficient way of finding main-sequence binary systems in globulars, and (2) current instrumentation on large telescopes is sufficient for establishing unambiguously the existence of main-sequence binary systems in nearby globular clusters.

Multifunctional quantum dot-polypeptide hybrid nanogel for targeted imaging and drug delivery

NASA Astrophysics Data System (ADS)

Yang, Jie; Yao, Ming-Hao; Wen, Lang; Song, Ji-Tao; Zhang, Ming-Zhen; Zhao, Yuan-Di; Liu, Bo

2014-09-01

A new type of multifunctional quantum dot (QD)-polypeptide hybrid nanogel with targeted imaging and drug delivery properties has been developed by metal-affinity driven self-assembly between artificial polypeptides and CdSe-ZnS core-shell QDs. On the surface of QDs, a tunable sandwich-like microstructure consisting of two hydrophobic layers and one hydrophilic layer between them was verified by capillary electrophoresis, transmission electron microscopy, and dynamic light scattering measurements. Hydrophobic and hydrophilic drugs can be simultaneously loaded in a QD-polypeptide nanogel. In vitro drug release of drug-loaded QD-polypeptide nanogels varies strongly with temperature, pH, and competitors. A drug-loaded QD-polypeptide nanogel with an arginine-glycine-aspartic acid (RGD) motif exhibited efficient receptor-mediated endocytosis in αvβ3 overexpressing HeLa cells but not in the control MCF-7 cells as analyzed by confocal microscopy and flow cytometry. In contrast, non-targeted QD-polypeptide nanogels revealed minimal binding and uptake in HeLa cells. Compared with the original QDs, the QD-polypeptide nanogels showed lower in vitro cytotoxicity for both HeLa cells and NIH 3T3 cells. Furthermore, the cytotoxicity of the targeted QD-polypeptide nanogel was lower for normal NIH 3T3 cells than that for HeLa cancer cells. These results demonstrate that the integration of imaging and drug delivery functions in a single QD-polypeptide nanogel has the potential for application in cancer diagnosis, imaging, and therapy.A new type of multifunctional quantum dot (QD)-polypeptide hybrid nanogel with targeted imaging and drug delivery properties has been developed by metal-affinity driven self-assembly between artificial polypeptides and CdSe-ZnS core-shell QDs. On the surface of QDs, a tunable sandwich-like microstructure consisting of two hydrophobic layers and one hydrophilic layer between them was verified by capillary electrophoresis, transmission electron microscopy, and dynamic light scattering measurements. Hydrophobic and hydrophilic drugs can be simultaneously loaded in a QD-polypeptide nanogel. In vitro drug release of drug-loaded QD-polypeptide nanogels varies strongly with temperature, pH, and competitors. A drug-loaded QD-polypeptide nanogel with an arginine-glycine-aspartic acid (RGD) motif exhibited efficient receptor-mediated endocytosis in αvβ3 overexpressing HeLa cells but not in the control MCF-7 cells as analyzed by confocal microscopy and flow cytometry. In contrast, non-targeted QD-polypeptide nanogels revealed minimal binding and uptake in HeLa cells. Compared with the original QDs, the QD-polypeptide nanogels showed lower in vitro cytotoxicity for both HeLa cells and NIH 3T3 cells. Furthermore, the cytotoxicity of the targeted QD-polypeptide nanogel was lower for normal NIH 3T3 cells than that for HeLa cancer cells. These results demonstrate that the integration of imaging and drug delivery functions in a single QD-polypeptide nanogel has the potential for application in cancer diagnosis, imaging, and therapy. Electronic supplementary information (ESI) available. See DOI: 10.1039/c4nr03058c

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOEpatents

Morant, Marc

2014-01-14

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase, or beta-glucosidase activity and isolated polynucleotides encoding polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Synthesis and studies of polypeptide materials: Self-assembled block copolypeptide amphiphiles, DNA-condensing block copolypeptides and membrane-interactive random copolypeptides

NASA Astrophysics Data System (ADS)

Wyrsta, Michael Dmytro

A new class of transition metal initiators for the controlled polymerization of alpha-aminoacid-N-carboxyanhydrides (alpha-NCAs), has been developed by Deming et al. This discovery has allowed for the synthesis of well-defined "protein-like" polymers. Using this chemistry we have made distinct block/random copolypeptides for biomedical applications. Drug delivery, gene delivery, and antimicrobial polymers were the focus of our research efforts. The motivation for the synthesis and study of synthetic polypeptide based materials comes from proteins. Natural proteins are able to adopt a staggeringly large amount of uniquely well-defined folded structures. These structures account for the diversity in properties of proteins. As catalysts (enzymes) natural proteins perform some of the most difficult chemistry with ease and precision at ambient pressures and temperatures. They also exhibit incredible structural properties that directly result from formation of complex hierarchical assemblies. Self-assembling block copolymers were synthesized with various compositions and architectures. In general, di- and tri-block amphiphiles were studied for their self-assembling properties. Both spherical and tubular vesicles were found to assemble from di- and tri-block amphiphiles, respectively. In addition to self-assembly, pH responsiveness was engineered into these amphiphiles by the incorporation of basic residues (lysine) into the hydrophobic block. Another form of self-assembly studied was the condensation of DNA using cationic block copolymers. It was found that cationic block copolymers could condense DNA into compact, ordered, water-soluble aggregates on the nanoscale. These aggregates sufficiently protected DNA from nucleases and yet were susceptible to proteases. These studies form the basis of a gene delivery platform. The ease with which NCAs are polymerized renders them completely amenable to parallel synthetic methods. We have employed this technique to discover new antimicrobial polypeptides. The polymers studied were themselves the antimicrobial agent, not a self-assembled aggregate that contained antibiotics. It was found that powerful antibacterial polymers could be readily prepared with simple binary compositions. Antibacterial activity was sensitive to copolymer composition, bacterial cell-wall type, and insensitive to chain length (within reason).

Adsorption of Cr(VI) on cerium immobilized cross-linked chitosan composite in single system and coexisted with Orange II in binary system.

PubMed

Zhu, Tianyi; Huang, Wei; Zhang, Lingfan; Gao, Jie; Zhang, Wenqing

2017-10-01

In this work, cerium immobilized cross-linked chitosan (CTS-Ce) composite, employed as an efficient adsorbent for Cr(VI) in single system and coexisted with Orange II (OII) in binary system, was prepared by co-precipitation method. The as-obtained adsorbent was characterized by FTIR, SEM, EDS and XPS before and after adsorption. The adsorption behaviors of Cr(VI) in single and binary system were systematically studied. The maximum adsorption capacity of Cr(VI) on CTS-Ce (202.8mg/g) was calculated by Langmuir equation in single metal system, but it decreased to 112.9mg/g with initial concentration of 100mg/L OII in binary system at pH 2 and 293K. The adsorption data for Cr(VI) followed the Langmuir model in single system, while fitted Temkin model well in binary system. In both single and binary system, the kinetics of adsorption exhibited pseudo-second order behavior and adsorption capacity increased with increasing temperature. Moreover, the data of thermodynamic parameters (ΔG°<0, ΔH°>0) indicated that the adsorption was a spontaneous and endothermic process. Besides, |ΔG Cr |>|ΔG Cr-OII | at the same temperature further suggested that Cr(VI) was adsorbed on the CTS-Ce composite faster in binary system than in single system. Copyright © 2017 Elsevier B.V. All rights reserved.

International Ultraviolet Explorer observations of the peculiar variable spectrum of the eclipsing binary R Arae

NASA Technical Reports Server (NTRS)

Mccluskey, G. E.; Kondo, Y.

1983-01-01

The eclipsing binary system R Arae = HD 149730 is a relatively bright southern system with an orbital period of about 4.4 days. It is a single-lined spectroscopic binary. The spectral class of the primary component is B9 Vp. The system was included in a study of mass flow and evolution in close binary systems using the International Ultraviolet Explorer satellite (IUE). Four spectra in the wavelength range from 1150 to 1900 A were obtained with the far-ultraviolet SWP camera, and six spectra in the range from 1900 to 3200 range were obtained with the mid-ultraviolet LWR camera. The close binary R Arae exhibits very unusual ultraviolet spectra. It appears that no other close binary system, observed with any of the orbiting satellites, shows outside-eclipse ultraviolet continuum flux variations of this nature.

On the Induced Gravitational Collapse

NASA Astrophysics Data System (ADS)

Becerra, Laura M.; Bianco, Carlo; Fryer, Chris; Rueda, Jorge; Ruffini, Remo

2018-01-01

The induced gravitational collapse (IGC) paradigm has been applied to explain the long gamma ray burst (GRB) associated with type Ic supernova, and recently the Xray flashes (XRFs). The progenitor is a binary systems of a carbon-oxygen core (CO) and a neutron star (NS). The CO core collapses and undergoes a supernova explosion which triggers the hypercritical accretion onto the NS companion (up to 10-2 M⊙s-1). For the binary driven hypernova (BdHNe), the binary system is enough bound, the NS reach its critical mass, and collapse to a black hole (BH) with a GRB emission characterized by an isotropic energy Eiso > 1052 erg. Otherwise, for binary systems with larger binary separations, the hypercritical accretion onto the NS is not sufficient to induced its gravitational collapse, a X-ray flash is produced with Eiso < 1052 erg. We're going to focus in identify the binary parameters that limits the BdHNe systems with the XRFs systems.

Moisture absorption and retention properties, and activity in alleviating skin photodamage of collagen polypeptide from marine fish skin.

PubMed

Hou, Hu; Li, Bafang; Zhang, Zhaohui; Xue, Changhu; Yu, Guangli; Wang, Jingfeng; Bao, Yuming; Bu, Lin; Sun, Jiang; Peng, Zhe; Su, Shiwei

2012-12-01

Collagen polypeptides were prepared from cod skin. Moisture absorption and retention properties of collagen polypeptides were determined at different relative humidities. In addition, the protective effects of collagen polypeptide against UV-induced damage to mouse skin were evaluated. Collagen polypeptides had good moisture absorption and retention properties and could alleviate the damage induced by UV radiation. The action mechanisms of collagen polypeptide mainly involved enhancing immunity, reducing the loss of moisture and lipid, promoting anti-oxidative properties, inhibiting the increase of glycosaminoglycans, repairing the endogenous collagen and elastin protein fibres, and maintaining the ratio of type III to type I collagen. Copyright © 2012 Elsevier Ltd. All rights reserved.

Polypeptide having or assisting in carbohydrate material degrading activity and uses thereof

DOEpatents

Schooneveld-Bergmans, Margot Elisabeth Francoise; Heijne, Wilbert Herman Marie; Los, Alrik Pieter

2016-02-16

The invention relates to a polypeptide which comprises the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 76% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 76% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Polypeptide having beta-glucosidase activity and uses thereof

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schoonneveld-Bergmans, Margot Elisabeth Francoise; Heijne, Wilbert Herman Marie; De Jong, Rene Marcel

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well asmore » the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.« less

Polypeptide having swollenin activity and uses thereof

DOEpatents

Schoonneveld-Bergmans, Margot Elizabeth Francoise; Heijne, Wilbert Herman Marie; Vlasie, Monica D; Damveld, Robbertus Antonius

2015-11-04

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 73% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 73% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Polypeptide having beta-glucosidase activity and uses thereof

DOEpatents

Schooneveld-Bergmans, Margot Elisabeth Francoise; Heijne, Wilbert Herman Marie; De Jong, Rene Marcel; Damveld, Robbertus Antonius

2015-09-01

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 70% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 70% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Polypeptide having cellobiohydrolase activity and uses thereof

DOEpatents

Sagt, Cornelis Maria Jacobus; Schooneveld-Bergmans, Margot Elisabeth Francoise; Roubos, Johannes Andries; Los, Alrik Pieter

2015-09-15

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 93% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 93% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Polypeptide having acetyl xylan esterase activity and uses thereof

DOEpatents

Schoonneveld-Bergmans, Margot Elisabeth Francoise; Heijne, Wilbert Herman Marie; Los, Alrik Pieter

2015-10-20

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 82% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 82% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Polypeptide having carbohydrate degrading activity and uses thereof

DOEpatents

Schooneveld-Bergmans, Margot Elisabeth Francoise; Heijne, Wilbert Herman Marie; Vlasie, Monica Diana; Damveld, Robbertus Antonius

2015-08-18

The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 73% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 73% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Mosaic HIV envelope immunogenic polypeptides

DOE Office of Scientific and Technical Information (OSTI.GOV)

Korber, Bette T. M.; Gnanakaran, S.; Perkins, Simon

Disclosed herein are mosaic HIV envelope (Env) polypeptides that can elicit an immune response to HIV (such as cytotoxic T cell (CTL), helper T cell, and/or humoral responses). Also disclosed are sets of the disclosed mosaic Env polypeptides, which include two or more (for example, three) of the polypeptides. Also disclosed herein are methods for treating or inhibiting HIV in a subject including administering one or more of the disclosed immunogenic polypeptides or compositions to a subject infected with HIV or at risk of HIV infection. In some embodiments, the methods include inducing an immune response to HIV in amore » subject comprising administering to the subject at least one (such as two, three, or more) of the immunogenic polypeptides or at least one (such as two, three, or more) nucleic acids encoding at least one of the immunogenic polypeptides disclosed herein.« less

Toxicity study of isolated polypeptide from wool hydrolysate.

PubMed

Li, Jiashen; Li, Yi; Zhang, Yu; Liu, Xuan; Zhao, Zheng; Zhang, Jing; Han, Yanxia; Zhou, Dangxia

2013-07-01

The cytotoxicity of wool polypeptide has been evaluated by both cell and animal models. Wool was dissolved in sodium hydroxide solution, the pH value of the solution was adjusted to 5.55 and the precipitate was harvested as wool polypeptide. The spray-dried polypeptide was collected as powders and characterized by SEM, FTIR and TG-DSC. The cell culturing results showed that wool polypeptide had no obvious negative effect on cell viability in vitro. Both acute oral toxicity and subacute 30-day oral toxicology studies showed that wool polypeptide had no influence on body weight, feed consumption, blood chemistry, and hematology at any dose levels. There were no treatment related findings on gross or detailed necroscopy, organ weights, organ/body weight ratios and histology. Our study indicated the absence of toxicity in wool polypeptide and supported its safe use as a food ingredient or drug carrier. Copyright © 2013 Elsevier Ltd. All rights reserved.

The incidence of stellar mergers and mass gainers among massive stars

DOE Office of Scientific and Technical Information (OSTI.GOV)

De Mink, S. E.; Sana, H.; Langer, N.

2014-02-10

Because the majority of massive stars are born as members of close binary systems, populations of massive main-sequence stars contain stellar mergers and products of binary mass transfer. We simulate populations of massive stars accounting for all major binary evolution effects based on the most recent binary parameter statistics and extensively evaluate the effect of model uncertainties. Assuming constant star formation, we find that 8{sub −4}{sup +9}% of a sample of early-type stars are the products of a merger resulting from a close binary system. In total we find that 30{sub −15}{sup +10}% of massive main-sequence stars are the productsmore » of binary interaction. We show that the commonly adopted approach to minimize the effects of binaries on an observed sample by excluding systems detected as binaries through radial velocity campaigns can be counterproductive. Systems with significant radial velocity variations are mostly pre-interaction systems. Excluding them substantially enhances the relative incidence of mergers and binary products in the non-radial velocity variable sample. This poses a challenge for testing single stellar evolutionary models. It also raises the question of whether certain peculiar classes of stars, such as magnetic O stars, are the result of binary interaction and it emphasizes the need to further study the effect of binarity on the diagnostics that are used to derive the fundamental properties (star-formation history, initial mass function, mass-to-light ratio) of stellar populations nearby and at high redshift.« less

Polypeptides having beta-glucosidase activity and polynucleotides encoding same

DOEpatents

Morant, Marc Dominique

2014-10-14

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Thermal and acid tolerant beta-xylosidases, genes encoding, related organisms, and methods

DOEpatents

Thompson, David N [Idaho Falls, ID; Thompson, Vicki S [Idaho Falls, ID; Schaller, Kastli D [Ammon, ID; Apel, William A [Jackson, WY; Lacey, Jeffrey A [Idaho Falls, ID; Reed, David W [Idaho Falls, ID

2011-04-12

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius and variations thereof are provided. Further provided are methods of at least partially degrading xylotriose and/or xylobiose using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius and variations thereof.

Brachytherapy Using Elastin-Like Polypeptides with (131)I Inhibit Tumor Growth in Rabbits with VX2 Liver Tumor.

PubMed

Liu, Xinpei; Shen, Yiming; Zhang, Xuqian; Lin, Rui; Jia, Qiang; Chang, Yixiang; Liu, Wenge; Liu, Wentian

2016-10-01

Brachytherapy is a targeted type of radiotherapy utilized in the treatment of cancers. Elastin-like polypeptides are a unique class of genetically engineered peptide polymers that have several attractive properties for brachytherapy. To explore the feasibility and application of brachytherapy for VX2 liver tumor using elastin-like polypeptides with (131)I so as to provide reliable experimental evidence for a new promising treatment of liver cancer. Elastin-like polypeptide as carrier was labeled with (131)I using the iodogen method. Ten eligible rabbits with VX2 liver tumor were randomly divided into the treatment group (n = 5) and control group (n = 5). The treatment group received brachytherapy using elastin-like polypeptide with (131)I, and in the control group, elastin-like polypeptide was injected into the VX2 liver tumor as a control. Periodic biochemical and imaging surveillances were required to assess treatment efficacy. The stability of elastin-like polypeptide with (131)I in vitro was maintained at over 96.8 % for 96 h. Biochemistry and imaging indicated brachytherapy using elastin-like polypeptide with (131)I for liver tumor can improve liver function and inhibit tumor growth (P < 0.05). Elastin-like polypeptide can be an ideal carrier of (131)I and have high labeling efficiency, radiochemical purity and stability. Brachytherapy using elastin-like polypeptide with (131)I for liver tumor is a useful therapy that possesses high antitumor efficacy advantages.

Ice Growth Inhibition in Antifreeze Polypeptide Solution by Short-Time Solution Preheating.

PubMed

Nishi, Naoto; Miyamoto, Takuya; Waku, Tomonori; Tanaka, Naoki; Hagiwara, Yoshimichi

2016-01-01

The objective of this study is to enhance the inhibition of ice growth in the aqueous solution of a polypeptide, which is inspired by winter flounder antifreeze protein. We carried out measurements on unidirectional freezing of the polypeptide solution. The thickness of the solution was 0.02 mm, and the concentration of polypeptide was varied from 0 to 2 mg/mL. We captured successive microscopic images of ice/solution interfaces, and measured the interface velocity from the locations of tips of the pectinate interface in the images. We also simultaneously measured the temperature by using a small thermocouple. The ice/solution interface temperature was defined by the temperature at the tips. It was found that the interface temperature was decreased with an increasing concentration of polypeptide. To try varying the activity of the polypeptide, we preheated the polypeptide solution and cooled it before carrying out the measurements. Preheating for 1-5 hours was found to cause a further decrease in the interface temperature. Furthermore, wider regions of solution and ice with inclined interfaces in the pectinate interface structure were observed, compared with the case where the solution was not preheated. Thus, the ice growth inhibition was enhanced by this preheating. To investigate the reason for this enhancement, we measured the conformation and aggregates of polypeptide in the solution. We also measured the local concentration of polypeptide. It was found that the polypeptide aggregates became larger as a result of preheating, although the polypeptide conformation was unchanged. These large aggregates caused both adsorption to the interface and the wide regions of supercooled solution in the pectinate interface structure.

BINARY CENTRAL STARS OF PLANETARY NEBULAE DISCOVERED THROUGH PHOTOMETRIC VARIABILITY. IV. THE CENTRAL STARS OF HaTr 4 AND Hf 2-2

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hillwig, Todd C.; Schaub, S. C.; Bond, Howard E.

We explore the photometrically variable central stars of the planetary nebulae HaTr 4 and Hf 2-2. Both have been classified as close binary star systems previously based on their light curves alone. Here, we present additional arguments and data confirming the identification of both as close binaries with an irradiated cool companion to the hot central star. We include updated light curves, orbital periods, and preliminary binary modeling for both systems. We also identify for the first time the central star of HaTr 4 as an eclipsing binary. Neither system has been well studied in the past, but we utilizemore » the small amount of existing data to limit possible binary parameters, including system inclination. These parameters are then compared to nebular parameters to further our knowledge of the relationship between binary central stars of planetary nebulae and nebular shaping and ejection.« less

Dynamical evolution of young binaries and multiple systems

NASA Astrophysics Data System (ADS)

Reipurth, B.

Most stars, and perhaps all, are born in small multiple systems whose components interact, leading to chaotic dynamic behavior. Some components are ejected, either into distant orbits or into outright escapes, while the remaining components form temporary and eventually permanent binary systems. More than half of all such breakups of multiple systems occur during the protostellar phase, leading to the occasional ejection of protostars outside their nascent cloud cores. Such orphaned protostars are observed as wide companions to embedded protostars, and thus allow the direct study of protostellar objects. Dynamic interactions during early stellar evolution explain the shape and enormous width of the separation distribution function of binaries, from close spectroscopic binaries to the widest binaries.

Photometric Analysis and Modeling of Five Mass-Transferring Binary Systems

NASA Astrophysics Data System (ADS)

Geist, Emily; Beaky, Matthew; Jamison, Kate

2018-01-01

In overcontact eclipsing binary systems, both stellar components have overfilled their Roche lobes, resulting in a dumbbell-shaped shared envelope. Mass transfer is common in overcontact binaries, which can be observed as a slow change on the rotation period of the system.We studied five overcontact eclipsing binary systems with evidence of period change, and thus likely mass transfer between the components, identified by Nelson (2014): V0579 Lyr, KN Vul, V0406 Lyr, V2240 Cyg, and MS Her. We used the 31-inch NURO telescope at Lowell Observatory in Flagstaff, Arizona to obtain images in B,V,R, and I filters for V0579 Lyr, and the 16-inch Meade LX200GPS telescope with attached SBIG ST-8XME CCD camera at Juniata College in Huntingdon, Pennsylvania to image KN Vul, V0406 Lyr, V2240 Cyg, and MS Her, also in B,V,R, and I.After data reduction, we created light curves for each of the systems and modeled the eclipsing binaries using the BinaryMaker3 and PHOEBE programs to determine their fundamental physical parameters for the first time. Complete light curves and preliminary models for each of these neglected eclipsing binary systems will be presented.

What we learn from eclipsing binaries in the ultraviolet

NASA Technical Reports Server (NTRS)

Guinan, Edward F.

1990-01-01

Recent results on stars and stellar physics from IUE (International Ultraviolet Explorer) observations of eclipsing binaries are discussed. Several case studies are presented, including V 444 Cyg, Aur stars, V 471 Tau and AR Lac. Topics include stellar winds and mass loss, stellar atmospheres, stellar dynamos, and surface activity. Studies of binary star dynamics and evolution are discussed. The progress made with IUE in understanding the complex dynamical and evolutionary processes taking place in W UMa-type binaries and Algol systems is highlighted. The initial results of intensive studies of the W UMa star VW Cep and three representative Algol-type binaries (in different stages of evolution) focused on gas flows and accretion, are included. The future prospects of eclipsing binary research are explored. Remaining problems are surveyed and the next challenges are presented. The roles that eclipsing binaries could play in studies of stellar evolution, cluster dynamics, galactic structure, mass luminosity relations for extra galactic systems, cosmology, and even possible detection of extra solar system planets using eclipsing binaries are discussed.

Polypeptides having xylanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj; Shaghasi, Tarana

The present invention relates to polypeptides having xylanase activity, catalytic domains, and carbohydrate binding domains, and polynucleotides encoding the polypeptides, catalytic domains, and carbohydrate binding domains. The present invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains, and carbohydrate binding domains.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj; Shagasi, Tarana

The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.

Polypeptides having endoglucanase activity and polynucleotides encoding same

DOEpatents

Spodsberg, Nikolaj; Shagasi, Tarana

2015-06-30

The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.

Thermal and acid tolerant beta xylosidases, arabinofuranosidases, genes encoding, related organisms, and methods

DOEpatents

Thompson, David N; Thompson, Vicki S; Schaller, Kastli D; Apel, William A; Reed, David W; Lacey, Jeffrey A

2013-04-30

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius and variations thereof are provided. Further provided are methods of at least partially degrading xylotriose, xylobiose, and/or arabinofuranose-substituted xylan using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius and variations thereof.

Polypeptides having beta-glucosidase and beta-xylosidase activity and polynucleotides encoding same

DOEpatents

Morant, Marc Dominique

2014-05-06

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having cellobiohydrolase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Stringer, Mary Ann; McBrayer, Brett

2016-11-29

The present invention relates to isolated polypeptides having cellobiohydrolase activity, catalytic domains, and cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains, and cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains, or cellulose binding domains.

Polypeptides having beta-glucosidase activity and beta-xylosidase activity and polynucleotides encoding same

DOEpatents

Morant, Marc Dominique

2014-05-06

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Polypeptides having beta-glucosidase activity and beta-xylosidase activity and polynucleotides encoding same

DOEpatents

Morant, Marc Dominique

2014-04-29

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Searches for all types of binary mergers in the first Advanced LIGO observing run

NASA Astrophysics Data System (ADS)

Read, Jocelyn

2017-01-01

The first observational run of the Advanced LIGO detectors covered September 12, 2015 to January 19, 2016. In that time, two definitive observations of merging binary black hole systems were made. In particular, the second observation, GW151226, relied on matched-filter searches targeting merging binaries. These searches were also capable of detecting binary mergers from binary neutron stars and from black-hole/neutron-star binaries. In this talk, I will give an overview of LIGO compact binary coalescence searches, in particular focusing on systems that contain neutron stars. I will discuss the sensitive volumes of the first observing run, the astrophysical implications of detections and non-detections, and prospects for future observations

Binary Plutinos

NASA Astrophysics Data System (ADS)

Noll, Keith S.

2015-08-01

The Pluto-Charon binary was the first trans-neptunian binary to be identified in 1978. Pluto-Charon is a true binary with both components orbiting a barycenter located between them. The Pluto system is also the first, and to date only, known binary with a satellite system consisting of four small satellites in near-resonant orbits around the common center of mass. Seven other Plutinos, objects in 3:2 mean motion resonance with Neptune, have orbital companions including 2004 KB19 reported here for the first time. Compared to the Cold Classical population, the Plutinos differ in the frequency of binaries, the relative sizes of the components, and their inclination distribution. These differences point to distinct dynamical histories and binary formation processes encountered by Plutinos.

Life and light: exotic photosynthesis in binary and multiple-star systems.

PubMed

O'Malley-James, J T; Raven, J A; Cockell, C S; Greaves, J S

2012-02-01

The potential for Earth-like planets within binary/multiple-star systems to host photosynthetic life was evaluated by modeling the levels of photosynthetically active radiation (PAR) such planets receive. Combinations of M and G stars in (i) close-binary systems; (ii) wide-binary systems, and (iii) three-star systems were investigated, and a range of stable radiation environments were found to be possible. These environmental conditions allow for the possibility of familiar, but also more exotic, forms of photosynthetic life, such as IR photosynthesizers and organisms that are specialized for specific spectral niches.

High Resolution Imaging of Very Low Mass Spectral Binaries: Three Resolved Systems and Detection of Orbital Motion in an L/T Transition Binary

NASA Astrophysics Data System (ADS)

Bardalez Gagliuffi, Daniella C.; Gelino, Christopher R.; Burgasser, Adam J.

2015-11-01

We present high resolution Laser Guide Star Adaptive Optics imaging of 43 late-M, L and T dwarf systems with Keck/NIRC2. These include 17 spectral binary candidates, systems whose spectra suggest the presence of a T dwarf secondary. We resolve three systems: 2MASS J1341-3052, SDSS J1511+0607 and SDSS J2052-1609 the first two are resolved for the first time. All three have projected separations <8 AU and estimated periods of 14-80 years. We also report a preliminary orbit determination for SDSS J2052-1609 based on six epochs of resolved astrometry between 2005 and 2010. Among the 14 unresolved spectral binaries, 5 systems were confirmed binaries but remained unresolved, implying a minimum binary fraction of {47}-11+12% for this sample. Our inability to resolve most of the spectral binaries, including the confirmed binaries, supports the hypothesis that a large fraction of very low mass systems have relatively small separations and are missed with direct imaging. Some of the data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation.

Equilibrium, stability, and orbital evolution of close binary systems

NASA Technical Reports Server (NTRS)

Lai, Dong; Rasio, Frederic A.; Shapiro, Stuart L.

1994-01-01

We present a new analytic study of the equilibrium and stability properties of close binary systems containing polytropic components. Our method is based on the use of ellipsoidal trial functions in an energy variational principle. We consider both synchronized and nonsynchronized systems, constructing the compressible generalizations of the classical Darwin and Darwin-Riemann configurations. Our method can be applied to a wide variety of binary models where the stellar masses, radii, spins, entropies, and polytropic indices are all allowed to vary over wide ranges and independently for each component. We find that both secular and dynamical instabilities can develop before a Roche limit or contact is reached along a sequence of models with decreasing binary separation. High incompressibility always makes a given binary system more susceptible to these instabilities, but the dependence on the mass ratio is more complicated. As simple applications, we construct models of double degenerate systems and of low-mass main-sequence star binaries. We also discuss the orbital evoltuion of close binary systems under the combined influence of fluid viscosity and secular angular momentum losses from processes like gravitational radiation. We show that the existence of global fluid instabilities can have a profound effect on the terminal evolution of coalescing binaries. The validity of our analytic solutions is examined by means of detailed comparisons with the results of recent numerical fluid calculations in three dimensions.

LISA verification binaries with updated distances from Gaia Data Release 2

NASA Astrophysics Data System (ADS)

Kupfer, T.; Korol, V.; Shah, S.; Nelemans, G.; Marsh, T. R.; Ramsay, G.; Groot, P. J.; Steeghs, D. T. H.; Rossi, E. M.

2018-06-01

Ultracompact binaries with orbital periods less than a few hours will dominate the gravitational wave signal in the mHz regime. Until recently, 10 systems were expected have a predicted gravitational wave signal strong enough to be detectable by the Laser Interferometer Space Antenna (LISA), the so-called `verification binaries'. System parameters, including distances, are needed to provide an accurate prediction of the expected gravitational wave strength to be measured by LISA. Using parallaxes from Gaia Data Release 2 we calculate signal-to-noise ratios (SNR) for ≈50 verification binary candidates. We find that 11 binaries reach a SNR≥20, two further binaries reaching a SNR≥5 and three more systems are expected to have a SNR≈5 after four years integration with LISA. For these 16 systems we present predictions of the gravitational wave amplitude (A) and parameter uncertainties from Fisher information matrix on the amplitude (A) and inclination (ι).

Identification of dehydrin-like proteins responsive to chilling in floral buds of blueberry (Vaccinium, section Cyanococcus).

PubMed

Muthalif, M M; Rowland, L J

1994-04-01

The level of three major polypeptides of 65, 60, and 14 kD increased in response to chilling unit accumulation in floral buds of a woody perennial, blueberry (Vaccinium, section Cynaococcus). The level of the polypeptides increased most dramatically within 300 h of chilling and decreased to the prechilling level with the initiation of budbreak. Cold-hardiness levels were assessed for dormant buds of Vaccinium corymbosum and Vaccinium ashei after different chilling treatments until the resumption of growth. These levels coincided with the level of the chilling-responsive polypeptides. Like some other previously described cold-induced proteins in annual plants, the level of the chilling-induced polypeptides also increased in leaves in response to cold treatment; the chilling-induced polypeptides were heat stable, resisting aggregation after incubation at 95 degrees C for 15 min. By fractionating bud proteins first by isoelectric point (pI) and then by molecular mass, the pI values of the 65- and 60-kD polypeptides were found to be 7.5 to 8.0 and the pI value of the 14-kD polypeptide was judged to be 8.5. Purification of the 65- and 60-kD polypeptides, followed by digestion with endoproteinase Lys-C and sequencing of selected fragments, revealed similarities in amino acid composition between the 65- and 60-kD polypeptides and dehydrins. Indeed, antiserum to the lysine-rich consensus sequence EKKGIMDKIKEKLPG of dehydrin proteins cross-reacted to all three of the major chilling-responsive polypeptides of blueberry, identifying these as dehydrins or dehydrin-like proteins.

Identification of dehydrin-like proteins responsive to chilling in floral buds of blueberry (Vaccinium, section Cyanococcus).

PubMed Central

Muthalif, M M; Rowland, L J

1994-01-01

The level of three major polypeptides of 65, 60, and 14 kD increased in response to chilling unit accumulation in floral buds of a woody perennial, blueberry (Vaccinium, section Cynaococcus). The level of the polypeptides increased most dramatically within 300 h of chilling and decreased to the prechilling level with the initiation of budbreak. Cold-hardiness levels were assessed for dormant buds of Vaccinium corymbosum and Vaccinium ashei after different chilling treatments until the resumption of growth. These levels coincided with the level of the chilling-responsive polypeptides. Like some other previously described cold-induced proteins in annual plants, the level of the chilling-induced polypeptides also increased in leaves in response to cold treatment; the chilling-induced polypeptides were heat stable, resisting aggregation after incubation at 95 degrees C for 15 min. By fractionating bud proteins first by isoelectric point (pI) and then by molecular mass, the pI values of the 65- and 60-kD polypeptides were found to be 7.5 to 8.0 and the pI value of the 14-kD polypeptide was judged to be 8.5. Purification of the 65- and 60-kD polypeptides, followed by digestion with endoproteinase Lys-C and sequencing of selected fragments, revealed similarities in amino acid composition between the 65- and 60-kD polypeptides and dehydrins. Indeed, antiserum to the lysine-rich consensus sequence EKKGIMDKIKEKLPG of dehydrin proteins cross-reacted to all three of the major chilling-responsive polypeptides of blueberry, identifying these as dehydrins or dehydrin-like proteins. PMID:8016270

Sodium-potassium-activated adenosine triphosphatase of electrophorus electric organ. X. Immunochemical properties of the Lubrol-solubilized enzume and its constituent polypeptides.

PubMed

Jean, D H; Albers, R W; Koval, G J

1975-02-10

Detergent (Lubrol WX)-solubilized sodium-potassium-activated adenosine triphosphatase ((Na+ + K+)-ATPase) of electrophorus electric organ contains two major constituent polypeptides with molecular weights of 96,000 and 58,000 which can be readily demonstrated by sodium dodecyl sulfate polyacrylamide gel electrophoresis. These two polypeptides can be clearly separated and can be obtained in milligram quantities by preparative sodium dodecyl sulfate gel electrophoresis. The separated polypeptides, after removal of sodium dodecyl sulfate, and Lubrol-solubilized (Na+ + K+)-ATPase activity to some degree. Moreover, the degree of inhibition is directly proportional to the increasing amounts of antisera. The inhibition is maximal 4 weeks after the first injection. Immunodiffusion in 1% agar gel indicated that only Lubrol-solubilized enzyme antiserum, but not 58,000-dalton or 96,00-dalton polypeptide antiserum, gives one major precipitin band. However, specific complex formation between each polypeptide antiserum and Lubrol-solubilized enzyme occurs. This was demonstrated indirectly. After incubating Lubrol-solubilized enzyme with increasing amounts of polypeptide antisera at 37 degrees for 15 min, they were placed in the side wells of an immunodiffusion plate with antiserum against Lubrol-solubilized enzyme in the central well. The intensity of the precipitin band decreased with increasing amounts of polypeptide antisera. Thus, the results indicate that both 96,000-dalton and 58,000-dalton polypeptides are integral subunits of (Na+ + K+)-ATPase.

Planet Formation in Binary Star Systems

NASA Astrophysics Data System (ADS)

Martin, Rebecca

About half of observed exoplanets are estimated to be in binary systems. Understanding planet formation and evolution in binaries is therefore essential for explaining observed exoplanet properties. Recently, we discovered that a highly misaligned circumstellar disk in a binary system can undergo global Kozai-Lidov (KL) oscillations of the disk inclination and eccentricity. These oscillations likely have a significant impact on the formation and orbital evolution of planets in binary star systems. Planet formation by core accretion cannot operate during KL oscillations of the disk. First, we propose to consider the process of disk mass transfer between the binary members. Secondly, we will investigate the possibility of planet formation by disk fragmentation. Disk self gravity can weaken or suppress the oscillations during the early disk evolution when the disk mass is relatively high for a narrow range of parameters. Thirdly, we will investigate the evolution of a planet whose orbit is initially aligned with respect to the disk, but misaligned with respect to the orbit of the binary. We will study how these processes relate to observations of star-spin and planet orbit misalignment and to observations of planets that appear to be undergoing KL oscillations. Finally, we will analyze the evolution of misaligned multi-planet systems. This theoretical work will involve a combination of analytic and numerical techniques. The aim of this research is to shed some light on the formation of planets in binary star systems and to contribute to NASA's goal of understanding of the origins of exoplanetary systems.

Polar alignment of a protoplanetary disc around an eccentric binary II: Effect of binary and disc parameters

NASA Astrophysics Data System (ADS)

Martin, Rebecca G.; Lubow, Stephen H.

2018-06-01

In a recent paper Martin & Lubow showed that a circumbinary disc around an eccentric binary can undergo damped nodal oscillations that lead to the polar (perpendicular) alignment of the disc relative to the binary orbit. The disc angular momentum vector aligns to the eccentricity vector of the binary. We explore the robustness of this mechanism for a low mass disc (0.001 of the binary mass) and its dependence on system parameters by means of hydrodynamic disc simulations. We describe how the evolution depends upon the disc viscosity, temperature, size, binary mass ratio, orbital eccentricity and inclination. We compare results with predictions of linear theory. We show that polar alignment of a low mass disc may occur over a wide range of binary-disc parameters. We discuss the application of our results to the formation of planetary systems around eccentric binary stars.

RED GIANTS IN ECLIPSING BINARY AND MULTIPLE-STAR SYSTEMS: MODELING AND ASTEROSEISMIC ANALYSIS OF 70 CANDIDATES FROM KEPLER DATA

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gaulme, P.; McKeever, J.; Rawls, M. L.

2013-04-10

Red giant stars are proving to be an incredible source of information for testing models of stellar evolution, as asteroseismology has opened up a window into their interiors. Such insights are a direct result of the unprecedented data from space missions CoRoT and Kepler as well as recent theoretical advances. Eclipsing binaries are also fundamental astrophysical objects, and when coupled with asteroseismology, binaries provide two independent methods to obtain masses and radii and exciting opportunities to develop highly constrained stellar models. The possibility of discovering pulsating red giants in eclipsing binary systems is therefore an important goal that could potentiallymore » offer very robust characterization of these systems. Until recently, only one case has been discovered with Kepler. We cross-correlate the detected red giant and eclipsing-binary catalogs from Kepler data to find possible candidate systems. Light-curve modeling and mean properties measured from asteroseismology are combined to yield specific measurements of periods, masses, radii, temperatures, eclipse timing variations, core rotation rates, and red giant evolutionary state. After using three different techniques to eliminate false positives, out of the 70 systems common to the red giant and eclipsing-binary catalogs we find 13 strong candidates (12 previously unknown) to be eclipsing binaries, one to be a non-eclipsing binary with tidally induced oscillations, and 10 more to be hierarchical triple systems, all of which include a pulsating red giant. The systems span a range of orbital eccentricities, periods, and spectral types F, G, K, and M for the companion of the red giant. One case even suggests an eclipsing binary composed of two red giant stars and another of a red giant with a {delta}-Scuti star. The discovery of multiple pulsating red giants in eclipsing binaries provides an exciting test bed for precise astrophysical modeling, and follow-up spectroscopic observations of many of the candidate systems are encouraged. The resulting highly constrained stellar parameters will allow, for example, the exploration of how binary tidal interactions affect pulsations when compared to the single-star case.« less

Polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and polynucleotides encoding same

DOE Office of Scientific and Technical Information (OSTI.GOV)

Morant, Marc

The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Extracellular secretion of recombinant proteins

DOEpatents

Linger, Jeffrey G.; Darzins, Aldis

2014-07-22

Nucleic acids encoding secretion signals, expression vectors containing the nucleic acids, and host cells containing the expression vectors are disclosed. Also disclosed are polypeptides that contain the secretion signals and methods of producing polypeptides, including methods of directing the extracellular secretion of the polypeptides. Exemplary embodiments include cellulase proteins fused to secretion signals, methods to produce and isolate these polypeptides, and methods to degrade lignocellulosic biomass.

Cellulolytic enzymes, nucleic acids encoding them and methods for making and using them

DOEpatents

Gray, Kevin A [San Diego, CA; Zhao, Lishan [Emeryville, CA; Cayouette, Michelle H [San Diego, CA

2012-01-24

The invention provides polypeptides having any cellulolytic activity, e.g., a cellulase activity, a endoglucanase, a cellobiohydrolase, a beta-glucosidase, a xylanase, a mannanse, a .beta.-xylosidase, an arabinofuranosidase, and/or an oligomerase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In one aspect, the invention is directed to polypeptides having any cellulolytic activity, e.g., a cellulase activity, e.g., endoglucanase, cellobiohydrolase, beta-glucosidase, xylanase, mannanse, .beta.-xylosidase, arabinofuranosidase, and/or oligomerase activity, including thermostable and thermotolerant activity, and polynucleotides encoding these enzymes, and making and using these polynucleotides and polypeptides. In one aspect, the invention provides polypeptides having an oligomerase activity, e.g., enzymes that convert recalcitrant soluble oligomers to fermentable sugars in the saccharification of biomass. The polypeptides of the invention can be used in a variety of pharmaceutical, agricultural, food and feed processing and industrial contexts. The invention also provides compositions or products of manufacture comprising mixtures of enzymes comprising at least one enzyme of this invention.

Unimpaired postprandial pancreatic polypeptide secretion in Parkinson's disease and REM sleep behavior disorder.

PubMed

Unger, Marcus M; Ekman, Rolf; Björklund, Anna-Karin; Karlsson, Gösta; Andersson, Chatarina; Mankel, Katharina; Bohne, Katharina; Tebbe, Johannes J; Stiasny-Kolster, Karin; Möller, Jens C; Mayer, Geert; Kann, Peter H; Oertel, Wolfgang H

2013-04-01

Pancreatic polypeptide is released immediately after food ingestion. The release is operated by vagal-abdominal projections and has therefore been suggested as a test for vagal nerve integrity. Pathoanatomical and clinical studies indicate vagal dysfunction in early Parkinson's disease (PD). We assessed the postprandial secretion of pancreatic polypeptide and motilin in healthy controls (n = 18) and patients with idiopathic rapid-eye-movement sleep behavior disorder (iRBD, n = 10), a potential premotor stage of PD, as well as in drug-naive (n = 19) and treated (n = 19) PD patients. The postprandial pancreatic polypeptide secretion showed a physiological pattern in all groups and even an enhanced response in drug-naive PD and iRBD. Motilin concentrations correlated with pancreatic polypeptide concentrations. Postprandial pancreatic polypeptide secretion is not a suitable test for vagal nerve integrity in PD. The unimpaired pancreatic polypeptide response in iRBD and PD might be explained by partially intact vagal-abdominal projections or compensatory mechanisms substituting a defective neuronal brain-gut axis. Copyright © 2012 Movement Disorders Society.

A de novo designed 11 kDa polypeptide: model for amyloidogenic intrinsically disordered proteins.

PubMed

Topilina, Natalya I; Ermolenkov, Vladimir V; Sikirzhytski, Vitali; Higashiya, Seiichiro; Lednev, Igor K; Welch, John T

2010-07-01

A de novo polypeptide GH(6)[(GA)(3)GY(GA)(3)GE](8)GAH(6) (YE8) has a significant number of identical weakly interacting beta-strands with the turns and termini functionalized by charged amino acids to control polypeptide folding and aggregation. YE8 exists in a soluble, disordered form at neutral pH but is responsive to changes in pH and ionic strength. The evolution of YE8 secondary structure has been successfully quantified during all stages of polypeptide fibrillation by deep UV resonance Raman (DUVRR) spectroscopy combined with other morphological, structural, spectral, and tinctorial characterization. The YE8 folding kinetics at pH 3.5 are strongly dependent on polypeptide concentration with a lag phase that can be eliminated by seeding with a solution of folded fibrillar YE8. The lag phase of polypeptide folding is concentration dependent leading to the conclusion that beta-sheet folding of the 11-kDa amyloidogenic polypeptide is completely aggregation driven.

Design and preparation of beta-sheet forming repetitive and block-copolymerized polypeptides.

PubMed

Higashiya, Seiichiro; Topilina, Natalya I; Ngo, Silvana C; Zagorevskii, Dmitri; Welch, John T

2007-05-01

The design and rapid construction of libraries of genes coding beta-sheet forming repetitive and block-copolymerized polypeptides bearing various C- and N-terminal sequences are described. The design was based on the assembly of DNA cassettes coding for the (GA)3GX amino acid sequence where the (GAGAGA) sequences would constitute the beta-strand units of a larger beta-sheet assembly. The edges of this beta-sheet would be functionalized by the turn-inducing amino acids (GX). The polypeptides were expressed in Escherichia coli using conventional vectors and were purified by Ni-nitriloacetic acid (NTA) chromatography. The correlation of polymer structure with molecular weight was investigated by gel electrophoresis and mass spectrometry. The monomer sequences and post-translational chemical modifications were found to influence the mobility of the polypeptides over the full range of polypeptide molecular weights while the electrophoretic mobility of lower molecular weight polypeptides was more susceptible to C- and N-termini polypeptide modifications.

From wide to close binaries?

NASA Astrophysics Data System (ADS)

Eggleton, Peter P.

The mechanisms by which the periods of wide binaries (mass 8 solar mass or less and period 10-3000 d) are lengthened or shortened are discussed, synthesizing the results of recent theoretical investigations. A system of nomenclature involving seven evolutionary states, three geometrical states, and 10 types of orbital-period evolution is developed and applied; classifications of 71 binaries are presented in a table along with the basic observational parameters. Evolutionary processes in wide binaries (single-star-type winds, magnetic braking with tidal friction, and companion-reinforced attrition), late case B systems, low-mass X-ray binaries, and triple systems are examined in detail, and possible evolutionary paths are shown in diagrams.

Structural specificity of mucosal-cell transport and metabolism of peptide drugs: implication for oral peptide drug delivery

NASA Technical Reports Server (NTRS)

Bai, J. P.; Amidon, G. L.

1992-01-01

The brush border membrane of intestinal mucosal cells contains a peptide carrier system with rather broad substrate specificity and various endo- and exopeptidase activities. Small peptide (di-/tripeptide)-type drugs with or without an N-terminal alpha-amino group, including beta-lactam antibiotics and angiotensin-converting enzyme (ACE) inhibitors, are transported by the peptide transporter. Polypeptide drugs are hydrolyzed by brush border membrane proteolytic enzymes to di-/tripeptides and amino acids. Therefore, while the intestinal brush border membrane has a carrier system facilitating the absorption of di-/tripeptide drugs, it is a major barrier limiting oral availability of polypeptide drugs. In this paper, the specificity of peptide transport and metabolism in the intestinal brush border membrane is reviewed.

Force field dependent solution properties of glycine oligomers

PubMed Central

Drake, Justin A.

2015-01-01

Molecular simulations can be used to study disordered polypeptide systems and to generate hypotheses on the underlying structural and thermodynamic mechanisms that govern their function. As the number of disordered protein systems investigated with simulations increase, it is important to understand how particular force fields affect the structural properties of disordered polypeptides in solution. To this end, we performed a comparative structural analysis of Gly3 and Gly10 in aqueous solution from all-atom, microsecond MD simulations using the CHARMM 27 (C27), CHARMM 36 (C36), and Amber ff12SB force fields. For each force field, Gly3 and Gly10 were simulated for at least 300 ns and 1 μs, respectively. Simulating oligoglycines of two different lengths allows us to evaluate how force field effects depend on polypeptide length. Using a variety of structural metrics (e.g. end-to-end distance, radius of gyration, dihedral angle distributions), we characterize the distribution of oligoglycine conformers for each force field and show that each sample conformation space differently, yielding considerably different structural tendencies of the same oligoglycine model in solution. Notably, we find that C36 samples more extended oligoglycine structures than both C27 and ff12SB. PMID:25952623

Formation of black hole x-ray binaries in globular clusters

NASA Astrophysics Data System (ADS)

Kremer, Kyle; Chatterjee, Sourav; Rodriguez, Carl; Rasio, Frederic

2018-01-01

We explore the formation of mass-transferring binary systems containing black holes within globular clusters. We show that it is possible to form mass-transferring binaries with main sequence, giant, and white dwarf companions with a variety of orbital parameters in globular clusters spanning a large range in present-day properties. We show that the presence of mass-transferring black hole systems has little correlation with the total number of black holes within the cluster at any time. In addition to mass-transferring binaries retained within their host clusters at late times, we also examine the black hole and neutron star binaries that are ejected from their host clusters. These ejected systems may contribute to the low-mass x-ray binary population in the galactic field.

Polycondensation of Asparagine-comprising Dipeptides in Aqueous Media-A Simulation of Polypeptide Formation in Primordial Earth Hydrosphere

NASA Astrophysics Data System (ADS)

Munegumi, Toratane; Tanikawa, Naoya

2017-09-01

Asparagine and aspartic acid might have mutually transformed in the primordial hydrosphere of the earth, if ammonia and aspartic acid had existed in equilibrium. These amino acids seem to contribute to polypeptides, while the simple amino acids glycine and alanine easily form cyclic dipeptides and do not achieve long peptide chains. Asparagine-comprising dipeptides contribute some kinds of activation forms of dipeptides because these can polymerize faster than asparagine only. The new finding of polypeptide formation suggests a pathway of sequential polypeptides to evolve a diversity of polypeptides.

Polycondensation of Asparagine-comprising Dipeptides in Aqueous Media-A Simulation of Polypeptide Formation in Primordial Earth Hydrosphere.

PubMed

Munegumi, Toratane; Tanikawa, Naoya

2017-09-01

Asparagine and aspartic acid might have mutually transformed in the primordial hydrosphere of the earth, if ammonia and aspartic acid had existed in equilibrium. These amino acids seem to contribute to polypeptides, while the simple amino acids glycine and alanine easily form cyclic dipeptides and do not achieve long peptide chains. Asparagine-comprising dipeptides contribute some kinds of activation forms of dipeptides because these can polymerize faster than asparagine only. The new finding of polypeptide formation suggests a pathway of sequential polypeptides to evolve a diversity of polypeptides.

A Novel Family in Medicago truncatula Consisting of More Than 300 Nodule-Specific Genes Coding for Small, Secreted Polypeptides with Conserved Cysteine Motifs1[w

PubMed Central

Mergaert, Peter; Nikovics, Krisztina; Kelemen, Zsolt; Maunoury, Nicolas; Vaubert, Danièle; Kondorosi, Adam; Kondorosi, Eva

2003-01-01

Transcriptome analysis of Medicago truncatula nodules has led to the discovery of a gene family named NCR (nodule-specific cysteine rich) with more than 300 members. The encoded polypeptides were short (60–90 amino acids), carried a conserved signal peptide, and, except for a conserved cysteine motif, displayed otherwise extensive sequence divergence. Family members were found in pea (Pisum sativum), broad bean (Vicia faba), white clover (Trifolium repens), and Galega orientalis but not in other plants, including other legumes, suggesting that the family might be specific for galegoid legumes forming indeterminate nodules. Gene expression of all family members was restricted to nodules except for two, also expressed in mycorrhizal roots. NCR genes exhibited distinct temporal and spatial expression patterns in nodules and, thus, were coupled to different stages of development. The signal peptide targeted the polypeptides in the secretory pathway, as shown by green fluorescent protein fusions expressed in onion (Allium cepa) epidermal cells. Coregulation of certain NCR genes with genes coding for a potentially secreted calmodulin-like protein and for a signal peptide peptidase suggests a concerted action in nodule development. Potential functions of the NCR polypeptides in cell-to-cell signaling and creation of a defense system are discussed. PMID:12746522

Primary light-harvesting system: phycobilisomes and associated membranes. Progress report, January 1, 1981-December 31, 1981

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gantt, E.

1981-01-01

Phycobilisomes, serving as primary light harvesting complexes in cyanobacteria and red algae, were investigated. Structurally the phycobilisomes of both groups have the same fundamental phycobiliprotein arrangement. Allophycocyanin is in the center near the thylakoid. Stacked rods composed of phycocyanin, or phycocyanin-phycoerythrin radiate peripherally from the allophycocyanin core. Phycobilisomes of Nostoc sp. and Fremyella diplosiphon, after separation into separate allophycocyanin and phycoerythrin-phycocyanin fractions have been associated in vitro. Hybrid phycobilisomes, derived from mixtures of phycobiliprotein from these species were also obtained. The interaction is specific since reassociation was not obtained with phycobiliprotein complexes of some other algae. Phycobilisomes, whether native, ormore » associated in vitro, were similar in their sedimentation, absorption, fluorescence excitation, fluorescence emission, and by electron microscopy. Furthermore, many of the colorless polypeptides were also highly similar between Nostoc and Fremyella. The similarity formed may reflect an evolutionary relationship between the two species. The polypeptide composition of Porphyridium cruentum phycobilisomes is the most complex of any thus far examined. The phycobiliprotein containing polypeptides comprised 84% of the total stainable protein, while the remaining were colorless. Most of the colorless polypeptides occurred in a pelletable fraction, which was enriched in allophycocyanin and phycocyanin, it is probable that some are involved in the linking of these phycobiliproteins.« less

Dielectric properties of grain-grainboundary binary system

NASA Astrophysics Data System (ADS)

Cheng, Peng-Fei; Li, Sheng-Tao; Wang, Hui

2014-09-01

Dielectric properties of grain-grainboundary binary system are analyzed theoretically and compared with unary system and classical Maxwell-Wagner (MW) polarization in binary system. It is found that MW polarization appears at higher frequency compared with intrinsic polarization for grain-grainboundary binary system, which is abnormal compared with classical dielectric theory. This dielectric anomaly is premised on the existence of electronic relaxation at grainboundary. The origin of giant dielectric constant of CaCu3Ti4O12 (CCTO) ceramics is also investigated on the basis of the theoretical results. It is proposed that low frequency relaxation originates from electronic relaxation of oxygen vacancy at depletion layer, while high frequency relaxation comes from MW polarization. The results of this paper offer a quantitative identification of MW polarization from intrinsic polarization at grainboundary and a judgment of the mechanism and location of a certain polarization in grain-grainboundary binary system.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOE Office of Scientific and Technical Information (OSTI.GOV)

Thompson, David N.; Apel, William A.; Thompson, Vicki S.

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.; Henriksen, Emily D.

2015-06-02

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.

2013-10-15

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N [Idaho Falls, ID; Apel, William A [Jackson, WY; Thompson, Vicki S [Idaho Falls, ID; Reed, David W [Idaho Falls, ID; Lacey, Jeffrey A [Idaho Falls, ID; Henriksen, Emily D [Idaho Falls, ID

2012-06-19

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N; Apel, William A; Thompson, Vicki S; Reed, David W; Lacey, Jeffrey A; Henriksen, Emily D

2013-04-23

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.; Henriksen, Emily D.

2010-12-28

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer-degrading genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N; Apel, William A; Thompson, Vicki S; Reed, David W; Lacey, Jeffrey A; Henriksen, Emily D

2013-07-30

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic biopolymer degrading genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOE Office of Scientific and Technical Information (OSTI.GOV)

Thompson, David N; Apel, William A; Thompson, Vicki S

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of at least partially degrading, cleaving, or removing polysaccharides, lignocellulose, cellulose, hemicellulose, lignin, starch, chitin, polyhydroxybutyrate, heteroxylans, glycosides, xylan-, glucan-, galactan-, or mannan-decorating groups using isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius.

WIYN OPEN CLUSTER STUDY. XXXVI. SPECTROSCOPIC BINARY ORBITS IN NGC 188

DOE Office of Scientific and Technical Information (OSTI.GOV)

Geller, Aaron M.; Mathieu, Robert D.; Harris, Hugh C.

2009-04-15

We present 98 spectroscopic binary orbits resulting from our ongoing radial velocity survey of the old (7 Gyr) open cluster NGC 188. All but 13 are high-probability cluster members based on both radial velocity and proper motion membership analyses. Fifteen of these member binaries are double lined. Our stellar sample spans a magnitude range of 10.8 {<=}V{<=} 16.5 (1.14-0.92 M {sub sun}) and extends spatially to 17 pc ({approx}13 core radii). All of our binary orbits have periods ranging from a few days to on the order of 10{sup 3} days, and thus are hard binaries that dynamically power themore » cluster. For each binary, we present the orbital solutions and place constraints on the component masses. Additionally, we discuss a few binaries of note from our sample, identifying a likely blue straggler-blue straggler binary system (7782), a double-lined binary with a secondary star which is underluminous for its mass (5080), two potential eclipsing binaries (4705 and 5762), and two binaries which are likely members of a quadruple system (5015a and 5015b)« less

Modeling the binary circumstellar medium of Type IIb/L/n supernova progenitors

NASA Astrophysics Data System (ADS)

Kolb, Christopher; Blondin, John; Borkowski, Kazik; Reynolds, Stephen

2018-01-01

Circumstellar interaction in close binary systems can produce a highly asymmetric environment, particularly for systems with a mass outflow velocity comparable to the binary orbital speed. This asymmetric circumstellar medium (CSM) becomes visible after a supernova explosion, when SN radiation illuminates the gas and when SN ejecta collide with the CSM. We aim to better understand the development of this asymmetric CSM, particularly for binary systems containing a red supergiant progenitor, and to study its impact on supernova morphology. To achieve this, we model the asymmetric wind and subsequent supernova explosion in full 3D hydrodynamics using the shock-capturing hydro code VH-1 on a spherical yin-yang grid. Wind interaction is computed in a frame co-rotating with the binary system, and gas is accelerated using a radiation pressure-driven wind model where optical depth of the radiative force is dependent on azimuthally-averaged gas density. We present characterization of our asymmetric wind density distribution model by fitting a polar-to-equatorial density contrast function to free parameters such as binary separation distance, primary mass loss rate, and binary mass ratio.

KOI-3278: a self-lensing binary star system.

PubMed

Kruse, Ethan; Agol, Eric

2014-04-18

Over 40% of Sun-like stars are bound in binary or multistar systems. Stellar remnants in edge-on binary systems can gravitationally magnify their companions, as predicted 40 years ago. By using data from the Kepler spacecraft, we report the detection of such a "self-lensing" system, in which a 5-hour pulse of 0.1% amplitude occurs every orbital period. The white dwarf stellar remnant and its Sun-like companion orbit one another every 88.18 days, a long period for a white dwarf-eclipsing binary. By modeling the pulse as gravitational magnification (microlensing) along with Kepler's laws and stellar models, we constrain the mass of the white dwarf to be ~63% of the mass of our Sun. Further study of this system, and any others discovered like it, will help to constrain the physics of white dwarfs and binary star evolution.

Gravitational radiation, inspiraling binaries, and cosmology

NASA Technical Reports Server (NTRS)

Chernoff, David F.; Finn, Lee S.

1993-01-01

We show how to measure cosmological parameters using observations of inspiraling binary neutron star or black hole systems in one or more gravitational wave detectors. To illustrate, we focus on the case of fixed mass binary systems observed in a single Laser Interferometer Gravitational-wave Observatory (LIGO)-like detector. Using realistic detector noise estimates, we characterize the rate of detections as a function of a threshold SNR Rho(0), H0, and the binary 'chirp' mass. For Rho(0) = 8, H0 = 100 km/s/Mpc, and 1.4 solar mass neutron star binaries, the sample has a median redshift of 0.22. Under the same assumptions but independent of H0, a conservative rate density of coalescing binaries implies LIGO will observe about 50/yr binary inspiral events. The precision with which H0 and the deceleration parameter q0 may be determined depends on the number of observed inspirals. For fixed mass binary systems, about 100 observations with Rho(0) = 10 in the LIGO will give H0 to 10 percent in an Einstein-DeSitter cosmology, and 3000 will give q0 to 20 percent. For the conservative rate density of coalescing binaries, 100 detections with Rho(0) = 10 will require about 4 yrs.

A New Orbit for the Eclipsing Binary V577 Oph

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jeffery, Elizabeth J.; Barnes, Thomas G. III; Montemayor, Thomas J.

Pulsating stars in eclipsing binary systems are unique objects for providing constraints on stellar models. To fully leverage the information available from the binary system, full orbital radial velocity curves must be obtained. We report 23 radial velocities for components of the eclipsing binary V577 Oph, whose primary star is a δ Sct variable. The velocities cover a nearly complete orbit and a time base of 20 years. We computed orbital elements for the binary and compared them to the ephemeris computed by Creevey et al. The comparison shows marginally different results. In particular, a change in the systemic velocitymore » by −2 km s{sup −1} is suggested by our results. We compare this systemic velocity difference to that expected due to reflex motion of the binary in response to the third body in the system. The systemic velocity difference is consistent with reflex motion, given our mass determination for the eclipsing binary and the orbital parameters determined by Volkov and Volkova for the three-body orbit. We see no evidence for the third body in our spectra, but we do see strong interstellar Na D lines that are consistent in strength with the direction and expected distance of V577 Oph.« less

Keto-isovalerate decarboxylase enzymes and methods of use thereof

DOEpatents

McElvain, Jessica; O'Keefe, Daniel P.; Paul, Brian James; Payne, Mark S.; Rothman, Steven Cary; He, Hongxian

2016-01-19

Provided herein are polypeptides and polynucleotides encoding such polypeptides which have ketoisovalerate decarboxylase activity. Also provided are recombinant host cells comprising such polypeptides and polynucleotides and methods of use thereof.

Changes in the Polypeptide Patterns of Barley Seedlings Exposed to Jasmonic Acid and Salinity 1

PubMed Central

Maslenkova, Liliana Todorova; Miteva, Tania Simeonova; Popova, Losanka P.

1992-01-01

Soluble and thylakoid membrane proteins of jasmonic acid (JA)-treated and salt-stressed barley (Hordeum vulgare L.) seedlings were investigated using 15% sodium dodecyl sulfate-polyacrylamide slab gel electrophoresis. High JA concentrations induced marked quantitative and qualitative changes in polypeptide profiles concerning mainly the proteins with approximately equal mobility, as in NaCl-stressed plants. The most obvious increase in thylakoid polypeptide band intensity was at 55 to 57 kilodaltons (kD). The relative share of some polypeptides with apparent molecular masses above 66 kD and of polypeptides with lower molecular masses in the region of 20.5 to 15 kD was enhanced. At the same time, one new band at 31 to 31.5 kD was well expressed at 25 and 250 micromolar JA concentrations and became discernible in the 100 micromolar NaCl-treated plants. The intensity of some polypeptides of soluble proteins (molecular masses of 60, 47, 37, 30, and 23.4 kD) increased with increasing JA concentration, whereas the intensities of other polypeptide bands (55, 21.4, and 15 kD) decreased. Enhanced levels of 60-, 47-, 34-, and 30-kD polypeptides and reduced levels of 55- and 15-kD polypeptides were present in NaCl-treated plants. The appearance of one new polypeptide, of 25.1 kD, was observed only in NaCl-treated plants. At 100 millimolar NaCl, an eightfold increase in proline content was observed while at 250 micromolar JA, the proline content was threefold over the control. It is hypothesized that exogenously applied jasmonates act as stress agents. As such, they provoke alterations in the proline content and they can modulate typical stress responses by induction of stress proteins. ImagesFigure 1Figure 4Figure 5 PMID:16668698

Bioresorbable polypeptide-based comb-polymers efficiently improves the stability and pharmacokinetics of proteins in vivo.

PubMed

Turabee, Md Hasan; Thambi, Thavasyappan; Lym, Jae Seung; Lee, Doo Sung

2017-03-28

Stimuli-responsive polypeptides are a promising class of biomaterials due to their tunable physicochemical and biological properties. Herein, a series of novel pH- and thermo-responsive block copolymers based on polypeptides were synthesized by ring-opening polymerization of γ-benzyl-l-glutamate-N-carboxyanhydride in the presence of poly(ethylene glycol)-diamine macroinitiator followed by aminolysis. The resulting polypeptide-based triblock copolymer, poly[(2-(dibutylamino)ethyl-l-glutamate)-co-(γ-benzyl-l-glutamate)]-poly(ethylene glycol)-b-poly[(2-(dibutylamino)ethyl-l-glutamate)-co-(γ-benzyl-l-glutamate)] (PNLG-co-PBLG-b-PEG-b-PBLG-co-PNLG), exists as a low viscous sol at low pH and temperature (≤pH 6.4, 25 °C) but it transforms to a soft gel under physiological conditions (pH 7.4 and 37 °C). The physical properties of the polypeptide gel can be tuned by controlling the ratio between hydrophobic PBLG and pH-sensitive PNLG blocks. The polypeptide-based copolymer did not show any noticeable cytotoxicity to fibroblast cells in vitro. It was found that subcutaneous injection of the polypeptide copolymer solution into the dorsal region of Sprague-Dawley (SD) rats formed a gel instantly without major inflammation. The gels were completely biodegraded in six weeks and found to be bioresorbable. Human growth hormone (hGH)-loaded polypeptide-based biodegradable copolymer sols readily formed a viscoelastic gel that inhibited an initial burst and prolonged the hGH release for one week. Overall, due to their bioresorbable and sustained release protein characteristics, polypeptide hydrogels may serve as viable platforms for therapeutic protein delivery and the surface tunable properties of polypeptide hydrogels can be exploited for other potential therapeutic proteins.

Doubled-lined eclipsing binary system KIC~2306740 with pulsating component discovered from Kepler space photometry

NASA Astrophysics Data System (ADS)

Yakut, Kadri

2015-08-01

We present a detailed study of KIC 2306740, an eccentric double-lined eclipsing binary system with a pulsating component.Archive Kepler satellite data were combined with newly obtained spectroscopic data with 4.2\\,m William Herschel Telescope(WHT). This allowed us to determine rather precise orbital and physical parameters of this long period, slightly eccentric, pulsating binary system. Duplicity effects are extracted from the light curve in order to estimate pulsation frequencies from the residuals.We modelled the detached binary system assuming non-conservative evolution models with the Cambridge STARS(TWIN) code.

Formation of wide binaries by turbulent fragmentation

NASA Astrophysics Data System (ADS)

Lee, Jeong-Eun; Lee, Seokho; Dunham, Michael M.; Tatematsu, Ken'ichi; Choi, Minho; Bergin, Edwin A.; Evans, Neal J.

2017-08-01

Understanding the formation of wide-binary systems of very low-mass stars (M ≤ 0.1 solar masses, M⊙) is challenging 1,2,3 . The most obvious route is through widely separated low-mass collapsing fragments produced by turbulent fragmentation of a molecular core4,5. However, close binaries or multiples from disk fragmentation can also evolve to wide binaries over a few initial crossing times of the stellar cluster through tidal evolution6. Finding an isolated low-mass wide-binary system in the earliest stage of formation, before tidal evolution could occur, would prove that turbulent fragmentation is a viable mechanism for (very) low-mass wide binaries. Here we report high-resolution ALMA observations of a known wide-separation protostellar binary, showing that each component has a circumstellar disk. The system is too young7 to have evolved from a close binary, and the disk axes are misaligned, providing strong support for the turbulent fragmentation model. Masses of both stars are derived from the Keplerian rotation of the disks; both are very low-mass stars.

Anisotropic distribution of orbit poles of binary asteroids

NASA Astrophysics Data System (ADS)

Pravec, P.; Scheirich, P.; Vokrouhlický, D.; Harris, A. W.; Kusnirak, P.; Hornoch, K.; Pray, D. P.; Higgins, D.; Galád, A.; Világi, J.; Gajdos, S.; Kornos, L.; Oey, J.; Husárik, M.; Cooney, W. R.; Gross, J.; Terrell, D.; Durkee, R.; Pollock, J.; Reichart, D.; Ivarsen, K.; Haislip, J.; Lacluyze, A.; Krugly, Y. N.; Gaftonyuk, N.; Dyvig, R.; Reddy, V.; Stephens, R. D.; Chiorny, V.; Vaduvescu, O.; Longa, P.; Tudorica, A.; Warner, B. D.; Masi, G.; Brinsfield, J.; Gonçalves, R.; Brown, P.; Krzeminski, Z.; Gerashchenko, O.; Marchis, F.

2011-10-01

Our photometric observations of 18 mainbelt binary systems in more than one apparition revealed a strikingly high number of 15 having positively re-observed mutual events in the return apparitions. Our simulations of the survey showed that the data strongly suggest that poles of mutual orbits between components of binary asteroids are not distributed randomly: The null hypothesis of the isotropic distribution of orbit poles is rejected at a confidence level greater than 99.99%. Binary orbit poles concentrate at high ecliptic latitudes, within 30° of the poles of the ecliptic. We propose that the binary orbit poles oriented preferentially up/down-right are due to formation of small binary systems by rotational fission of critically spinning parent bodies with poles near the YORP asymptotic states with obliquities near 0 and 180°. An alternative process of elimination of binaries with poles closer to the ecliptic by the Kozai dynamics of gravitational perturbations from the sun does not explain the observed orbit pole concentration as in the close asteroid binary systems the J2 perturbation due to the primary dominates the solar-tide effect.

A comparative study using WHO and binary oral epithelial dysplasia grading systems in actinic cheilitis.

PubMed

Câmara, P R; Dutra, S N; Takahama Júnior, A; Fontes, Kbfc; Azevedo, R S

2016-09-01

To evaluate comparatively the influence of histopathological features on epithelial dysplasia (ED) and the effectiveness in usage of WHO and binary grading systems in actinic cheilitis (AC). Cytological and architectural alterations established by WHO for ED were evaluated in 107 cases of AC. Epithelial dysplasia was graded using WHO and binary systems. The comparisons were performed using kappa, chi-square, and phi coefficient tests (P < 0.05). Most cases were classified as mild ED (44.5%) in the WHO system and as low risk for malignant transformation (64.5%) in the binary system. There was a positive correlation between WHO and binary systems (k = 0.33; P < 0.0002). Loss of basal cell polarity (P < 0.001) was associated with severity of ED grade in the WHO system. Anisonucleosis (P < 0.0001), nuclear pleomorphism (P < 0.0001), anisocytosis (P = 0.03), cell pleomorphism (P = 0.002) increased nuclear/cytoplasm ratio (P < 0.0001), increased nuclear size (P < 0.0001), increased number of mitotic figures (P = 0.0006), and dyskeratosis (P = 0.008) were associated with severity of ED grade in the binary system. It seems that usage of binary ED grading system in AC may be more precise because there is correlation between many of cytological and some of architectural microscopic alterations with increased grade of ED. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Terrestrial Planet Formation Around Close Binary Stars

NASA Technical Reports Server (NTRS)

Lissauer, Jack J.; Quintana, Elisa V.

2003-01-01

Most stars reside in multiple star systems; however, virtually all models of planetary growth have assumed an isolated single star. Numerical simulations of the collapse of molecular cloud cores to form binary stars suggest that disks will form within such systems. Observations indirectly suggest disk material around one or both components within young binary star systems. If planets form at the right places within such circumstellar disks, they can remain in stable orbits within the binary star systems for eons. We are simulating the late stages of growth of terrestrial planets around close binary stars, using a new, ultrafast, symplectic integrator that we have developed for this purpose. The sum of the masses of the two stars is one solar mass, and the initial disk of planetary embryos is the same as that used for simulating the late stages of terrestrial planet growth within our Solar System and in the Alpha Centauri wide binary star system. Giant planets &are included in the simulations, as they are in most simulations of the late stages of terrestrial planet accumulation in our Solar System. When the stars travel on a circular orbit with semimajor axis of up to 0.1 AU about their mutual center of mass, the planetary embryos grow into a system of terrestrial planets that is statistically identical to those formed about single stars, but a larger semimajor axis and/or a significantly eccentric binary orbit can lead to significantly more dynamically hot terrestrial planet systems.

SHAPING THE BROWN DWARF DESERT: PREDICTING THE PRIMORDIAL BROWN DWARF BINARY DISTRIBUTIONS FROM TURBULENT FRAGMENTATION

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jumper, Peter H.; Fisher, Robert T., E-mail: robert.fisher@umassd.edu

2013-05-20

The formation of brown dwarfs (BDs) poses a key challenge to star formation theory. The observed dearth of nearby ({<=}5 AU) BD companions to solar mass stars, known as the BD desert, as well as the tendency for low-mass binary systems to be more tightly bound than stellar binaries, has been cited as evidence for distinct formation mechanisms for BDs and stars. In this paper, we explore the implications of the minimal hypothesis that BDs in binary systems originate via the same fundamental fragmentation mechanism as stars, within isolated, turbulent giant molecular cloud cores. We demonstrate analytically that the scalingmore » of specific angular momentum with turbulent core mass naturally gives rise to the BD desert, as well as wide BD binary systems. Further, we show that the turbulent core fragmentation model also naturally predicts that very low mass binary and BD/BD systems are more tightly bound than stellar systems. In addition, in order to capture the stochastic variation intrinsic to turbulence, we generate 10{sup 4} model turbulent cores with synthetic turbulent velocity fields to show that the turbulent fragmentation model accommodates a small fraction of binary BDs with wide separations, similar to observations. Indeed, the picture which emerges from the turbulent fragmentation model is that a single fragmentation mechanism may largely shape both stellar and BD binary distributions during formation.« less

Versatile platform for nanotechnology based on circular permutations of chaperonin protein

NASA Technical Reports Server (NTRS)

McMillan, R. Andrew (Inventor); Kagawa, Hiromi (Inventor); Paavola, Chad D. (Inventor); Chan, Suzanne L. (Inventor); Li, Yi-Fen (Inventor); Trent, Jonathan D. (Inventor)

2010-01-01

The present invention provides chaperonin polypeptides which are modified to include N-terminal and C-terminal ends that are relocated from the central pore region to various different positions in the polypeptide which are located on the exterior of the folded modified chaperonin polypeptide. In the modified chaperonin polypeptide, the naturally-occurring N-terminal and C-terminal ends are joined together directly or with an intervening linker peptide sequence. The relocated N-terminal or C-terminal ends can be covalently joined to, or bound with another molecule such as a nucleic acid molecule, a lipid, a carbohydrate, a second polypeptide, or a nanoparticle. The modified chaperonin polypeptides can assemble into double-ringed chaperonin structures. Further, the chaperonin structures can organize into higher order structures such as nanofilaments or nanoarrays which can be used to produce nanodevices and nanocoatings.

Are Binary Separations related to their System Mass?

NASA Astrophysics Data System (ADS)

Sterzik, M. F.; Durisen, R. H.

2004-08-01

We compile most recent multiplicity fractions and binary separation distributions for different primary masses, including very low-mass and brown dwarf primaries, and compare them with dynamical decay models of small-N clusters. The model predictions are based on detailed numerical calculations of the internal cluster dynamics, as well as on Monte-Carlo methods. Both observations and models reflect the same trends: (1) The multiplicity fraction is an increasing function of the primary mass. (2) The mean binary separations are increasing with the system mass in the sense that very low-mass binaries have average separations around ≈ 4AU, while the binary separation distribution for solar-type primaries peaks at ≈ 40AU. M-type binary systems apparently preferentially populate intermediate separations. Similar specific energy at the time of cluster formation for all cluster masses can possibly explain this trend.

Stochastic Gravitational-Wave Background due to Primordial Binary Black Hole Mergers.

PubMed

Mandic, Vuk; Bird, Simeon; Cholis, Ilias

2016-11-11

Recent Advanced LIGO detections of binary black hole mergers have prompted multiple studies investigating the possibility that the heavy GW150914 binary system was of primordial origin, and hence could be evidence for dark matter in the form of black holes. We compute the stochastic background arising from the incoherent superposition of such primordial binary black hole systems in the Universe and compare it to the similar background spectrum due to binary black hole systems of stellar origin. We investigate the possibility of detecting this background with future gravitational-wave detectors, and conclude that constraining the dark matter component in the form of black holes using stochastic gravitational-wave background measurements will be very challenging.

The influence of the side-chain sequence on the structure-activity correlations of immunomodulatory branched polypeptides. Synthesis and conformational analysis of new model polypeptides.

PubMed

Mezö, G; Hudecz, F; Kajtár, J; Szókán, G; Szekerke, M

1989-10-01

New branched polypeptides were synthesized for a detailed study of the influence of the side-chain structure on the conformation and biological properties. The first subset of polypeptides were prepared by coupling of tetrapeptides to poly[L-Lys]. These polymers contain either DL-Ala3-X [poly[Lys-(X-DL-Ala3)n

Use of linalool synthase in genetic engineering of scent production

DOEpatents

Pichersky, E.

1998-12-15

A purified S-linalool synthase polypeptide from Clarkia breweri is disclosed as is the recombinant polypeptide and nucleic acid sequences encoding the polypeptide. Also disclosed are antibodies immunoreactive with the purified peptide and with recombinant versions of the polypeptide. Methods of using the nucleic acid sequences, as well as methods of enhancing the smell and the flavor of plants expressing the nucleic acid sequences are also disclosed. 5 figs.

Use of linalool synthase in genetic engineering of scent production

DOEpatents

Pichersky, Eran

1998-01-01

A purified S-linalool synthase polypeptide from Clarkia breweri is disclosed as is the recombinant polypeptide and nucleic acid sequences encoding the polypeptide. Also disclosed are antibodies immunoreactive with the purified peptide and with recombinant versions of the polypeptide. Methods of using the nucleic acid sequences, as well as methods of enhancing the smell and the flavor of plants expressing the nucleic acid sequences are also disclosed.

Pituitary adenylate cyclase activating polypeptide reduces A-type K+ currents and caspase activity in cultured adult mouse olfactory neurons.

PubMed

Han, P; Lucero, M T

2005-01-01

Pituitary adenylate cyclase activating polypeptide has been shown to reduce apoptosis in neonatal cerebellar and olfactory receptor neurons, however the underlying mechanisms have not been elucidated. In addition, the neuroprotective effects of pituitary adenylate cyclase activating polypeptide have not been examined in adult tissues. To study the effects of pituitary adenylate cyclase activating polypeptide on neurons in apoptosis, we measured caspase activation in adult olfactory receptor neurons in vitro. Interestingly, we found that the protective effects of pituitary adenylate cyclase activating polypeptide were related to the absence of a 4-aminopyridine (IC50=144 microM) sensitive rapidly inactivating potassium current often referred to as A-type current. In the presence of 40 nM pituitary adenylate cyclase activating polypeptide 38, both A-type current and activated caspases were significantly reduced. A-type current reduction by pituitary adenylate cyclase activating polypeptide was blocked by inhibiting the phospholipase C pathway, but not the adenylyl cyclase pathway. Our observation that 5 mM 4-aminopyridine mimicked the caspase inhibiting effects of pituitary adenylate cyclase activating polypeptide indicates that A-type current is involved in apoptosis. This work contributes to our growing understanding that potassium currents are involved with the activation of caspases to affect the balance between cell life and death.

Eukaryotic polypeptide elongation system and its sensitivity to the inhibitory substances of plant origin.

PubMed

Gałasiński, W

1996-05-01

The structural and functional characteristics of the elongation system (ribosomes and elongation factors) are presented. The immunochemical and diagnostic meaning of the ribosome investigations is considered. Evidence of the participation of ribosomes in the first step of protein glycosylation is presented. The heterogeneous elongation factor eEF-1, isolated from Guerin epithelioma, can be separated into three fractions: one of them functionally corresponds to EF-1 alpha, the second on to EF-1 beta gamma, and the third is an unidentified, active aggregate named EF-1B, which contains the subunit forms EF-1 alpha and EF-1 beta gamma, and other polypeptides showing protein kinase activity. The aggregate EF-1B can be autophosphorylated, while the subunit forms EF-1 alpha and EF-1 beta gamma can neither become autophosphorylated nor phosphorylate other polypeptides. The subunit form EF-beta gamma consists from two polypeptides of 32 and 51 kDa, corresponding to other eukaryotic beta and gamma polypeptides, respectively. EF-1 beta gamma is thermostable and protects against thermal inactivation of EF-1 alpha in the EF-1 alpha-EF-1 beta gamma complex. Pure eEF-2 preparations isolated from normal and neoplastic tissues show different structural features. The existence of eEF-2 in multiple forms, differing in molecular mass, have been found. The eEF-2 with molecular weight of about 100 kDa can be phosphorylated, while eEF-2 of about 65 kDa was not phosphorylated by protein kinase eEF-2. The phosphorylated eEF-2 lost its activity, and this effect was reversed by dephosphorylation. The eEF-2 (65 kDa) was isolated from the active polyribosomes, and it may directly participate in the translocation step of the peptide elongation. It was noted that the components of elongation system can be inhibited, in separate steps, by the substances isolated from various sources of plant origin. Alkaloids emetine and cepheline, cardiac remedy digoxin, saponin glycoside, and its aglycon directly inactivated ribosomes. Quercetin inhibited eEF-1 activity by directly influencing its subunit form EF-1 alpha. eEF-2 was shown to be a target site of the inhibitory action of the glycoside isolated from Melissa officinalis leaves.

Planetary nebula progenitors that swallow binary systems

NASA Astrophysics Data System (ADS)

Soker, Noam

2016-01-01

I propose that some irregular messy planetary nebulae (PNe) owe their morphologies to triple-stellar evolution where tight binary systems evolve inside and/or on the outskirts of the envelope of asymptotic giant branch (AGB) stars. In some cases, the tight binary system can survive, in others, it is destroyed. The tight binary system might break up with one star leaving the system. In an alternative evolution, one of the stars of the broken-up tight binary system falls towards the AGB envelope with low specific angular momentum, and drowns in the envelope. In a different type of destruction process, the drag inside the AGB envelope causes the tight binary system to merge. This releases gravitational energy within the AGB envelope, leading to a very asymmetrical envelope ejection, with an irregular and messy PN as a descendant. The evolution of the triple-stellar system can be in a full common envelope evolution or in a grazing envelope evolution. Both before and after destruction (if destruction takes place), the system might launch pairs of opposite jets. One pronounced signature of triple-stellar evolution might be a large departure from axisymmetrical morphology of the descendant PN. I estimate that about one in eight non-spherical PNe is shaped by one of these triple-stellar evolutionary routes.

Late type close binary system CM Dra

NASA Astrophysics Data System (ADS)

Kalomeni, Belinda

2015-08-01

In this study, we present new observations of the close binary system CM Dra. We analyzed all the available data of the system and estimated the physical parameters of the system stars highly accurately. Using the newly obtained parameters the distance of the system is determined to be 11.6 pc. A possible giant planet orbiting the close binary system has been detected. This orbital period would likely make it one of the longest known orbital period planet.

Self-organization in a system of binary strings with spatial interactions

NASA Astrophysics Data System (ADS)

Banzhaf, W.; Dittrich, P.; Eller, B.

1999-01-01

We consider an artificial reaction system whose components are binary strings. Upon encounter, two binary strings produce a third string which competes for storage space with the originators. String types or species can only survive when produced in sufficient numbers. Spatial interactions through introduction of a topology and rules for distance-dependent reactions are discussed. We observe various kinds of survival strategies of binary strings.

The formation of high-mass binary star systems

NASA Astrophysics Data System (ADS)

Lund, Kristin; Bonnell, Ian A.

2018-06-01

We develop a semi-analytic model to investigate how accretion onto wide low-mass binary stars can result in a close high-mass binary system. The key ingredient is to allow mass accretion while limiting the gain in angular momentum. We envision this process as being regulated by an external magnetic field during infall. Molecular clouds are made to collapse spherically with material either accreting onto the stars or settling in a disk. Our aim is to determine what initial conditions are needed for the resulting binary to be both massive and close. Whether material accretes, and what happens to the binary separation as a result, depends on the relative size of its specific angular momentum, compared to the specific angular momentum of the binary. When we add a magnetic field we are introducing a torque to the system which is capable of stripping the molecular cloud of some of its angular momentum, and consequently easing the formation of high-mass binaries. Our results suggest that clouds in excess of 1000 M⊙ and radii of 0.5 pc or larger, can easily form binary systems with masses in excess of 25 M⊙ and separations of order 10 R⊙ with magnetic fields of order 100 μG (mass-to-flux ratios of order 5).

Novozymes, Inc.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Spodsberg, Nikolaj

The present invention relates to isolated polypeptides having endoglucanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Ketol-acid reductoisomerase enzymes and methods of use

DOEpatents

Govindarajan, Sridhar; Li, Yougen; Liao, Der-Ing; O'Keefe, Daniel P.; Minshull, Jeremy Stephen; Rothman, Steven Cary; Tobias, Alexander Vincent

2015-10-27

Provided herein are polypeptides having ketol-aid reductoisomerase activity as well as microbial host cells comprising such polypeptides. Polypeptides provided herein may be used in biosynthetic pathways, including, but not limited to, isobutanol biosynthetic pathways.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang, Yu; Tang, Lan; Henriksen, Svend Hostgaard Bang

The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.

Building an Unusual White-Dwarf Duo

NASA Astrophysics Data System (ADS)

Kohler, Susanna

2016-09-01

A new study has examined how the puzzling wide binary system HS 2220+2146 which consists of two white dwarfs orbiting each other might have formed. This system may be an example of a new evolutionary pathway for wide white-dwarf binaries.Evolution of a BinaryMore than 100 stellar systems have been discovered consisting of two white dwarfs in a wide orbit around each other. How do these binaries form? In the traditional picture, the system begins as a binary consisting of two main-sequence stars. Due to the large separation between the stars, the stars evolve independently, each passing through the main-sequence and giant branches and ending their lives as white dwarfs.An illustration of a hierarchical triple star system, in which two stars orbit each other, and a third star orbits the pair. [NASA/JPL-Caltech]Because more massive stars evolve more quickly, the most massive of the two stars in a binary pair should be the first to evolve into a white dwarf. Consequently, when we observe a double-white-dwarf binary, its usually a safe bet that the more massive of the two white dwarfs will also be the older and cooler of the pair, since it should have formed first.But in the case of the double-white-dwarf binary HS 2220+2146, the opposite is true: the more massive of the two white dwarfs appears to be the younger and hotter of the pair. If it wasnt created in the traditional way, then how did this system form?Two From Three?Led by Jeff Andrews (Foundation for Research and Technology-Hellas, Greece and Columbia University), a team of scientists recently examined this system more carefully, analyzing its spectra to confirm our understanding of the white dwarfs temperatures and masses.Based on their observations, Andrews and collaborators determined that there are no hidden additional companions that could have caused the unusual evolution of this system. Instead, the team proposed that this unusual binary might be an example of an evolutionary channel that involves three stars.The authors proposed formation scenario for H220+2146. In this picture, the inner binary merges to form a blue straggler. This star and the remaining main-sequence star then evolve independently into white dwarfs, forming the system observed today. [Andrews et al. 2016]An Early MergerIn the model the authors propose for HS 2220+2146, the binary system began as a hierarchical triple system of main-sequence stars. The innermost binary then merged to form a large star known as a blue straggler a star that, due to the merger, will evolve more slowly than its larger mass implies it should.The blue straggler and the remaining main-sequence star, still in a wide orbit, then continued to evolve independently of each other. The smaller star ended its main-sequence lifetime and became a white dwarf first, followed by the more massive but slowly evolving blue straggler thus forming the system we observe today.If the authors model is correct, then HS 2220+2146 would be the first binary double white dwarf known to have formed through this channel. ESAs Gaia mission, currently underway, is expected to discover up to a million new white dwarfs, many of which will likely be in wide binary systems. Among these, we may well find many other systems like HS 2220+2146 that formed in the same way.CitationJeff J. Andrews et al 2016 ApJ 828 38. doi:10.3847/0004-637X/828/1/38

A 115 kDa calmodulin-binding protein is located in rat liver endosome fractions.

PubMed Central

Enrich, C; Bachs, O; Evans, W H

1988-01-01

The distribution of calmodulin-binding polypeptides in various rat liver subcellular fractions was investigated. Plasma-membrane, endosome, Golgi and lysosome fractions were prepared by established procedures. The calmodulin-binding polypeptides present in the subcellular fractions were identified by using an overlay technique after transfer from gels to nitrocellulose sheets. Distinctive populations of calmodulin-binding polypeptides were present in all the fractions examined except lysosomes. A major 115 kDa calmodulin-binding polypeptide of pI 4.3 was located to the endosome subfractions, and it emerges as a candidate endosome-specific protein. Partitioning of endosome fractions between aqueous and Triton X-114 phases indicated that the calmodulin-binding polypeptide was hydrophobic. Major calmodulin-binding polypeptides of 140 and 240 kDa and minor polypeptides of 40-60 kDa were present in plasma membranes. The distribution of calmodulin in the various endosome and plasma-membrane fractions was also analysed, and the results indicated that the amounts were high compared with those in the cytosol. Images Fig. 1. Fig. 2. Fig. 3. Fig. 4. Fig. 5. PMID:3214436

Stability of binaries. Part 1: Rigid binaries

NASA Astrophysics Data System (ADS)

Sharma, Ishan

2015-09-01

We consider the stability of binary asteroids whose members are possibly granular aggregates held together by self-gravity alone. A binary is said to be stable whenever each member is orbitally and structurally stable to both orbital and structural perturbations. To this end, we extend the stability test for rotating granular aggregates introduced by Sharma (Sharma, I. [2012]. J. Fluid Mech., 708, 71-99; Sharma, I. [2013]. Icarus, 223, 367-382; Sharma, I. [2014]. Icarus, 229, 278-294) to the case of binary systems comprised of rubble members. In part I, we specialize to the case of a binary with rigid members subjected to full three-dimensional perturbations. Finally, we employ the stability test to critically appraise shape models of four suspected binary systems, viz., 216 Kleopatra, 25143 Itokawa, 624 Hektor and 90 Antiope.

White dwarf-main sequence binaries from LAMOST: the DR5 catalogue

NASA Astrophysics Data System (ADS)

Ren, J.-J.; Rebassa-Mansergas, A.; Parsons, S. G.; Liu, X.-W.; Luo, A.-L.; Kong, X.; Zhang, H.-T.

2018-07-01

We present the data release (DR) 5 catalogue of white dwarf-main sequence (WDMS) binaries from the Large sky Area Multi-Object fibre Spectroscopic Telescope (LAMOST). The catalogue contains 876 WDMS binaries, of which 757 are additions to our previous LAMOST DR1 sample and 357 are systems that have not been published before. We also describe a LAMOST-dedicated survey that aims at obtaining spectra of photometrically selected WDMS binaries from the Sloan Digital Sky Survey (SDSS) that are expected to contain cool white dwarfs and/or early-type M dwarf companions. This is a population under-represented in previous SDSS WDMS binary catalogues. We determine the stellar parameters (white dwarf effective temperatures, surface gravities and masses, and M dwarf spectral types) of the LAMOST DR5 WDMS binaries and make use of the parameter distributions to analyse the properties of the sample. We find that, despite our efforts, systems containing cool white dwarfs remain under-represented. Moreover, we make use of LAMOST DR5 and SDSS DR14 (when available) spectra to measure the Na I λλ 8183.27, 8194.81 absorption doublet and/or Hα emission radial velocities of our systems. This allows identifying 128 binaries displaying significant radial velocity variations, 76 of which are new. Finally, we cross-match our catalogue with the Catalina Surveys and identify 57 systems displaying light-curve variations. These include 16 eclipsing systems, two of which are new, and nine binaries that are new eclipsing candidates. We calculate periodograms from the photometric data and measure (estimate) the orbital periods of 30 (15) WDMS binaries.

Flare Activity of Wide Binary Stars with Kepler

NASA Astrophysics Data System (ADS)

Clarke, Riley W.; Davenport, James R. A.; Covey, Kevin R.; Baranec, Christoph

2018-01-01

We present an analysis of flare activity in wide binary stars using a combination of value-added data sets from the NASA Kepler mission. The target list contains a set of previously discovered wide binary star systems identified by proper motions in the Kepler field. We cross-matched these systems with estimates of flare activity for ∼200,000 stars in the Kepler field, allowing us to compare relative flare luminosity between stars in coeval binaries. From a sample of 184 previously known wide binaries in the Kepler field, we find 58 with detectable flare activity in at least 1 component, 33 of which are similar in mass (q > 0.8). Of these 33 equal-mass binaries, the majority display similar (±1 dex) flare luminosity between both stars, as expected for stars of equal mass and age. However, we find two equal-mass pairs where the secondary (lower mass) star is more active than its counterpart, and two equal-mass pairs where the primary star is more active. The stellar rotation periods are also anomalously fast for stars with elevated flare activity. Pairs with discrepant rotation and activity qualitatively seem to have lower mass ratios. These outliers may be due to tidal spin-up, indicating these wide binaries could be hierarchical triple systems. We additionally present high-resolution adaptive optics images for two wide binary systems to test this hypothesis. The demographics of stellar rotation and magnetic activity between stars in wide binaries may be useful indicators for discerning the formation scenarios of these systems.

White dwarf-main sequence binaries from LAMOST: the DR5 catalogue

NASA Astrophysics Data System (ADS)

Ren, J.-J.; Rebassa-Mansergas, A.; Parsons, S. G.; Liu, X.-W.; Luo, A.-L.; Kong, X.; Zhang, H.-T.

2018-03-01

We present the data release (DR) 5 catalogue of white dwarf-main sequence (WDMS) binaries from the Large Area Multi-Object fiber Spectroscopic Telescope (LAMOST). The catalogue contains 876 WDMS binaries, of which 757 are additions to our previous LAMOST DR1 sample and 357 are systems that have not been published before. We also describe a LAMOST-dedicated survey that aims at obtaining spectra of photometrically-selected WDMS binaries from the Sloan Digital Sky Survey (SDSS) that are expected to contain cool white dwarfs and/or early type M dwarf companions. This is a population under-represented in previous SDSS WDMS binary catalogues. We determine the stellar parameters (white dwarf effective temperatures, surface gravities and masses, and M dwarf spectral types) of the LAMOST DR5 WDMS binaries and make use of the parameter distributions to analyse the properties of the sample. We find that, despite our efforts, systems containing cool white dwarfs remain under-represented. Moreover, we make use of LAMOST DR5 and SDSS DR14 (when available) spectra to measure the Na I λλ 8183.27, 8194.81 absorption doublet and/or Hα emission radial velocities of our systems. This allows identifying 128 binaries displaying significant radial velocity variations, 76 of which are new. Finally, we cross-match our catalogue with the Catalina Surveys and identify 57 systems displaying light curve variations. These include 16 eclipsing systems, two of which are new, and nine binaries that are new eclipsing candidates. We calculate periodograms from the photometric data and measure (estimate) the orbital periods of 30 (15) WDMS binaries.

Formation of close binary black holes merging due to gravitational-wave radiation

NASA Astrophysics Data System (ADS)

Tutukov, A. V.; Cherepashchuk, A. M.

2017-10-01

The conditions for the formation of close-binary black-hole systems merging over the Hubble time due to gravitational-wave radiation are considered in the framework of current ideas about the evolution of massive close-binary systems. The original systems whose mergers were detected by LIGO consisted of main-sequence stars with masses of 30-100 M ⊙. The preservation of the compactness of a binary black hole during the evolution of its components requires either the formation of a common envelope, probably also with a low initial abundance of metals, or the presence of a "kick"—a velocity obtained during a supernova explosion accompanied by the formation of a black hole. In principle, such a kick can explain the relatively low frequency of mergers of the components of close-binary stellar black holes, if the characteristic speed of the kick exceeds the orbital velocities of the system components during the supernova explosion. Another opportunity for the components of close-binary systems to approach each other is related to their possible motion in a dense molecular cloud.

Formation of S-type planets in close binaries: scattering induced tidal capture of circumbinary planets

NASA Astrophysics Data System (ADS)

Gong, Yan-Xiang; Ji, Jianghui

2018-05-01

Although several S-type and P-type planets in binary systems were discovered in past years, S-type planets have not yet been found in close binaries with an orbital separation not more than 5 au. Recent studies suggest that S-type planets in close binaries may be detected through high-accuracy observations. However, nowadays planet formation theories imply that it is difficult for S-type planets in close binaries systems to form in situ. In this work, we extensively perform numerical simulations to explore scenarios of planet-planet scattering among circumbinary planets and subsequent tidal capture in various binary configurations, to examine whether the mechanism can play a part in producing such kind of planets. Our results show that this mechanism is robust. The maximum capture probability is ˜10%, which can be comparable to the tidal capture probability of hot Jupiters in single star systems. The capture probability is related to binary configurations, where a smaller eccentricity or a low mass ratio of the binary will lead to a larger probability of capture, and vice versa. Furthermore, we find that S-type planets with retrograde orbits can be naturally produced via capture process. These planets on retrograde orbits can help us distinguish in situ formation and post-capture origin for S-type planet in close binaries systems. The forthcoming missions (PLATO) will provide the opportunity and feasibility to detect such planets. Our work provides several suggestions for selecting target binaries in search for S-type planets in the near future.

Binary Lenses in OGLE-III EWS Database. Seasons 2002-2003

NASA Astrophysics Data System (ADS)

Jaroszynski, M.; Udalski, A.; Kubiak, M.; Szymanski, M.; Pietrzynski, G.; Soszynski, I.; Zebrun, K.; Szewczyk, O.; Wyrzykowski, L.

2004-06-01

We present 15 binary lens candidates from OGLE-III Early Warning System database for seasons 2002-2003. We also found 15 events interpreted as single mass lensing of double sources. The candidates were selected by visual light curves inspection. Examining the models of binary lenses of this and our previous study (10 caustic crossing events of OGLE-II seasons 1997--1999) we find one case of extreme mass ratio binary (q approx 0.005) and the rest in the range 0.1

Human pancreatic polypeptide in children and young adults.

PubMed

Hanukoglu, A; Chalew, S; Kowarski, A A

1990-01-01

Measurement of human pancreatic polypeptide may be useful for assessment of gastrointestinal function, integrity of the parasympathetic nervous system or screening for endocrine neoplasia. In adults hPP levels have been reported to increase with age. However hPP levels throughout childhood have not been well characterized in comparison with the adult range. We studied fasting human pancreatic polypeptide (hPP) from 45 pediatric patients, from infancy - 15 years, and 18 older adolescents and adults aged 16-45 years. The mean hPP level of children (233 +/- 147 pg/ml) was significantly higher than that (113 +/- 35 pg/ml) of adults (P less than .0001). There was no difference in mean hPP levels of children with normal growth hormone secretion compared to growth hormone deficient patients. There was no effect of gender or body mass index on hPP levels. We conclude that fasting hPP levels must be interpreted with respect to the age of the subject, children particularly, in that preteens may have higher fasting levels than older teenagers and adults.

The use of phage display in neurobiology.

PubMed

Bradbury, Andrew R M

2010-04-01

Phage display has been extensively used to study protein-protein interactions, receptor- and antibody-binding sites, and immune responses, to modify protein properties, and to select antibodies against a wide range of different antigens. In the format most often used, a polypeptide is displayed on the surface of a filamentous phage by genetic fusion to one of the coat proteins, creating a chimeric coat protein, and coupling phenotype (the protein) to genotype (the gene within). As the gene encoding the chimeric coat protein is packaged within the phage, selection of the phage on the basis of the binding properties of the polypeptide displayed on the surface simultaneously results in the isolation of the gene encoding the polypeptide. This unit describes the background to the technique, and illustrates how it has been applied to a number of different problems, each of which has its neurobiological counterparts. Although this overview concentrates on the use of filamentous phage, which is the most popular platform, other systems are also described. (c) 2010 by John Wiley & Sons, Inc.

Waveform model for an eccentric binary black hole based on the effective-one-body-numerical-relativity formalism

NASA Astrophysics Data System (ADS)

Cao, Zhoujian; Han, Wen-Biao

2017-08-01

Binary black hole systems are among the most important sources for gravitational wave detection. They are also good objects for theoretical research for general relativity. A gravitational waveform template is important to data analysis. An effective-one-body-numerical-relativity (EOBNR) model has played an essential role in the LIGO data analysis. For future space-based gravitational wave detection, many binary systems will admit a somewhat orbit eccentricity. At the same time, the eccentric binary is also an interesting topic for theoretical study in general relativity. In this paper, we construct the first eccentric binary waveform model based on an effective-one-body-numerical-relativity framework. Our basic assumption in the model construction is that the involved eccentricity is small. We have compared our eccentric EOBNR model to the circular one used in the LIGO data analysis. We have also tested our eccentric EOBNR model against another recently proposed eccentric binary waveform model; against numerical relativity simulation results; and against perturbation approximation results for extreme mass ratio binary systems. Compared to numerical relativity simulations with an eccentricity as large as about 0.2, the overlap factor for our eccentric EOBNR model is better than 0.98 for all tested cases, including spinless binary and spinning binary, equal mass binary, and unequal mass binary. Hopefully, our eccentric model can be the starting point to develop a faithful template for future space-based gravitational wave detectors.

Catalytic and reactive polypeptides and methods for their preparation and use

DOEpatents

Schultz, Peter

1993-01-01

Catalytic and reactive polypeptides include a binding site specific for a reactant or reactive intermediate involved in a chemical reaction of interest. The polypeptides further include at least one active functionality proximate the bi.

Isolated nucleic acids encoding antipathogenic polypeptides and uses thereof

DOEpatents

Altier, Daniel J.; Crane, Virginia C.; Ellanskaya, Irina; Ellanskaya, Natalia; Gilliam, Jacob T.; Hunter-Cevera, Jennie; Presnail, James K.; Schepers, Eric J.; Simmons, Carl R.; Torok, Tamas; Yalpani, Nasser

2010-04-20

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from fungal fermentation broths. Nucleic acids that encode the antipathogenic polypeptides are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention are also disclosed.

Antifungal polypeptides

DOEpatents

Altier, Daniel J.; Dahlbacka, Glen; Ellanskaya, legal representative, Natalia; Herrmann, Rafael; Hunter-Cevera, Jennie; McCutchen, Billy F.; Presnail, James K.; Rice, Janet A.; Schepers, Eric; Simmons, Carl R.; Torok, Tamas; Yalpani, Nasser; Ellanskaya, deceased, Irina

2007-12-11

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.

Antifungal polypeptides

DOEpatents

Altier, Daniel J.; Dahlbacka, Glen; Elleskaya, Irina; Ellanskaya, legal representative; Natalia; Herrmann, Rafael; Hunter-Cevera, Jennie; McCutchen, Billy F.; Presnail, James K.; Rice, Janet A.; Schepers, Eric; Simmons, Carl R.; Torok, Tamas; Yalpani, Nasser

2010-08-10

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.

Antifungal polypeptides

DOEpatents

Altier, Daniel J [Waukee, IA; Dahlbacka, Glen [Oakland, CA; Elleskaya, Irina [Kyiv, UA; Ellanskaya, legal representative, Natalia; Herrmann, Rafael [Wilmington, DE; Hunter-Cevera, Jennie [Elliott City, MD; McCutchen, Billy F [College Station, IA; Presnail, James K [Avondale, PA; Rice, Janet A [Wilmington, DE; Schepers, Eric [Port Deposit, MD; Simmons, Carl R [Des Moines, IA; Torok, Tamas [Richmond, CA; Yalpani, Nasser [Johnston, IA

2011-04-12

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.

Antifungal polypeptides

DOEpatents

Altier, Daniel J [Granger, IA; Dahlbacka, Glen [Oakland, CA; Ellanskaya, Irina [Kyiv, UA; Ellanskaya, legal representative, Natalia; Herrmann, Rafael [Wilmington, DE; Hunter-Cevera, Jennie [Elliott City, MD; McCutchen, Billy F [College Station, TX; Presnail, James K [Avondale, PA; Rice, Janet A [Wilmington, DE; Schepers, Eric [Port Deposit, MD; Simmons, Carl R [Des Moines, IA; Torok, Tamas [Richmond, CA; Yalpani, Nasser [Johnston, IA

2012-04-03

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include novel amino acid sequences, and variants and fragments thereof, for antipathogenic polypeptides that were isolated from microbial fermentation broths. Nucleic acid molecules comprising nucleotide sequences that encode the antipathogenic polypeptides of the invention are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention, or variant or fragment thereof, are also disclosed.

[beta]-Glucan Synthesis in the Cotton Fiber (III. Identification of UDP-Glucose-Binding Subunits of [beta]-Glucan Synthases by Photoaffinity Labeling with [[beta]-32P]5[prime]-N3-UDP-Glucose.

PubMed Central

Li, L.; Drake, R. R.; Clement, S.; Brown, R. M.

1993-01-01

Using differential product entrapment and photolabeling under specifying conditions, we identifIed a 37-kD polypeptide as the best candidate among the UDP-glucose-binding polypeptides for the catalytic subunit of cotton (Gossypium hirsutum) cellulose synthase. This polypeptide is enriched by entrapment under conditions favoring [beta]-1,4-glucan synthesis, and it is magnesium dependent and sensitive to unlabeled UDP-glucose. A 52-kD polypeptide was identified as the most likely candidate for the catalytic subunit of [beta]-1,3-glucan synthase because this polypeptide is the most abundant protein in the entrapment fraction obtained under conditions favoring [beta]-1,3-glucan synthesis, is coincident with [beta]-1,3-glucan synthase activity, and is calcium dependent. The possible involvement of other polypeptides in the synthesis of [beta]-1,3-glucan is discussed. PMID:12231766

Chirality-selected phase behaviour in ionic polypeptide complexes

DOE PAGES

Perry, Sarah L.; Leon, Lorraine; Hoffmann, Kyle Q.; ...

2015-01-14

In this study, polyelectrolyte complexes present new opportunities for self-assembled soft matter. Factors determining whether the phase of the complex is solid or liquid remain unclear. Ionic polypeptides enable examination of the effects of stereochemistry on complex formation. Here we demonstrate that chirality determines the state of polyelectrolyte complexes, formed from mixing dilute solutions of oppositely charged polypeptides, via a combination of electrostatic and hydrogen-bonding interactions. Fluid complexes occur when at least one of the polypeptides in the mixture is racemic, which disrupts backbone hydrogen-bonding networks. Pairs of purely chiral polypeptides, of any sense, form compact, fibrillar solids with amore » β-sheet structure. Analogous behaviour occurs in micelles formed from polypeptide block copolymers with polyethylene oxide, where assembly into aggregates with either solid or fluid cores, and eventually into ordered phases at high concentrations, is possible. Chirality is an exploitable tool for manipulating material properties in polyelectrolyte complexation.« less

How do accretion discs break?

NASA Astrophysics Data System (ADS)

Dogan, Suzan

2016-07-01

Accretion discs are common in binary systems, and they are often found to be misaligned with respect to the binary orbit. The gravitational torque from a companion induces nodal precession in misaligned disc orbits. In this study, we first calculate whether this precession is strong enough to overcome the internal disc torques communicating angular momentum. We compare the disc precession torque with the disc viscous torque to determine whether the disc should warp or break. For typical parameters precession wins: the disc breaks into distinct planes that precess effectively independently. To check our analytical findings, we perform 3D hydrodynamical numerical simulations using the PHANTOM smoothed particle hydrodynamics code, and confirm that disc breaking is widespread and enhances accretion on to the central object. For some inclinations, the disc goes through strong Kozai cycles. Disc breaking promotes markedly enhanced and variable accretion and potentially produces high-energy particles or radiation through shocks. This would have significant implications for all binary systems: e.g. accretion outbursts in X-ray binaries and fuelling supermassive black hole (SMBH) binaries. The behaviour we have discussed in this work is relevant to a variety of astrophysical systems, for example X-ray binaries, where the disc plane may be tilted by radiation warping, SMBH binaries, where accretion of misaligned gas can create effectively random inclinations and protostellar binaries, where a disc may be misaligned by a variety of effects such as binary capture/exchange, accretion after binary formation.

Lignases and aldo-keto reductases for conversion of lignin-containing materials to fermentable products

DOEpatents

Scharf, Michael; Sethi, Amit

2016-09-13

Termites have specialized digestive systems that overcome the lignin barrier in wood to release fermentable simple sugars. Using the termite Reticulitermes flavipes and its gut symbionts, high-throughput titanium pyrosequencing and proteomics approaches experimentally compared the effects of lignin-containing diets on host-symbiont digestome composition. Proteomic investigations and functional digestive studies with recombinant lignocellulases conducted in parallel provided strong evidence of congruence at the transcription and translational levels and provide enzymatic strategies for overcoming recalcitrant lignin barriers in biofuel feedstocks. Briefly described, therefore, the disclosure provides a system for generating a fermentable product from a lignified plant material, the system comprising a cooperating series of at least two catalytically active polypeptides, where said catalytically active polypeptides are selected from the group consisting of: cellulase Cell-1, .beta.-glu cellulase, an aldo-keto-reductase, a catalase, a laccase, and an endo-xylanase.

Neuropeptides in Lower Urinary Tract (LUT) Function

PubMed Central

Arms, Lauren; Vizzard, Margaret A.

2014-01-01

Numerous neuropeptide/receptor systems including vasoactive intestinal polypeptide, pituitary adenylate cyclase-activating polypeptide, calcitonin gene-related peptide, substance P, neurokinin A, bradykinin, and endothelin-1 are expressed in the lower urinary tract (LUT) in both neural and non-neural (e.g., urothelium) components. LUT neuropeptide immunoreactivity is present in afferent and autonomic efferent neurons innervating the bladder and urethra and in the urothelium of the urinary bladder. Neuropeptides have tissue-specific distributions and functions in the LUT and exhibit neuroplastic changes in expression and function with LUT dysfunction following neural injury, inflammation and disease. LUT dysfunction with abnormal voiding including urinary urgency, increased voiding frequency, nocturia, urinary incontinence and pain may reflect a change in the balance of neuropeptides in bladder reflex pathways. LUT neuropeptide/receptor systems may represent potential targets for therapeutic intervention. PMID:21290237

Effects of Disk Warping on the Inclination Evolution of Star-Disk-Binary Systems

NASA Astrophysics Data System (ADS)

Zanazzi, J. J.; Lai, Dong

2018-04-01

Several recent studies have suggested that circumstellar disks in young stellar binaries may be driven into misalignement with their host stars due to secular gravitational interactions between the star, disk and the binary companion. The disk in such systems is twisted/warped due to the gravitational torques from the oblate central star and the external companion. We calculate the disk warp profile, taking into account of bending wave propagation and viscosity in the disk. We show that for typical protostellar disk parameters, the disk warp is small, thereby justifying the "flat-disk" approximation adopted in previous theoretical studies. However, the viscous dissipation associated with the small disk warp/twist tends to drive the disk toward alignment with the binary or the central star. We calculate the relevant timescales for the alignment. We find the alignment is effective for sufficiently cold disks with strong external torques, especially for systems with rapidly rotating stars, but is ineffective for the majority of star-disk-binary systems. Viscous warp driven alignment may be necessary to account for the observed spin-orbit alignment in multi-planet systems if these systems are accompanied by an inclined binary companion.

Effects of disc warping on the inclination evolution of star-disc-binary systems

NASA Astrophysics Data System (ADS)

Zanazzi, J. J.; Lai, Dong

2018-07-01

Several recent studies have suggested that circumstellar discs in young stellar binaries may be driven into misalignement with their host stars due to the secular gravitational interactions between the star, disc, and the binary companion. The disc in such systems is twisted/warped due to the gravitational torques from the oblate central star and the external companion. We calculate the disc warp profile, taking into account the bending wave propagation and viscosity in the disc. We show that for typical protostellar disc parameters, the disc warp is small, thereby justifying the `flat-disc' approximation adopted in previous theoretical studies. However, the viscous dissipation associated with the small disc warp/twist tends to drive the disc towards alignment with the binary or the central star. We calculate the relevant time-scales for the alignment. We find that the alignment is effective for sufficiently cold discs with strong external torques, especially for systems with rapidly rotating stars, but is ineffective for the majority of the star-disc-binary systems. Viscous warp-driven alignment may be necessary to account for the observed spin-orbit alignment in multiplanet systems if these systems are accompanied by an inclined binary companion.

Heterotetrameric composition of aquaporin-4 water channels.

PubMed

Neely, J D; Christensen, B M; Nielsen, S; Agre, P

1999-08-24

Aquaporin (AQP) water channel proteins are tetrameric assemblies of individually active approximately 30 kDa subunits. AQP4 is the predominant water channel protein in brain, but immunoblotting of native tissues has previously yielded multiple poorly resolved bands. AQP4 is known to encode two distinct mRNAs with different translation initiating methionines, M1 or M23. Using SDS-PAGE urea gels and immunoblotting with anti-peptide antibodies, four polypeptides were identified in brain and multiple other rat tissues with the following levels of expression: 32 kDa > 34 kDa > 36 kDa > 38 kDa. The 34 and 38 kDa polypeptides react with an antibody specific for the N-terminus of the M1 isoform, and 32 and 36 kDa correspond to the shorter M23 isoform. Immunogold electron microscopic studies with rat cerebellum cryosections demonstrated that the 34 kDa polypeptide colocalizes in perivascular astrocyte endfeet where the 32 kDa polypeptide is abundantly expressed. Velocity sedimentation, cross-linking, and immunoprecipitation analyses of detergent-solubilized rat brain revealed that the 32 and 34 kDa polypeptides reside within heterotetramers. Immunoprecipitation of AQP4 expressed in Xenopus laevis oocytes demonstrated that heterotetramer formation reflects the relative expression levels of the 32 and 34 kDa polypeptides; however, tetramers containing different compositions of the two polypeptides exhibit similar water permeabilities. These studies demonstrate that AQP4 heterotetramers are formed from two overlapping polypeptides and indicate that the 22-amino acid sequence at the N-terminus of the 34 kDa polypeptide does not influence water permeability but may contribute to membrane trafficking or assembly of arrays.

Peptidergic innervation of the human male genital tract.

PubMed

Gu, J; Polak, J M; Probert, L; Islam, K N; Marangos, P J; Mina, S; Adrian, T E; McGregor, G P; O'Shaughnessy, D J; Bloom, S R

1983-08-01

Four peptides--vasoactive intestinal polypeptide, substance P, somatostatin and a peptide-like avian pancreatic polypeptide--have been found in nerves of the human male genitalia using highly sensitive and specific methods of immunocytochemistry and radioimmunoassay. Five other peptides (met-enkephalin, leu-enkephalin, neurotensin, bombesin and cholecystokinin-8) were absent. Vasoactive intestinal polypeptide was the most abundant peptide, its highest concentration being in the proximal corpus cavernosum. Immunoelectron microscopy localized this peptide to large (97 +/- 20 nm), round, electron-dense granules of p-type nerve terminals. Vasoactive intestinal polypeptide-immunoreactive neuronal cell bodies were found in the prostate gland and the root of the corpus cavernosum. Substance P immunoreactive material was present in smaller concentration and was mainly localized in nerves around the corpuscular receptors of the glans penis. Somatostatin immunoreactive nerves were associated mainly with the smooth muscle of the seminal vesicle and the vas deferens. When antiserum to avian pancreatic polypeptide was applied, certain nerves were stained, particularly in the vas deferens, the prostate gland and the seminal vesicle. However, chromatography detected no pure avian pancreatic polypeptide suggesting the presence of a structurally related substance, possibly neuropeptide Y, which cross-reacts with the avian pancreatic polypeptide antiserum. Similar distributions between vasoactive intestinal polypeptide-immunoreactive and acetylcholinesterase-positive nerves and between avian pancreatic polypeptide-immunoreactive and adrenergic nerves were observed. A general neuronal marker, neuron-specific enolase, was used to investigate the general pattern of the organ's innervation. The abundance and distribution patterns of these peptide-immunoreactive nerves indicate that they may play important roles in the male sexual physiology.

Architecture effects on multivalent interactions by polypeptide-based multivalent ligands

NASA Astrophysics Data System (ADS)

Liu, Shuang

Multivalent interactions are characterized by the simultaneous binding between multiple ligands and multiple binding sites, either in solutions or at interfaces. In biological systems, most multivalent interactions occur between protein receptors and carbohydrate ligands through hydrogen-bonding and hydrophobic interactions. Compared with weak affinity binding between one ligand and one binding site, i.e. monovalent interaction, multivalent interactioins provide greater avidity and specificity, and therefore play unique roles in a broad range of biological activities. Moreover, the studies of multivalent interactions are also essential for producing effective inhibitors and effectors of biological processes that could have important therapeutic applications. Synthetic multivalent ligands have been designed to mimic the biological functions of natural multivalent interactions, and various types of scaffolds have been used to display multiple ligands, including small molecules, linear polymers, dendrimers, nanoparticle surfaces, monolayer surfaces and liposomes. Studies have shown that multivalent interactions can be highly affected by various architectural parameters of these multivalent ligands, including ligand identities, valencies, spacing, ligand densities, nature of linker arms, scaffold length and scaffold conformation. Most of these multivalent ligands are chemically synthesized and have limitations of controlling over sequence and conformation, which is a barrier for mimicking ordered and controlled natural biological systems. Therefore, multivalent ligands with precisely controlled architecture are required for improved structure-function relationship studies. Protein engineering methods with subsequent chemical coupling of ligands provide significant advantages of controlling over backbone conformation and functional group placement, and therefore have been used to synthesize recombinant protein-based materials with desired properties similar to natural protein materials, including structural as well as functional proteins. Therefore, polypeptide-based multivalent scaffolds are used to display ligands to assess the contribution of different architectural parameters to the multivalent binding events. In this work, a family of alanine-rich alpha-helical glycopolypeptides was designed and synthesized by a combination of protein engineering and chemical coupling, to display two types of saccharide ligands for two different multivalent binding systems. The valencies, chain length and spacing between adjacent ligands of these multivalent ligands were designed in order to study architecture effects on multivalent interactions. The polypeptides and their glycoconjugates were characterized via various methods, including SDS-PAGE, NMR, HPLC, amino acid analysis (AAA), MALDI, circular dichroism (CD) and GPC. In the first multivalent binding system, cholera toxin B pentamer (CT B5) was chosen to be the protein receptor due to its well-characterized structure, lack of significant steric interference of binding to multiple binding sites, and requirement of only simple monosaccharide as ligands. Galactopyranoside was incorporated into polypeptide scaffolds through amine-carboxylic acid coupling to the side chains of glutamic acid residues. The inhibition and binding to CT B5 of these glycopolypeptide ligands were evaluated by direct enzyme-linked assay (DELA). As a complement method, weak affinity chromatography (WAC) was also used to evaluate glycopolypeptides binding to a CT B5 immobilized column. The architecture effects on CT B 5 inhibition are discussed. In the second system, cell surface receptor L-selectin was targeted by polypeptide-based multivalent ligands containing disulfated galactopyranoside ligands, due to its important roles in various immunological activities. The effects of glycopolypeptide architectural variables L-selectin shedding were evaluated via ELISA-based assays. These polypeptide-based multivalent ligands are suggested to be useful for elucidating architecture effects on multivalent interactions, manipulating multivalent interactions and the subsequent cellular responses in different systems. These materials have great potential applications in therapeutics and could also provide guidelines for design of multivalent ligands for other protein receptors.

Bondi-Hoyle-Lyttleton Accretion onto Binaries

NASA Astrophysics Data System (ADS)

Antoni, Andrea; MacLeod, Morgan; Ramírez-Ruiz, Enrico

2018-01-01

Binary stars are not rare. While only close binary stars will eventually interact with one another, even the widest binary systems interact with their gaseous surroundings. The rates of accretion and the gaseous drag forces arising in these interactions are the key to understanding how these systems evolve. This poster examines accretion flows around a binary system moving supersonically through a background gas. We perform three-dimensional hydrodynamic simulations of Bondi-Hoyle-Lyttleton accretion using the adaptive mesh refinement code FLASH. We simulate a range of values of semi-major axis of the orbit relative to the gravitational focusing impact parameter of the pair. On large scales, gas is gravitationally focused by the center-of-mass of the binary, leading to dynamical friction drag and to the accretion of mass and momentum. On smaller scales, the orbital motion imprints itself on the gas. Notably, the magnitude and direction of the forces acting on the binary inherit this orbital dependence. The long-term evolution of the binary is determined by the timescales for accretion, slow down of the center-of-mass, and decay of the orbit. We use our simulations to measure these timescales and to establish a hierarchy between them. In general, our simulations indicate that binaries moving through gaseous media will slow down before the orbit decays.

The Eclipsing Central Stars of the Planetary Nebulae Lo 16 and PHR J1040-5417

NASA Astrophysics Data System (ADS)

Hillwig, Todd C.; Frew, David; Jones, David; Crispo, Danielle

2017-01-01

Binary central stars of planetary nebula are a valuable tool in understanding common envelope evolution. In these cases both the resulting close binary system and the expanding envelope (the planetary nebula) can be studied directly. In order to compare observed systems with common envelope evolution models we need to determine precise physical parameters of the binaries and the nebulae. Eclipsing central stars provide us with the best opportunity to determine high precision values for mass, radius, and temperature of the component stars in these close binaries. We present photometry and spectroscopy for two of these eclipsing systems; the central stars of Lo 16 and PHR 1040-5417. Using light curves and radial velocity curves along with binary modeling we provide physical parameters for the stars in both of these systems.

Dynamical effects of stellar companions

NASA Astrophysics Data System (ADS)

Naoz, Smadar

2015-08-01

The fraction of stellar binaries in the field is extremely high (about 40% - 70% for > 1 Msun stars), and thus, given this frequency, a large fraction of all exoplanetary systems may reside in binaries. While close-in giant planets tend to be found preferentially in binary stellar systems it seems that the frequency of giant planets in close binaries (<100 AU) is significantly lower than in the overall population. Stellar companions’ gravitational perturbations may significantly alter the planetary orbits around their partner on secular timescales. They can drive planets to large eccentric orbits which can either result in plunging these planets into the star or shrinking their orbits and forming short period planets. I will review the dynamical effects stellar binaries have on a planetary systems. I will also present new results on the influence that stellar evolution has on the dynamical processes in these systems.

Binaries and triples among asteroid pairs

NASA Astrophysics Data System (ADS)

Pravec, Petr; Scheirich, Peter; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián

2015-08-01

Despite major achievements obtained during the past two decades, our knowledge of the population and properties of small binary and multiple asteroid systems is still far from advanced. There is a numerous indirect evidence for that most small asteroid systems were formed by rotational fission of cohesionless parent asteroids that were spun up to the critical frequency presumably by YORP, but details of the process are lacking. Furthermore, as we proceed with observations of more and more binary and paired asteroids, we reveal new facts that substantially refine and sometimes change our understanding of the asteroid systems. One significant new finding we have recently obtained is that primaries of many asteroid pairs are actually binary or triple systems. The first such case found is (3749) Balam (Vokrouhlický, ApJL 706, L37, 2009). We have found 9 more binary systems among asteroid pairs within our ongoing NEOSource photometric project since October 2012. They are (6369) 1983 UC, (8306) Shoko, (9783) Tensho-kan, (10123) Fideoja, (21436) Chaoyichi, (43008) 1999 UD31, (44620) 1999 RS43, (46829) 1998 OS14 and (80218) 1999 VO123. We will review their characteristics. These paired binaries as we call them are mostly similar to binaries in the general ("background") population (of unpaired asteroids), but there are a few trends. The paired binaries tend to have larger secondaries with D_2/D_1 = 0.3 to 0.5 and they also tend to be wider systems with 8 of the 10 having orbital periods between 30 and 81 hours, than average among binaries in the general population. There may be also a larger fraction of triples; (3749) Balam is a confirmed triple, having a larger close and a smaller distant satellite, and (8306) Shoko and (10123) Fideoja are suspect triples as they show additional rotational lightcurve components with periods of 61 and 38.8 h that differ from the orbital period of 36.2 and 56.5 h, respectively. The unbound secondaries tend to be of the same size or smaller (with one exception) than the bound orbiting secondaries. I will compare the observed properties of the paired binaries to predictions from theories of formation of asteroid binaries and pairs.

The abundance and organization of polypeptides associated with antigens of the Rh blood group system.

PubMed

Gardner, B; Anstee, D J; Mawby, W J; Tanner, M J; von dem Borne, A E

1991-06-01

Twelve murine monoclonal antibodies, which react with human red cells of common Rh phenotype but give weak or negative reactions with Rh null erythrocytes, were used in quantitative binding assays and competitive binding assays to investigate the abundance and organization of polypeptides involved in the expression of antigens of the Rh blood group system. Antibodies of the R6A-type (R6A, BRIC-69, BRIC-207) and the 2D10-type (MB-2D10, LA18.18, LA23.40) recognize related structures and 100,000-200,000 molecules of each antibody bind maximally to erythrocytes of common Rh phenotype. Antibodies of the BRIC-125 type (BRICs 32, 122, 125, 126, 168, 211) recognize structures that are unrelated to those recognized by R6A-type and 2D10-type antibodies and between 10,000 and 50,000 antibody molecules bind maximally to erythrocytes of the common Rh phenotype. The binding of antibodies of the R6A-type and the 2D10-type, but not of antibodies of the BRIC-125-type could be partially inhibited by human anti-D antibodies (polyclonal and monoclonal) and a murine anti-e-like antibody. These results are consistent with evidence (Moore & Green 1987; Avent et al., 1988b) that the Rh blood group antigens are associated with a complex that comprises two groups of related polypeptides of M(r) 30,000 and M(r) 35,000-100,000, respectively, and suggest that there are 1-2 x 10(5) copies of this complex per erythrocyte. The polypeptide recognized by antibodies of the BRIC-125 type is likely to be associated with this complex.

Hierarchically self-assembled hexagonal honeycomb and kagome superlattices of binary 1D colloids.

PubMed

Lim, Sung-Hwan; Lee, Taehoon; Oh, Younghoon; Narayanan, Theyencheri; Sung, Bong June; Choi, Sung-Min

2017-08-25

Synthesis of binary nanoparticle superlattices has attracted attention for a broad spectrum of potential applications. However, this has remained challenging for one-dimensional nanoparticle systems. In this study, we investigate the packing behavior of one-dimensional nanoparticles of different diameters into a hexagonally packed cylindrical micellar system and demonstrate that binary one-dimensional nanoparticle superlattices of two different symmetries can be obtained by tuning particle diameter and mixing ratios. The hexagonal arrays of one-dimensional nanoparticles are embedded in the honeycomb lattices (for AB 2 type) or kagome lattices (for AB 3 type) of micellar cylinders. The maximization of free volume entropy is considered as the main driving force for the formation of superlattices, which is well supported by our theoretical free energy calculations. Our approach provides a route for fabricating binary one-dimensional nanoparticle superlattices and may be applicable for inorganic one-dimensional nanoparticle systems.Binary mixtures of 1D particles are rarely observed to cooperatively self-assemble into binary superlattices, as the particle types separate into phases. Here, the authors design a system that avoids phase separation, obtaining binary superlattices with different symmetries by simply tuning the particle diameter and mixture composition.

Ordered biological nanostructures formed from chaperonin polypeptides

NASA Technical Reports Server (NTRS)

Trent, Jonathan D. (Inventor); McMillan, R. Andrew (Inventor); Paavola, Chad D. (Inventor); Kagawa, Hiromi (Inventor)

2010-01-01

The following application relates to nanotemplates, nanostructures, nanoarrays and nanodevices formed from wild-type and mutated chaperonin polypeptides, methods of producing such compositions, methods of using such compositions and particular chaperonin polypeptides that can be utilized in producing such compositions.

Physical Identification of Binary System of Gliclazide-Hydrophilic Polymers Using X-Ray Diffraction

NASA Astrophysics Data System (ADS)

Rachmawati, H.; Yatinasari, Faizatun, Syarie, S. A.

2008-03-01

The formation of binary system in pharmaceutical solid state is aimed to improve the physicochemical characteristics of active compound, such as its solubility. To identify the physical change of the binary system including crystallinity or particle morphology, there are many methods can be applied. In present report, we study the physical interaction of the binary system of gliclazide and hydrophilic polymers. In this binary system, gliclazide was either dispersed or mixed with polyvinyl pirrolidone (PVP K30) or polyethylene glycol (PEG 6000). The dispersion system of gliclazide in the polymeric carriers was prepared by solvation-evaporation method, using dichloromethane/methylene chloride as an organic solvent. The physical characterization of both dispersed and mixed of gliclazide was studied using X-ray diffraction at interval 6-50 °/2θ. As a comparison, the same procedure was performed for pure gliclazide. To confirm the diffractogram of this binary system, Fourier Transform Infrared (FT-IR) spectroscopy was carried out as well. Both diffarctogram and FT-IR spectra revealed that there was no new compound formed in the solid dispersion system of gliclazide:PEG 6000 and gliclazide:PVP K30. In contrast, the solubility as well as the dissolution rate of gliclazide in the presence of both hydrophilic polymers was increased as compared to pure gliclazide. We conclude therefore that solvatation followed by evaporation of gliclazide in the presence of either PEG 6000 or PVP K30 did not alter its crystalline characteristic. The improved of gliclazide solubility in the binary system might due to other mechanism such as increased in the wettability and the hydrophylicity effect of the polymers.

A Pulsar and White Dwarf in an Unexpected Orbit

NASA Astrophysics Data System (ADS)

Kohler, Susanna

2016-11-01

Astronomers have discovered a binary system consisting of a low-mass white dwarf and a millisecond pulsar but its eccentric orbit defies all expectations of how such binaries form.Observed orbital periods and binary eccentricities for binary millisecond pulsars. PSR J2234+0511 is the furthest right of the green stars that mark the five known eccentric systems. [Antoniadis et al. 2016]Unusual EccentricityIt would take a low-mass (0.4 solar masses) white dwarf over 100 billion years to form from the evolution of a single star. Since this is longer than the age of the universe, we believe that these lightweights are instead products of binary-star evolution and indeed, we observe many of these stars to still be in binary systems.But the binary evolution that can create a low-mass white dwarf includes a period of mass transfer, in which efficient tidal dissipation damps the systems orbital eccentricity. Because of this, we would expect all systems containing low-mass white dwarfs to have circular orbits.In the past, our observations of low-mass white dwarfmillisecond pulsar binaries have all been consistent with this expectation. But a new detection has thrown a wrench in the works: the unambiguous identification of a low-mass white dwarf thats in an eccentric (e=0.13) orbit with the millisecond pulsar PSR J2234+0511. How could this system have formed?Eliminating Formation ModelsLed by John Antoniadis (Dunlap Institute at University of Toronto), a team of scientists has used newly obtained optical photometry (from the Sloan Digital Sky Survey) and spectroscopy (from the Very Large Telescope in Chile) of the white dwarf to confirm the identification of this system.Antoniadis and collaborators then use measurements of the bodies masses (0.28 and 1.4 solar masses for the white dwarf and pulsar, respectively) and velocities, and constraints on the white dwarfs temperature, radius and surface gravity, to address three proposed models for the formation of this system.The 3D motion of the pulsar (black solid lines; current position marked with diamond) in our galaxy over the past 1.5 Gyr. This motion is typical for low-mass X-ray binary descendants, favoring a binary-evolution model over a 3-body-interaction model. [Antoniadis et al. 2016]In the first model, the eccentric binary was created via adynamic three-body formation channel. This possibility is deemed unlikely, as the white-dwarf properties and all the kinematic properties of the system point to normal binary evolution.In the secondmodel, the binary system gains its high eccentricity after mass transfer ends, when the pulsar progenitor experiences a spontaneous phase transition. The authors explore two options for this: one in which the neutron star implodes into a strange-quark star, and the other in which an over-massive white dwarf suffers a delayed collapse into a neutron star. Both cases are deemed unlikely, because the mass inferred for the pulsar progenitor is not consistent with either model.In the third model, the system forms a circumbinary disk fueled by material escaping the proto-white dwarf. After mass transfer has ended, interactions between the binary and its disk gradually increase the eccentricity of the system, pumping it up to what we observe today. All of the properties of the system measured by Antoniadis and collaborators are thus far consistent with this model.Further observations of this system and systems like it (several others have been detected, though not yet confirmed) will help determine whether binary evolution combined with interactions with a disk can indeed explain the formation of this unexpectedly eccentricsystem.CitationJohn Antoniadis et al 2016 ApJ 830 36. doi:10.3847/0004-637X/830/1/36

Inferences about binary stellar populations using gravitational wave observations

NASA Astrophysics Data System (ADS)

Wysocki, Daniel; Gerosa, Davide; O'Shaughnessy, Richard; Belczynski, Krzysztof; Gladysz, Wojciech; Berti, Emanuele; Kesden, Michael; Holz, Daniel

2018-01-01

With the dawn of gravitational wave astronomy, enabled by the LIGO and Virgo interferometers, we now have a new window into the Universe. In the short time these detectors have been in use, multiple confirmed detections of gravitational waves from compact binary coalescences have been made. Stellar binary systems are one of the likely progenitors of the observed compact binary sources. If this is indeed the case, then we can use measured properties of these binary systems to learn about their progenitors. We will discuss the Bayesian framework in which we make these inferences, and results which include mass and spin distributions.

Isobaric vapor-liquid equilibria for binary systems α-phenylethylamine + toluene and α-phenylethylamine + cyclohexane at 100 kPa

NASA Astrophysics Data System (ADS)

Wu, Xiaoru; Gao, Yingyu; Ban, Chunlan; Huang, Qiang

2016-09-01

In this paper the results of the vapor-liquid equilibria study at 100 kPa are presented for two binary systems: α-phenylethylamine(1) + toluene (2) and (α-phenylethylamine(1) + cyclohexane(2)). The binary VLE data of the two systems were correlated by the Wilson, NRTL, and UNIQUAC models. For each binary system the deviations between the results of the correlations and the experimental data have been calculated. For the both binary systems the average relative deviations in temperature for the three models were lower than 0.99%. The average absolute deviations in vapour phase composition (mole fractions) and in temperature T were lower than 0.0271 and 1.93 K, respectively. Thermodynamic consistency has been tested for all vapor-liquid equilibrium data by the Herrington method. The values calculated by Wilson and NRTL equations satisfied the thermodynamics consistency test for the both two systems, while the values calculated by UNIQUAC equation didn't.

KIC 7177553: A QUADRUPLE SYSTEM OF TWO CLOSE BINARIES

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lehmann, H.; Borkovits, T.; Rappaport, S. A.

2016-03-01

KIC 7177553 was observed by the Kepler satellite to be an eclipsing eccentric binary star system with an 18-day orbital period. Recently, an eclipse timing study of the Kepler binaries has revealed eclipse timing variations (ETVs) in this object with an amplitude of ∼100 s and an outer period of 529 days. The implied mass of the third body is that of a super-Jupiter, but below the mass of a brown dwarf. We therefore embarked on a radial velocity (RV) study of this binary to determine its system configuration and to check the hypothesis that it hosts a giant planet. Frommore » the RV measurements, it became immediately obvious that the same Kepler target contains another eccentric binary, this one with a 16.5-day orbital period. Direct imaging using adaptive optics reveals that the two binaries are separated by 0.″4 (∼167 AU) and have nearly the same magnitude (to within 2%). The close angular proximity of the two binaries and very similar γ velocities strongly suggest that KIC 7177553 is one of the rare SB4 systems consisting of two eccentric binaries where at least one system is eclipsing. Both systems consist of slowly rotating, nonevolved, solar-like stars of comparable masses. From the orbital separation and the small difference in γ velocity, we infer that the period of the outer orbit most likely lies in the range of 1000–3000 yr. New images taken over the next few years, as well as the high-precision astrometry of the Gaia satellite mission, will allow us to set much narrower constraints on the system geometry. Finally, we note that the observed ETVs in the Kepler data cannot be produced by the second binary. Further spectroscopic observations on a longer timescale will be required to prove the existence of the massive planet.« less

Wind-accelerated orbital evolution in binary systems with giant stars

NASA Astrophysics Data System (ADS)

Chen, Zhuo; Blackman, Eric G.; Nordhaus, Jason; Frank, Adam; Carroll-Nellenback, Jonathan

2018-01-01

Using 3D radiation-hydrodynamic simulations and analytic theory, we study the orbital evolution of asymptotic giant branch (AGB) binary systems for various initial orbital separations and mass ratios, and thus different initial accretion modes. The time evolution of binary separations and orbital periods are calculated directly from the averaged mass-loss rate, accretion rate and angular momentum loss rate. We separately consider spin-orbit synchronized and zero-spin AGB cases. We find that the angular momentum carried away by the mass loss together with the mass transfer can effectively shrink the orbit when accretion occurs via wind-Roche lobe overflow. In contrast, the larger fraction of mass lost in Bondi-Hoyle-Lyttleton accreting systems acts to enlarge the orbit. Synchronized binaries tend to experience stronger orbital period decay in close binaries. We also find that orbital period decay is faster when we account for the non-linear evolution of the accretion mode as the binary starts to tighten. This can increase the fraction of binaries that result in common envelope, luminous red novae, Type Ia supernovae and planetary nebulae with tight central binaries. The results also imply that planets in the habitable zone around white dwarfs are unlikely to be found.

Constraining Binary Asteroid Mass Distributions Based On Mutual Motion

NASA Astrophysics Data System (ADS)

Davis, Alex B.; Scheeres, Daniel J.

2017-06-01

The mutual gravitational potential and torques of binary asteroid systems results in a complex coupling of attitude and orbital motion based on the mass distribution of each body. For a doubly-synchronous binary system observations of the mutual motion can be leveraged to identify and measure the unique mass distributions of each body. By implementing arbitrary shape and order computation of the full two-body problem (F2BP) equilibria we study the influence of asteroid asymmetries on separation and orientation of a doubly-synchronous system. Additionally, simulations of binary systems perturbed from doubly-synchronous behavior are studied to understand the effects of mass distribution perturbations on precession and nutation rates such that unique behaviors can be isolated and used to measure asteroid mass distributions. We apply our investigation to the Trojan binary asteroid system 617 Patroclus and Menoetius (1906 VY), which will be the final flyby target of the recently announced LUCY Discovery mission in March 2033. This binary asteroid system is of particular interest due to the results of a recent stellar occultation study (DPS 46, id.506.09) that suggests the system to be doubly-synchronous and consisting of two-similarly sized oblate ellipsoids, in addition to suggesting the presence mass asymmetries resulting from an impact crater on the southern limb of Menoetius.

Polarized light curves illuminate wind geometries in Wolf-Rayet binary stars

NASA Astrophysics Data System (ADS)

Hoffman, Jennifer L.; Fullard, Andrew G.; Nordsieck, Kenneth H.

2018-01-01

Although the majority of massive stars are affected by a companion during the course of their evolution, the role of binary systems in creating supernova and GRB progenitors is not well understood. Binaries containing Wolf-Rayet stars are particularly interesting because they may provide a mechanism for producing the rapid rotation necessary for GRB formation. However, constraining the evolutionary fate of a Wolf-Rayet binary system requires characterizing its mass loss and mass transfer, a difficult prospect in systems whose colliding winds obscure the stars and produce complicated spectral signatures.The technique of spectropolarimetry is ideally suited to studying WR binary systems because it can disentangle spectral components that take different scattering paths through a complex distribution of circumstellar material. In particular, comparing the polarization behavior as a function of orbital phase of the continuum (which arises from the stars) with that of the emission lines (which arise from the interaction region) can provide a detailed view of the wind structures in a WR+O binary and constrain the system’s mass loss and mass transfer properties.We present new continuum and line polarization curves for three WR+O binaries (WR 30, WR 47, and WR 113) obtained with the RSS spectropolarimeter at the Southern African Large Telescope. We use radiative transfer simulations to analyze the polarization curves, and discuss our interpretations in light of current models for V444 Cygni, a well-studied related binary system. Accurately characterizing the structures of the wind collision regions in these massive binaries is key to understanding their evolution and properly accounting for their contribution to the supernova (and possible GRB) progenitor population.

Uncovering the identities of compact objects in high-mass X-ray binaries and gamma-ray binaries by astrometric measurements

NASA Astrophysics Data System (ADS)

Yamaguchi, M. S.; Yano, T.; Gouda, N.

2018-03-01

We develop a method for identifying a compact object in binary systems with astrometric measurements and apply it to some binaries. Compact objects in some high-mass X-ray binaries and gamma-ray binaries are unknown, which is responsible for the fact that emission mechanisms in such systems have not yet confirmed. The accurate estimate of the mass of the compact object allows us to identify the compact object in such systems. Astrometric measurements are expected to enable us to estimate the masses of the compact objects in the binary systems via a determination of a binary orbit. We aim to evaluate the possibility of the identification of the compact objects for some binary systems. We then calculate probabilities that the compact object is correctly identified with astrometric observation (= confidence level) by taking into account a dependence of the orbital shape on orbital parameters and distributions of masses of white dwarfs, neutron stars and black holes. We find that the astrometric measurements with the precision of 70 μas for γ Cas allow us to identify the compact object at 99 per cent confidence level if the compact object is a white dwarf with 0.6 M⊙. In addition, we can identify the compact object with the precision of 10 μas at 97 per cent or larger confidence level for LS I +61° 303 and 99 per cent or larger for HESS J0632+057. These results imply that the astrometric measurements with the 10 μas precision level can realize the identification of compact objects for γ Cas, LS I +61° 303, and HESS J0632+057.

Characterization of auxin-binding proteins from zucchini plasma membrane

NASA Technical Reports Server (NTRS)

Hicks, G. R.; Rice, M. S.; Lomax, T. L.

1993-01-01

We have previously identified two auxin-binding polypeptides in plasma membrane (PM) preparations from zucchini (Cucurbita pepo L.) (Hicks et al. 1989, Proc. Natl. Acad. Sci. USA 86, 4948-4952). These polypeptides have molecular weights of 40 kDa and 42 kDa and label specifically with the photoaffinity auxin analog 5-N3-7-3H-IAA (azido-IAA). Azido-IAA permits both the covalent and radioactive tagging of auxin-binding proteins and has allowed us to characterize further the 40-kDa and 42-kDa polypeptides, including the nature of their attachment to the PM, their relationship to each other, and their potential function. The azido-IAA-labeled polypeptides remain in the pelleted membrane fraction following high-salt and detergent washes, which indicates a tight and possibly integral association with the PM. Two-dimensional electrophoresis of partially purified azido-IAA-labeled protein demonstrates that, in addition to the major isoforms of the 40-kDa and 42-kDa polypeptides, which possess isoelectric points (pIs) of 8.2 and 7.2, respectively, several less abundant isoforms that display unique pIs are apparent at both molecular masses. Tryptic and chymotryptic digestion of the auxin-binding proteins indicates that the 40-kDa and 42-kDa polypeptides are closely related or are modifications of the same polypeptide. Phase extraction with the nonionic detergent Triton X-114 results in partitioning of the azido-IAA-labeled polypeptides into the aqueous (hydrophilic) phase. This apparently paradoxical behavior is also exhibited by certain integral membrane proteins that aggregate to form channels. The results of gel filtration indicate that the auxin-binding proteins do indeed aggregate strongly and that the polypeptides associate to form a dimer or multimeric complex in vivo. These characteristics are consistent with the hypothesis that the 40-kDa and 42-kDa polypeptides are subunits of a multimeric integral membrane protein which has an auxin-binding site, and which may possess transporter or channel function.

Characterization of auxin-binding proteins from zucchini plasma membrane.

PubMed

Hicks, G R; Rice, M S; Lomax, T L

1993-01-01

We have previously identified two auxin-binding polypeptides in plasma membrane (PM) preparations from zucchini (Cucurbita pepo L.) (Hicks et al. 1989, Proc. Natl. Acad. Sci. USA 86, 4948-4952). These polypeptides have molecular weights of 40 kDa and 42 kDa and label specifically with the photoaffinity auxin analog 5-N3-7-3H-IAA (azido-IAA). Azido-IAA permits both the covalent and radioactive tagging of auxin-binding proteins and has allowed us to characterize further the 40-kDa and 42-kDa polypeptides, including the nature of their attachment to the PM, their relationship to each other, and their potential function. The azido-IAA-labeled polypeptides remain in the pelleted membrane fraction following high-salt and detergent washes, which indicates a tight and possibly integral association with the PM. Two-dimensional electrophoresis of partially purified azido-IAA-labeled protein demonstrates that, in addition to the major isoforms of the 40-kDa and 42-kDa polypeptides, which possess isoelectric points (pIs) of 8.2 and 7.2, respectively, several less abundant isoforms that display unique pIs are apparent at both molecular masses. Tryptic and chymotryptic digestion of the auxin-binding proteins indicates that the 40-kDa and 42-kDa polypeptides are closely related or are modifications of the same polypeptide. Phase extraction with the nonionic detergent Triton X-114 results in partitioning of the azido-IAA-labeled polypeptides into the aqueous (hydrophilic) phase. This apparently paradoxical behavior is also exhibited by certain integral membrane proteins that aggregate to form channels. The results of gel filtration indicate that the auxin-binding proteins do indeed aggregate strongly and that the polypeptides associate to form a dimer or multimeric complex in vivo. These characteristics are consistent with the hypothesis that the 40-kDa and 42-kDa polypeptides are subunits of a multimeric integral membrane protein which has an auxin-binding site, and which may possess transporter or channel function.

Spectral properties of binary asteroids

NASA Astrophysics Data System (ADS)

Pajuelo, Myriam; Birlan, Mirel; Carry, Benoît; DeMeo, Francesca E.; Binzel, Richard P.; Berthier, Jérôme

2018-04-01

We present the first attempt to characterize the distribution of taxonomic class among the population of binary asteroids (15% of all small asteroids). For that, an analysis of 0.8-2.5{μ m} near-infrared spectra obtained with the SpeX instrument on the NASA/IRTF is presented. Taxonomic class and meteorite analog is determined for each target, increasing the sample of binary asteroids with known taxonomy by 21%. Most binary systems are bound in the S-, X-, and C- classes, followed by Q and V-types. The rate of binary systems in each taxonomic class agrees within uncertainty with the background population of small near-Earth objects and inner main belt asteroids, but for the C-types which are under-represented among binaries.

Accretion dynamics in pre-main sequence binaries

NASA Astrophysics Data System (ADS)

Tofflemire, B.; Mathieu, R.; Herczeg, G.; Ardila, D.; Akeson, R.; Ciardi, D.; Johns-Krull, C.

Binary stars are a common outcome of star formation. Orbital resonances, especially in short-period systems, are capable of reshaping the distribution and flows of circumstellar material. Simulations of the binary-disk interaction predict a dynamically cleared gap around the central binary, accompanied by periodic ``pulsed'' accretion events that are driven by orbital motion. To place observational constraints on the binary-disk interaction, we have conducted a long-term monitoring program tracing the time-variable accretion behavior of 9 short-period binaries. In this proceeding we present two results from our campaign: 1) the detection of periodic pulsed accretion events in DQ Tau and TWA 3A, and 2) evidence that the TWA 3A primary is the dominant accretor in the system.

Cobalamin-Independent Methionine Synthase (MetE): A Face-to-Face Double Barrel that Evolved by Gene Duplication

DOE Office of Scientific and Technical Information (OSTI.GOV)

Pejcha, Robert; Ludwig, Martha L.

2010-03-08

Cobalamin-independent methionine synthase (MetE) catalyzes the transfer of a methyl group from methyltetrahydrofolate to L-homocysteine (Hcy) without using an intermediate methyl carrier. Although MetE displays no detectable sequence homology with cobalamin-dependent methionine synthase (MetH), both enzymes require zinc for activation and binding of Hcy. Crystallographic analyses of MetE from T. maritima reveal an unusual dual-barrel structure in which the active site lies between the tops of the two ({beta}{alpha}){sub 8} barrels. The fold of the N-terminal barrel confirms that it has evolved from the C-terminal polypeptide by gene duplication; comparisons of the barrels provide an intriguing example of homologous domainmore » evolution in which binding sites are obliterated. The C-terminal barrel incorporates the zinc ion that binds and activates Hcy. The zinc-binding site in MetE is distinguished from the (Cys){sub 3}Zn site in the related enzymes, MetH and betaine-homocysteine methyltransferase, by its position in the barrel and by the metal ligands, which are histidine, cysteine, glutamate, and cysteine in the resting form of MetE. Hcy associates at the face of the metal opposite glutamate, which moves away from the zinc in the binary E {center_dot} Hcy complex. The folate substrate is not intimately associated with the N-terminal barrel; instead, elements from both barrels contribute binding determinants in a binary complex in which the folate substrate is incorrectly oriented for methyl transfer. Atypical locations of the Hcy and folate sites in the C-terminal barrel presumably permit direct interaction of the substrates in a ternary complex. Structures of the binary substrate complexes imply that rearrangement of folate, perhaps accompanied by domain rearrangement, must occur before formation of a ternary complex that is competent for methyl transfer.« less

Characterization of Clostridium perfringens iota-toxin genes and expression in Escherichia coli.

PubMed

Perelle, S; Gibert, M; Boquet, P; Popoff, M R

1993-12-01

The iota toxin which is produced by Clostridium perfringens type E, is a binary toxin consisting of two independent polypeptides: Ia, which is an ADP-ribosyltransferase, and Ib, which is involved in the binding and internalization of the toxin into the cell. Two degenerate oligonucleotide probes deduced from partial amino acid sequence of each component of C. spiroforme toxin, which is closely related to the iota toxin, were used to clone three overlapping DNA fragments containing the iota-toxin genes from C. perfringens type E plasmid DNA. Two genes, in the same orientation, coding for Ia (387 amino acids) and Ib (875 amino acids) and separated by 243 noncoding nucleotides were identified. A predicted signal peptide was found for each component, and the secreted Ib displays two domains, the propeptide (172 amino acids) and the mature protein (664 amino acids). The Ia gene has been expressed in Escherichia coli and C. perfringens, under the control of its own promoter. The recombinant polypeptide obtained was recognized by Ia antibodies and ADP-ribosylated actin. The expression of the Ib gene was obtained in E. coli harboring a recombinant plasmid encompassing the putative promoter upstream of the Ia gene and the Ia and Ib genes. Two residues which have been found to be involved in the NAD+ binding site of diphtheria and pseudomonas toxins are conserved in the predicted Ia sequence (Glu-14 and Trp-19). The predicted amino acid Ib sequence shows 33.9% identity with and 54.4% similarity to the protective antigen of the anthrax toxin complex. In particular, the central region of Ib, which contains a predicted transmembrane segment (Leu-292 to Ser-308), presents 45% identity with the corresponding protective antigen sequence which is involved in the translocation of the toxin across the cell membrane.

The Eclipsing Binary On-Line Atlas (EBOLA)

NASA Astrophysics Data System (ADS)

Bradstreet, D. H.; Steelman, D. P.; Sanders, S. J.; Hargis, J. R.

2004-05-01

In conjunction with the upcoming release of \\it Binary Maker 3.0, an extensive on-line database of eclipsing binaries is being made available. The purposes of the atlas are: \\begin {enumerate} Allow quick and easy access to information on published eclipsing binaries. Amass a consistent database of light and radial velocity curve solutions to aid in solving new systems. Provide invaluable querying capabilities on all of the parameters of the systems so that informative research can be quickly accomplished on a multitude of published results. Aid observers in establishing new observing programs based upon stars needing new light and/or radial velocity curves. Encourage workers to submit their published results so that others may have easy access to their work. Provide a vast but easily accessible storehouse of information on eclipsing binaries to accelerate the process of understanding analysis techniques and current work in the field. \\end {enumerate} The database will eventually consist of all published eclipsing binaries with light curve solutions. The following information and data will be supplied whenever available for each binary: original light curves in all bandpasses, original radial velocity observations, light curve parameters, RA and Dec, V-magnitudes, spectral types, color indices, periods, binary type, 3D representation of the system near quadrature, plots of the original light curves and synthetic models, plots of the radial velocity observations with theoretical models, and \\it Binary Maker 3.0 data files (parameter, light curve, radial velocity). The pertinent references for each star are also given with hyperlinks directly to the papers via the NASA Abstract website for downloading, if available. In addition the Atlas has extensive searching options so that workers can specifically search for binaries with specific characteristics. The website has more than 150 systems already uploaded. The URL for the site is http://ebola.eastern.edu/.

Binary Systems and the Initial Mass Function

NASA Astrophysics Data System (ADS)

Malkov, O. Yu.

2017-07-01

In the present paper we discuss advantages and disadvantages of binary stars, which are important for star formation history determination. We show that to make definite conclusions of the initial mass function shape, it is necessary to study binary population well enough to correct the luminosity function for unresolved binaries; to construct the mass-luminosity relation based on wide binaries data, and to separate observational mass functions of primaries, of secondaries, and of unresolved binaries.

Effects of cell penetrating Notch inhibitory peptide conjugated to elastin-like polypeptide on glioblastoma cells.

PubMed

Opačak-Bernardi, Teuta; Ryu, Jung Su; Raucher, Drazen

2017-07-01

Notch pathway was found to be activated in most glioblastomas (GBMs), underlining the importance of Notch in formation and recurrence of GBM. In this study, a Notch inhibitory peptide, dominant negative MAML (dnMAML), was conjugated to elastin-like polypeptide (ELP) for tumor targeted delivery. ELP is a thermally responsive polypeptide that can be actively and passively targeted to the tumor site by localized application of hyperthermia. This complex was further modified with the addition of a cell penetrating peptide, SynB1, for improved cellular uptake and blood-brain barrier penetration. The SynB1-ELP1-dnMAML was examined for its cellular uptake, cytotoxicity, apoptosis, cell cycle inhibition and the inhibition of target genes' expression. SynB1-ELP1-dnMAML inhibited the growth of D54 and U251 cells by inducing apoptosis and cell cycle arrest, especially in the presence of hyperthermia. Hyperthermia increased overall uptake of the polypeptide by the cells and enhanced the resulting pharmacological effects of dnMAML, showing the inhibition of targets of Notch pathway such as Hes-1 and Hey-L. These results confirm that dnMAML is an effective Notch inhibitor and combination with ELP may allow thermal targeting of the SynB1-ELP1-dnMAML complex in cancer cells while avoiding the dangers of systemic Notch inhibition.

Comparison of two gas chromatograph models and analysis of binary data

NASA Technical Reports Server (NTRS)

Keba, P. S.; Woodrow, P. T.

1972-01-01

The overall objective of the gas chromatograph system studies is to generate fundamental design criteria and techniques to be used in the optimum design of the system. The particular tasks currently being undertaken are the comparison of two mathematical models of the chromatograph and the analysis of binary system data. The predictions of two mathematical models, an equilibrium absorption model and a non-equilibrium absorption model exhibit the same weaknesses in their inability to predict chromatogram spreading for certain systems. The analysis of binary data using the equilibrium absorption model confirms that, for the systems considered, superposition of predicted single component behaviors is a first order representation of actual binary data. Composition effects produce non-idealities which limit the rigorous validity of superposition.

Using Model Point Spread Functions to Identifying Binary Brown Dwarf Systems

NASA Astrophysics Data System (ADS)

Matt, Kyle; Stephens, Denise C.; Lunsford, Leanne T.

2017-01-01

A Brown Dwarf (BD) is a celestial object that is not massive enough to undergo hydrogen fusion in its core. BDs can form in pairs called binaries. Due to the great distances between Earth and these BDs, they act as point sources of light and the angular separation between binary BDs can be small enough to appear as a single, unresolved object in images, according to Rayleigh Criterion. It is not currently possible to resolve some of these objects into separate light sources. Stephens and Noll (2006) developed a method that used model point spread functions (PSFs) to identify binary Trans-Neptunian Objects, we will use this method to identify binary BD systems in the Hubble Space Telescope archive. This method works by comparing model PSFs of single and binary sources to the observed PSFs. We also use a method to compare model spectral data for single and binary fits to determine the best parameter values for each component of the system. We describe these methods, its challenges and other possible uses in this poster.

Hydrodynamical processes in coalescing binary stars

NASA Astrophysics Data System (ADS)

Lai, Dong

1994-01-01

Coalescing neutron star binaries are considered to be the most promising sources of gravitational waves that could be detected by the planned laser-interferometer LIGO/VIRGO detectors. Extracting gravity wave signals from noisy data requires accurate theoretical waveforms in the frequency range 10-1000 Hz end detailed understanding of the dynamics of the binary orbits. We investigate the quasi-equilibrium and dynamical tidal interactions in coalescing binary stars, with particular focus on binary neutron stars. We develop a new formalism to study the equilibrium and dynamics of fluid stars in binary systems. The stars are modeled as compressible ellipsoids, and satisfy polytropic equation of state. The hydrodynamic equations are reduced to a set of ordinary differential equations for the evolution of the principal axes and other global quantities. The equilibrium binary structure is determined by a set of algebraic equations. We consider both synchronized and nonsynchronized systems, obtaining the generalizations to compressible fluid of the classical results for the ellipsoidal binary configurations. Our method can be applied to a wide variety of astrophysical binary systems containing neutron stars, white dwarfs, main-sequence stars and planets. We find that both secular and dynamical instabilities can develop in close binaries. The quasi-static (secular) orbital evolution, as well as the dynamical evolution of binaries driven by viscous dissipation and gravitational radiation reaction are studied. The development of the dynamical instability accelerates the binary coalescence at small separation, leading to appreciable radial infall velocity near contact. We also study resonant excitations of g-mode oscillations in coalescing binary neutron stars. A resonance occurs when the frequency of the tidal driving force equals one of the intrinsic g-mode frequencies. Using realistic microscopic nuclear equations of state, we determine the g-modes in a cold neutron atar. Resonant excitations of these g-modes during the last few minutes of the binary coalescence result in energy transfer and angular momentum transfer from the binary orbit to the neutron star. Because of the weak coupling between the g-modes and the tidal potential, the induced orbital phase errors due to resonances are small. However, resonant excitations of the g-modes play an important role in the tidal heating of binary neutron stars.

Mass loss from interacting close binary systems

NASA Technical Reports Server (NTRS)

Plavec, M. J.

1981-01-01

The three well-defined classes of evolved binary systems that show evidence of present and/or past mass loss are the cataclysmic variables, the Algols, and Wolf-Rayet stars. It is thought that the transformation of supergiant binary systems into the very short-period cataclysmic variables must have been a complex process. The new evidence that has recently been obtained from the far ultraviolet spectra that a certain subclass of the Algols (the Serpentids) are undergoing fairly rapid evolution is discussed. It is thought probable that the remarkable mass outflow observed in them is connected with a strong wind powered by accretion. The origin of the circumbinary clouds or flat disks that probably surround many strongly interacting binaries is not clear. Attention is also given to binary systems with hot white dwarf or subdwarf components, such as the symbiotic objects and the BQ stars; it is noted that in them both components may be prone to an enhanced stellar wind.

A New Equilibrium State for Singly Synchronous Binary Asteroids

NASA Astrophysics Data System (ADS)

Golubov, Oleksiy; Unukovych, Vladyslav; Scheeres, Daniel J.

2018-04-01

The evolution of rotation states of small asteroids is governed by the Yarkovsky–O’Keefe–Radzievskii–Paddack (YORP) effect, nonetheless some asteroids can stop their YORP evolution by attaining a stable equilibrium. The same is true for binary asteroids subjected to the binary YORP (BYORP) effect. Here we discuss a new type of equilibrium that combines these two, which is possible in a singly synchronous binary system. This equilibrium occurs when the normal YORP, the tangential YORP, and the BYORP compensate each other, and tidal torques distribute the angular momentum between the components of the system and dissipate energy. If unperturbed, such a system would remain singly synchronous in perpetuity with constant spin and orbit rates, as the tidal torques dissipate the incoming energy from impinging sunlight at the same rate. The probability of the existence of this kind of equilibrium in a binary system is found to be on the order of a few percent.

Analysis of the internal nuclear matrix. Oligomers of a 38 kD nucleolar polypeptide stabilized by disulfide bonds.

PubMed

Fields, A P; Kaufmann, S H; Shaper, J H

1986-05-01

When rat liver nuclei are treated with the sulfhydryl cross-linking reagent sodium tetrathionate (NaTT) prior to nuclease treatment and extraction with 1.6 M NaCl, residual nucleoli and an extensive non-chromatin intranuclear network remain associated with the nuclear envelope. Subsequent treatment of this structure with 1 M NaCl containing 20 mM dithiothreitol (DTT) solubilizes the intranuclear material, while the nuclear envelope remains structurally intact. We have isolated and partially characterized a major polypeptide of the disulfide-stabilized internal nuclear matrix. The polypeptide, which has an apparent molecular mass 38 kD and isoelectric point 5.3, has been localized to the nucleolus of rat liver nuclei by indirect immunofluorescence using a specific polyclonal chicken antiserum. Based on its molecular mass, isoelectric point, intracellular localization and amino acid composition, the 38 kD polypeptide appears to be analogous to the nucleolar phosphoprotein B23 described by Prestayko et al. (Biochemistry 13 (1974) 1945) [20]. Immunologically related polypeptides have likewise been localized to the nucleoli of both hamster and human tissue culture cell lines as well as the cellular slime mold Physarum polycephalum. By immunoblotting, a single 38 kD polypeptide is recognized by the antiserum in rat, mouse, hamster and human cell lines. The antiserum has been utilized to investigate the oligomeric structure of the 38 kD polypeptide and the nature of its association with the rat liver nuclear matrix. By introducing varying numbers of disulfide bonds, we have found that the 38 kD polypeptide becomes incorporated into the internal nuclear matrix in a two-step process. Soluble disulfide-bonded homodimers of the polypeptide are first formed and then are rendered salt-insoluble by more extensive disulfide cross-linking.

The Evolution of Compact Binary Star Systems.

PubMed

Postnov, Konstantin A; Yungelson, Lev R

2014-01-01

We review the formation and evolution of compact binary stars consisting of white dwarfs (WDs), neutron stars (NSs), and black holes (BHs). Mergings of compact-star binaries are expected to be the most important sources for forthcoming gravitational-wave (GW) astronomy. In the first part of the review, we discuss observational manifestations of close binaries with NS and/or BH components and their merger rate, crucial points in the formation and evolution of compact stars in binary systems, including the treatment of the natal kicks, which NSs and BHs acquire during the core collapse of massive stars and the common envelope phase of binary evolution, which are most relevant to the merging rates of NS-NS, NS-BH and BH-BH binaries. The second part of the review is devoted mainly to the formation and evolution of binary WDs and their observational manifestations, including their role as progenitors of cosmologically-important thermonuclear SN Ia. We also consider AM CVn-stars, which are thought to be the best verification binary GW sources for future low-frequency GW space interferometers.

Stability of binaries. Part II: Rubble-pile binaries

NASA Astrophysics Data System (ADS)

Sharma, Ishan

2016-10-01

We consider the stability of the binary asteroids whose members are granular aggregates held together by self-gravity alone. A binary is said to be stable whenever both its members are orbitally and structurally stable to both orbital and structural perturbations. To this end, we extend the stability analysis of Sharma (Sharma [2015] Icarus, 258, 438-453), that is applicable to binaries with rigid members, to the case of binary systems with rubble members. We employ volume averaging (Sharma et al. [2009] Icarus, 200, 304-322), which was inspired by past work on elastic/fluid, rotating and gravitating ellipsoids. This technique has shown promise when applied to rubble-pile ellipsoids, but requires further work to settle some of its underlying assumptions. The stability test is finally applied to some suspected binary systems, viz., 216 Kleopatra, 624 Hektor and 90 Antiope. We also see that equilibrated binaries that are close to mobilizing their maximum friction can sustain only a narrow range of shapes and, generally, congruent shapes are preferred.

1E 1048.5 + 5421 - A new 114 minute AM Herculis binary

NASA Technical Reports Server (NTRS)

Morris, Simon L.; Schmidt, Gary D.; Liebert, James; Gioia, Isabella M.; Maccacaro, Tommaso

1987-01-01

The discovery of a new AM Herculis binary system, found as a serendipitous Einstein X-ray source, is described. Like the previously discovered mass-transfer binaries involving synchronously rotating magnetic white-dwarf primaries, the system exhibits strong circular polarization, X-ray and optical continuum variations, and optical emission lines, all of which seem to be modulated with these binary periods of 114.5 + or - 0.2 minutes. Although all data are not concurrent, the new system appears to possess the highest ratio of F(x)/F(opt) yet found for an AM Her system. The surprising accumulation of AM Her variables with periods near 114 minute is commented on.

Method to determine transcriptional regulation pathways in organisms

DOEpatents

Gardner, Timothy S.; Collins, James J.; Hayete, Boris; Faith, Jeremiah

2012-11-06

The invention relates to computer-implemented methods and systems for identifying regulatory relationships between expressed regulating polypeptides and targets of the regulatory activities of such regulating polypeptides. More specifically, the invention provides a new method for identifying regulatory dependencies between biochemical species in a cell. In particular embodiments, provided are computer-implemented methods for identifying a regulatory interaction between a transcription factor and a gene target of the transcription factor, or between a transcription factor and a set of gene targets of the transcription factor. Further provided are genome-scale methods for predicting regulatory interactions between a set of transcription factors and a corresponding set of transcriptional target substrates thereof.

A photometric analysis of the neglected EW-type binary V336 TrA

NASA Astrophysics Data System (ADS)

Kriwattanawong, W.; Sarotsakulchai, T.; Maungkorn, S.; Reichart, D. E.; Haislip, J. B.; Kouprianov, V. V.; LaCluyze, A. P.; Moore, J. P.

2018-05-01

This study presents an analysis of photometric light curves and absolute parameters for the EW-type binary V336 TrA. VRI imaging observations were taken in 2013 by using the robotic telescopes PROMPT 4 and PROMPT 5 at Cerro Tololo Inter-American Observatory (CTIO), Chile. The observed light curves were fitted by using the Wilson-Devinney method. The results showed that V336 TrA is a W-type contact binary with a mass ratio of q = 1.396. The binary is a weak contact system with a fill-out factor of f = 15.69%. The system contains components with masses of 0.653 M⊙ and 0.912 M⊙ for the hotter and the cooler, respectively. The location of the secondary (less massive) component on the log M - log L diagram was found to be near the TAMS. The component has evolved to be oversize and overluminous. The orbital angular momentum of the binary was found to be log Jo = 51.61 cgs, less than all detached systems for same mass. The system has undergone angular momentum and/or mass loss, during the binary evolution from the detached to contact system.

Binary Number System Training for Graduate Foreign Students at New York Institute of Technology.

ERIC Educational Resources Information Center

Sudsataya, Nuntawun

This thesis describes the design, development, implementation, and evaluation of a training module to instruct graduate foreign students to learn the representation of the binary system and the method of decimal-binary conversion. The designer selected programmed instruction as the method of instruction and used the "lean" approach to…

Transcriptional control in Alicyclobacillus acidocaldarius and associated genes, proteins, and methods

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lee, Brady D.; Thompson, David N.; Apel, William A.

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of modulating transcription or transcription or transcriptional control using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Enhanced processive cellulases

DOEpatents

Adney, William S.; Beckham, Gregg T.; Jarvis, Eric; Himmel, Michael E.; Decker, Stephen R.; Linger, Jeffrey G.; Podkaminer, Kara; Baker, John O.; Taylor, II, Larry; Xu, Qi; Singh, Arjun

2017-06-20

Nucleic acid sequences encoding chimeric polypeptides that exhibit enhanced cellulase activities are disclosed herein. These nucleic acids may be expressed in hosts such as fungi, which in turn may be cultured to produce chimeric polypeptides. Also disclosed are chimeric polypeptides and their use in the degradation of cellulosic materials.

Transcriptional control in Alicyclobacillus acidocaldarius and associated genes, proteins, and methods

DOEpatents

Lee, Brady Deneys; Thompson, David N; Apel, William A.; Thompson, Vicki Slavchev; Reed, David W; Lacey, Jeffrey A

2014-05-06

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of modulating transcription or transcription or transcriptional control using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Transcriptional control in Alicyclobacillus acidocaldarius and associated genes, proteins, and methods

DOEpatents

Lee, Brady D.; Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.

2015-11-17

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of modulating transcription or transcription or transcriptional control using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Transcriptional control in alicyclobacillus acidocaldarius and associated genes, proteins, and methods

DOEpatents

Lee, Brady D; Thompson, David N; Apel, William A; Thompson, Vicki S; Reed, David W; Lacey, Jeffrey A

2016-11-22

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods of modulating transcription or transcription or transcriptional control using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Caffeine-water-polypeptide interaction in aqueous solution

NASA Astrophysics Data System (ADS)

Ghabi, Habib; Dhahbi, Mahmoud

1999-04-01

The interaction of caffeine monomer with the synthetic polypeptides polyasparagine (pAg) and polyaspartic acid (pAsp) was studied by UV spectrophotometry. The results show that different types of interactions are possible depending on the nature of polypeptide. The form of the complex was discussed.

New prospects for observing and cataloguing exoplanets in well-detached binaries

NASA Astrophysics Data System (ADS)

Schwarz, R.; Funk, B.; Zechner, R.; Bazsó, Á.

2016-08-01

This paper is devoted to study the circumstances favourable to detect circumstellar and circumbinary planets in well-detached binary-star systems using eclipse timing variations (ETVs). We investigated the dynamics of well-detached binary star systems with a star separation from 0.5 to 3 au, to determine the probability of the detection of such variations with ground-based telescopes and space telescopes (like former missions CoRoT and Kepler and future space missions Plato, Tess and Cheops). For the chosen star separations both dynamical configurations (circumstellar and circumbinary) may be observable. We performed numerical simulations by using the full three-body problem as dynamical model. The dynamical stability and the ETVs are investigated by computing ETV maps for different masses of the secondary star and the exoplanet (Earth, Neptune and Jupiter size). In addition we changed the planet's and binary's eccentricities. We conclude that many amplitudes of ETVs are large enough to detect exoplanets in binary-star systems. As an application, we prepared statistics of the catalogue of exoplanets in binary star systems which we introduce in this article and compared the statistics with our parameter-space which we used for our calculations. In addition to these statistics of the catalogue we enlarged them by the investigation of well-detached binary star systems from several catalogues and discussed the possibility of further candidates.

New Small Polypeptides Associated with DNA-Dependent RNA Polymerase of Escherichia coli after Infection with Bacteriophage T4

PubMed Central

Stevens, Audrey

1972-01-01

Four new small polypeptides are associated with DNA-dependent RNA polymerase from E. coli after infection with T4 phage. The new polypeptides are easily detected in RNA polymerase from E. coli cells labeled with amino acids after phage infection. Their molecular weights range from 10,000 to 22,000, as detected by polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate. All four polypeptides are found after infection with either wild-type T4 phage or T4 early amber mutants in genes 44, 42, 47, and 46. None of the polypeptides is labeled significantly before 5 min after infection at 30°. When two maturation-defective amber mutants in gene 55 of T4 phage are used for infection, a polypeptide with a molecular weight of 22,000 is absent. When a maturation-defective amber mutant in gene 33 of T4 phage is used, another small protein is absent. PMID:4551978

Nucleic acids encoding antifungal polypeptides and uses thereof

DOEpatents

Altier, Daniel J.; Ellanskaya, I. A.; Gilliam, Jacob T.; Hunter-Cevera, Jennie; Presnail, James K; Schepers, Eric; Simmons, Carl R.; Torok, Tamas; Yalpani, Nasser

2010-11-02

Compositions and methods for protecting a plant from a pathogen, particularly a fungal pathogen, are provided. Compositions include an amino acid sequence, and variants and fragments thereof, for an antipathogenic polypeptide that was isolated from a fungal fermentation broth. Nucleic acid molecules that encode the antipathogenic polypeptides of the invention, and antipathogenic domains thereof, are also provided. A method for inducing pathogen resistance in a plant using the nucleotide sequences disclosed herein is further provided. The method comprises introducing into a plant an expression cassette comprising a promoter operably linked to a nucleotide sequence that encodes an antipathogenic polypeptide of the invention. Compositions comprising an antipathogenic polypeptide or a transformed microorganism comprising a nucleic acid of the invention in combination with a carrier and methods of using these compositions to protect a plant from a pathogen are further provided. Transformed plants, plant cells, seeds, and microorganisms comprising a nucleotide sequence that encodes an antipathogenic polypeptide of the invention are also disclosed.

Plasmodium falciparum polypeptides released during in vitro cultivation*

PubMed Central

Da Silva, L. Rodriguez; Loche, M.; Dayal, R.; Perrin, L. H.

1983-01-01

Synchronous cultures of Plasmodium falciparum were successively labelled with (35S)-methionine and both the supernatants and the pellets of infected red blood cells were collected. The release of TCA-precipitable material in the culture supernatants was low during the development of ring forms and trophozoites, increased during schizogony, and was maximum at the time of schizont rupture and merozoite reinvasion. Analysis of the supernatants by SDS — PAGE and autoradiography showed that both polypeptides common to the various developmental stages of the parasite and schizont/merozoite-specific polypeptides were released. Polypeptides of relative molecular mass 140 000, 82 000 and, to a lower degree, 41 000 were present in high amounts in the culture supernatants. These polypeptides have been shown to be the target of monoclonal antibodies that are able to inhibit the growth of P. falciparum cultures, and may be involved in protective immunity. The released polypeptides may also be used as target antigens in immunodiagnostic tests aiming at the detection of malaria infection. ImagesFig. 2AFig. 2BFig. 3 PMID:6340846

Molecular diversity and hypoglycemic polypeptide-P content of Momordica charantia in different accessions and different seasons.

PubMed

Tian, Miao; Zeng, Xiang-Qing; Song, Huan-Lei; Hu, Shan-Xin; Wang, Fu-Jun; Zhao, Jian; Hu, Zhi-Bi

2015-04-01

Momordica charantia (MC) has been used for treating diabetes mellitus from ancient times in Asia, Africa and South America. There are many MC accessions in local markets. Polypeptide-P as a main hypoglycemic component in MC was first studied in this experiment to illustrate the different contents in MC of different accessions and different harvesting times. Nineteen MC accessions collected from different regions were clustered into three groups using random amplified polymorphic DNA (RAPD) and inter-simple sequence repeat (ISSR) molecular markers. Content of polypeptide-P in the tested MC accessions was detected by western blot (WB) method. The WB results revealed that polypeptide-P was detected in MC accessions harvested in June and July but not in September and October. Furthermore, Polypeptide-P content corresponded well with the MC accessions. Our results suggest that the MC accessions and the harvesting times or the weather during harvest play significant roles in high content of polypeptide-P. © 2014 Society of Chemical Industry.

Carbohydrate degrading polypeptide and uses thereof

DOEpatents

Sagt, Cornelis Maria Jacobus; Schooneveld-Bergmans, Margot Elisabeth Francoise; Roubos, Johannes Andries; Los, Alrik Pieter

2015-10-20

The invention relates to a polypeptide having carbohydrate material degrading activity which comprises the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 4, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 96% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional protein and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.

Population trends of binary near-Earth asteroids based on radar and lightcurves observations

NASA Astrophysics Data System (ADS)

Brozovic, Marina; Benner, Lance A. M.; Naidu, Shantanu P.; Taylor, Patrick A.; Busch, Michael W.; Margot, Jean-Luc; Nolan, Michael C.; Howell, Ellen S.; Springmann, Alessondra; Giorgini, Jon D.; Shepard, Michael K.; Magri, Christopher; Richardson, James E.; Rivera-Valentin, Edgard G.; Rodriguez-Ford, Linda A.; Zambrano Marin, Luisa Fernanda

2016-10-01

The Arecibo and Goldstone planetary radars are invaluable instruments for the discovery and characterization of binary and triple asteroids in the near-Earth asteroid (NEA) population. To date, 41 out of 56 known binaries and triples (~73% of the objects) have been discovered by radar and 49 of these multiple systems have been detected by radar. Their absolute magnitudes range from 12.4 for (1866) Sisyphus to 22.6 for 2015 TD144 and have a mean and rms dispersion of 18.1+-2.0. There is a pronounced decrease in the abundance of binaries for absolute magnitudes H>20. One of the smallest binaries, 1994 CJ1, with an absolute magnitude H=21.4, is also the most accessible binary for a spacecraft rendezvous. Among 365 NEAs with H<22 (corresponding to diameters larger than ~ 140 m) detected by radar since 1999, ~13% have at least one companion. Two triple systems are known, (15391) 2001 SN263 and (136617) 1994 CC, but this is probably an underestimate due to low signal to noise ratios (SNRs) for many of the binary radar detections. Taxonomic classes have been reported for 41 out of 56 currently known multiple systems and some trends are starting to emerge: at least 50% of multiple asteroid systems are S, Sq, Q, or Sk, and at least 20% are optically dark (C, B, P, or U). Thirteen V-class NEAs have been observed by radar and six of them are binaries. Curiously, a comparable number of E-class objects have been detected by radar, but none is known to be a binary.

A massive binary black-hole system in OJ 287 and a test of general relativity.

PubMed

Valtonen, M J; Lehto, H J; Nilsson, K; Heidt, J; Takalo, L O; Sillanpää, A; Villforth, C; Kidger, M; Poyner, G; Pursimo, T; Zola, S; Wu, J-H; Zhou, X; Sadakane, K; Drozdz, M; Koziel, D; Marchev, D; Ogloza, W; Porowski, C; Siwak, M; Stachowski, G; Winiarski, M; Hentunen, V-P; Nissinen, M; Liakos, A; Dogru, S

2008-04-17

Tests of Einstein's general theory of relativity have mostly been carried out in weak gravitational fields where the space-time curvature effects are first-order deviations from Newton's theory. Binary pulsars provide a means of probing the strong gravitational field around a neutron star, but strong-field effects may be best tested in systems containing black holes. Here we report such a test in a close binary system of two candidate black holes in the quasar OJ 287. This quasar shows quasi-periodic optical outbursts at 12-year intervals, with two outburst peaks per interval. The latest outburst occurred in September 2007, within a day of the time predicted by the binary black-hole model and general relativity. The observations confirm the binary nature of the system and also provide evidence for the loss of orbital energy in agreement (within 10 per cent) with the emission of gravitational waves from the system. In the absence of gravitational wave emission the outburst would have happened 20 days later.

Synergies in Astrometry: Predicting Navigational Error of Visual Binary Stars

NASA Astrophysics Data System (ADS)

Gessner Stewart, Susan

2015-08-01

Celestial navigation can employ a number of bright stars which are in binary systems. Often these are unresolved, appearing as a single, center-of-light object. A number of these systems are, however, in wide systems which could introduce a margin of error in the navigation solution if not handled properly. To illustrate the importance of good orbital solutions for binary systems - as well as good astrometry in general - the relationship between the center-of-light versus individual catalog position of celestial bodies and the error in terrestrial position derived via celestial navigation is demonstrated. From the list of navigational binary stars, fourteen such binary systems with at least 3.0 arcseconds apparent separation are explored. Maximum navigational error is estimated under the assumption that the bright star in the pair is observed at maximum separation, but the center-of-light is employed in the navigational solution. The relationships between navigational error and separation, orbital periods, and observers' latitude are discussed.

Numerical Simulations of Close and Contact Binary Systems Having Bipolytropic Equation of State

NASA Astrophysics Data System (ADS)

Kadam, Kundan; Clayton, Geoffrey C.; Motl, Patrick M.; Marcello, Dominic; Frank, Juhan

2017-01-01

I present the results of the numerical simulations of the mass transfer in close and contact binary systems with both stars having a bipolytropic (composite polytropic) equation of state. The initial binary systems are obtained by a modifying Hachisu’s self-consistent field technique. Both the stars have fully resolved cores with a molecular weight jump at the core-envelope interface. The initial properties of these simulations are chosen such that they satisfy the mass-radius relation, composition and period of a late W-type contact binary system. The simulations are carried out using two different Eulerian hydrocodes, Flow-ER with a fixed cylindrical grid, and Octo-tiger with an AMR capable cartesian grid. The detailed comparison of the simulations suggests an agreement between the results obtained from the two codes at different resolutions. The set of simulations can be treated as a benchmark, enabling us to reliably simulate mass transfer and merger scenarios of binary systems involving bipolytropic components.

Mass flow in interacting binaries observed in the ultraviolet

NASA Technical Reports Server (NTRS)

Kondo, Yoji

1989-01-01

Recent satellite observations of close binary systems show that practically all binaries exhibit evidence of mass flow and that, where the observations are sufficiently detailed, a fraction of the matter flowing out of the mass-losing component is accreted by the companion and the remainder is lost from the binary system. The mass flow is not conservative. During the phase of dynamic mass flow, the companion star becomes immersed in optically-thick plasma and the physical properties of that star elude close scrutiny.

In what sense a neutron star-black hole binary is the holy grail for testing gravity?

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bagchi, Manjari; Torres, Diego F., E-mail: manjari.bagchi@icts.res.in, E-mail: dtorres@ieec.uab.es

2014-08-01

Pulsars in binary systems have been very successful to test the validity of general relativity in the strong field regime [1-4]. So far, such binaries include neutron star-white dwarf (NS-WD) and neutron star-neutron star (NS-NS) systems. It is commonly believed that a neutron star-black hole (NS-BH) binary will be much superior for this purpose. But in what sense is this true? Does it apply to all possible deviations?.

Evolutionary Pathways for Asteroid Satellites

NASA Astrophysics Data System (ADS)

Jacobson, Seth Andrew

2015-08-01

The YORP-induced rotational fission hypothesis is a proposed mechanism for the creation of small asteroid binaries, which make up approximately 1/6-th of the near-Earth asteroid and small Main Belt asteroid populations. The YORP effect is a radiative torque that rotationally accelerates asteroids on timescales of thousands to millions of years. As asteroids rotationally accelerate, centrifugal accelerations on material within the body can match gravitational accelerations holding that material in place. When this occurs, that material goes into orbit. Once in orbit that material coalesces into a companion that undergoes continued dynamical evolution.Observations with radar, photometric and direct imaging techniques reveal a diverse array of small asteroid satellites. These systems can be sorted into a number of morphologies according to size, multiplicity of members, dynamical orbit and spin states, and member shapes. For instance, singly synchronous binaries have short separation distances between the two members, rapidly rotating oblate primary members, and tidally locked prolate secondary members. Other confirmed binary morphologies include doubly synchronous, tight asynchronous and wide asynchronous binaries. Related to these binary morphologies are unbound paired asteroid systems and bi-lobate contact binaries.A critical test for the YORP-induced rotational fission hypothesis is whether the binary asteroids produced evolve to the observed binary and related systems. In this talk I will review how this evolution is believed to occur according to gravitational dynamics, mutual body tides and the binary YORP effect.

Binary statistics among population II stars

NASA Astrophysics Data System (ADS)

Zinnecker, H.; Köhler, R.; Jahreiß, H.

2004-08-01

Population II stars are old, metal-poor, Galactic halo stars with high proper motion. We have carried out a visual binary survey of 164 halo stars in the solar neighborhood (median distance 100 pc), using infrared speckle interferometry, adaptive optics, and wide field direct imaging. The sample is based on the lists of Population II stars of Carney et al. (1994) and Norris (1986), with reliable distances from HIPPARCOS measurements. At face value, we found 33 binaries, 6 triples, and 1 quadruple system. When we limit ourselves to K-band flux ratios larger than 0.1 (to avoid background contamination), the numbers drop to 9 binaries and 1 triple, corresponding to a binary frequency of 6 - 7 % above our angular resolution limit of about 0.1 arcsec. If we count all systems with K-band flux ratios greater than 0.01, we obtain 15 more binaries and 3 more triples, corresponding to a binary frequency for projected separations in excess of 10 AU of around 20 %. This is to be compared with the frequency of spectroscopic binaries (up to a period of 3000 days) of Population II stars of about 15 % (Latham et al. 2002). We also determined a semi-major axis distribution for our visual Population II binary and triple systems, which appears to be remarkably different from that of Population I stars. Second epoch-observations must help confirm the reality of our results.

Optimization of binary thermodynamic and phase diagram data

NASA Astrophysics Data System (ADS)

Bale, Christopher W.; Pelton, A. D.

1983-03-01

An optimization technique based upon least squares regression is presented to permit the simultaneous analysis of diverse experimental binary thermodynamic and phase diagram data. Coefficients of polynomial expansions for the enthalpy and excess entropy of binary solutions are obtained which can subsequently be used to calculate the thermodynamic properties or the phase diagram. In an interactive computer-assisted analysis employing this technique, one can critically analyze a large number of diverse data in a binary system rapidly, in a manner which is fully self-consistent thermodynamically. Examples of applications to the Bi-Zn, Cd-Pb, PbCl2-KCl, LiCl-FeCl2, and Au-Ni binary systems are given.

Combined Effects and Cross-Interactions of Different Antibiotics and Polypeptides in Salmonella bredeney.

PubMed

Ju, Xiangyu; Zhu, Mengjiao; Han, Jinzhi; Lu, Zhaoxin; Zhao, Haizhen; Bie, Xiaomei

2018-05-24

Salmonella spp. are health-threatening foodborne pathogens. The increasingly common spread of antibiotic-resistant Salmonella spp. is a major public healthcare issue worldwide. In this study, we wished to explore (1) antibiotic or polypeptide combinations to inhibit multidrug-resistant Salmonella bredeney and (2) the regulation of cross-resistance and collateral sensitivity of antibiotics and polypeptides. We undertook a study to select antibiotic combinations. Then, we promoted drug-resistant strains of S. bredeney after 15 types of antibiotic treatment. From each evolving population, the S. bredeney strain was exposed to a particular single drug. Then, we analyzed how the evolved S. bredeney strains acquired resistance or susceptibility to other drugs. A total of 105 combinations were tested against S. bredeney following the protocols of CLSI-2016 and EUCAST-2017. The synergistic interactions between drug pairings were diverse. Notably, polypeptides were more likely to be linked to synergistic combinations: 56% (19/34) of the synergistic pairings were relevant to polypeptides. Simultaneously, macrolides demonstrated antagonism toward polypeptides. The latter were more frequently related to collateral sensitivity than the other drugs because the other 13 drugs sensitized S. bredeney to polypeptides. In an experimental evolution involving 15 drugs, single drug-evolved strains were examined against the other 14 drugs, and the results were compared with the minimal inhibitory concentration of the ancestral strain. Single drug-evolved S. bredeney strains could alter the sensitivity to other drugs, and S. bredeney evolution against antibiotics could sensitize it to polypeptides.

Application of the Double-Tangent Construction of Coexisting Phases to Any Type of Phase Equilibrium for Binary Systems Modeled with the Gamma-Phi Approach

ERIC Educational Resources Information Center

Jaubert, Jean-Noël; Privat, Romain

2014-01-01

The double-tangent construction of coexisting phases is an elegant approach to visualize all the multiphase binary systems that satisfy the equality of chemical potentials and to select the stable state. In this paper, we show how to perform the double-tangent construction of coexisting phases for binary systems modeled with the gamma-phi…

Radial Velocity Studies of Close Binary Stars. XI.

NASA Astrophysics Data System (ADS)

Pribulla, Theodor; Rucinski, Slavek M.; Lu, Wenxian; Mochnacki, Stefan W.; Conidis, George; Blake, R. M.; DeBond, Heide; Thomson, J. R.; Pych, Wojtek; Ogłoza, Waldemar; Siwak, Michal

2006-08-01

Radial-velocity measurements and sine-curve fits to orbital radial velocity variations are presented for 10 close binary systems: DU Boo, ET Boo, TX Cnc, V1073 Cyg, HL Dra, AK Her, VW LMi, V566 Oph, TV UMi, and AG Vir. With this contribution, the David Dunlap Observatory program has reached the point of 100 published radial velocity orbits. The radial velocities have been determined using an improved fitting technique that uses rotational profiles to approximate individual peaks in broadening functions. Three systems, ET Boo, VW LMi, and TV UMi, are found to be quadruple, while AG Vir appears to be a spectroscopic triple. ET Boo, a member of a close visual binary with Pvis=113 yr, was previously known to be a multiple system, but we show that the second component is actually a close, noneclipsing binary. The new observations have enabled us to determine the spectroscopic orbits of the companion, noneclipsing pairs in ET Boo and VW LMi. A particularly interesting case is VW LMi, for which the period of the mutual revolution of the two spectroscopic binaries is only 355 days. While most of the studied eclipsing pairs are contact binaries, ET Boo is composed of two double-lined detached binaries, and HL Dra is a single-lined detached or semidetached system. Five systems of this group have been observed spectroscopically before: TX Cnc, V1073 Cyg, AK Her (as a single-lined binary), V566 Oph, and AG Vir, but our new data are of much higher quality than in the previous studies. Based on data obtained at the David Dunlap Observatory, University of Toronto, Canada.

Candidate Binary Microlensing Events from the MACHO Project

NASA Astrophysics Data System (ADS)

Becker, A. C.; Alcock, C.; Allsman, R. A.; Alves, D. R.; Axelrod, T. S.; Bennett, D. P.; Cook, K. H.; Drake, A. J.; Freeman, K. C.; Griest, K.; King, L. J.; Lehner, M. J.; Marshall, S. L.; Minniti, D.; Peterson, B. A.; Popowski, P.; Pratt, M. R.; Quinn, P. J.; Rodgers, A. W.; Stubbs, C. W.; Sutherland, W.; Tomaney, A.; Vandehei, T.; Welch, D. L.; Baines, D.; Brakel, A.; Crook, B.; Howard, J.; Leach, T.; McDowell, D.; McKeown, S.; Mitchell, J.; Moreland, J.; Pozza, E.; Purcell, P.; Ring, S.; Salmon, A.; Ward, K.; Wyper, G.; Heller, A.; Kaspi, S.; Kovo, O.; Maoz, D.; Retter, A.; Rhie, S. H.; Stetson, P.; Walker, A.; MACHO Collaboration

1998-12-01

We present the lightcurves of 22 gravitational microlensing events from the first six years of the MACHO Project gravitational microlensing survey which are likely examples of lensing by binary systems. These events were selected from a total sample of ~ 300 events which were either detected by the MACHO Alert System or discovered through retrospective analyses of the MACHO database. Many of these events appear to have undergone a caustic or cusp crossing, and 2 of the events are well fit with lensing by binary systems with large mass ratios, indicating secondary companions of approximately planetary mass. The event rate is roughly consistent with predictions based upon our knowledge of the properties of binary stars. The utility of binary lensing in helping to solve the Galactic dark matter problem is demonstrated with analyses of 3 binary microlensing events seen towards the Magellanic Clouds. Source star resolution during caustic crossings in 2 of these events allows us to estimate the location of the lensing systems, assuming each source is a single star and not a short period binary. * MACHO LMC-9 appears to be a binary lensing event with a caustic crossing partially resolved in 2 observations. The resulting lens proper motion appears too small for a single source and LMC disk lens. However, it is considerably less likely to be a single source star and Galactic halo lens. We estimate the a priori probability of a short period binary source with a detectable binary character to be ~ 10 %. If the source is also a binary, then we currently have no constraints on the lens location. * The most recent of these events, MACHO 98-SMC-1, was detected in real-time. Follow-up observations by the MACHO/GMAN, PLANET, MPS, EROS and OGLE microlensing collaborations lead to the robust conclusion that the lens likely resides in the SMC.

Shaping planetary nebulae with jets in inclined triple stellar systems

NASA Astrophysics Data System (ADS)

Akashi, Muhammad; Soker, Noam

2017-08-01

We conduct three-dimensional hydrodynamical simulations of two opposite jets launched obliquely to the orbital plane around an asymptotic giant branch (AGB) star and within its dense wind, and demonstrate the formation of a 'messy' planetary nebula (PN), namely a PN lacking any type of symmetry (I.e. highly irregular). In building the initial conditions, we assume that a tight binary system orbits the AGB star and that the orbital plane of the tight binary system is inclined to the orbital plane of the binary system and the AGB star (the triple system plane). We further assume that the accreted mass on to the tight binary system forms an accretion disc around one of the stars and that the plane of the disc is tilted to the orbital plane of the triple system. The highly asymmetrical and filamentary structures that we obtain support the notion that messy PNe might be shaped by triple stellar systems.

Photometric detection of a candidate low-mass giant binary system at the Milky Way Galactic Center

NASA Astrophysics Data System (ADS)

Krishna Gautam, Abhimat; Do, Tuan; Ghez, Andrea; Sakai, Shoko; Morris, Mark; Lu, Jessica; Witzel, Gunther; Jia, Siyao; Becklin, Eric Eric; Matthews, Keith

2018-01-01

We present the discovery of a new periodic variable star at the Milky Way Galactic Center (GC). This study uses laser guide-star adaptive optics data collected with the W. M. Keck 10 m telescope in the K‧-band (2.2 µm) over 35 nights spanning an 11 year time baseline, and 5 nights of additional H-band (1.6 µm) data. We implemented an iterative photometric calibration and local correction technique, resulting in a photometric uncertainty of Δm_K‧ ∼ 0.03 to a magnitude of m_K‧ ∼ 16.The periodically variable star has a 39.42 day period. We find that the star is not consistent with known periodically variable star classes in this period range with its observed color and luminosity, nor with an eclipsing binary system. The star's color and luminosity are however consistent with an ellipsoidal binary system at the GC, consisting of a K-giant and a dwarf component with an orbital period of 78.84 days. If a binary system, it represents the first detection of a low-mass giant binary system in the central half parsec of the GC. Such long-period binary systems can easily evaporate in the dense environment of the GC due to interactions with other stars. The existence and properties of a low-mass, long-period binary system can thus place valuable constraints on dynamical models of the GC environment and probe the density of the hypothesized dark cusp of stellar remnants at the GC.

Thymus Polypeptide Preparation Tactivin Restores Learning and Memory in Thymectomied Rats.

PubMed

Novoseletskaya, A V; Kiseleva, N M; Zimina, I V; Bystrova, O V; Belova, O V; Inozemtsev, A N; Arion, V Ya; Sergienko, V I

2015-09-01

We studied the effects of tactivin and splenic polypeptides on learning and memory of thymectomized animals. In 3-week rats, thymectomy blocked active avoidance conditioning. Injections of tactivin (0.5 mg/kg) during 1 month after surgery restored learning capacity; splenic polypeptides were ineffective.

Thermophilic and thermoacidophilic sugar transporter genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.

2013-01-15

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for transporting sugars across cell membranes using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic metabolism genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, Vicki S.; Apel, William A.; Reed, David William; Lee, Brady D.; Thompson, David N.; Roberto, Francisco F.; Lacey, Jeffrey A.

2015-12-29

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for modulating or altering metabolism in a cell using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic metabolism genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, Vicki S; Apel, William A; Reed, David W; Lee, Brady D; Thompson, David N; Roberto, Francisco F; Lacey, Jeffrey A

2014-05-20

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for modulating or altering metabolism in a cell using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic glycosylation genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N; Apel, William A; Thompson, Vicki S; Reed, David W; Lacey, Jeffrey A

2017-06-14

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for glycosylating and/or post-translationally modifying proteins using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic sugar transporter genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N [Idaho Falls, ID; Apel, William A [Jackson, WY; Thompson, Vicki S [Idaho Falls, ID; Reed, David W [Idaho Falls, ID; Lacey, Jeffrey A [Idaho Falls, ID

2011-12-06

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for transporting sugars across cell membranes using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic sugar transporter genes and enzymes from alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N [Idaho Falls, ID; Apel, William A [Jackson, WY; Thompson, Vicki S [Idaho Falls, ID; Reed, David W [Idaho Falls, ID; Lacey, Jeffrey A [Idaho Falls, ID

2011-06-14

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for transporting sugars across cell membranes using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic sugar transporter genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.

2013-01-29

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for transporting sugars across cell membranes using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic glycosylation genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N.; Apel, William A.; Thompson, Vicki S.; Reed, David W.; Lacey, Jeffrey A.

2016-01-12

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for glycosylating and/or post-translationally modifying proteins using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic sugar transporter genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOEpatents

Thompson, David N; Apel, William A; Thompson, Vicki S; Reed, David W; Lacey, Jeffrey A

2013-11-05

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for transporting sugars across cell membranes using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Thermophilic and thermoacidophilic metabolism genes and enzymes from Alicyclobacillus acidocaldarius and related organisms, methods

DOE Office of Scientific and Technical Information (OSTI.GOV)

Thompson, Vicki S.; Apel, William A.; Lacey, Jeffrey A.

Isolated and/or purified polypeptides and nucleic acid sequences encoding polypeptides from Alicyclobacillus acidocaldarius are provided. Further provided are methods for modulating or altering metabolism in a cell using isolated and/or purified polypeptides and nucleic acid sequences from Alicyclobacillus acidocaldarius.

Spectral properties of binary asteroids

NASA Astrophysics Data System (ADS)

Pajuelo, Myriam; Birlan, Mirel; Carry, Benoît; DeMeo, Francesca E.; Binzel, Richard P.; Berthier, Jérôme

2018-07-01

We present the first attempt to characterize the distribution of taxonomic class among the population of binary asteroids (15 per cent of all small asteroids). For that, an analysis of 0.8-2.5 µm near-infrared spectra obtained with the SpeX instrument on the NASA/IRTF (Infrared Telescope Facility) is presented. Taxonomic class and meteorite analogue is determined for each target, increasing the sample of binary asteroids with known taxonomy by 21 per cent. Most binary systems are bound in the S, X, and C classes, followed by Q and V types. The rate of binary systems in each taxonomic class agrees within uncertainty with the background population of small near-Earth objects and inner main belt asteroids, but for the C types which are under-represented among binaries.

The architecture of the hierarchical triple star KOI 928 from eclipse timing variations seen in Kepler photometry

DOE PAGES

Steffen, J. H.; Quinn, S. N.; Borucki, W. J.; ...

2011-10-01

We present a hierarchical triple star system (KIC 9140402) where a low mass eclipsing binary orbits a more massive third star. The orbital period of the binary (4.98829 Days) is determined by the eclipse times seen in photometry from NASA's Kepler spacecraft. The periodically changing tidal field, due to the eccentric orbit of the binary about the tertiary, causes a change in the orbital period of the binary. The resulting eclipse timing variations provide insight into the dynamics and architecture of this system and allow the inference of the total mass of the binary (0.424±0.017M circle-dot) and the orbital parametersmore » of the binary about the central star.« less

Orbital period changes of OB-type contact binaries and their implications for the triplicity, formation and evolution of this type of binary stars

NASA Astrophysics Data System (ADS)

Qian, S.-B.; Kreiner, J. M.; Liu, L.; He, J.-J.; Zhu, L.-Y.; Yuan, J.-Z.; Dai, Z.-B.

2007-08-01

Orbital period variations of NINE well-observed OB-type contact binary stars, LY Aur, BH Cen, V382 CYg, V729 Cyg, AW Lac, TU Mus, RZ Pyx, V701 Sco and CT Tau, are investigated in detail. Of the nine systems, V701 Sco and CT Tau are two contact binaries containing twin components with a mass ratio of unit, LY Aur and V729 Cyg have the longest period among contact binary stars (P=4.0 and 6.6 days, respectively), and BH Cen and V701 Sco are the members of two extremely young galactic cluster IC 2994 and NGC 6383. It is discovered that, apart from the two systems with twin components (V701 Sco and CT Tau), the orbital periods of the rest SEVEN binary stars show a long-term increase. This is different from the situations of the late-type (W UMa-type) contact binaries where both secular period increase and decrease are usually encountered, indicating that magnetic field may play an important role in causing the long-term period decrease of W UMa-type contact binary stars. The fact that no long-term continuous period variations were found for V701 Sco and CT Tau may suggest that contact binary with twin components can be in an equilibrium. Based on the rates of period changes (dP/dt) of the SEVEN sample binary stars, statistical relations between dP/dt and orbital period (P) and the mean density of the secondary component were found. Our results suggest that the period increases of the short-period systems (P<2 days) may be mainly caused by a mass transfer from the less massive component to the more massive one, while for the long-period ones (P>2 days), LY Aur and V729 Cyg, their period increases may be resulted from a combination of stellar wind and mass transfer from the secondary to the primary. Meanwhile, cyclic period changes are found for all of the nine binary systems. Those periodic variations can be plausibly explained as the results of light-travel time effects suggesting that they are triple systems. The astrophysical parameters of the tertiary components in the nine systems have been determined. The tertiary components in the seven binaries, BH Cen, V382 Cyg, AW Lac, TU Mus, RZ Pyx, V701 Sco and CT Tau, may be invisible, while those in LY Aur and V729 Cyg may be the fainter visual companions in the two systems. It is possible that the tertiary components in those binaries played an important role for the formations and evolutions of the contact configurations by bringing angular momentum out from the central systems. Thus they have initial short period and can evolve into a contact configuration in a short timescale.

Accreting Black Hole Binaries in Globular Clusters

NASA Astrophysics Data System (ADS)

Kremer, Kyle; Chatterjee, Sourav; Rodriguez, Carl L.; Rasio, Frederic A.

2018-01-01

We explore the formation of mass-transferring binary systems containing black holes (BHs) within globular clusters (GC). We show that it is possible to form mass-transferring BH binaries with main sequence, giant, and white dwarf companions with a variety of orbital parameters in GCs spanning a large range in present-day properties. All mass-transferring BH binaries found in our models at late times are dynamically created. The BHs in these systems experienced a median of ∼30 dynamical encounters within the cluster before and after acquiring the donor. Furthermore, we show that the presence of mass-transferring BH systems has little correlation with the total number of BHs within the cluster at any time. This is because the net rate of formation of BH–non-BH binaries in a cluster is largely independent of the total number of retained BHs. Our results suggest that the detection of a mass-transferring BH binary in a GC does not necessarily indicate that the host cluster contains a large BH population.

The iron complex in high mass X-ray binaries

NASA Astrophysics Data System (ADS)

Giménez-García, A.; Torrejón, J. M.; Martínez-Núñez, S.; Rodes-Rocas, J. J.; Bernabéu, G.

2013-05-01

An X-ray binary system consists of a compact object (a white dwarf, a neutron star or a black hole) accreting material from an optical companion star. The spectral type of the optical component strongly affects the mass transfer to the compact object. This is the reason why X-ray binary systems are usually divided in High Mass X-ray Binaries (companion O or B type, denoted HMXB) and Low Mass X-ray Binaries (companion type A or later). The HMXB are divided depending on the partner's luminosity class in two main groups: the Supergiant X-ray Binaries (SGXB) and Be X-ray Binaries (BeXB). We introduce the spectral characterization of a sample of 9 High Mass X-ray Binaries in the iron complex (˜ 6-7 keV). This spectral range is a fundamental tool in the study of the surrounding material of these systems. The sources have been divided into three main groups according to their current standard classification: SGXB, BeXB and γ Cassiopeae-like. The purpose of this work is to look for qualitative patterns in the iron complex, around 6-7 keV, in order to discern between current different classes that make up the group of HMXB. We find significant spectral patterns for each of the sets, reflecting differences in accretion physics thereof.

Using porphyrin-amino acid pairs to model the electrochemistry of heme proteins: experimental and theoretical investigations.

PubMed

Samajdar, Rudra N; Manogaran, Dhivya; Yashonath, S; Bhattacharyya, Aninda J

2018-04-18

Quasi reversibility in electrochemical cycling between different oxidation states of iron is an often seen characteristic of iron containing heme proteins that bind dioxygen. Surprisingly, the system becomes fully reversible in the bare iron-porphyrin complex: hemin. This leads to the speculation that the polypeptide bulk (globin) around the iron-porphyrin active site in these heme proteins is probably responsible for the electrochemical quasi reversibility. To understand the effect of such polypeptide bulk on iron-porphyrin, we study the interaction of specific amino acids with the hemin center in solution. We choose three representative amino acids-histidine (a well-known iron coordinator in bio-inorganic systems), tryptophan (a well-known fluoroprobe for proteins), and cysteine (a redox-active organic molecule). The interactions of these amino acids with hemin are studied using electrochemistry, spectroscopy, and density functional theory. The results indicate that among these three, the interaction of histidine with the iron center is strongest. Further, histidine maintains the electrochemical reversibility of iron. On the other hand, tryptophan and cysteine interact weakly with the iron center but disturb the electrochemical reversibility by contributing their own redox active processes to the system. Put together, this study attempts to understand the molecular interactions that can control electrochemical reversibility in heme proteins. The results obtained here from the three representative amino acids can be scaled up to build a heme-amino acid interaction database that may predict the electrochemical properties of any protein with a defined polypeptide sequence.

Gaia Assorted Mass Binaries Long Excluded from SLoWPoKES (GAMBLES): Identifying Ultra-wide Binary Pairs with Components of Diverse Mass

DOE Office of Scientific and Technical Information (OSTI.GOV)

Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav, E-mail: ryan.j.oelkers@vanderbilt.edu

The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >10{sup 3} au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded frommore » SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 10{sup 3} and 10{sup 5.5} au (0.002–1.5 pc), using the published distances and proper motions from the Tycho -Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc; even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.« less

Gaia Assorted Mass Binaries Long Excluded from SLoWPoKES (GAMBLES): Identifying Ultra-wide Binary Pairs with Components of Diverse Mass

NASA Astrophysics Data System (ADS)

Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav

2017-06-01

The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >103 au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded from SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 103 and 105.5 au (0.002-1.5 pc), using the published distances and proper motions from the Tycho-Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.

COSMIC probes into compact binary formation and evolution

NASA Astrophysics Data System (ADS)

Breivik, Katelyn

2018-01-01

The population of compact binaries in the galaxy represents the final state of all binaries that have lived up to the present epoch. Compact binaries present a unique opportunity to probe binary evolution since many of the interactions binaries experience can be imprinted on the compact binary population. By combining binary evolution simulations with catalogs of observable compact binary systems, we can distill the dominant physical processes that govern binary star evolution, as well as predict the abundance and variety of their end products.The next decades herald a previously unseen opportunity to study compact binaries. Multi-messenger observations from telescopes across all wavelengths and gravitational-wave observatories spanning several decades of frequency will give an unprecedented view into the structure of these systems and the composition of their components. Observations will not always be coincident and in some cases may be separated by several years, providing an avenue for simulations to better constrain binary evolution models in preparation for future observations.I will present the results of three population synthesis studies of compact binary populations carried out with the Compact Object Synthesis and Monte Carlo Investigation Code (COSMIC). I will first show how binary-black-hole formation channels can be understood with LISA observations. I will then show how the population of double white dwarfs observed with LISA and Gaia could provide a detailed view of mass transfer and accretion. Finally, I will show that Gaia could discover thousands black holes in the Milky Way through astrometric observations, yielding view into black-hole astrophysics that is complementary to and independent from both X-ray and gravitational-wave astronomy.

Identification of binary and multiple systems in TGAS using the Virtual Observatory

NASA Astrophysics Data System (ADS)

Jiménez-Esteban, F.; Solano, E.

2018-04-01

Binary and multiple stars have long provided an effective method of testing stellar formation and evolution theories. In particular, wide binary systems with separations > 20,000 au are particularly challenging as their physical separations are beyond the typical size of a collapsing cloud core (5,000 - 10,000 au). We present here a preliminary work in which we make use of the TGAS catalogue and Virtual Observatory tools and services (Aladin, TOPCAT, STILTS, VOSA, VizieR) to identify binary and multiple star candidate systems. The catalogue will be available from the Spanish VO portal (http://svo.cab.inta-csic.es) in the coming months.

The massive multiple system HD 64315

NASA Astrophysics Data System (ADS)

Lorenzo, J.; Simón-Díaz, S.; Negueruela, I.; Vilardell, F.; Garcia, M.; Evans, C. J.; Montes, D.

2017-10-01

Context. The O6 Vn star HD 64315 is believed to belong to the star-forming region known as NGC 2467, but previous distance estimates do not support this association. Moreover, it has been identified as a spectroscopic binary, but existing data support contradictory values for its orbital period. Aims: We explore the multiple nature of this star with the aim of determining its distance, and understanding its connection to NGC 2467. Methods: A total of 52 high-resolution spectra have been gathered over a decade. We use their analysis, in combination with the photometric data from All Sky Automated Survey and Hipparcos catalogues, to conclude that HD 64315 is composed of at least two spectroscopic binaries, one of which is an eclipsing binary. We have developed our own program to fit four components to the combined line shapes. Once the four radial velocities were derived, we obtained a model to fit the radial-velocity curves using the Spectroscopic Binary Orbit Program (SBOP). We then implemented the radial velocities of the eclipsing binary and the light curves in the Wilson-Devinney code iteratively to derive stellar parameters for its components. We were also able to analyse the non-eclipsing binary, and to derive minimum masses for its components which dominate the system flux. Results: HD 64315 contains two binary systems, one of which is an eclipsing binary. The two binaries are separated by 0.09 arcsec (or 500 AU) if the most likely distance to the system, 5 kpc, is considered. The presence of fainter companions is not excluded by current observations. The non-eclipsing binary (HD 64315 AaAb) has a period of 2.70962901 ± 0.00000021 d. Its components are hotter than those of the eclipsing binary, and dominate the appearance of the system. The eclipsing binary (HD 64315 BaBb) has a shorter period of 1.0189569 ± 0.0000008 d. We derive masses of 14.6 ± 2.3 M⊙ for both components of the BaBb system. They are almost identical; both stars are overfilling their respective Roche lobes, and share a common envelope in an overcontact configuration. The non-eclipsing binary is a detached system composed of two stars with spectral types around O6 V with minimum masses of 10.8 M⊙ and 10.2 M⊙, and likely masses ≈ 30 M⊙. Conclusions: HD 64315 provides a cautionary tale about high-mass star isolation and multiplicity. Its total mass is likely above 90M⊙, but it seems to have formed without an accompanying cluster. It contains one the most massive overcontact binaries known, a likely merger progenitor in a very wide multiple system. Based on observations obtained at the European Southern Observatory under programmes 078.D-0665(A), 082-D.0136 and 093.A-9001(A). Based on observations made with the Nordic Optical Telescope, operated on the island of La Palma jointly by Denmark, Finland, Iceland, Norway, and Sweden, in the Spanish Observatorio del Roque de los Muchachos of the Instituto de Astrofísica de Canarias.

Binary Microlensing Events from the MACHO Project

NASA Astrophysics Data System (ADS)

Alcock, C.; Allsman, R. A.; Alves, D.; Axelrod, T. S.; Baines, D.; Becker, A. C.; Bennett, D. P.; Bourke, A.; Brakel, A.; Cook, K. H.; Crook, B.; Crouch, A.; Dan, J.; Drake, A. J.; Fragile, P. C.; Freeman, K. C.; Gal-Yam, A.; Geha, M.; Gray, J.; Griest, K.; Gurtierrez, A.; Heller, A.; Howard, J.; Johnson, B. R.; Kaspi, S.; Keane, M.; Kovo, O.; Leach, C.; Leach, T.; Leibowitz, E. M.; Lehner, M. J.; Lipkin, Y.; Maoz, D.; Marshall, S. L.; McDowell, D.; McKeown, S.; Mendelson, H.; Messenger, B.; Minniti, D.; Nelson, C.; Peterson, B. A.; Popowski, P.; Pozza, E.; Purcell, P.; Pratt, M. R.; Quinn, J.; Quinn, P. J.; Rhie, S. H.; Rodgers, A. W.; Salmon, A.; Shemmer, O.; Stetson, P.; Stubbs, C. W.; Sutherland, W.; Thomson, S.; Tomaney, A.; Vandehei, T.; Walker, A.; Ward, K.; Wyper, G.

2000-09-01

We present the light curves of 21 gravitational microlensing events from the first six years of the MACHO Project gravitational microlensing survey that are likely examples of lensing by binary systems. These events were manually selected from a total sample of ~350 candidate microlensing events that were either detected by the MACHO Alert System or discovered through retrospective analyses of the MACHO database. At least 14 of these 21 events exhibit strong (caustic) features, and four of the events are well fit with lensing by large mass ratio (brown dwarf or planetary) systems, although these fits are not necessarily unique. The total binary event rate is roughly consistent with predictions based upon our knowledge of the properties of binary stars, but a precise comparison cannot be made without a determination of our binary lens event detection efficiency. Toward the Galactic bulge, we find a ratio of caustic crossing to noncaustic crossing binary lensing events of 12:4, excluding one event for which we present two fits. This suggests significant incompleteness in our ability to detect and characterize noncaustic crossing binary lensing. The distribution of mass ratios, N(q), for these binary lenses appears relatively flat. We are also able to reliably measure source-face crossing times in four of the bulge caustic crossing events, and recover from them a distribution of lens proper motions, masses, and distances consistent with a population of Galactic bulge lenses at a distance of 7+/-1 kpc. This analysis yields two systems with companions of ~0.05 Msolar.

Identification of bovine sperm acrosomal proteins that interact with a 32-kDa acrosomal matrix protein.

PubMed

Nagdas, Subir K; Smith, Linda; Medina-Ortiz, Ilza; Hernandez-Encarnacion, Luisa; Raychoudhury, Samir

2016-03-01

Mammalian fertilization is accomplished by the interaction between sperm and egg. Previous studies from this laboratory have identified a stable acrosomal matrix assembly from the bovine sperm acrosome termed the outer acrosomal membrane-matrix complex (OMC). This stable matrix assembly exhibits precise binding activity for acrosin and N-acetylglucosaminidase. A highly purified OMC fraction comprises three major (54, 50, and 45 kDa) and several minor (38-19 kDa) polypeptides. The set of minor polypeptides (38-19 kDa) termed "OMCrpf polypeptides" is selectively solubilized by high-pH extraction (pH 10.5), while the three major polypeptides (55, 50, and 45 kDa) remain insoluble. Proteomic identification of the OMC32 polypeptide (32 kDa polypeptide isolated from high-pH soluble fraction of OMC) yielded two peptides that matched the NCBI database sequence of acrosin-binding protein. Anti-OMC32 recognized an antigenically related family of polypeptides (OMCrpf polypeptides) in the 38-19-kDa range with isoelectric points ranging between 4.0 and 5.1. Other than glycohydrolases, OMC32 may also be complexed to other acrosomal proteins. The present study was undertaken to identify and localize the OMC32 binding polypeptides and to elucidate the potential role of the acrosomal protein complex in sperm function. OMC32 affinity chromatography of a detergent-soluble fraction of bovine cauda sperm acrosome followed by mass spectrometry-based identification of bound proteins identified acrosin, lactadherin, SPACA3, and IZUMO1. Co-immunoprecipitation analysis also demonstrated the interaction of OMC32 with acrosin, lactadherin, SPACA3, and IZUMO1. Our immunofluorescence studies revealed the presence of SPACA3 and lactadherin over the apical segment, whereas IZUMO1 is localized over the equatorial segment of Triton X-100 permeabilized cauda sperm. Immunoblot analysis showed that a significant portion of SPACA3 was released after the lysophosphatidylcholine (LPC)-induced acrosome reaction, whereas the IZUMO1 and lactadherin polypeptides remain associated to the particulate fraction. Almost entire population of bovine sperm IZUMO1 relocates to the equatorial segment during the LPC-induced acrosome reaction. We propose that the interaction of OMC32 matrix polypeptide with detergent-soluble acrosomal proteins regulates the release of hydrolases/other acrosomal protein(s) during the acrosome reaction.

A contact binary asteroid evolutionary cycle driven by BYORP & the classical Laplace plane

NASA Astrophysics Data System (ADS)

Rieger, Samantha; Scheeres, Daniel J.

2017-10-01

Several contact binaries have been observed to have high obliquities distributed around 90°. With this information, we explore the possibility of these high obliquities being a key characteristic that causes an evolutionary cycle of contact binary formation and separation.The contact binary cycle begins with a single asteroid that is spinning up due to the YORP effect. For the binary cycle we assume YORP will drive the obliquity to 90°. Eventually, the asteroid will reach a critical spin frequency that will cause the asteroid to fission into a binary. We assume that the mass-ratio, q, of the system is greater than 0.2. With a high q, the secondary will not escape/impact the primary but will evolve through tides into a stable circular double-synchronous orbit. The binary being synchronous will cause the forces from BYORP to have secular effects on the system. For this cycle, BYORP will need to expand the secondary away from the primary.As the system expands, we have found that the secondary will follow the classical Laplace plane. Therefore, the secondary’s orbit will increase in inclination with respect to the equator as the secondary’s orbit expands. The Laplace plane is a stable orbit to perturbations from J2 & Sun tides except for an instability region that exists for primaries with obliquities above 68.875° & a secondary orbital radius of 13.5-19.5 primary radii. Once BYORP expands the secondary into this instability region, the eccentricity of the secondary’s orbit will increase until the orbit intersects with the primary & causes an impact. This impact will create a contact binary with a new obliquity that will randomly range from 23°-150°. The cycle will begin again with YORP driving the contact binary to an obliquity of 90°.Our contribution will discuss the proposed contact binary cycle in more detail, including the mechanics of the system that drives the events given above. We will include investigations into how losing synchronous lock will disrupt the eccentricity growth in the Laplace plane instability region. We will also discuss the time scales of each event to help predict which part of the cycle we will most likely to be observing when discovering new contact binaries & binary systems.

High-resolution spectroscopy of extremely metal-poor stars from SDSS/Segue. II. Binary fraction

DOE Office of Scientific and Technical Information (OSTI.GOV)

Aoki, Wako; Suda, Takuma; Beers, Timothy C.

2015-02-01

The fraction of binary systems in various stellar populations of the Galaxy and the distribution of their orbital parameters are important but not well-determined factors in studies of star formation, stellar evolution, and Galactic chemical evolution. While observational studies have been carried out for a large sample of nearby stars, including some metal-poor Population II stars, almost no constraints on the binary nature for extremely metal-poor (EMP; [Fe/H] <−3.0) stars have yet been obtained. Here we investigate the fraction of double-lined spectroscopic binaries and carbon-enhanced metal-poor (CEMP) stars, many of which could have formed as pairs of low-mass and intermediate-massmore » stars, to estimate the lower limit of the fraction of binary systems having short periods. The estimate is based on a sample of very metal-poor stars selected from the Sloan Digital Sky Survey and observed at high spectral resolution in a previous study by Aoki et al. That survey reported 3 double-lined spectroscopic binaries and 11 CEMP stars, which we consider along with a sample of EMP stars from the literature compiled in the SAGA database. We have conducted measurements of the velocity components for stacked absorption features of different spectral lines for each double-lined spectroscopic binary. Our estimate indicates that the fraction of binary stars having orbital periods shorter than 1000 days is at least 10%, and possibly as high as 20% if the majority of CEMP stars are formed in such short-period binaries. This result suggests that the period distribution of EMP binary systems is biased toward short periods, unless the binary fraction of low-mass EMP stars is significantly higher than that of other nearby stars.« less

Embedded binaries and their dense cores

NASA Astrophysics Data System (ADS)

Sadavoy, Sarah I.; Stahler, Steven W.

2017-08-01

We explore the relationship between young, embedded binaries and their parent cores, using observations within the Perseus Molecular Cloud. We combine recently published Very Large Array observations of young stars with core properties obtained from Submillimetre Common-User Bolometer Array 2 observations at 850 μm. Most embedded binary systems are found towards the centres of their parent cores, although several systems have components closer to the core edge. Wide binaries, defined as those systems with physical separations greater than 500 au, show a tendency to be aligned with the long axes of their parent cores, whereas tight binaries show no preferred orientation. We test a number of simple, evolutionary models to account for the observed populations of Class 0 and I sources, both single and binary. In the model that best explains the observations, all stars form initially as wide binaries. These binaries either break up into separate stars or else shrink into tighter orbits. Under the assumption that both stars remain embedded following binary break-up, we find a total star formation rate of 168 Myr-1. Alternatively, one star may be ejected from the dense core due to binary break-up. This latter assumption results in a star formation rate of 247 Myr-1. Both production rates are in satisfactory agreement with current estimates from other studies of Perseus. Future observations should be able to distinguish between these two possibilities. If our model continues to provide a good fit to other star-forming regions, then the mass fraction of dense cores that becomes stars is double what is currently believed.

Multiphase, multicomponent phase behavior prediction

NASA Astrophysics Data System (ADS)

Dadmohammadi, Younas

Accurate prediction of phase behavior of fluid mixtures in the chemical industry is essential for designing and operating a multitude of processes. Reliable generalized predictions of phase equilibrium properties, such as pressure, temperature, and phase compositions offer an attractive alternative to costly and time consuming experimental measurements. The main purpose of this work was to assess the efficacy of recently generalized activity coefficient models based on binary experimental data to (a) predict binary and ternary vapor-liquid equilibrium systems, and (b) characterize liquid-liquid equilibrium systems. These studies were completed using a diverse binary VLE database consisting of 916 binary and 86 ternary systems involving 140 compounds belonging to 31 chemical classes. Specifically the following tasks were undertaken: First, a comprehensive assessment of the two common approaches (gamma-phi (gamma-ϕ) and phi-phi (ϕ-ϕ)) used for determining the phase behavior of vapor-liquid equilibrium systems is presented. Both the representation and predictive capabilities of these two approaches were examined, as delineated form internal and external consistency tests of 916 binary systems. For the purpose, the universal quasi-chemical (UNIQUAC) model and the Peng-Robinson (PR) equation of state (EOS) were used in this assessment. Second, the efficacy of recently developed generalized UNIQUAC and the nonrandom two-liquid (NRTL) for predicting multicomponent VLE systems were investigated. Third, the abilities of recently modified NRTL model (mNRTL2 and mNRTL1) to characterize liquid-liquid equilibria (LLE) phase conditions and attributes, including phase stability, miscibility, and consolute point coordinates, were assessed. The results of this work indicate that the ϕ-ϕ approach represents the binary VLE systems considered within three times the error of the gamma-ϕ approach. A similar trend was observed for the for the generalized model predictions using quantitative structure-property parameter generalizations (QSPR). For ternary systems, where all three constituent binary systems were available, the NRTL-QSPR, UNIQUAC-QSPR, and UNIFAC-6 models produce comparable accuracy. For systems where at least one constituent binary is missing, the UNIFAC-6 model produces larger errors than the QSPR generalized models. In general, the LLE characterization results indicate the accuracy of the modified models in reproducing the findings of the original NRTL model.

How do binary separations depend on cloud initial conditions?

NASA Astrophysics Data System (ADS)

Sterzik, M. F.; Durisen, R. H.; Zinnecker, H.

2003-11-01

We explore the consequences of a star formation scenario in which the isothermal collapse of a rotating, star-forming core is followed by prompt fragmentation into a cluster containing a small number (N <~ 10) of protostars and/or substellar objects. The subsequent evolution of the cluster is assumed to be dominated by dynamical interactions among cluster members, and this establishes the final properties of the binary and multiple systems. The characteristic scale of the fragmenting core is determined by the cloud initial conditions (such as temperature, angular momentum and mass), and we are able to relate the separation distributions of the final binary population to the properties of the star-forming core. Because the fragmentation scale immediately after the isothermal collapse is typically a factor of 3-10 too large, we conjecture that fragmentation into small clusters followed by dynamical evolution is required to account for the observed binary separation distributions. Differences in the environmental properties of the cores are expected to imprint differences on the characteristic dimensions of the binary systems they form. Recent observations of hierarchical systems, differences in binary characteristics among star forming regions and systematic variations in binary properties with primary mass can be interpreted in the context of this scenario.

Dynamical evolution of a fictitious population of binary Neptune Trojans

NASA Astrophysics Data System (ADS)

Brunini, Adrián

2018-03-01

We present numerical simulations of the evolution of a synthetic population of Binary Neptune Trojans, under the influence of the solar perturbations and tidal friction (the so-called Kozai cycles and tidal friction evolution). Our model includes the dynamical influence of the four giant planets on the heliocentric orbit of the binary centre of mass. In this paper, we explore the evolution of initially tight binaries around the Neptune L4 Lagrange point. We found that the variation of the heliocentric orbital elements due to the libration around the Lagrange point introduces significant changes in the orbital evolution of the binaries. Collisional processes would not play a significant role in the dynamical evolution of Neptune Trojans. After 4.5 × 109 yr of evolution, ˜50 per cent of the synthetic systems end up separated as single objects, most of them with slow diurnal rotation rate. The final orbital distribution of the surviving binary systems is statistically similar to the one found for Kuiper Belt Binaries when collisional evolution is not included in the model. Systems composed by a primary and a small satellite are more fragile than the ones composed by components of similar sizes.

An accessible echelle pipeline and its application to a binary star

NASA Astrophysics Data System (ADS)

Carmichael, Theron; Johnson, John Asher

2018-01-01

Nearly every star observed in the Galaxy has one or more companions that play an integral role in the evolution of the star. Whether it is a planet or another star, a companion opens up opportunities for unique forms of analysis to be done on a system. Some 2400 lightyears away, there is a 3-10 Myr old binary system called KH 15D, which not only includes two T Tauri K-type stars in a close orbit of 48 days, but also a truncated, coherently precessing warped disk in a circumbinary orbit.In binary systems, a double-lined spectroscopic binary may be observable in spectra. This is a spectrum that contains a mixture of each star's properties and manifests as two sets of spectral emission and absorption lines that correspond to each star. Slightly different is a single-lined spectroscopic binary, where only one set of spectral lines from one star is visible. The data of KH 15D are studied in the form of a double single-lined spectroscopic binary. This means that at two separate observing times, a single-lined spectroscopic binary is obtained from one of the stars of KH 15D. This is possible because of the circumbinary disk that blocks one star at a time from view.Here, we study this binary system with a combination of archival echelle data from the Keck Observatory and new echelle data from Las Campanas Observatory. This optical data is reduced with a new Python-based pipeline available on GitHub. The objective is to measure the mass function of the binary star and refine the current values of each star's properties.

Research on the Orbital Period of Massive Binaries

NASA Astrophysics Data System (ADS)

Zhao, E.; Qain, S.

2011-12-01

Massive binary is the kind of binary, whose spectral type is earlier than B5. Research on massive binary plays an important role in the mass and angular momentum transfer or loss between the components, and the evolution of binary. Some massive binaries are observed and analyzed, including O-type binary LY Aur, B-type contact binary RZ Pyx and B-type semi-detached binary AI Cru. It is found that all of their periods have a long-term increasing, which indicates that the system is undergoing a Case A slow mass transfer stage on the nuclear time-scale of the secondary. Moreover, analysis show a cyclic change of orbital period, which can be explained by the light-travel effect time of the third body.

Induction, immunochemical identity and immunofluorescence localization of an 80 000-molecular-weight peroxisome-proliferation-associated polypeptide (polypeptide PPA-80) and peroxisomal enoyl-CoA hydratase of mouse liver and renal cortex.

PubMed

Lalwani, N D; Reddy, M K; Mangkornkanok-Mark, M; Reddy, J K

1981-07-15

The hypolipidaemic drugs methyl clofenapate, BR-931, Wy-14643 and procetofen induced a marked proliferation of peroxisomes in the parenchymal cells of liver and the proximal-convoluted-tubular epithelium of mouse kidney. The proliferation of peroxisomes was associated with 6-12-fold increase in the peroxisomal palmitoyl-CoA oxidizing capacity of the mouse liver. Enhanced activity of the peroxisomal palmitoyl-CoA oxidation system was also found in the renal-cortical homogenates of hypolipidaemic-drug-treated mice. The activity of enoyl-CoA hydratase in the mouse liver increased 30-50-fold and in the kidney cortex 3-5-fold with hypolipidaemic-drug-induced peroxisome proliferation in these tissues, and over 95% of this induced activity was found to be heat-labile peroxisomal enzyme in both organs. Sodium dodecyl sulphate/polyacrylamide-gel-electrophoretic analysis of large-particle and microsomal fractions obtained from the liver and kidney cortex of mice treated with hypolipidaemic peroxisome proliferators demonstrated a substantial increase in the quantity of an 80000-mol.wt. peroxisome-proliferation-associated polypeptide (polypeptide PPA-80). The heat-labile peroxisomal enoyl-CoA hydratase was purified from the livers of mice treated with the hypolipidaemic drug methyl clofenapate; the antibodies raised against this electrophoretically homogeneous protein yielded a single immunoprecipitin band with purified mouse liver enoyl-CoA hydratase and with liver and kidney cortical extracts of normal and hypolipidaemic-drug-treated mice. These anti-(mouse liver enoyl-CoA hydratase) antibodies also cross-reacted with purified rat liver enoyl-CoA hydratase and with the polypeptide PPA-80 obtained from rat and mouse liver. Immunofluorescence studies with anti-(polypeptide PPA-80) and anti-(peroxisomal enoyl-CoA hydratase) provided visual evidence for the localization and induction of polypeptide PPA-80 and peroxisomal enoyl-CoA hydratase in the liver and kidney respectively of normal and hypolipidaemic-drug-treated mice. In the kidney, the distribution of these two proteins is identical and limited exclusively to the cytoplasm of proximal-convoluted-tubular epithelium. The immunofluorescence studies clearly complement the biochemical and ultrastructural observations of peroxisome induction in the liver and kidney cortex of mice fed on hypolipidaemic drugs. In addition, preliminary ultrastructural studies with the protein-A-gold-complex technique demonstrate that the heat-labile hepatic enoyl-CoA hydratase is localized in the peroxisome matrix.

Three polypeptides screened from phage display random peptide library may be the receptor polypeptide of Mycoplasma genitalium adhesion protein.

PubMed

Deng, Xiangying; Zhu, Youcong; Dai, Pei; Yu, Minjun; Chen, Liesong; Zhu, Cuiming; You, Xiaoxing; Li, Lingling; Zeng, Yanhua

2018-04-28

Mycoplasma genitalium adhesion protein (MgPa) is a major adhesin of M. genitalium, a human pathogen associated with a series of genitourinary tract diseases. MgPa plays a very important role in M. genitalium adhering to the host cells. However, the exact receptor peptides or proteins of MgPa are still poorly understood so far. Three polypeptides (V-H-W-D-F-R-Q-W-W-Q-P-S), (D-W-S-S-W-V -Y-R-D-P-Q-T) and (H-Y-I-D-F-R-W) were previously screened from a phage display random peptide library using recombinant MgPa (rMgPa) as a target molecule. In this study, three polypeptides were artificially synthesized and investigated as to whether they are potential receptors of MgPa. We found that rMgPa specifically bound to three synthesized polypeptides as determined via an indirect enzyme-linked immunosorbent assay (ELISA). Moreover, three polypeptides were further identified by indirect immunofluorescence microscopy (IFM). We confirmed that rMgPa and M. genitalium can adhere to SV-HUC-1 cells in vitro and that anti-rMgPa antibody and three synthesized polypeptides can partially inhibit the adherence of rMgPa and M. genitalium to SV-HUC-1 cells. In summary, these three polypeptides may be the essential receptor peptides of MgPa, and may aid in enhancing the understanding of biological function of MgPa and the possible pathogenic mechanism of M. genitalium. Copyright © 2018 Elsevier Ltd. All rights reserved.

Effect of Aerobic Priming on the Response of Echinochloa crus-pavonis to Anaerobic Stress (Protein Synthesis and Phosphorylation).

PubMed Central

Zhang, F.; Lin, J. J.; Fox, T. C.; Mujer, C. V.; Rumpho, M. E.; Kennedy, R. A.

1994-01-01

Echinochloa species differ in their ability to germinate and grow in the absence of oxygen. Seeds of Echinochloa crus-pavonis (H.B.K.) Schult do not germinate under anoxia but remain viable for extended periods (at least 30 d) when incubated in an anaerobic environment. E. crus-pavonis can be induced to germinate and grow in an anaerobic environment if the seeds are first subjected to a short (1-18 h) exposure to aerobic conditions (aerobic priming). Changes in polypeptide patterns (constitutive and de novo synthesized) and protein phosphorylation induced by aerobic priming were investigated. In the absence of aerobic priming protein degradation was not evident under anaerobic conditions, although synthesis of a 20-kD polypeptide was induced. During aerobic priming, however, synthesis of 37- and 55-kD polypeptides was induced and persisted upon return of the seeds to anoxia. Furthermore, phosphorylation of two 18-kD polypeptides was observed only in those seeds that were labeled with 32PO4 during the aerobic priming period. Subsequent chasing in an anaerobic environment resulted in a decrease in phosphorylation of these polypeptides. Likewise, phosphorylation of the 18-kD polypeptides was not observed if the seeds were labeled in an anaerobic atmosphere. These results suggest that the regulated induction of the 20-, 37-, and 55- kD polypeptides may be important for anaerobic germination and growth of E. crus-pavonis and that the specific phosphorylation of the 18-kD polypeptides may be a factor in regulating this induction. PMID:12232272

Surface active complexes formed between keratin polypeptides and ionic surfactants.

PubMed

Pan, Fang; Lu, Zhiming; Tucker, Ian; Hosking, Sarah; Petkov, Jordan; Lu, Jian R

2016-12-15

Keratins are a group of important proteins in skin and hair and as biomaterials they can provide desirable properties such as strength, biocompatibility, and moisture regaining and retaining. The aim of this work is to develop water-soluble keratin polypeptides from sheep wool and then explore how their surface adsorption behaves with and without surfactants. Successful preparation of keratin samples was demonstrated by identification of the key components from gel electrophoresis and the reproducible production of gram scale samples with and without SDS (sodium dodecylsulphate) during wool fibre dissolution. SDS micelles could reduce the formation of disulphide bonds between keratins during extraction, reducing inter-molecular crosslinking and improving keratin polypeptide solubility. However, Zeta potential measurements of the two polypeptide batches demonstrated almost identical pH dependent surface charge distributions with isoelectric points around pH 3.5, showing complete removal of SDS during purification by dialysis. In spite of different solubility from the two batches of keratin samples prepared, very similar adsorption and aggregation behavior was revealed from surface tension measurements and dynamic light scattering. Mixing of keratin polypeptides with SDS and C 12 TAB (dodecyltrimethylammonium bromide) led to the formation of keratin-surfactant complexes that were substantially more effective at reducing surface tension than the polypeptides alone, showing great promise in the delivery of keratin polypeptides via the surface active complexes. Neutron reflection measurements revealed the coexistence of surfactant and keratin polypeptides at the interface, thus providing the structural support to the observed surface tension changes associated with the formation of the surface active complexes. Copyright © 2016. Published by Elsevier Inc.

Energy transport in the three coupled α-polypeptide chains of collagen molecule with long-range interactions effect

NASA Astrophysics Data System (ADS)

Mvogo, Alain; Ben-Bolie, G. H.; Kofané, T. C.

2015-06-01

The dynamics of three coupled α-polypeptide chains of a collagen molecule is investigated with the influence of power-law long-range exciton-exciton interactions. The continuum limit of the discrete equations reveal that the collagen dynamics is governed by a set of three coupled nonlinear Schrödinger equations, whose dispersive coefficient depends on the LRI parameter r. We construct the analytic symmetric and asymmetric (antisymmetric) soliton solutions, which match with the structural features of collagen related with the acupuncture channels. These solutions are used as initial conditions for the numerical simulations of the discrete equations, which reveal a coherent transport of energy in the molecule for r > 3. The results also indicate that the width of the solitons is a decreasing function of r, which help to stabilize the solitons propagating in the molecule. To confirm further the efficiency of energy transport in the molecule, the modulational instability of the system is performed and the numerical simulations show that the energy can flow from one polypeptide chain to another in the form of nonlinear waves.

Periodic Emission from the Gamma-ray Binary 1FGL J1018.6-5856

NASA Technical Reports Server (NTRS)

Celic, O.; Corbet, R. H. D.; Donato, D.; Ferrara, E. C.; Gehrels, N.; Harding, A. K.; Hays, E.; McEnery, J. E.; Thompson, D. J.; Troja, E.

2012-01-01

Gamma-ray binaries are stellar systems containing a neutron star or black hole with gamma-ray emission produced by an interaction between the components. These systems are rare, even though binary evolution models predict dozens in our Galaxy. A search for gamma-ray binaries with the Fermi Large Area Telescope (LAT) shows that IFGL JI018.6-5856 exhibits intensity and spectral modulation with a 16.6 day period. We identified a variable X-ray counterpart, which shows a sharp maximum coinciding with maximum gamma-ray emission, as well as an 06V f) star optical counterpart and a radio counterpart that is also apparently modulated on the orbital period. IFGL J1018.6-5856 is thus a gamma-ray binary, and its detection suggests the presence of other fainter binaries in the Galaxy.

The Großschwabhausen binary survey

NASA Astrophysics Data System (ADS)

Mugrauer, M.; Buder, S.; Reum, F.; Birth, A.

2017-01-01

Background: Since 2009, the Großschwabhausen binary survey is being carried out at the University Observatory Jena. This new imaging survey uses available time slots during photometric monitoring campaigns, caused by nonphotometric weather conditions, which often exhibit good atmospheric seeing. The goal of the project is to obtain current relative astrometric measurements of the binary systems that are listed in the Washington Visual Double Star Catalog. Materials and Methods: For the survey we use the Refraktor-Teleskop-Kamera at the University Observatory Jena to take imaging data of selected visual binary systems. Results: In this paper, we characterize the target sample of the survey, describe the imaging observations and the astrometric measurements including the astrometric calibration, and present the relative astrometric measures of 352 binaries that could be obtained during the course of the Großschwabhausen binary survey, so far.

Periodic emission from the gamma-ray binary 1FGL J1018.6-5856.

PubMed

Fermi LAT Collaboration; Ackermann, M; Ajello, M; Ballet, J; Barbiellini, G; Bastieri, D; Belfiore, A; Bellazzini, R; Berenji, B; Blandford, R D; Bloom, E D; Bonamente, E; Borgland, A W; Bregeon, J; Brigida, M; Bruel, P; Buehler, R; Buson, S; Caliandro, G A; Cameron, R A; Caraveo, P A; Cavazzuti, E; Cecchi, C; Çelik, Ö; Charles, E; Chaty, S; Chekhtman, A; Cheung, C C; Chiang, J; Ciprini, S; Claus, R; Cohen-Tanugi, J; Corbel, S; Corbet, R H D; Cutini, S; de Luca, A; den Hartog, P R; de Palma, F; Dermer, C D; Digel, S W; do Couto e Silva, E; Donato, D; Drell, P S; Drlica-Wagner, A; Dubois, R; Dubus, G; Favuzzi, C; Fegan, S J; Ferrara, E C; Focke, W B; Fortin, P; Fukazawa, Y; Funk, S; Fusco, P; Gargano, F; Gasparrini, D; Gehrels, N; Germani, S; Giglietto, N; Giordano, F; Giroletti, M; Glanzman, T; Godfrey, G; Grenier, I A; Grove, J E; Guiriec, S; Hadasch, D; Hanabata, Y; Harding, A K; Hayashida, M; Hays, E; Hill, A B; Hughes, R E; Jóhannesson, G; Johnson, A S; Johnson, T J; Kamae, T; Katagiri, H; Kataoka, J; Kerr, M; Knödlseder, J; Kuss, M; Lande, J; Longo, F; Loparco, F; Lovellette, M N; Lubrano, P; Mazziotta, M N; McEnery, J E; Michelson, P F; Mitthumsiri, W; Mizuno, T; Monte, C; Monzani, M E; Morselli, A; Moskalenko, I V; Murgia, S; Nakamori, T; Naumann-Godo, M; Norris, J P; Nuss, E; Ohno, M; Ohsugi, T; Okumura, A; Omodei, N; Orlando, E; Ozaki, M; Paneque, D; Parent, D; Pesce-Rollins, M; Pierbattista, M; Piron, F; Pivato, G; Porter, T A; Rainò, S; Rando, R; Razzano, M; Reimer, A; Reimer, O; Ritz, S; Romani, R W; Roth, M; Saz Parkinson, P M; Sgrò, C; Siskind, E J; Spandre, G; Spinelli, P; Suson, D J; Takahashi, H; Tanaka, T; Thayer, J G; Thayer, J B; Thompson, D J; Tibaldo, L; Tinivella, M; Torres, D F; Tosti, G; Troja, E; Uchiyama, Y; Usher, T L; Vandenbroucke, J; Vianello, G; Vitale, V; Waite, A P; Winer, B L; Wood, K S; Wood, M; Yang, Z; Zimmer, S; Coe, M J; Di Mille, F; Edwards, P G; Filipović, M D; Payne, J L; Stevens, J; Torres, M A P

2012-01-13

Gamma-ray binaries are stellar systems containing a neutron star or black hole, with gamma-ray emission produced by an interaction between the components. These systems are rare, even though binary evolution models predict dozens in our Galaxy. A search for gamma-ray binaries with the Fermi Large Area Telescope (LAT) shows that 1FGL J1018.6-5856 exhibits intensity and spectral modulation with a 16.6-day period. We identified a variable x-ray counterpart, which shows a sharp maximum coinciding with maximum gamma-ray emission, as well as an O6V((f)) star optical counterpart and a radio counterpart that is also apparently modulated on the orbital period. 1FGL J1018.6-5856 is thus a gamma-ray binary, and its detection suggests the presence of other fainter binaries in the Galaxy.

Periodic Emission from the Gamma-Ray Binary 1FGL J1018.6-5856

NASA Technical Reports Server (NTRS)

2012-01-01

Gamma-ray binaries are stellar systems containing a neutron star or black hole, with gamma-ray emission produced by an interaction between the components. These systems are rare, even though binary evolution models predict dozens in our Galaxy, A search for gamma-ray binaries with the Fermi Large Area Telescope (LAT) shows that 1FGL ]1018.6-5856 exhibits intensity and spectral modulation with a 16.6 day period. We identified a variable x-ray counterpart, which shows a sharp maximum coinciding with maximum gamma-ray emission, as well as an O6V((f)) star optical counterpart and a radio counterpart that is also apparently modulated on the orbital period. 1FGL ]1018.6-5856 is thus a gamma-ray binary, and its detection suggests the presence of other fainter binaries in the Galaxy.

Brown Dwarf Binaries from Disintegrating Triple Systems

NASA Astrophysics Data System (ADS)

Reipurth, Bo; Mikkola, Seppo

2015-04-01

Binaries in which both components are brown dwarfs (BDs) are being discovered at an increasing rate, and their properties may hold clues to their origin. We have carried out 200,000 N-body simulations of three identical stellar embryos with masses drawn from a Chabrier IMF and embedded in a molecular core. The bodies are initially non-hierarchical and undergo chaotic motions within the cloud core, while accreting using Bondi-Hoyle accretion. The coupling of dynamics and accretion often leads to one or two dominant bodies controlling the center of the cloud core, while banishing the other(s) to the lower-density outskirts, leading to stunted growth. Eventually each system transforms either to a bound hierarchical configuration or breaks apart into separate single and binary components. The orbital motion is followed for 100 Myr. In order to illustrate 200,000 end-states of such dynamical evolution with accretion, we introduce the “triple diagnostic diagram,” which plots two dimensionless numbers against each other, representing the binary mass ratio and the mass ratio of the third body to the total system mass. Numerous freefloating BD binaries are formed in these simulations, and statistical properties are derived. The separation distribution function is in good correspondence with observations, showing a steep rise at close separations, peaking around 13 AU and declining more gently, reaching zero at separations greater than 200 AU. Unresolved BD triple systems may appear as wider BD binaries. Mass ratios are strongly peaked toward unity, as observed, but this is partially due to the initial assumptions. Eccentricities gradually increase toward higher values, due to the lack of viscous interactions in the simulations, which would both shrink the orbits and decrease their eccentricities. Most newborn triple systems are unstable and while there are 9209 ejected BD binaries at 1 Myr, corresponding to about 4% of the 200,000 simulations, this number has grown to 15,894 at 100 Myr (˜8%). The total binary fraction among freefloating BDs is 0.43, higher than indicated by current observations, which, however, are still incomplete. Also, the gradual breakup of higher-order multiples leads to many more singles, thus lowering the binary fraction. The main threat to newly born triple systems is internal instabilities, not external perturbations. At 1 Myr there are 1325 BD binaries still bound to a star, corresponding to 0.66% of the simulations, but only 253 (0.13%) are stable on timescales >100 Myr. These simulations indicate that dynamical interactions in newborn triple systems of stellar embryos embedded in and accreting from a cloud core naturally form a population of freefloating BD binaries, and this mechanism may constitute a significant pathway for the formation of BD binaries.

The PyCBC search for binary black hole coalescences in Advanced LIGO's first observing run

NASA Astrophysics Data System (ADS)

Willis, Joshua; LIGO Scientific Collaboration

2017-01-01

Advanced LIGO's first observing run saw the first detections of binary black hole coalescences. We describe the PyCBC matched filter analysis, and the results of that search for binary systems with total mass up to 100 solar masses. This is a matched filter search for general-relativistic signals from binary black hole systems. Two signals, GW150914 and GW151226, were identified with very high significance, and a third possible signal, LVT151012, was found, though at much lower significance. Supported by NSF award PHY-1506254.

SEARCHING FOR BINARY Y DWARFS WITH THE GEMINI MULTI-CONJUGATE ADAPTIVE OPTICS SYSTEM (GeMS)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Opitz, Daniela; Tinney, C. G.; Faherty, Jacqueline K.

The NASA Wide-field Infrared Survey Explorer (WISE) has discovered almost all the known members of the new class of Y-type brown dwarfs. Most of these Y dwarfs have been identified as isolated objects in the field. It is known that binaries with L- and T-type brown dwarf primaries are less prevalent than either M-dwarf or solar-type primaries, they tend to have smaller separations and are more frequently detected in near-equal mass configurations. The binary statistics for Y-type brown dwarfs, however, are sparse, and so it is unclear if the same trends that hold for L- and T-type brown dwarfs alsomore » hold for Y-type ones. In addition, the detection of binary companions to very cool Y dwarfs may well be the best means available for discovering even colder objects. We present results for binary properties of a sample of five WISE Y dwarfs with the Gemini Multi-Conjugate Adaptive Optics System. We find no evidence for binary companions in these data, which suggests these systems are not equal-luminosity (or equal-mass) binaries with separations larger than ∼0.5–1.9 AU. For equal-mass binaries at an age of 5 Gyr, we find that the binary binding energies ruled out by our observations (i.e., 10{sup 42} erg) are consistent with those observed in previous studies of hotter ultra-cool dwarfs.« less

Binary asteroid population. 2. Anisotropic distribution of orbit poles of small, inner main-belt binaries

NASA Astrophysics Data System (ADS)

Pravec, P.; Scheirich, P.; Vokrouhlický, D.; Harris, A. W.; Kušnirák, P.; Hornoch, K.; Pray, D. P.; Higgins, D.; Galád, A.; Világi, J.; Gajdoš, Š.; Kornoš, L.; Oey, J.; Husárik, M.; Cooney, W. R.; Gross, J.; Terrell, D.; Durkee, R.; Pollock, J.; Reichart, D. E.; Ivarsen, K.; Haislip, J.; LaCluyze, A.; Krugly, Yu. N.; Gaftonyuk, N.; Stephens, R. D.; Dyvig, R.; Reddy, V.; Chiorny, V.; Vaduvescu, O.; Longa-Peña, P.; Tudorica, A.; Warner, B. D.; Masi, G.; Brinsfield, J.; Gonçalves, R.; Brown, P.; Krzeminski, Z.; Gerashchenko, O.; Shevchenko, V.; Molotov, I.; Marchis, F.

2012-03-01

Our photometric observations of 18 main-belt binary systems in more than one apparition revealed a strikingly high number of 15 having positively re-observed mutual events in the return apparitions. Our simulations of the survey showed that it cannot be due to an observational selection effect and that the data strongly suggest that poles of mutual orbits between components of binary asteroids in the primary size range 3-8 km are not distributed randomly: The null hypothesis of an isotropic distribution of the orbit poles is rejected at a confidence level greater than 99.99%. Binary orbit poles concentrate at high ecliptic latitudes, within 30° of the poles of the ecliptic. We propose that the binary orbit poles oriented preferentially up/down-right are due to either of the two processes: (i) the YORP tilt of spin axes of their parent bodies toward the asymptotic states near obliquities 0° and 180° (pre-formation mechanism) or (ii) the YORP tilt of spin axes of the primary components of already formed binary systems toward the asymptotic states near obliquities 0° and 180° (post-formation mechanism). The alternative process of elimination of binaries with poles closer to the ecliptic by dynamical instability, such as the Kozai effect due to gravitational perturbations from the Sun, does not explain the observed orbit pole concentration. This is because for close binary asteroid systems, the gravitational effects of primary’s irregular shape dominate the solar-tide effect.

Trans*versing the DMZ: A Non-Binary Autoethnographic Exploration of Gender and Masculinity

ERIC Educational Resources Information Center

Stewart, Dafina-Lazarus

2017-01-01

Using an abductive, critical-poststructuralist autoethnographic approach, I consider the ways in which masculine of centre, non-binary/genderqueer trans* identities transverse the poles of socializing binary gender systems, structures, and norms which inform higher education. In this paper, I assert that non-binary genderqueer identities are…

Binary Star Fractions from the LAMOST DR4

NASA Astrophysics Data System (ADS)

Tian, Zhi-Jia; Liu, Xiao-Wei; Yuan, Hai-Bo; Chen, Bing-Qiu; Xiang, Mao-Sheng; Huang, Yang; Wang, Chun; Zhang, Hua-Wei; Guo, Jin-Cheng; Ren, Juan-Juan; Huo, Zhi-Ying; Yang, Yong; Zhang, Meng; Bi, Shao-Lan; Yang, Wu-Ming; Liu, Kang; Zhang, Xian-Fei; Li, Tan-Da; Wu, Ya-Qian; Zhang, Jing-Hua

2018-05-01

Stellar systems composed of single, double, triple or higher-order systems are rightfully regarded as the fundamental building blocks of the Milky Way. Binary stars play an important role in formation and evolution of the Galaxy. Through comparing the radial velocity variations from multi-epoch observations, we analyze the binary fraction of dwarf stars observed with LAMOST. Effects of different model assumptions, such as orbital period distributions on the estimate of binary fractions, are investigated. The results based on log-normal distribution of orbital periods reproduce the previous complete analyses better than the power-law distribution. We find that the binary fraction increases with T eff and decreases with [Fe/H]. We first investigate the relation between α-elements and binary fraction in such a large sample as provided by LAMOST. The old stars with high [α/Fe] dominate with a higher binary fraction than young stars with low [α/Fe]. At the same mass, earlier forming stars possess a higher binary fraction than newly forming ones, which may be related with evolution of the Galaxy.

Candidates of eclipsing multiples based on extraneous eclipses on binary light curves: KIC 7622486, KIC 7668648, KIC 7670485 and KIC 8938628

NASA Astrophysics Data System (ADS)

Zhang, Jia; Qian, Sheng-Bang; He, Jian-Duo

2017-02-01

Four candidates of eclipsing multiples, based on new extraneous eclipses found on Kepler binary light curves, are presented and studied. KIC 7622486 is a double eclipsing binary candidate with orbital periods of 2.2799960 d and 40.246503 d. The two binary systems do not eclipse each other in the line of sight, but there is mutual gravitational influence between them which leads to the small but definite eccentricity of 0.0035(0.0022) associated with the short 2.2799960 d period orbit. KIC 7668648 is a hierarchical quadruple system candidate, with two sets of solid 203 ± 5 d period extraneous eclipses and another independent set of extraneous eclipses. A clear and credible extraneous eclipse is found on the binary light curve of KIC 7670485 which makes it a triple system candidate. Two sets of extraneous eclipses with periods of about 390 d and 220 d are found on KIC 8938628 binary curves, which not only confirm the previous conclusion of the 388.5 ± 0.3 triple system, but also indicate new additional objects that make KIC 8938628 a hierarchical quadruple system candidate. The results from these four candidates will contribute to the field of eclipsing multiples.

Colliding Winds in Massive Binaries

NASA Astrophysics Data System (ADS)

Thaller, M. L.

1998-12-01

In close binary systems of massive stars, the individual stellar winds will collide and form a bow shock between the stars, which may have significant impact on the mass-loss and evolution of the system. The existence of such a shock can be established through orbital-phase related variations in the UV resonance lines and optical emission lines. High density regions near the shock will produce Hα and Helium I emission which can be used to map the mass-flow structure of the system. The shock front between the stars may influence the balance of mass-loss versus mass-transfer in massive binary evolution, as matter lost to one star due to Roche lobe overflow may hit the shock and be deflected before it can accrete onto the surface of the other star. I have completed a high-resolution spectroscopic survey of 37 massive binaries, and compared the incidence and strength of emission to an independent survey of single massive stars. Binary stars show a statistically significant overabundance of optical emission, especially when one of the binary stars is in either a giant or supergiant phase of evolution. Seven systems in my survey exhibited clear signs of orbital phase related emission, and for three of the stars (HD 149404, HD 152248, and HD 163181), I present qualitative models of the mass-flow dynamics of the systems.

21 CFR 314.70 - Supplements and other changes to an approved application.

Code of Federal Regulations, 2014 CFR

2014-04-01

... derived from such studies; (vi) For a natural product, a recombinant DNA-derived protein/polypeptide, or a...) Changes solely affecting a natural protein, a recombinant DNA-derived protein/polypeptide or a complex or..., recombinant DNA-derived protein/polypeptide, complex or conjugate of a drug substance with a monoclonal...

Application of Statistical Thermodynamics To Predict the Adsorption Properties of Polypeptides in Reversed-Phase HPLC.

PubMed

Tarasova, Irina A; Goloborodko, Anton A; Perlova, Tatyana Y; Pridatchenko, Marina L; Gorshkov, Alexander V; Evreinov, Victor V; Ivanov, Alexander R; Gorshkov, Mikhail V

2015-07-07

The theory of critical chromatography for biomacromolecules (BioLCCC) describes polypeptide retention in reversed-phase HPLC using the basic principles of statistical thermodynamics. However, whether this theory correctly depicts a variety of empirical observations and laws introduced for peptide chromatography over the last decades remains to be determined. In this study, by comparing theoretical results with experimental data, we demonstrate that the BioLCCC: (1) fits the empirical dependence of the polypeptide retention on the amino acid sequence length with R(2) > 0.99 and allows in silico determination of the linear regression coefficients of the log-length correction in the additive model for arbitrary sequences and lengths and (2) predicts the distribution coefficients of polypeptides with an accuracy from 0.98 to 0.99 R(2). The latter enables direct calculation of the retention factors for given solvent compositions and modeling of the migration dynamics of polypeptides separated under isocratic or gradient conditions. The obtained results demonstrate that the suggested theory correctly relates the main aspects of polypeptide separation in reversed-phase HPLC.

Cysteine-containing peptide tag for site-specific conjugation of proteins

DOEpatents

Backer, Marina V.; Backer, Joseph M.

2008-04-08

The present invention is directed to a biological conjugate, comprising: (a) a targeting moiety comprising a polypeptide having an amino acid sequence comprising the polypeptide sequence of SEQ ID NO:2 and the polypeptide sequence of a selected targeting protein; and (b) a binding moiety bound to the targeting moiety; the biological conjugate having a covalent bond between the thiol group of SEQ ID NO:2 and a functional group in the binding moiety. The present invention is directed to a biological conjugate, comprising: (a) a targeting moiety comprising a polypeptide having an amino acid sequence comprising the polypeptide sequence of SEQ ID NO:2 and the polypeptide sequence of a selected targeting protein; and (b) a binding moiety that comprises an adapter protein, the adapter protein having a thiol group; the biological conjugate having a disulfide bond between the thiol group of SEQ ID NO:2 and the thiol group of the adapter protein. The present invention is also directed to biological sequences employed in the above biological conjugates, as well as pharmaceutical preparations and methods using the above biological conjugates.

Cysteine-containing peptide tag for site-specific conjugation of proteins

DOEpatents

Backer, Marina V.; Backer, Joseph M.

2010-10-05

The present invention is directed to a biological conjugate, comprising: (a) a targeting moiety comprising a polypeptide having an amino acid sequence comprising the polypeptide sequence of SEQ ID NO:2 and the polypeptide sequence of a selected targeting protein; and (b) a binding moiety bound to the targeting moiety; the biological conjugate having a covalent bond between the thiol group of SEQ ID NO:2 and a functional group in the binding moiety. The present invention is directed to a biological conjugate, comprising: (a) a targeting moiety comprising a polypeptide having an amino acid sequence comprising the polypeptide sequence of SEQ ID NO:2 and the polypeptide sequence of a selected targeting protein; and (b) a binding moiety that comprises an adapter protein, the adapter protein having a thiol group; the biological conjugate having a disulfide bond between the thiol group of SEQ ID NO:2 and the thiol group of the adapter protein. The present invention is also directed to biological sequences employed in the above biological conjugates, as well as pharmaceutical preparations and methods using the above biological conjugates.

Competition between surface adsorption and folding of fibril-forming polypeptides

NASA Astrophysics Data System (ADS)

Ni, Ran; Kleijn, J. Mieke; Abeln, Sanne; Cohen Stuart, Martien A.; Bolhuis, Peter G.

2015-02-01

Self-assembly of polypeptides into fibrillar structures can be initiated by planar surfaces that interact favorably with certain residues. Using a coarse-grained model, we systematically studied the folding and adsorption behavior of a β -roll forming polypeptide. We find that there are two different folding pathways depending on the temperature: (i) at low temperature, the polypeptide folds in solution into a β -roll before adsorbing onto the attractive surface; (ii) at higher temperature, the polypeptide first adsorbs in a disordered state and folds while on the surface. The folding temperature increases with increasing attraction as the folded β -roll is stabilized by the surface. Surprisingly, further increasing the attraction lowers the folding temperature again, as strong attraction also stabilizes the adsorbed disordered state, which competes with folding of the polypeptide. Our results suggest that to enhance the folding, one should use a weakly attractive surface. They also explain the recent experimental observation of the nonmonotonic effect of charge on the fibril formation on an oppositely charged surface [C. Charbonneau et al., ACS Nano 8, 2328 (2014), 10.1021/nn405799t].

Straightforward and effective protein encapsulation in polypeptide-based artificial cells.

PubMed

Zhi, Zheng-Liang; Haynie, Donald T

2006-01-01

A simple and straightforward approach to encapsulating an enzyme and preserving its function in polypeptide-based artificial cells is demonstrated. A model enzyme, glucose oxidase (GOx), was encapsulated by repeated stepwise adsorption of poly(L-lysine) and poly(L-glutamic acid) onto GOx-coated CaCO3 templates. These polypeptides are known from previous research to exhibit nanometer-scale organization in multilayer films. Templates were dissolved by ethylenediaminetetraacetic acid (EDTA) at neutral pH. Addition of polyethylene glycol (PEG) to the polypeptide assembly solutions greatly increased enzyme retention on the templates, resulting in high-capacity, high-activity loading of the enzyme into artificial cells. Assay of enzyme activity showed that over 80 mg-mL(-1) GOx was retained in artificial cells after polypeptide multilayer film formation and template dissolution in the presence of PEG, but only one-fifth as much was retained in the absence of PEG. Encapsulation is a means of improving the availability of therapeutic macromolecules in biomedicine. This work therefore represents a means of developing polypeptide-based artificial cells for use as therapeutic biomacromolecule delivery vehicles.

N-terminus conservation in the anchor polypeptide of a prokaryotic and eukaryotic alga. [Nostoc; Porphydium cruentum

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gantt, E.; Lipschultz, C.A.; Cunningham, F.X. Jr.

1987-04-01

Energy flow between the extrinsic phycobilisomes and the photosystems within thylakoids, is probably mediated by a blue anchor polypeptide. Polypeptides in the 94 kD range, purified by LiDS-PAGE from phycobilisomes of Nostoc and Porphyrdium cruentum, crossreacted with anti-Nostoc-94 (although weakly with the latter). Though rich in ASP and GLU, the polypeptides were very hydrophobic, and low in MET, CYS, and HIS. Partial sequence of the N-terminus shows considerable homology 1 - 5 - 10 - 15 - 20 N: (S)-V-K-A-S-G-G-S-S-V-A-(R)-P-Q-L-Y-Q-(G)-L-(A)-V- P: V-()-K-A-S-G-G-S-P-V-V-K-P-Q-L-Y-(K)-()-A-(S)- between the species. There is a lack of homology when compared with ..cap alpha.. and ..beta.. polypeptides ofmore » allophycocyanin with rod linkers of phycobilisomes and other phycobiliproteins. Polypeptides of 94 and 92 kD from thylakoids of Nostoc, also immunoreactive with anti-94, were blocked at the N-terminus.« less

Vulcan Identification of Eclipsing Binaries in the Kepler Field of View

NASA Astrophysics Data System (ADS)

Mjaseth, Kimberly; Batalha, N.; Borucki, W.; Caldwell, D.; Latham, D.; Martin, K. R.; Rabbette, M.; Witteborn, F.

2007-05-01

We report the discovery of 236 new eclipsing binary stars located in and around the field of view of the Kepler Mission. The binaries were identified from photometric light curves from the Vulcan exoplanet transit survey. The Vulcan camera is comprised of a modest aperture (10cm) f/2.8 Canon lens focusing a 7° x 7° field of view onto a 4096 x 4096 Kodak CCD. The system yields an hour-to-hour relative precision of 0.003 on 12th magnitude stars and saturates at 9th magnitude. The binaries have magnitudes in the range of 9.5 < V < 13.5 and periods ranging from 0.5 to 13 days. The milli-magnitude photometric precision allows detection of transits as shallow as 1%. The catalog contains a total of 273 eclipsing binary stars, including detached systems (high and low mass ratio), contact binaries, and triple systems. We present the derived orbital/transit properties, light curves, and stellar properties for selected targets. In addition, we summarize the results of radial velocity follow-up work. Support for this work came from NASA's Discovery Program and NASA's Origins of the Solar System Program.

VX Her: Eclipsing Binary System or Single Variable Star

NASA Astrophysics Data System (ADS)

Perry, Kathleen; Castelaz, Michael; Henson, Gary; Boghozian, Andrew

2015-01-01

VX Her is a pulsating variable star with a period of .4556504 days. It is believed to be part of an eclipsing binary system (Fitch et al. 1966). This hypothesis originated from Fitch seeing VX Her's minimum point on its light curve reaching a 0.7 magnitude fainter than normal and remaining that way for nearly two hours. If VX Her were indeed a binary system, I would expect to see similar results with a fainter minimum and a broader, more horizontal dip. Having reduced and analyzed images from the Southeastern Association for Research in Astronomy Observatory in Chile and Kitt Peak, as well as images from a 0.15m reflector at East Tennessee State University, I found that VX Her has the standard light curve of the prototype variable star, RR Lyrae. Using photometry, I found no differing features in its light curve to suggest that it is indeed a binary system. However, more observations are needed in case VX Her is a wide binary.

Estimating gravitational radiation from super-emitting compact binary systems

NASA Astrophysics Data System (ADS)

Hanna, Chad; Johnson, Matthew C.; Lehner, Luis

2017-06-01

Binary black hole mergers are among the most violent events in the Universe, leading to extreme warping of spacetime and copious emission of gravitational radiation. Even though black holes are the most compact objects they are not necessarily the most efficient emitters of gravitational radiation in binary systems. The final black hole resulting from a binary black hole merger retains a significant fraction of the premerger orbital energy and angular momentum. A nonvacuum system can in principle shed more of this energy than a black hole merger of equivalent mass. We study these super-emitters through a toy model that accounts for the possibility that the merger creates a compact object that retains a long-lived time-varying quadrupole moment. This toy model may capture the merger of (low mass) neutron stars, but it may also be used to consider more exotic compact binaries. We hope that this toy model can serve as a guide to more rigorous numerical investigations into these systems.

Collapsing Binary Asteroids With YORP And BYORP

NASA Astrophysics Data System (ADS)

Taylor, Patrick A.

2012-05-01

A separated binary system may be collapsed to contact via the removal of angular momentum from the system until a viable tidal end state no longer exists. The thermal YORP and BYORP effects are both capable of removing angular momentum from the system, by spin-down of the components and shrinking the mutual orbit, respectively. The YORP effect, with strength of order that measured for (1862) Apollo [1], can collapse a binary system with equal-mass components in as little as tens of thousands of years (depending on the initial angular momentum), while smaller secondaries require two or more orders of magnitude longer to collapse. BYORP, with a BYORP coefficent of 0.001 [2], is less efficient, especially for smaller secondaries. By these methods, only near-Earth binaries with large mass ratios can collapse within a dynamical lifetime, a population of which is observed by radar with a frequency comparable to separated binaries. [1] Kaasalainen et al., 2007, Nature 446, 420-422. [2] McMahon and Scheeres, 2010, Icarus 209, 494-509.

The critical binary star separation for a planetary system origin of white dwarf pollution

NASA Astrophysics Data System (ADS)

Veras, Dimitri; Xu, Siyi; Rebassa-Mansergas, Alberto

2018-01-01

The atmospheres of between one quarter and one half of observed single white dwarfs in the Milky Way contain heavy element pollution from planetary debris. The pollution observed in white dwarfs in binary star systems is, however, less clear, because companion star winds can generate a stream of matter which is accreted by the white dwarf. Here, we (i) discuss the necessity or lack thereof of a major planet in order to pollute a white dwarf with orbiting minor planets in both single and binary systems, and (ii) determine the critical binary separation beyond which the accretion source is from a planetary system. We hence obtain user-friendly functions relating this distance to the masses and radii of both stars, the companion wind, and the accretion rate on to the white dwarf, for a wide variety of published accretion prescriptions. We find that for the majority of white dwarfs in known binaries, if pollution is detected, then that pollution should originate from planetary material.

Shaping planetary nebulae with jets in inclined triple stellar systems

NASA Astrophysics Data System (ADS)

Akashi, Muhammad; Soker, Noam

2017-10-01

We conduct three-dimensional hydrodynamical simulations of two opposite jets launched obliquely to the orbital plane around an asymptotic giant branch (AGB) star and within its dense wind, and demonstrate the formation of a `messy' planetary nebula (PN), namely, a PN lacking any type of symmetry (highly irregular). In building the initial conditions we assume that a tight binary system orbits the AGB star, and that the orbital plane of the tight binary system is inclined to the orbital plane of binary system and the AGB star. We further assume that the accreted mass onto the tight binary system forms an accretion disk around one of the stars, and that the plane of the disk is in between the two orbital planes. The highly asymmetrical lobes that we obtain support the notion that messy PNe might be shaped by triple stellar systems.

Binary interaction dominates the evolution of massive stars.

PubMed

Sana, H; de Mink, S E; de Koter, A; Langer, N; Evans, C J; Gieles, M; Gosset, E; Izzard, R G; Le Bouquin, J-B; Schneider, F R N

2012-07-27

The presence of a nearby companion alters the evolution of massive stars in binary systems, leading to phenomena such as stellar mergers, x-ray binaries, and gamma-ray bursts. Unambiguous constraints on the fraction of massive stars affected by binary interaction were lacking. We simultaneously measured all relevant binary characteristics in a sample of Galactic massive O stars and quantified the frequency and nature of binary interactions. More than 70% of all massive stars will exchange mass with a companion, leading to a binary merger in one-third of the cases. These numbers greatly exceed previous estimates and imply that binary interaction dominates the evolution of massive stars, with implications for populations of massive stars and their supernovae.

The most plausible explanation of the cyclic period changes in close binaries: the case of the RS CVn-type binary WW Dra

NASA Astrophysics Data System (ADS)

Liao, W.-P.; Qian, S.-B.

2010-07-01

Cyclic period changes are a fairly common phenomenon in close binary systems and are usually explained as being caused either by the magnetic activity of one or both components or by the light travel time effect (LTTE) of a third body. We searched the orbital period changes in 182 EA-type (including the 101 Algol systems used by Hall), 43 EB-type and 53 EW-type binaries with known mass ratio and spectral type of the secondary component. We reproduced and improved the diagram in Hall according to the new collected data. Our plots do not support the conclusion derived by Hall that cyclic period changes are restricted to binaries having a secondary component with spectral type later than F5. The presence of period changes among systems with a secondary component of early type indicates that magnetic activity is one, but not the only, cause of the period variation. It is discovered that cyclic period changes, probably resulting from the presence of a third body, are more frequent in EW-type binaries among close systems. Therefore, the most plausible explanation of the cyclic period changes is the LTTE through the presence of a third body. Using the century-long historical record of the times of light minimum, we analysed the cyclic period change in the Algol binary WW Dra. It is found that the orbital period of the binary shows a ~112.2-yr cyclic variation with an amplitude of ~0.1977d. The cyclic oscillation can be attributed to the LTTE by means of a third body with a mass no less than 6.43Msolar. However, no spectral lines of the third body were discovered, indicating that it may be a candidate black hole. The third body is orbiting the binary at a distance closer than 14.4 au and may play an important role in the evolution of this system.

High-field superconductivity in the Nb-Ti-Zr ternary system

NASA Astrophysics Data System (ADS)

Ralls, K. M.; Rose, R. M.; Wulff, J.

1980-06-01

Resistive critical current densities, critical fields, and normal-state electrical resistivities were obtained at 4.2 °K for 55 alloys in the Nb-Ti-Zr ternary alloy system, excepting Ti-Zr binary compositions. The resistive critical field as a function of ternary composition has a saddle point between the Nb-Ti and Nb-Zr binaries, so that ternary alloying in this system is not expected to result in higher critical fields than the binary alloys.

Planetary Systems Dynamics Eccentric patterns in debris disks & Planetary migration in binary systems

NASA Astrophysics Data System (ADS)

Faramaz, V.; Beust, H.; Augereau, J.-C.; Bonsor, A.; Thébault, P.; Wu, Y.; Marshall, J. P.; del Burgo, C.; Ertel, S.; Eiroa, C.; Montesinos, B.; Mora, A.

2014-01-01

We present some highlights of two ongoing investigations that deal with the dynamics of planetary systems. Firstly, until recently, observed eccentric patterns in debris disks were found in young systems. However recent observations of Gyr-old eccentric debris disks leads to question the survival timescale of this type of asymmetry. One such disk was recently observed in the far-IR by the Herschel Space Observatory around ζ2 Reticuli. Secondly, as a binary companion orbits a circumprimary disk, it creates regions where planet formation is strongly handicapped. However, some planets were detected in this zone in tight binary systems (γ Cep, HD 196885). We aim to determine whether a binary companion can affect migration such that planets are brought in these regions and focus in particular on the planetesimal-driven migration mechanism.

Spin Evolution of Stellar Progenitors in Compact Binaries

NASA Astrophysics Data System (ADS)

Steinle, Nathan; Kesden, Michael

2018-01-01

Understanding the effects of various processes on the spins of stellar progenitors in compact binary systems is important for modeling the binary’s evolution and thus for interpreting the gravitational radiation emitted during inspiral and merger. Tides, winds, and natal kicks can drastically modify the binary parameters: tidal interactions increase the spin magnitudes, align the spins with the orbital angular momentum, and circularize the orbit; stellar winds decrease the spin magnitudes and cause mass loss; and natal kicks can misalign the spins and orbital angular momentum or even disrupt the binary. Also, during Roche lobe overflow, the binary may experience either stable mass transfer or common envelope evolution. The former can lead to a mass ratio reversal and alter the component spins, while the latter can dramatically shrink the binary separation. For a wide range of physically reasonable stellar-evolution scenarios, we compare the timescales of these processes to assess their relative contributions in determining the initial spins of compact binary systems.

Coenzyme Q supplementation or over-expression of the yeast Coq8 putative kinase stabilizes multi-subunit Coq polypeptide complexes in yeast coq null mutants.

PubMed

He, Cuiwen H; Xie, Letian X; Allan, Christopher M; Tran, Uyenphuong C; Clarke, Catherine F

2014-04-04

Coenzyme Q biosynthesis in yeast requires a multi-subunit Coq polypeptide complex. Deletion of any one of the COQ genes leads to respiratory deficiency and decreased levels of the Coq4, Coq6, Coq7, and Coq9 polypeptides, suggesting that their association in a high molecular mass complex is required for stability. Over-expression of the putative Coq8 kinase in certain coq null mutants restores steady-state levels of the sensitive Coq polypeptides and promotes the synthesis of late-stage Q-intermediates. Here we show that over-expression of Coq8 in yeast coq null mutants profoundly affects the association of several of the Coq polypeptides in high molecular mass complexes, as assayed by separation of digitonin extracts of mitochondria by two-dimensional blue-native/SDS PAGE. The Coq4 polypeptide persists at high molecular mass with over-expression of Coq8 in coq3, coq5, coq6, coq7, coq9, and coq10 mutants, indicating that Coq4 is a central organizer of the Coq complex. Supplementation with exogenous Q6 increased the steady-state levels of Coq4, Coq7, and Coq9, and several other mitochondrial polypeptides in select coq null mutants, and also promoted the formation of late-stage Q-intermediates. Q supplementation may stabilize this complex by interacting with one or more of the Coq polypeptides. The stabilizing effects of exogenously added Q6 or over-expression of Coq8 depend on Coq1 and Coq2 production of a polyisoprenyl intermediate. Based on the observed interdependence of the Coq polypeptides, the effect of exogenous Q6, and the requirement for an endogenously produced polyisoprenyl intermediate, we propose a new model for the Q-biosynthetic complex, termed the CoQ-synthome. Copyright © 2014 Elsevier B.V. All rights reserved.

Coenzyme Q supplementation or over-expression of the yeast Coq8 putative kinase stabilizes multi-subunit Coq polypeptide complexes in yeast coq null mutants*

PubMed Central

He, Cuiwen H.; Xie, Letian X.; Allan, Christopher M.; Tran, UyenPhuong C.; Clarke, Catherine F.

2014-01-01

Coenzyme Q biosynthesis in yeast requires a multi-subunit Coq polypeptide complex. Deletion of any one of the COQ genes leads to respiratory deficiency and decreased levels of the Coq4, Coq6, Coq7, and Coq9 polypeptides, suggesting that their association in a high molecular mass complex is required for stability. Over-expression of the putative Coq8 kinase in certain coq null mutants restores steady-state levels of the sensitive Coq polypeptides and promotes the synthesis of late-stage Q-intermediates. Here we show that over-expression of Coq8 in yeast coq null mutants profoundly affects the association of several of the Coq polypeptides in high molecular mass complexes, as assayed by separation of digitonin extracts of mitochondria by two-dimensional blue-native/SDS PAGE. The Coq4 polypeptide persists at high molecular mass with over-expression of Coq8 in coq3, coq5, coq6, coq7, coq9, and coq10 mutants, indicating that Coq4 is a central organizer of the Coq complex. Supplementation with exogenous Q6 increased the steady-state levels of Coq4, Coq7, Coq9, and several other mitochondrial polypeptides in select coq null mutants, and also promoted the formation of late-stage Q-intermediates. Q supplementation may stabilize this complex by interacting with one or more of the Coq polypeptides. The stabilizing effects of exogenously added Q6 or over-expression of Coq8 depend on Coq1 and Coq2 production of a polyisoprenyl intermediate. Based on the observed interdependence of the Coq polypeptides, the effect of exogenous Q6, and the requirement for an endogenously produced polyisoprenyl intermediate, we propose a new model for the Q-biosynthetic complex, termed the CoQ-synthome. PMID:24406904

On the Lack of Circumbinary Planets Orbiting Isolated Binary Stars

NASA Astrophysics Data System (ADS)

Fleming, David; Barnes, Rory; Graham, David E.; Luger, Rodrigo; Quinn, Thomas R.

2018-04-01

To date, no binary star system with an orbital period less than 7.5 days has been observed to host a circumbinary planet (CBP), a puzzling observation given the thousands of binary stars with orbital periods < 10 days discovered by the Kepler mission (Kirk et al., 2016) and the observational biases that favor their detection (Munoz & Lai, 2015). We outline a mechanism that explains the observed lack of CBPs via coupled stellar-tidal evolution of isolated binary stars. Tidal forces between low-mass, short-period binary stars on the pre-main sequence slow the stellar rotations, transferring rotational angular momentum to the orbit as the stars approach the tidally locked state. This transfer increases the binary orbital period, expanding the region of dynamical instability around the binary, and destabilizing CBPs that tend to preferentially orbit just beyond the initial dynamical stability limit. After the stars tidally lock, we find that angular momentum loss due to magnetic braking can significantly shrink the binary orbit, and hence the region of dynamical stability, over time impacting where surviving CBPs are observed relative to the boundary. We perform simulations over a wide range of parameter space and find that the expansion of the instability region occurs for most plausible initial conditions and that in some cases, the stability semi-major axis doubles from its initial value. We examine the dynamical and observable consequences of a CBP falling within the dynamical instability limit by running N-body simulations of circumbinary planetary systems and find that typically, at least one planet is ejected from the system. We apply our theory to the shortest period Kepler binary that possesses a CBP, Kepler-47, and find that its existence is consistent with our model. Under conservative assumptions, we find that coupled stellar-tidal evolution of pre-main sequence binary stars removes at least one close-in CBP in 87% of multi-planet circumbinary systems.

Primary Surface Particle Motion as a Mechanism for YORP-Driven Binary Asteroid Evolution

NASA Astrophysics Data System (ADS)

Fahnestock, Eugene G.; Scheeres, D. J.

2008-09-01

Within the largest class of binary asteroid systems -- asynchronous binaries typified by 1999 KW4 -- we hypothesize continued YORP spin-up of the rapidly rotating primary leads to recurring episodic lofting motion of primary equator regolith. We theorize this is a mechanism for transporting YORP-injected angular momentum from primary spin into the mutual orbit. This both enables binary primaries to continue to spin at near surface fission rates and produces continued orbit expansion on time scales several times faster than expansion predicted by tidal dissipation alone. This is distinct from the Binary Yorp (BYORP) phenomenon, not studied in this work but to be added to it later. We evaluate our hypotheses using a combination of techniques for an example binary system. First high-fidelity dynamic simulation of surface-originating particles in the full-detail gravity field of the binary components, themselves propagated according to the full two body problem, gives particle final disposition (return impact, transfer impact, escape). Trajectory end states found for regolith lofted at different initial primary spin rates and relative poses are collected into probability matrices, allowing probabilistic propagation of surface particles for long durations at low computational cost. We track changes to mass, inertia dyad, rotation state, and centroid position and velocity for each component in response to this mapped particle motion. This allows tracking of primary, secondary, and mutual orbit angular momenta over time, clearly demonstrating the angular momentum transfer mechanism and validating our hypotheses. We present current orbit expansion rates and estimated orbit size doubling times consistent with this mechanism, for a few binary systems. We also discuss ramifications of this type of rapid binary evolution towards separation, including the frequency with which "divorced binaries" on similar heliocentric orbits are produced, formation of triple systems such as 2001 SN263, and separation timescale dependence on heliocentric distance.

Generation of two-dimensional binary mixtures in complex plasmas

NASA Astrophysics Data System (ADS)

Wieben, Frank; Block, Dietmar

2016-10-01

Complex plasmas are an excellent model system for strong coupling phenomena. Under certain conditions the dust particles immersed into the plasma form crystals which can be analyzed in terms of structure and dynamics. Previous experiments focussed mostly on monodisperse particle systems whereas dusty plasmas in nature and technology are polydisperse. Thus, a first and important step towards experiments in polydisperse systems are binary mixtures. Recent experiments on binary mixtures under microgravity conditions observed a phase separation of particle species with different radii even for small size disparities. This contradicts several numerical studies of 2D binary mixtures. Therefore, dedicated experiments are required to gain more insight into the physics of polydisperse systems. In this contribution first ground based experiments on two-dimensional binary mixtures are presented. Particular attention is paid to the requirements for the generation of such systems which involve the consideration of the temporal evolution of the particle properties. Furthermore, the structure of these two-component crystals is analyzed and compared to simulations. This work was supported by the Deutsche Forschungsgemeinschaft DFG in the framework of the SFB TR24 Greifswald Kiel, Project A3b.

Multimodal switching of conformation and solubility in homocysteine derived polypeptides.

PubMed

Kramer, Jessica R; Deming, Timothy J

2014-04-16

We report the design and synthesis of poly(S-alkyl-L-homocysteine)s, which were found to be a new class of readily prepared, multiresponsive polymers that possess the unprecedented ability to respond in different ways to different stimuli, either through a change in chain conformation or in water solubility. The responsive properties of these materials are also effected under mild conditions and are completely reversible for all pathways. The key components of these polymers are the incorporation of water solubilizing alkyl functional groups that are integrated with precisely positioned, multiresponsive thioether linkages. This promising system allows multimodal switching of polypeptide properties to obtain desirable features, such as coupled responses to multiple external inputs.

The diageotropica mutant of tomato lacks high specific activity auxin binding sites

NASA Technical Reports Server (NTRS)

Hicks, G. R.; Rayle, D. L.; Lomax, T. L.

1989-01-01

Tomato plants homozygous for the diageotropica (dgt) mutation exhibit morphological and physiological abnormalities which suggest that they are unable to respond to the plant growth hormone auxin (indole-3-acetic acid). The photoaffinity auxin analog [3H]5N3-IAA specifically labels a polypeptide doublet of 40 and 42 kilodaltons in membrane preparations from stems of the parental variety, VFN8, but not from stems of plants containing the dgt mutation. In roots of the mutant plants, however, labeling is indistinguishable from that in VFN8. These data suggest that the two polypeptides are part of a physiologically important auxin receptor system, which is altered in a tissue-specific manner in the mutant.

VizieR Online Data Catalog: Orbital parameters of 341 new binaries (Murphy+, 2018)

NASA Astrophysics Data System (ADS)

Murphy, S. J.; Moe, M.; Kurtz, D. W.; Bedding, T.; Shibahashi, H.; Boffin, H. M. J.

2018-01-01

Kepler targets with effective temperatures between 6600 and 10000K have been investigated for pulsational phase modulation that can be attributed to binary orbital motion. For each target, we provide a binary status, which also reflects whether or not the target pulsates. For the binary systems, we provide the Kepler Input Catalogue (KIC) number, as well as the binary orbital elements: the period, semi-major axis, eccentricity, longitude of periastron, time of periastron passage, binary mass function and a calculated radial velocity semi-amplitude. (3 data files).

Effects of pituitary adenylate cyclase activating polypeptide in the urinary system, with special emphasis on its protective effects in the kidney.

PubMed

Reglodi, Dora; Kiss, Peter; Horvath, Gabriella; Lubics, Andrea; Laszlo, Eszter; Tamas, Andrea; Racz, Boglarka; Szakaly, Peter

2012-04-01

Pituitary adenylate cyclase activating polypeptide (PACAP) is a widespread neuropeptide with diverse effects in the nervous system and peripheral organs. One of the most well-studied effects of PACAP is its cytoprotective action, against different harmful stimuli in a wide variety of cells and tissues. PACAP occurs in the urinary system, from the kidney to the lower urinary tract. The present review focuses on the nephroprotective effects of PACAP and summarizes data obtained regarding the protective effects of PACAP in different models of kidney pathologies. In vitro data show that PACAP protects tubular cells against oxidative stress, myeloma light chain, cisplatin, cyclosporine-A and hypoxia. In vivo data provide evidence for its protective effects in ischemia/reperfusion, cisplatin, cyclosporine-A, myeloma kidney injury, diabetic nephropathy and gentamicin-induced kidney damage. Results accumulated on the renoprotective effects of PACAP suggest that PACAP is an emerging candidate for treatment of human kidney pathologies. Copyright © 2011 Elsevier Ltd. All rights reserved.

Effects of side group functionality and molecular weight on the activity of synthetic antimicrobial polypeptides.

PubMed

Engler, Amanda C; Shukla, Anita; Puranam, Sravanthi; Buss, Hilda G; Jreige, Nina; Hammond, Paula T

2011-05-09

The rapid emergence of antibiotic-resistant bacteria along with increasing difficulty in biofilm treatment has caused an immediate need for the development of new classes of antimicrobial therapeutics. We have developed a library of antimicrobial polypeptides, prepared by the ring-opening polymerization of γ-propargyl-L-glutamate N-carboxyanhydride and the alkyne-azide cycloaddition click reaction, which mimic the favorable characteristics of naturally occurring antimicrobial peptides (AmPs). AmPs are known not to cause drug resistance as well as prevent bacteria attachment on surfaces. The ease and scale of synthesis of the antimicrobial polypeptides developed here are significantly improved over the traditional Merrifield synthetic peptide approaches needed for naturally occurring antimicrobial peptides and avoids the unique challenges of biosynthetic pathways. The polypeptides range in length from 30 to 140 repeat units and can have varied side group functionality, including primary, secondary, tertiary, and quaternary amines with hydrocarbon side chains ranging from 1 to 12 carbons long. Overall, we find these polypeptides to exhibit broad-spectrum activity against both Gram positive and Gram negative bacteria, namely, S. aureus and E. coli , while having very low hemolytic activity. Many of the polypeptides can also be used as surface coatings to prevent bacterial attachment. The polypeptide library developed in this work addresses the need for effective biocompatible therapeutics for drug delivery and medical device coatings.

New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa

PubMed Central

Gladkikh, Irina; Monastyrnaya, Margarita; Zelepuga, Elena; Sintsova, Oksana; Tabakmakher, Valentin; Gnedenko, Oksana; Ivanov, Alexis; Hua, Kuo-Feng; Kozlovskaya, Emma

2015-01-01

Sea anemones are a rich source of Kunitz-type polypeptides that possess not only protease inhibitor activity, but also Kv channels toxicity, analgesic, antihistamine, and anti-inflammatory activities. Two Kunitz-type inhibitors belonging to a new Heteractis crispa RG (HCRG) polypeptide subfamily have been isolated from the sea anemone Heteractis crispa. The amino acid sequences of HCRG1 and HCRG2 identified using the Edman degradation method share up to 95% of their identity with the representatives of the HCGS polypeptide multigene subfamily derived from H. crispa cDNA. Polypeptides are characterized by positively charged Arg at the N-terminus as well as P1 Lys residue at their canonical binding loop, identical to those of bovine pancreatic trypsin inhibitor (BPTI). These polypeptides are shown by our current evidence to be more potent inhibitors of trypsin than the known representatives of the HCGS subfamily with P1Thr. The kinetic and thermodynamic characteristics of the intermolecular interactions between inhibitors and serine proteases were determined by the surface plasmon resonance (SPR) method. Residues functionally important for polypeptide binding to trypsin were revealed using molecular modeling methods. Furthermore, HCRG1 and HCRG2 possess anti-inflammatory activity, reducing tumor necrosis factor-α (TNF-α) and interleukin 6 (IL-6) secretions, as well as proIL-1β expression in lipopolysaccharide (LPS)-activated macrophages. However, there was no effect on nitric oxide (NO) generation. PMID:26404319

From the Macro to the Micro: Gel Mapping to Differentiate between Sporozoites of Two Immunologically Distinct Strains of Eimeria maxima (Strains M6 and Guelph)

PubMed Central

Liu, Hongbin; Al Nasr, Ibrahim; Liu, Xianyong; Suo, Xun; Barta, John

2015-01-01

Two immunologically distinct strains of E. maxima were examined in this study: the M6 strain and the Guelph strain. The differential expression between the sporozoites of the two strains of E. maxima was determined by image analysis of 100 μg of protein from each strain separated by standard one- and conventional two-dimensional polyacrylamide gel electrophoresis. In addition to differences in both molecular weight and the electrophoretic mobility, differences in the intensity of polypeptide bands for example, GS 136.4 and M6 169 were explored. Pooled gels were prepared from each strain. A representative 2D-PAGE gel spanning a non-linear pH range of 3–10 of E. maxima strain M6 consisted of approximately 694 polypeptide spots with about 67 (9.6%) of the polypeptide spots being unique relative to the other strain. E. maxima strain GS had about 696 discernable polypeptide spots with 69 spots (9.9%) that differed from those of the M6 strain. In-depth characterization of the variable polypeptide spots; unique polypeptide spots (absence or presence) and shared polypeptide spots with modifications may lead to novel vaccine target in the form of multi-component, multi-stage, multi-immunovariant strains, multi-species subunit vaccine, and diagnostic probe for E. maxima. PMID:26641262

From the Macro to the Micro: Gel Mapping to Differentiate between Sporozoites of Two Immunologically Distinct Strains of Eimeria maxima (Strains M6 and Guelph).

PubMed

El-Ashram, Saeed; Yin, Qing; Liu, Hongbin; Al Nasr, Ibrahim; Liu, Xianyong; Suo, Xun; Barta, John

2015-01-01

Two immunologically distinct strains of E. maxima were examined in this study: the M6 strain and the Guelph strain. The differential expression between the sporozoites of the two strains of E. maxima was determined by image analysis of 100 μg of protein from each strain separated by standard one- and conventional two-dimensional polyacrylamide gel electrophoresis. In addition to differences in both molecular weight and the electrophoretic mobility, differences in the intensity of polypeptide bands for example, GS 136.4 and M6 169 were explored. Pooled gels were prepared from each strain. A representative 2D-PAGE gel spanning a non-linear pH range of 3-10 of E. maxima strain M6 consisted of approximately 694 polypeptide spots with about 67 (9.6%) of the polypeptide spots being unique relative to the other strain. E. maxima strain GS had about 696 discernable polypeptide spots with 69 spots (9.9%) that differed from those of the M6 strain. In-depth characterization of the variable polypeptide spots; unique polypeptide spots (absence or presence) and shared polypeptide spots with modifications may lead to novel vaccine target in the form of multi-component, multi-stage, multi-immunovariant strains, multi-species subunit vaccine, and diagnostic probe for E. maxima.

Performance Enhancement of Radial Distributed System with Distributed Generators by Reconfiguration Using Binary Firefly Algorithm

NASA Astrophysics Data System (ADS)

Rajalakshmi, N.; Padma Subramanian, D.; Thamizhavel, K.

2015-03-01

The extent of real power loss and voltage deviation associated with overloaded feeders in radial distribution system can be reduced by reconfiguration. Reconfiguration is normally achieved by changing the open/closed state of tie/sectionalizing switches. Finding optimal switch combination is a complicated problem as there are many switching combinations possible in a distribution system. Hence optimization techniques are finding greater importance in reducing the complexity of reconfiguration problem. This paper presents the application of firefly algorithm (FA) for optimal reconfiguration of radial distribution system with distributed generators (DG). The algorithm is tested on IEEE 33 bus system installed with DGs and the results are compared with binary genetic algorithm. It is found that binary FA is more effective than binary genetic algorithm in achieving real power loss reduction and improving voltage profile and hence enhancing the performance of radial distribution system. Results are found to be optimum when DGs are added to the test system, which proved the impact of DGs on distribution system.

Elastin-like polypeptides: the power of design for smart cell encapsulation.

PubMed

Bandiera, Antonella

2017-01-01

Cell encapsulation technology is still a challenging issue. Innovative methodologies such as additive manufacturing, and alternative bioprocesses, such as cell therapeutic delivery, where cell encapsulation is a key tool are rapidly gaining importance for their potential in regenerative medicine. Responsive materials such as elastin-based recombinant expression products have features that are particularly attractive for cell encapsulation. They can be designed and tailored to meet desired requirements. Thus, they represent promising candidates for the development of new concept-based materials that can be employed in this field. Areas covered: An overview of the design and employment of elastin-like polypeptides for cell encapsulation is given to outline the state of the art. Special attention is paid to the design of the macromolecule employed as well as to the method of matrix formation and the biological system involved. Expert opinion: As a result of recent progress in regenerative medicine there is a compelling need for materials that provide specific properties and demonstrate defined functional features. Rationally designed materials that may adapt according to applied external stimuli and that are responsive to biological systems, such as elastin-like polypeptides, belong to this class of smart material. A run through the components described to date represents a good starting point for further advancement in this area. Employment of these components in cell encapsulation application will promote its advance toward 'smart cell encapsulation technology'.

Ankyrin-binding activity of nervous system cell adhesion molecules expressed in adult brain.

PubMed

Davis, J Q; Bennett, V

1993-01-01

A family of ankyrin-binding glycoproteins have been identified in adult rat brain that include alternatively spliced products of the same pre-mRNA. A composite sequence of ankyrin-binding glycoprotein (ABGP) shares 72% amino acid sequence identity with chicken neurofascin, a membrane-spanning neural cell adhesion molecule in the Ig super-family expressed in embryonic brain. ABGP polypeptides and ankyrin associate as pure proteins in a 1:1 molar stoichiometry at a site located in the predicted cytoplasmic domain. ABGP polypeptides are expressed late in postnatal development to approximately the same levels as ankyrin, and comprise a significant fraction of brain membrane proteins. Immunofluorescence studies have shown that ABGP polypeptides are co-localized with ankyrinB. Major differences in developmental expression have been reported for neurofascin in embryos compared with the late postnatal expression of ABGP, suggesting that ABGP and neurofascin represent products of gene duplication events that have subsequently evolved in parallel with distinct roles. Predicted cytoplasmic domains of rat ABGP and chicken neurofascin are nearly identical to each other and closely related to a group of nervous system cell adhesion molecules with variable extracellular domains, including L1, Nr-CAM and Ng-CAM of vertebrates, and neuroglian of Drosophila. A hypothesis to be evaluated is that ankyrin-binding activity is shared by all of these proteins.

Full Ionisation In Binary-Binary Encounters With Small Positive Energies

NASA Astrophysics Data System (ADS)

Sweatman, W. L.

2006-08-01

Interactions between binary stars and single stars and binary stars and other binary stars play a key role in the dynamics of a dense stellar system. Energy can be transferred between the internal dynamics of a binary and the larger scale dynamics of the interacting objects. Binaries can be destroyed and created by the interaction. In a binary-binary encounter, full ionisation occurs when both of the binary stars are destroyed in the interaction to create four single stars. This is only possible when the total energy of the system is positive. For very small energies the probability of this occurring is very low and it tends towards zero as the total energy tends towards zero. Here the case is considered for which all the stars have equal masses. An asymptotic power law is predicted relating the probability of full ionisation with the total energy when this latter quantity is small. The exponent, which is approximately 2.31, is compared with the results from numerical scattering experiments. The theoretical approach taken is similar to one used previously in the three-body problem. It makes use of the fact that the most dramatic changes in scale and energies of a few-body system occur when its components pass near to a central configuration. The position, and number, of these configurations is not known for the general four-body problem, however, with equal masses there are known to be exactly five different cases. Separate consideration and comparison of the properties of orbits close to each of these five central configurations enables the prediction of the form of the cross-section for full ionisation for the case of small positive total energy. This is the relation between total energy and the probability of total ionisation described above.

Extrasolar binary planets. I. Formation by tidal capture during planet-planet scattering

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ochiai, H.; Nagasawa, M.; Ida, S., E-mail: nagasawa.m.ad@m.titech.ac.jp

2014-08-01

We have investigated (1) the formation of gravitationally bounded pairs of gas-giant planets (which we call 'binary planets') from capturing each other through planet-planet dynamical tide during their close encounters and (2) the subsequent long-term orbital evolution due to planet-planet and planet-star quasi-static tides. For the initial evolution in phase 1, we carried out N-body simulations of the systems consisting of three Jupiter-mass planets taking into account the dynamical tide. The formation rate of the binary planets is as much as 10% of the systems that undergo orbital crossing, and this fraction is almost independent of the initial stellarcentric semimajormore » axes of the planets, while ejection and merging rates sensitively depend on the semimajor axes. As a result of circularization by the planet-planet dynamical tide, typical binary separations are a few times the sum of the physical radii of the planets. After the orbital circularization, the evolution of the binary system is governed by long-term quasi-static tide. We analytically calculated the quasi-static tidal evolution in phase 2. The binary planets first enter the spin-orbit synchronous state by the planet-planet tide. The planet-star tide removes angular momentum of the binary motion, eventually resulting in a collision between the planets. However, we found that the binary planets survive the tidal decay for the main-sequence lifetime of solar-type stars (∼10 Gyr), if the binary planets are beyond ∼0.3 AU from the central stars. These results suggest that the binary planets can be detected by transit observations at ≳ 0.3 AU.« less

Dynamical Evolution and Momentum Transfer for Binary Asteroid Systems

NASA Astrophysics Data System (ADS)

Bellerose, Julie

Over the past decade, robotic missions have been sent to small bodies, providing a basic understanding of their environment. Some of these small systems are found to be in pairs, orbiting each other, which are thought to represent about 16% of the near-Earth asteroid population. It is fair to assume that a mission will target a binary asteroid system in the near future as they can enable scientific insight into both the geology and dynamics of asteroids. In previous work, the dynamical evolution of binary systems was investigated for an ellipsoidsphere model. From the dynamics of two celestial bodies, equilibrium configurations and their stability were analyzed. For a given value of angular momentum, it was shown that there are in general two relative equilibrium configurations which are opposite in stability. When perturbations are introduced, we found that the equilibrium states are the minimum energy points of nearby periodic families. General dynamics from unstable to stable configurations were investigated for binaries in close proximity. Accounting for the dynamics of binaries, the dynamics of particles in this gravitational field were also studied. The location of the analogue Lagrangian points and energy associated with them were characterized. The L1 region is a key element for transfers between the bodies. It was shown that L1 can be situated between or inside the bodies depending on the free parameters of the system modifying the transfer possibilities since L1 has a hyperbolic manifold associated with it. In the current work, we look at the L1 region for binary system where the bodies are in relative equilibrium, close to each other. We find that L1 transits from outside to inside the ellipsoid when the mass ratio is larger than 0.6. For binary systems in close proximity with L1 being inside the ellipsoidal body, simulations show that particles on the surface tend to move away from the ellipsoid, toward the spherical primary. We can relate this to the Roche limit of binaries which affect the distribution of mass between the bodies. Other parameters such as the spin rate of a larger spherical primary may also influence particle distribution. Hence, we can map and characterize the mass distribution and momentum exchange that may occur within a closely formed binary systems.

Red-shifted fluorescent proteins mPlum and mRaspberry and polynucleotides encoding the same

DOEpatents

Tsien, Roger Y [La Jolla, CA; Wang, Lei [San Diego, CA

2008-07-01

Methods using somatic hypermutation (SHM) for producing polypeptide and nucleic acid variants, and nucleic acids encoding such polypeptide variants are disclosed. Such variants may have desired properties. Also disclosed are novel polypeptides, such as improved fluorescent proteins, produced by the novel methods, and nucleic acids, vectors, and host cells comprising such vectors.

Estimating Mass Parameters of Doubly Synchronous Binary Asteroids

NASA Astrophysics Data System (ADS)

Davis, Alex; Scheeres, Daniel J.

2017-10-01

The non-spherical mass distributions of binary asteroid systems lead to coupled mutual gravitational forces and torques. Observations of the coupled attitude and orbital dynamics can be leveraged to provide information about the mass parameters of the binary system. The full 3-dimensional motion has 9 degrees of freedom, and coupled dynamics require the use of numerical investigation only. In the current study we simplify the system to a planar ellipsoid-ellipsoid binary system in a doubly synchronous orbit. Three modes are identified for the system, which has 4 degrees of freedom, with one degree of freedom corresponding to an ignorable coordinate. The three modes correspond to the three major librational modes of the system when it is in a doubly synchronous orbit. The linearized periods of each mode are a function of the mass parameters of the two asteroids, enabling measurement of these parameters based on observations of the librational motion. Here we implement estimation techniques to evaluate the capabilities of this mass measurement method. We apply this methodology to the Trojan binary asteroid system 617 Patroclus and Menoetius (1906 VY), the final flyby target of the recently announced LUCY Discovery mission. This system is of interest because a stellar occultation campaign of the Patroclus and Menoetius system has suggested that the asteroids are similarly sized oblate ellipsoids moving in a doubly-synchronous orbit, making the system an ideal test for this investigation. A number of missed observations during the campaign also suggested the possibility of a crater on the southern limb of Menoetius, the presence of which could be evaluated by our mass estimation method. This presentation will review the methodology and potential accuracy of our approach in addition to evaluating how the dynamical coupling can be used to help understand light curve and stellar occultation observations for librating binary systems.

Preformed mRNA in Cotyledons of Ungerminated Seeds of Cicer arietinum L. 1

PubMed Central

Matilla, Angel; Nicolás, Gregorio; Vicente, Oscar; Sierra, José Manuel

1980-01-01

Polyadenylated RNA was isolated from total RNA extracted from cotyledons of ungerminated or 18-hour-germinated chick-pea seeds by affinity chromatography on oligo(dT)-cellulose. Both poly(A)-containing RNA fractions exhibited a template activity when assayed in two cell-free translation systems, wheat germ extracts, and nuclease-treated reticulocyte lysates. Translation of preformed mRNA from cotyledons of dry seeds was completely abolished in the presence of several inhibitors of polypeptide chain initiation and also in the presence of the two “cap” analogues m7 GTP and m7 GMP. The patterns of polypeptides synthesized by translation of poly(A)-containing RNAs from cotyledons of ungerminated or 18-hour-germinated seeds, in the wheat germ system, analyzed by electrophoresis and autoradiography, were similar but not identical. It is concluded that cotyledons of dry Cicer arietinum L. seeds contain preformed mRNA. PMID:16661345

Spectroscopic observations of V443 Herculis - A symbiotic binary with a low mass white dwarf

NASA Technical Reports Server (NTRS)

Dobrzycka, Danuta; Kenyon, Scott J.; Mikolajewska, Joanna

1993-01-01

We present an analysis of new and existing photometric and spectroscopic observations of the symbiotic binary V443 Herculis. This binary system consists of a normal M5 giant and a hot compact star. These two objects have comparable luminosities: about 1500 solar for the M5 giant and about 1000 solar for the compact star. We identify three nebular regions in this binary: a small, highly ionized volume surrounding the hot component, a modestly ionized shell close to the red giant photosphere, and a less dense region of intermediate ionization encompassing both binary components. The system parameters for V443 Her suggest the hot component currently declines from a symbiotic nova eruption.

Study of binary asteroids with three space missions

NASA Astrophysics Data System (ADS)

Kovalenko, Irina; Doressoundiram, Alain; Hestroffer, Daniel

Binary and multiple asteroids are common in the Solar system and encountered in various places going from Near-Earth region, to the main-belt, Trojans and Centaurs, and beyond Neptune. Their study can provide insight on the Solar System formation and its subsequent dynamical evolution. Binaries are also objects of high interest because they provide fundamental physical parameters such as mass and density, and hence clues on the early Solar System, or other processes that are affecting asteroid over time. We will present our current project on analysis of such systems based on three space missions. The first one is the Herschel space observatory (ESA), the largest infrared telescope ever launched. Thirty Centaurs and trans-Neptunian binaries were observed by Herschel and the measurement allowed to define size, albedo and thermal properties [1]. The second one is the satellite Gaia (ESA). This mission is designed to chart a three-dimensional map of the Galaxy. Gaia will provide positional measurements of Solar System Objects - including asteroid binaries - with unprecedented accuracy [2]. And the third one is the proposed mission AIDA, which would study the effects of crashing a spacecraft into an asteroid [3]. The objectives are to demonstrate the ability to modify the trajectory of an asteroid, to precisely measure its trajectory change, and to characterize its physical properties. The target of this mission is a binary system: (65803) Didymos. This encompasses orbital characterisations for both astrometric and resolved binaries, as well as unbound orbit, study of astrometric binaries, derivation of densities, and general statistical analysis of physical and orbital properties of trans-Neptunian and other asteroid binaries. Acknowledgements : work supported by Labex ESEP (ANR N° 2011-LABX-030) [1] Müller T., Lellouch E., Stansberry J. et al. 2009. TNOs are Cool: A Survey of the Transneptunian Region. EM&P 105, 209-219. [2] Mignard F., Cellino A., Muinonen K. et al. 2007. The Gaia Mission: Expected Applications to Asteroid Science. EM&P 1001, 97-125. [3] Galvez A., Carnelli I. et al. 2013. AIDA: The Asteroid Impact & Deflection Assessment Mission. EPSC 2013 - 1043.

Orbital motion in pre-main sequence binaries

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schaefer, G. H.; Prato, L.; Simon, M.

2014-06-01

We present results from our ongoing program to map the visual orbits of pre-main sequence (PMS) binaries in the Taurus star forming region using adaptive optics imaging at the Keck Observatory. We combine our results with measurements reported in the literature to analyze the orbital motion for each binary. We present preliminary orbits for DF Tau, T Tau S, ZZ Tau, and the Pleiades binary HBC 351. Seven additional binaries show curvature in their relative motion. Currently, we can place lower limits on the orbital periods for these systems; full solutions will be possible with more orbital coverage. Five othermore » binaries show motion that is indistinguishable from linear motion. We suspect that these systems are bound and might show curvature with additional measurements in the future. The observations reported herein lay critical groundwork toward the goal of measuring precise masses for low-mass PMS stars.« less

Periodic Emission from the Gamma-Ray Binary 1FGL J1018.6-5856

DOE PAGES

Ackermann, M.

2012-01-12

Gamma-ray binaries are stellar systems containing a neutron star or black hole with gamma-ray emission produced by an interaction between the components. These systems are rare, even though binary evolution models predict dozens in our Galaxy. A search for gamma-ray binaries with the Fermi Large Area Telescope (LAT) shows that 1FGL J1018.6-5856 exhibits intensity and spectral modulation with a 16.6 day period. We identified a variable X-ray counterpart, which shows a sharp maximum coinciding with maximum gamma-ray emission, as well as an O6V((f)) star optical counterpart and a radio counterpart that is also apparently modulated on the orbital period. 1FGLmore » J1018.6-5856 is thus a gamma-ray binary, and its detection suggests the presence of other fainter binaries in the Galaxy.« less

The formation of planetary systems during the evolution of close binary stars

NASA Astrophysics Data System (ADS)

Tutukov, A. V.

1991-08-01

Modern scenarios of the formation of planetary systems around single stars and products of merging close binaries are described. The frequencies of the realization of different scenarios in the Galaxy are estimated. It is concluded that the modern theory of the early stages of the evolution of single stars and the theory of the evolution of close binaries offer several possible versions for the origin of planetary systems, while the scenario dating back to Kant and Laplace remains the likeliest.

Sizing up the population of gamma-ray binaries

NASA Astrophysics Data System (ADS)

Dubus, Guillaume; Guillard, Nicolas; Petrucci, Pierre-Olivier; Martin, Pierrick

2017-12-01

Context. Gamma-ray binaries are thought to be composed of a young pulsar in orbit around a massive O or Be star with their gamma-ray emission powered by pulsar spin-down. The number of such systems in our Galaxy is not known. Aims: We aim to estimate the total number of gamma-ray binaries in our Galaxy and to evaluate the prospects for new detections in the GeV and TeV energy range, taking into account that their gamma-ray emission is modulated on the orbital period. Methods: We modelled the population of gamma-ray binaries and evaluated the fraction of detected systems in surveys with the Fermi-LAT (GeV), H.E.S.S., HAWC and CTA (TeV) using observation-based and synthetic template light curves. Results: The detected fraction depends more on the orbit-average flux than on the light-curve shape. Our best estimate for the number of gamma-ray binaries is 101-52+89 systems. A handful of discoveries are expected by pursuing the Fermi-LAT survey. Discoveries in TeV surveys are less likely. However, this depends on the relative amounts of power emitted in GeV and TeV domains. There could be as many as ≈ 200 HESS J0632+057-like systems with a high ratio of TeV to GeV emission compared to other gamma-ray binaries. Statistics allow for as many as three discoveries in five years of HAWC observations and five discoveries in the first two years of the CTA Galactic Plane survey. Conclusions: We favour continued Fermi-LAT observations over ground-based TeV surveys to find new gamma-ray binaries. Gamma-ray observations are most sensitive to short orbital period systems with a high spin-down pulsar power. Radio pulsar surveys (SKA) are likely to be more efficient in detecting long orbital period systems, providing a complementary probe into the gamma-ray binary population.

Changes in Gene Expression during Tomato Fruit Ripening 1

PubMed Central

Biggs, M. Scott; Harriman, Robert W.; Handa, Avtar K.

1986-01-01

Total proteins from pericarp tissue of different chronological ages from normally ripening tomato (Lycopersicon esculentum Mill. cv Rutgers) fruits and from fruits of the isogenic ripening-impaired mutants rin, nor, and Nr were extracted and separated by sodium dodecylsulfate-polyacrylamide gel electrophoresis. Analysis of the stained bands revealed increases in 5 polypeptides (94, 44, 34, 20, and 12 kilodaltons), decreases in 12 polypeptides (106, 98, 88, 76, 64, 52, 48, 45, 36, 28, 25, and 15 kilodaltons), and fluctuations in 5 polypeptides (85, 60, 26, 21, and 16 kilodaltons) as normal ripening proceeded. Several polypeptides present in ripening normal pericarp exhibited very low or undetectable levels in developing mutant pericarp. Total RNAs extracted from various stages of Rutgers pericarp and from 60 to 65 days old rin, nor, and Nr pericarp were fractionated into poly(A)+ and poly(A)− RNAs. Peak levels of total RNA, poly(A)+ RNA, and poly(A)+ RNA as percent of total RNA occurred between the mature green to breaker stages of normal pericarp. In vitro translation of poly(A)+ RNAs from normal pericarp in rabbit reticulocyte lysates revealed increases in mRNAs for 9 polypeptides (116, 89, 70, 42, 38, 33, 31, 29, and 26 kilodaltons), decreases in mRNAs for 2 polypeptides (41 and 35 kilodaltons), and fluctuations in mRNAs for 5 polypeptides (156, 53, 39, 30, and 14 kilodaltons) during normal ripening. Analysis of two-dimensional separation of in vitro translated polypeptides from poly(A)+ RNAs isolated from different developmental stages revealed even more extensive changes in mRNA populations during ripening. In addition, a polygalacturonase precursor (54 kilodaltons) was immunoprecipitated from breaker, turning, red ripe, and 65 days old Nr in vitro translation products. Images Fig. 1 Fig. 3 Fig. 5 Fig. 6 Fig. 7 PMID:16664828

A pH- and temperature-responsive bioresorbable injectable hydrogel based on polypeptide block copolymers for the sustained delivery of proteins in vivo.

PubMed

Turabee, Md Hasan; Thambi, Thavasyappan; Duong, Huu Thuy Trang; Jeong, Ji Hoon; Lee, Doo Sung

2018-02-27

Sustained delivery of protein therapeutics is limited owing to the fragile nature of proteins. Despite its great potential, delivery of proteins without any loss of bioactivity remains a challenge in the use of protein therapeutics in the clinic. To surmount this shortcoming, we report a pH- and temperature-responsive in situ-forming injectable hydrogel based on comb-type polypeptide block copolymers for the controlled delivery of proteins. Polypeptide block copolymers, composed of hydrophilic polyethylene glycol (PEG), temperature-responsive poly(γ-benzyl-l-glutamate) (PBLG), and pH-responsive oligo(sulfamethazine) (OSM), exhibit pH- and temperature-induced sol-to-gel transition behavior in aqueous solutions. Polypeptide block copolymers were synthesized by combining N-carboxyanhydride-based ring-opening polymerization and post-functionalization of the chain-end using N-hydroxy succinimide ester activated OSM. The physical properties of polypeptide-based hydrogels were tuned by varying the composition of temperature- and pH-responsive PBLG and OSM in block copolymers. Polypeptide block copolymers were non-toxic to human embryonic kidney cells at high concentrations (2000 μg mL -1 ). Subcutaneous administration of polypeptide block copolymer sols formed viscoelastic gel instantly at the back of Sprague-Dawley (SD) rats. The in vivo gels exhibited sustained degradation and were found to be bioresorbable in 6 weeks without any noticeable inflammation at the injection site. Anionic characteristics of hydrogels allow efficient loading of a cationic model protein, lysozyme, through electrostatic interaction. Lysozyme-loaded polypeptide block copolymer sols readily formed a viscoelastic gel in vivo and sustained lysozyme release for at least a week. Overall, the results demonstrate an elegant approach to control the release of certain charged proteins and open a myriad of therapeutic possibilities in protein therapeutics.

Constraining Accreting Binary Populations in Normal Galaxies

NASA Astrophysics Data System (ADS)

Lehmer, Bret; Hornschemeier, A.; Basu-Zych, A.; Fragos, T.; Jenkins, L.; Kalogera, V.; Ptak, A.; Tzanavaris, P.; Zezas, A.

2011-01-01

X-ray emission from accreting binary systems (X-ray binaries) uniquely probe the binary phase of stellar evolution and the formation of compact objects such as neutron stars and black holes. A detailed understanding of X-ray binary systems is needed to provide physical insight into the formation and evolution of the stars involved, as well as the demographics of interesting binary remnants, such as millisecond pulsars and gravitational wave sources. Our program makes wide use of Chandra observations and complementary multiwavelength data sets (through, e.g., the Spitzer Infrared Nearby Galaxies Survey [SINGS] and the Great Observatories Origins Deep Survey [GOODS]), as well as super-computing facilities, to provide: (1) improved calibrations for correlations between X-ray binary emission and physical properties (e.g., star-formation rate and stellar mass) for galaxies in the local Universe; (2) new physical constraints on accreting binary processes (e.g., common-envelope phase and mass transfer) through the fitting of X-ray binary synthesis models to observed local galaxy X-ray binary luminosity functions; (3) observational and model constraints on the X-ray evolution of normal galaxies over the last 90% of cosmic history (since z 4) from the Chandra Deep Field surveys and accreting binary synthesis models; and (4) predictions for deeper observations from forthcoming generations of X-ray telesopes (e.g., IXO, WFXT, and Gen-X) to provide a science driver for these missions. In this talk, we highlight the details of our program and discuss recent results.

The evolution of photoevaporating viscous discs in binaries

NASA Astrophysics Data System (ADS)

Rosotti, Giovanni P.; Clarke, Cathie J.

2018-02-01

A large fraction of stars are in binary systems, yet the evolution of protoplanetary discs in binaries has been little explored from the theoretical side. In this paper, we investigate the evolution of the discs surrounding the primary and secondary components of binary systems on the assumption that this is driven by photoevaporation induced by X-rays from the respective star. We show how for close enough separations (20-30 au for average X-ray luminosities) the tidal torque of the companion changes the qualitative behaviour of disc dispersal from inside out to outside in. Fewer transition discs created by photoevaporation are thus expected in binaries. We also demonstrate that in close binaries the reduction in viscous time leads to accelerated disc clearing around both components, consistent with unresolved observations. When looking at the differential disc evolution around the two components, in close binaries discs around the secondary clear first due to the shorter viscous time-scale associated with the smaller outer radius. In wide binaries instead the difference in photoevaporation rate makes the secondaries longer lived, though this is somewhat dependent on the assumed scaling of viscosity with stellar mass. We find that our models are broadly compatible with the growing sample of resolved observations of discs in binaries. We also predict that binaries have higher accretion rates than single stars for the same disc mass. Thus, binaries probably contribute to the observed scatter in the relationship between disc mass and accretion rate in young stars.

Role of Side-Chain Molecular Features in Tuning Lower Critical Solution Temperatures (LCSTs) of Oligoethylene Glycol Modified Polypeptides.

PubMed

Gharakhanian, Eric G; Deming, Timothy J

2016-07-07

A series of thermoresponsive polypeptides has been synthesized using a methodology that allowed facile adjustment of side-chain functional groups. The lower critical solution temperature (LCST) properties of these polymers in water were then evaluated relative to systematic molecular modifications in their side-chains. It was found that in addition to the number of ethylene glycol repeats in the side-chains, terminal and linker groups also have substantial and predictable effects on cloud point temperatures (Tcp). In particular, we found that the structure of these polypeptides allowed for inclusion of polar hydroxyl groups, which significantly increased their hydrophilicity and decreased the need to use long oligoethylene glycol repeats to obtain LCSTs. The thioether linkages in these polypeptides were found to provide an additional structural feature for reversible switching of both polypeptide conformation and thermoresponsive properties.

A Bio-Inspired Two-Layer Sensing Structure of Polypeptide and Multiple-Walled Carbon Nanotube to Sense Small Molecular Gases

PubMed Central

Wang, Li-Chun; Su, Tseng-Hsiung; Ho, Cheng-Long; Yang, Shang-Ren; Chiu, Shih-Wen; Kuo, Han-Wen; Tang, Kea-Tiong

2015-01-01

In this paper, we propose a bio-inspired, two-layer, multiple-walled carbon nanotube (MWCNT)-polypeptide composite sensing device. The MWCNT serves as a responsive and conductive layer, and the nonselective polypeptide (40 mer) coating the top of the MWCNT acts as a filter into which small molecular gases pass. Instead of using selective peptides to sense specific odorants, we propose using nonselective, peptide-based sensors to monitor various types of volatile organic compounds. In this study, depending on gas interaction and molecular sizes, the randomly selected polypeptide enabled the recognition of certain polar volatile chemical vapors, such as amines, and the improved discernment of low-concentration gases. The results of our investigation demonstrated that the polypeptide-coated sensors can detect ammonia at a level of several hundred ppm and barely responded to triethylamine. PMID:25751078

Simultaneous Polymerization and Polypeptide Particle Production via Reactive Spray-Drying

PubMed Central

2016-01-01

A method for producing polypeptide particles via in situ polymerization of N-carboxyanhydrides during spray-drying has been developed. This method was enabled by the development of a fast and robust synthetic pathway to polypeptides using 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU) as an initiator for the ring-opening polymerization of N-carboxyanhydrides. The polymerizations finished within 5 s and proved to be very tolerant toward impurities such as amino acid salts and water. The formed particles were prepared by mixing the monomer, N-carboxyanhydride of l-glutamic acid benzyl ester (NCAGlu) and the initiator (DBU) during the atomization process in the spray-dryer and were spherical with a size of ∼1 μm. This method combines two steps; making it a straightforward process that facilitates the production of polypeptide particles. Hence, it furthers the use of spray-drying and polypeptide particles in the pharmaceutical industry. PMID:27445061

Simultaneous Polymerization and Polypeptide Particle Production via Reactive Spray-Drying.

PubMed

Glavas, Lidija; Odelius, Karin; Albertsson, Ann-Christine

2016-09-12

A method for producing polypeptide particles via in situ polymerization of N-carboxyanhydrides during spray-drying has been developed. This method was enabled by the development of a fast and robust synthetic pathway to polypeptides using 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU) as an initiator for the ring-opening polymerization of N-carboxyanhydrides. The polymerizations finished within 5 s and proved to be very tolerant toward impurities such as amino acid salts and water. The formed particles were prepared by mixing the monomer, N-carboxyanhydride of l-glutamic acid benzyl ester (NCAGlu) and the initiator (DBU) during the atomization process in the spray-dryer and were spherical with a size of ∼1 μm. This method combines two steps; making it a straightforward process that facilitates the production of polypeptide particles. Hence, it furthers the use of spray-drying and polypeptide particles in the pharmaceutical industry.

Habitability in Binary Systems: The Role of UV Reduction and Magnetic Protection

NASA Astrophysics Data System (ADS)

Clark, Joni; Mason, P. A.; Zuluaga, J. I.; Cuartas, P. A.; Bustamonte, S.

2013-06-01

The number of planets found in binary systems is growing rapidly and the discovery of many more planets in binary systems appears inevitable. We use the newly refined and more restrictive, single star habitable zone (HZ) models of Kopparapu et al. (2013) and include planetary magnetic protection calculations in order to investigate binary star habitability. Here we present results on circumstellar or S-type planets, which are planets orbiting a single star member of a binary. P-type planets, on the other hand, orbit the center of mass of the binary. Stable planetary orbits exist in HZs for both types of binaries as long as the semi-major axis of the planet is either greater than (P-type) or less than (S-type) a few times the semi-major axis of the binary. We define two types of S-type binaries for this investigation. The SA-type is a circumstellar planet orbiting the binary’s primary star. In this case, the limits of habitability are dominated by the primary being only slightly affected by the presence of the lower mass companion. Thus, the SA-type planets have habitability characteristics, including magnetic protection, similar to single stars of the same type. The SB-type is a circumstellar planet orbiting the secondary star in a wide binary. An SB-type planet needs to orbit slightly outside the secondary’s single star HZ and remain within the primary’s single star HZ at all times. We explore the parameter space for which this is possible. We have found that planets lying in the combined HZ of SB binaries can be magnetically protected against the effects of stellar winds from both primary and secondary stars in a limited number of cases. We conclude that habitable conditions exist for a subset of SA-type, and a smaller subset of SB-type binaries. However, circumbinary planets (P-types) provide the most intriguing possibilities for the existence of complex life due to the effect of synchronization of binaries with periods in the 20-30 day range which allows for planets with significant magnetic protection.

Absolute parameters and chemical composition of the binary star OU Gem

NASA Astrophysics Data System (ADS)

Glazunova, L. V.; Mishenina, T. V.; Soubiran, C.; Kovtyukh, V. V.

2014-10-01

The absolute parameters and chemical composition of the BY Dra-type spectroscopic binary OU Gem (HD 45088) were determined on the basis of 10 high-resolution spectra. A new orbital solution of the binary system was determined, the binary ephemerides were specified, and the main physical and atmospheric parameters of the binary components were obtained. The chemical composition of both components was estimated for the first time for the stars of such type.

Orbital synchronization capture of two binaries emitting gravitational waves

NASA Astrophysics Data System (ADS)

Seto, Naoki

2018-03-01

We study the possibility of orbital synchronization capture for a hierarchical quadrupole stellar system composed by two binaries emitting gravitational waves. Based on a simple model including the mass transfer for white dwarf binaries, we find that the capture might be realized for inter-binary distances less than their gravitational wavelength. We also discuss related intriguing phenomena such as a parasitic relation between the coupled white dwarf binaries and significant reductions of gravitational and electromagnetic radiations.

THE QUASI-ROCHE LOBE OVERFLOW STATE IN THE EVOLUTION OF CLOSE BINARY SYSTEMS CONTAINING A RADIO PULSAR

DOE Office of Scientific and Technical Information (OSTI.GOV)

Benvenuto, O. G.; De Vito, M. A.; Horvath, J. E., E-mail: adevito@fcaglp.unlp.edu.ar, E-mail: foton@iag.usp.br

We study the evolution of close binary systems formed by a normal (solar composition), intermediate-mass-donor star together with a neutron star. We consider models including irradiation feedback and evaporation. These nonstandard ingredients deeply modify the mass-transfer stages of these binaries. While models that neglect irradiation feedback undergo continuous, long-standing mass-transfer episodes, models including these effects suffer a number of cycles of mass transfer and detachment. During mass transfer, the systems should reveal themselves as low-mass X-ray binaries (LMXBs), whereas when they are detached they behave as binary radio pulsars. We show that at these stages irradiated models are in amore » Roche lobe overflow (RLOF) state or in a quasi-RLOF state. Quasi-RLOF stars have radii slightly smaller than their Roche lobes. Remarkably, these conditions are attained for an orbital period as well as donor mass values in the range corresponding to a family of binary radio pulsars known as ''redbacks''. Thus, redback companions should be quasi-RLOF stars. We show that the characteristics of the redback system PSR J1723-2837 are accounted for by these models. In each mass-transfer cycle these systems should switch from LMXB to binary radio pulsar states with a timescale of approximately one million years. However, there is recent and fast growing evidence of systems switching on far shorter, human timescales. This should be related to instabilities in the accretion disk surrounding the neutron star and/or radio ejection, still to be included in the model having the quasi-RLOF state as a general condition.« less

Photometric and Spectroscopic Analysis for the Determination of Physical Parameters of an Eclipsing Binary Star System

NASA Astrophysics Data System (ADS)

Reid, Piper

2013-01-01

A binary star system is a pair of stars that are bound together by gravity. Most of the stars that we see in the night sky are members of multiple star systems. A system of stars where one star passes in front of the other (as observed from Earth) on a periodic basis is called an eclipsing binary. Eclipsing binaries can have very short rotational periods and in all cases these pairs of stars are so far away that they can only be resolved from Earth as a single point of light. The interaction of the two stars serves to produce physical phenomena that can be observed and used to study stellar properties. By careful data collection and analysis is it possible for an amateur astronomer using commercial, low cost equipment (including a home built spectroscope) to gather photometric (brightness versus time) and spectroscopic (brightness versus wavelength) data, analyze the data, and calculate the physical properties of a binary star system? Using a CCD camera, tracking mount and telescope photometric data of BB Pegasi was collected and a light curve produced. 57 Cygni was also studied using a spectroscope, tracking mount and telescope to prove that Doppler shift of Hydrogen Balmer absorption lines can be used to determine radial velocity. The orbital period, orbital velocity, radius of each star, separation of the two stars and mass of each star was calculated for the eclipsing binary BB Pegasi using photometric and spectroscopic data and Kepler’s 3rd Law. These data were then compared to published data. By careful use of consumer grade astronomical equipment it is possible for an amateur astronomer to determine an array of physical parameters of a distant binary star system from a suburban setting.

New Results on Contact Binary Stars

NASA Astrophysics Data System (ADS)

He, J.; Qian, S.; Zhu, L.; Liu, L.; Liao, W.

2014-08-01

Contact binary star is a kind of close binary with the strongest interaction binary system. Their formations and evolutions are unsolved problems in astrophysics. Since 2000, our groups have observed and studied more than half a hundred of contact binaries. In this report, I will summarize our new results of some contact binary stars (e.g. UZ CMi, GSC 03526-01995, FU Dra, GSC 0763-0572, V524 Mon, MR Com, etc.). They are as follow: (1) We discovered that V524 Mon and MR Com are shallow-contact binaries with their period decreasing; (2) GSC 03526-01995 is middle-contact binary without a period increasing or decreasing continuously; (3) UZ CMi, GSC 0763-0572 and FU Dra are middle-contact binaries with the period increasing continuously; (4) UZ CMi, GSC 03526-01995, FU Dra and V524 Mon show period oscillation which may imply the presence of additional components in these contact binaries.

Solidification phenomena of binary organic mixtures

NASA Technical Reports Server (NTRS)

Chang, K.

1982-01-01

The coalescence rates and motion of liquid bubbles in binary organic mixtures were studied. Several factors such as temperature gradient, composition gradient, interfacial tension, and densities of the two phases play important roles in separation of phases of immiscible liquids. An attempt was made to study the effect of initial compositions on separation rates of well-dispersed organic mixtures at different temperatures and, ultimately, on the homogeneity of solidification of the immiscible binary organic liquids. These organic mixtures serve as models for metallic pseudo binary systems under study. Two specific systems were investigated: ethyl salicylate - diethyl glycol and succinonitrile - water.

Generalized Roche potential for misaligned binary systems - Properties of the critical lobe

NASA Technical Reports Server (NTRS)

Avni, Y.; Schiller, N.

1982-01-01

The paper considers the Roche potential for binary systems where the stellar rotation axis is not aligned with the orbital revolution axis. It is shown that, as the degree of misalignment varies, internal Lagrangian points and external Lagrangian points may switch their roles. A systematic method to identify the internal Lagrangian point and to calculate the volume of the critical lobe is developed, and numerical results for a wide range of parameters of binary systems with circular orbits are presented. For binary systems with large enough misalignment, discrete changes occur in the topological structure of the equipotential surfaces as the orbital phase varies. The volume of the critical lobe has minima, as a function of orbital phase, at the two instances when the secondary crosses the equatorial plane of the primary. In semidetached systems, mass transfer may be confined to the vicinity of these two instances.

Discovery and characterization of 3000+ main-sequence binaries from APOGEE spectra

NASA Astrophysics Data System (ADS)

El-Badry, Kareem; Ting, Yuan-Sen; Rix, Hans-Walter; Quataert, Eliot; Weisz, Daniel R.; Cargile, Phillip; Conroy, Charlie; Hogg, David W.; Bergemann, Maria; Liu, Chao

2018-05-01

We develop a data-driven spectral model for identifying and characterizing spatially unresolved multiple-star systems and apply it to APOGEE DR13 spectra of main-sequence stars. Binaries and triples are identified as targets whose spectra can be significantly better fit by a superposition of two or three model spectra, drawn from the same isochrone, than any single-star model. From an initial sample of ˜20 000 main-sequence targets, we identify ˜2500 binaries in which both the primary and secondary stars contribute detectably to the spectrum, simultaneously fitting for the velocities and stellar parameters of both components. We additionally identify and fit ˜200 triple systems, as well as ˜700 velocity-variable systems in which the secondary does not contribute detectably to the spectrum. Our model simplifies the process of simultaneously fitting single- or multi-epoch spectra with composite models and does not depend on a velocity offset between the two components of a binary, making it sensitive to traditionally undetectable systems with periods of hundreds or thousands of years. In agreement with conventional expectations, almost all the spectrally identified binaries with measured parallaxes fall above the main sequence in the colour-magnitude diagram. We find excellent agreement between spectrally and dynamically inferred mass ratios for the ˜600 binaries in which a dynamical mass ratio can be measured from multi-epoch radial velocities. We obtain full orbital solutions for 64 systems, including 14 close binaries within hierarchical triples. We make available catalogues of stellar parameters, abundances, mass ratios, and orbital parameters.

Kepler eclipsing binary stars. IV. Precise eclipse times for close binaries and identification of candidate three-body systems

DOE Office of Scientific and Technical Information (OSTI.GOV)

Conroy, Kyle E.; Stassun, Keivan G.; Prša, Andrej

2014-02-01

We present a catalog of precise eclipse times and analysis of third-body signals among 1279 close binaries in the latest Kepler Eclipsing Binary Catalog. For these short-period binaries, Kepler's 30 minute exposure time causes significant smearing of light curves. In addition, common astrophysical phenomena such as chromospheric activity, as well as imperfections in the light curve detrending process, can create systematic artifacts that may produce fictitious signals in the eclipse timings. We present a method to measure precise eclipse times in the presence of distorted light curves, such as in contact and near-contact binaries which exhibit continuously changing light levelsmore » in and out of eclipse. We identify 236 systems for which we find a timing variation signal compatible with the presence of a third body. These are modeled for the light travel time effect and the basic properties of the third body are derived. This study complements J. A. Orosz et al. (in preparation), which focuses on eclipse timing variations of longer period binaries with flat out-of-eclipse regions. Together, these two papers provide comprehensive eclipse timings for all binaries in the Kepler Eclipsing Binary Catalog, as an ongoing resource freely accessible online to the community.« less

ON THE LIKELIHOOD OF PLANET FORMATION IN CLOSE BINARIES

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jang-Condell, Hannah, E-mail: hjangcon@uwyo.edu

2015-02-01

To date, several exoplanets have been discovered orbiting stars with close binary companions (a ≲ 30 AU). The fact that planets can form in these dynamically challenging environments implies that planet formation must be a robust process. The initial protoplanetary disks in these systems from which planets must form should be tidally truncated to radii of a few AU, which indicates that the efficiency of planet formation must be high. Here, we examine the truncation of circumstellar protoplanetary disks in close binary systems, studying how the likelihood of planet formation is affected over a range of disk parameters. If themore » semimajor axis of the binary is too small or its eccentricity is too high, the disk will have too little mass for planet formation to occur. However, we find that the stars in the binary systems known to have planets should have once hosted circumstellar disks that were capable of supporting planet formation despite their truncation. We present a way to characterize the feasibility of planet formation based on binary orbital parameters such as stellar mass, companion mass, eccentricity, and semimajor axis. Using this measure, we can quantify the robustness of planet formation in close binaries and better understand the overall efficiency of planet formation in general.« less

Massive binary stars as a probe of massive star formation

NASA Astrophysics Data System (ADS)

Kiminki, Daniel C.

2010-10-01

Massive stars are among the largest and most influential objects we know of on a sub-galactic scale. Binary systems, composed of at least one of these stars, may be responsible for several types of phenomena, including type Ib/c supernovae, short and long gamma ray bursts, high-velocity runaway O and B-type stars, and the density of the parent star clusters. Our understanding of these stars has met with limited success, especially in the area of their formation. Current formation theories rely on the accumulated statistics of massive binary systems that are limited because of their sample size or the inhomogeneous environments from which the statistics are collected. The purpose of this work is to provide a higher-level analysis of close massive binary characteristics using the radial velocity information of 113 massive stars (B3 and earlier) and binary orbital properties for the 19 known close massive binaries in the Cygnus OB2 Association. This work provides an analysis using the largest amount of massive star and binary information ever compiled for an O-star rich cluster like Cygnus OB2, and compliments other O-star binary studies such as NGC 6231, NGC 2244, and NGC 6611. I first report the discovery of 73 new O or B-type stars and 13 new massive binaries by this survey. This work involved the use of 75 successful nights of spectroscopic observation at the Wyoming Infrared Observatory in addition to observations obtained using the Hydra multi-object spectrograph at WIYN, the HIRES echelle spectrograph at KECK, and the Hamilton spectrograph at LICK. I use these data to estimate the spectrophotometric distance to the cluster and to measure the mean systemic velocity and the one-sided velocity dispersion of the cluster. Finally, I compare these data to a series of Monte Carlo models, the results of which indicate that the binary fraction of the cluster is 57 +/- 5% and that the indices for the power law distributions, describing the log of the periods, mass-ratios, and eccentricities, are --0.2 +/- 0.3, 0.3 +/- 0.3, and --0.8 +/- 0.3 respectively (or not consistent with a simple power law distribution). The observed distributions indicate a preference for short period systems with nearly circular orbits and companions that are not likely drawn from a standard initial mass function, as would be expected from random pairing. An interesting and unexpected result is that the period distribution is inconsistent with a standard power-law slope stemming mainly from an excess of periods between 3 and 5 days and an absence of periods between 7 and 14 days. One possible explanation of this phenomenon is that the binary systems with periods from 7--14 days are migrating to periods of 3--5 days. In addition, the binary distribution here is not consistent with previous suggestions in the literature that 45% of OB binaries are members of twin systems (mass ratio near 1).

Directed evolution methods for improving polypeptide folding and solubility and superfolder fluorescent proteins generated thereby

DOEpatents

Waldo, Geoffrey S.

2007-09-18

The current invention provides methods of improving folding of polypeptides using a poorly folding domain as a component of a fusion protein comprising the poorly folding domain and a polypeptide of interest to be improved. The invention also provides novel green fluorescent proteins (GFPs) and red fluorescent proteins that have enhanced folding properties.

The Research on the Impact of Maca Polypeptide on Sport Fatigue.

PubMed

Miao, Hua

2015-01-01

In order to study the effect of maca polypeptide on sport fatigue, this paper selected 40 male mice, and they were randomly divided into group A, B, C and D. group A, B and C were fed food with different concentrations of maca polypeptide, and group D was control group. After two weeks of feeding, measured physiological indexes of mice, including blood glucose, urea nitrogen and creatinine. At last gived the experimental results, as well as the analysis. Experimental results show that maca polypeptide can improve the ability of anti-fatigue mice, and in a certain concentration range, the higher the concentration, the better the resistance to fatigue.

Electrophoretic analysis of the major polypeptides of human erythrocyte membranes prepared by low and high osmolarity haemolysis.

PubMed

Zail, S S; Hoek, V D

1975-04-16

Human erythrocyte membranes were prepared in three ways: washing in hypotonic Tris buffer, pH 7.6, by lysis in isotonic Tris buffer pH 7.6 after incubation at 37 degrees C for 2 hours and by ultrasonication in an isotonic medium, pH 7.6. Analysis of the major polypeptides of the erythrocyte membranes by sodium dodecylsulphate polyacrylamide gel electrophoresis revealed a selective depletion of a major polypeptide representing glyceraldehyde-3-phosphate dehydrogenase in the membranes prepared by high osmolarity lysis. The pattern of seperation of the remaining polypeptides was identical in the 3 different membrane preparations.

Peptide Regulation of Cells Renewal Processes in Kidney Tissue Cultures from Young and Old Animals.

PubMed

Chalisova, N I; Lin'kova, N S; Nichik, T E; Ryzhak, A P; Dudkov, A V; Ryzhak, G A

2015-05-01

Polypeptide complex isolated from calf kidneys stimulates the processes of cell renewal in organotypic kidney tissue cultures from young and old rats. The polypeptide complex enhances expression of proliferation marker Ki-67 and reduces expression of proapoptotic peptide p53 in kidney explants obtained from young and old animals. Short peptides T-31 (AED) and T-35 (EDL) also stimulate proliferation and reduce apoptosis of the kidney cells, but to a lesser degree than the polypeptide complex. The results provide the basis for further investigation of the polypeptide complex as a preparation for the therapy of kidney diseases, including age-related pathologies.

Positive correlation between symptoms and circulating motilin, pancreatic polypeptide and gastrin concentrations in functional bowel disorders.

PubMed Central

Preston, D M; Adrian, T E; Christofides, N D; Lennard-Jones, J E; Bloom, S R

1985-01-01

Motilin, pancreatic polypeptide and gastrin blood concentrations in response to drinking water have been studied in 40 patients with functional bowel disease and compared with results in two groups of healthy control subjects. Patients with slow transit constipation and idiopathic megacolon showed impaired motilin release. Pancreatic polypeptide release was reduced in patients with slow transit constipation, but increased in those with functional diarrhoea. Gastrin release was impaired in all groups complaining of chronic constipation. Circulating motilin, pancreatic polypeptide and gastrin concentrations appear to bear some relationship to intestinal transit time in patients with functional bowel disorders. PMID:4054704

Positive correlation between symptoms and circulating motilin, pancreatic polypeptide and gastrin concentrations in functional bowel disorders.

PubMed

Preston, D M; Adrian, T E; Christofides, N D; Lennard-Jones, J E; Bloom, S R

1985-10-01

Motilin, pancreatic polypeptide and gastrin blood concentrations in response to drinking water have been studied in 40 patients with functional bowel disease and compared with results in two groups of healthy control subjects. Patients with slow transit constipation and idiopathic megacolon showed impaired motilin release. Pancreatic polypeptide release was reduced in patients with slow transit constipation, but increased in those with functional diarrhoea. Gastrin release was impaired in all groups complaining of chronic constipation. Circulating motilin, pancreatic polypeptide and gastrin concentrations appear to bear some relationship to intestinal transit time in patients with functional bowel disorders.

Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

PubMed

Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

1986-12-30

The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

Alternancia entre el estado de emisión de Rayos-X y Pulsar en Sistemas Binarios Interactuantes

NASA Astrophysics Data System (ADS)

De Vito, M. A.; Benvenuto, O. G.; Horvath, J. E.

2015-08-01

Redbacks belong to the family of binary systems in which one of the components is a pulsar. Recent observations show redbacks that have switched their state from pulsar - low mass companion (where the accretion of material over the pulsar has ceased) to low mass X-ray binary system (where emission is produced by the mass accretion on the pulsar), or inversely. The irradiation effect included in our models leads to cyclic mass transfer episodes, which allow close binary systems to switch between one state to other. We apply our results to the case of PSR J1723-2837, and discuss the need to include new ingredients in our code of binary evolution to describe the observed state transitions.

Template-dependent polypeptide synthesis in a factor- and energy-free translation system promoted by pyridine.

PubMed

Nitta, I; Ueda, T; Nojima, T; Watanabe, K

1995-10-01

We demonstrate here that a high concentration (40-70%) of pyridine, an aromatic tertiary amine catalyst, is able to promote translation on ribosomes without the presence of soluble protein factors or chemical energy sources. Compared with Monro's fragment reaction [Methods Enzymol. 20, 472-481 (1971)] which reflects only the peptidyltransferase step, this novel translation system can produce polypeptides with chain lengths of at least several tens of residues depending on the template RNA. In the presence of 60% pyridine, poly(U) and poly(UC) promoted incorporation of the respective amino acids, phenylalanine and serine-leucine, twofold, whereas poly(A) promoted the incorporation of lysine by only 25%. The degrees of polymerization of phenylalanine and lysine were up to the decamer and around 40mer, respectively. In poly(UC)-dependent oligo(serine-leucine) synthesis, oligopeptides with a serine and leucine alternate sequence were the main products. This novel pyridine system evidently differs from the non-enzymatic translation system reported by Gavrilova and Spirin [FEBS Lett. 17, 324-326 (1971)]; the former system displays partial resistance toward deproteinization reagents such as SDS and proteinase K, whereas the latter system is completely sensitive.

The fidelity of Kepler eclipsing binary parameters inferred by the neural network

NASA Astrophysics Data System (ADS)

Holanda, N.; da Silva, J. R. P.

2018-04-01

This work aims to test the fidelity and efficiency of obtaining automatic orbital elements of eclipsing binary systems, from light curves using neural network models. We selected a random sample with 78 systems, from over 1400 eclipsing binary detached obtained from the Kepler Eclipsing Binaries Catalog, processed using the neural network approach. The orbital parameters of the sample systems were measured applying the traditional method of light curve adjustment with uncertainties calculated by the bootstrap method, employing the JKTEBOP code. These estimated parameters were compared with those obtained by the neural network approach for the same systems. The results reveal a good agreement between techniques for the sum of the fractional radii and moderate agreement for e cos ω and e sin ω, but orbital inclination is clearly underestimated in neural network tests.

The fidelity of Kepler eclipsing binary parameters inferred by the neural network

NASA Astrophysics Data System (ADS)

Holanda, N.; da Silva, J. R. P.

2018-07-01

This work aims to test the fidelity and efficiency of obtaining automatic orbital elements of eclipsing binary systems, from light curves using neural network models. We selected a random sample with 78 systems, from over 1400 detached eclipsing binaries obtained from the Kepler Eclipsing Binaries Catalog, processed using the neural network approach. The orbital parameters of the sample systems were measured applying the traditional method of light-curve adjustment with uncertainties calculated by the bootstrap method, employing the JKTEBOP code. These estimated parameters were compared with those obtained by the neural network approach for the same systems. The results reveal a good agreement between techniques for the sum of the fractional radii and moderate agreement for e cosω and e sinω, but orbital inclination is clearly underestimated in neural network tests.

Direct-Sequence Spread Spectrum System

DTIC Science & Technology

1990-06-01

by directly modulating a conventional narrowband frequency-modulated (FM) carrier by a high rate digital code. The direct modulation is binary phase ...specification of the DSSS system will not be developed. The results of the evaluation phase of this research will be compared against theoretical...spread spectrum is called binary phase -shift keying 19 (BPSK). BPSK is a modulation in which a binary Ŕ" represents a 0-degree relative phase

Binary adsorption of copper(II) and cadmium(II) from aqueous solutions by biomass of marine alga Durvillaea potatorum

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yu, Q.; Kaewsarn, P.

1999-06-01

Much work on the biosorption of heavy metals by low-cost, natural biomass has been on the uptake of single metals. In practice, wastewaters often contain multiple heavy metal ions. In this paper the binary adsorption of copper(II) and cadmium(II) by a pretreated biomass of the marine alga Durvillaea potatorum from aqueous solutions was studied. The results showed that the uptake capacities for each heavy metal of the binary system were lower when compared with the single metal biosorption for copper and cadmium, respectively, but the total capacities for the binary system were similar to those obtained for single metal biosorption.more » The uptake capacities for copper and cadmium increased as the equilibrium pH increased and reached a plateau at a pH around 5.0. The uptake process was relatively fast, with 90% of the adsorption completed within 10 minutes for copper and 30 minutes for cadmium, and equilibrium reached after about 60 minutes of stirring. The biosorption isotherms of binary systems were not significantly affected by equilibrium temperature. The presence of light metal ions in solution also did not affect adsorption significantly. The binary adsorption was successfully predicted by the extended Langmuir model, using parameters and capacities obtained from single component systems.« less

The Spot Variability and Related Brightness variations of the Solar Type PreContact W UMa Binary System V1001 Cas

NASA Astrophysics Data System (ADS)

Samec, Ronald George; Koenke, Sam S.; Faulkner, Danny R.

2015-08-01

A new classification of eclipsing binary has emerged, Pre Contact WUMa Binaries (PCWB’s, Samec et al. 2012). These solar-type systems are usually detached or semidetached with one or both components under filling their critical Roche lobes. They usually have EA or EB-type light curves (unequal eclipse depths, indicating components with substantially different temperatures). The accepted scenario for these W UMa binaries is that they are undergoing steady but slow angular momentum losses due to magnetic braking as stellar winds blow radially away on stiff bipolar field lines. These binaries are believed to come into stable contact and eventually coalesce into blue straggler type, single, fast rotating A-type stars (Guinan and Bradstreet,1988). High precision 2012 and 2009 light curves are compared for the very short period (~0.43d) Precontact W UMa Binary (PCWB), V1001 Cassiopeia. This is the shortest period PCWB found so far. Its short period, similar to the majority of W UMa’s, in contrast to its distinct Algol-type light curve, make it a very rare and interesting system. Our solutions of light curves separated by some three years give approximately the same physical parameters. However the spots radically change, in temperature, area and position causing a distinctive variation in the shape of the light curves. We conclude that spots are very active on this solar type dwarf system and that it may mimic its larger cousins, the RS CVn binaries.

Multi-epoch observations with high spatial resolution of multiple T Tauri systems

NASA Astrophysics Data System (ADS)

Csépány, Gergely; van den Ancker, Mario; Ábrahám, Péter; Köhler, Rainer; Brandner, Wolfgang; Hormuth, Felix; Hiss, Hector

2017-07-01

Context. In multiple pre-main-sequence systems the lifetime of circumstellar discs appears to be shorter than around single stars, and the actual dissipation process may depend on the binary parameters of the systems. Aims: We report high spatial resolution observations of multiple T Tauri systems at optical and infrared wavelengths. We determine whether the components are gravitationally bound and orbital motion is visible, derive orbital parameters, and investigate possible correlations between the binary parameters and disc states. Methods: We selected 18 T Tau multiple systems (16 binary and two triple systems, yielding 16 + 2 × 2 = 20 binary pairs) in the Taurus-Auriga star-forming region from a previous survey, with spectral types from K1 to M5 and separations from 0.22″ (31 AU) to 5.8″ (814 AU). We analysed data acquired in 2006-07 at Calar Alto using the AstraLux lucky imaging system, along with data from SPHERE and NACO at the VLT, and from the literature. Results: We found ten pairs to orbit each other, five pairs that may show orbital motion, and five likely common proper motion pairs. We found no obvious correlation between the stellar parameters and binary configuration. The 10 μm infra-red excess varies between 0.1 and 7.2 mag (similar to the distribution in single stars, where it is between 1.7 and 9.1), implying that the presence of the binary star does not greatly influence the emission from the inner disc. Conclusions: We have detected orbital motion in young T Tauri systems over a timescale of ≈ 20 yr. Further observations with even longer temporal baseline will provide crucial information on the dynamics of these young stellar systems.

Not Alone: Tracing the Origins of Very-Low-Mass Stars and Brown Dwarfs Through Multiplicity Studies

NASA Astrophysics Data System (ADS)

Burgasser, A. J.; Reid, I. N.; Siegler, N.; Close, L.; Allen, P.; Lowrance, P.; Gizis, J.

The properties of multiple stellar systems have long provided important empirical constraints for star-formation theories, enabling (along with several other lines of evidence) a concrete, qualitative picture of the birth and early evolution of normal stars. At very low masses (VLM; M ? 0.1 solar mass), down to and below the hydrogen-burning minimum mass, our understanding of formation processes is not as clear, with several competing theories now under consideration. One means of testing these theories is through the empirical characterization of VLM multiple systems. Here, we review the results of various VLM multiplicity studies to date. These systems can be generally characterized as closely separated (93% have projected separations ? < 20 AU), near equal-mass (77% have M2/M1 ? 0.8) and occurring infrequently (perhaps 10-30% of systems are binary). Both the frequency and maximum separation of stellar and brown dwarf binaries steadily decrease for lower system masses, suggesting that VLM binary formation and/or evolution may be a mass-dependent process. There is evidence for a fairly rapid decline in the number of loosely bound systems below ~0.3 solar mass, corresponding to a factor of 10-20 increase in the minimum binding energy of VLM binaries as compared to more massive stellar binaries. This wide-separation "desert" is present among both field (~1-5 G.y.) and older (>100 m.y.) cluster systems, while the youngest (<10 m.y.) VLM binaries, particularly those in nearby, low-density star-forming regions, appear to have somewhat different systemic properties. We compare these empirical trends to predictions laid out by current formation theories, and outline future observational studies needed to probe the full parameter space of the lowest-mass multiple systems.

Molecular cloning and expression of a gene that controls the high-temperature regulon of Escherichia coli.

PubMed Central

Neidhardt, F C; VanBogelen, R A; Lau, E T

1983-01-01

The high-temperature production (HTP) regulon of Escherichia coli consists of a set of operons that are induced coordinately by a shift to a high temperature under the control of a single chromosomal gene called htpR or hin. To identify more components of this regulon, the rates of synthesis of many polypeptides resolved on two-dimensional polyacrylamide gels were measured in various strains by pulse-labeling after a temperature shift-up. A total of 13 polypeptides were found to be heat inducible only in cells bearing a normal htpR gene on the chromosome or on a plasmid; on this basis these polypeptides were designated products of the HTP regulon. Several hybrid plasmids that contain segments of the E. coli chromosome in the 75-min region were found to carry the htpR gene. A restriction map of this region was constructed, and selected fragments were subcloned and tested for the ability to complement an htpR mutant. The polypeptides encoded by these fragments were detected by permitting expression in maxicells, minicells, and chloramphenicol-treated cells. Complementation was accompanied by production of a polypeptide having a molecular weight of approximately 33,000. This polypeptide, designated F33.4, was markedly reduced in amount in an htpR mutant expected to contain very little htpR gene product. Polypeptide F33.4 is postulated to be the product of htpR and to be an effector that controls heat induction of the HTP regulon. Images PMID:6337122

The cell-wall glycoproteins of the green alga Scenedesmus obliquus. The predominant cell-wall polypeptide of Scenedesmus obliquus is related to the cell-wall glycoprotein gp3 of Chlamydomonas reinhardtii.

PubMed

Voigt, Jürgen; Stolarczyk, Adam; Zych, Maria; Malec, Przemysław; Burczyk, Jan

2014-02-01

The green alga Scenedesmus obliquus contains a multilayered cell wall, ultrastructurally similar to that of Chlamydomonas reinhardtii, although its proportion of hydroxyproline is considerably lower. Therefore, we have investigated the polypeptide composition of the insoluble and the chaotrope-soluble wall fractions of S. obliquus. The polypeptide pattern of the chaotrope-soluble wall fraction was strongly modified by chemical deglycosylation with anhydrous hydrogen fluoride (HF) in pyridine indicating that most of these polypeptides are glycosylated. Polypeptide constituents of the chaotrope-soluble cell-wall fraction with apparent molecular masses of 240, 270, 265, and 135 kDa cross-reacted with a polyclonal antibody raised against the 100 kDa deglycosylation product of the C. reinhardtii cell-wall glycoprotein GP3B. Chemical deglycosylation of the chaotrope-soluble wall fraction resulted in a 135 kDa major polypeptide and a 106 kDa minor component reacting with the same antibody. This antibody recognized specific peptide epitopes of GP3B. When the insoluble wall fraction of S. obliquus was treated with anhydrous HF/pyridine, three polypeptides with apparent molecular masses of 144, 135, and 65 kDa were solubilized, which also occured in the deglycosylated chaotrope-soluble wall fraction. These findings indicate that theses glycoproteins are cross-linked to the insoluble wall fraction via HF-sensitive bonds. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

Multiplicity in Early Stellar Evolution

NASA Astrophysics Data System (ADS)

Reipurth, B.; Clarke, C. J.; Boss, A. P.; Goodwin, S. P.; Rodríguez, L. F.; Stassun, K. G.; Tokovinin, A.; Zinnecker, H.

Observations from optical to centimeter wavelengths have demonstrated that multiple systems of two or more bodies is the norm at all stellar evolutionary stages. Multiple systems are widely agreed to result from the collapse and fragmentation of cloud cores, despite the inhibiting influence of magnetic fields. Surveys of class 0 protostars with millimeter interferometers have revealed a very high multiplicity frequency of about 2/3, even though there are observational difficulties in resolving close protobinaries, thus supporting the possibility that all stars could be born in multiple systems. Near-infrared adaptive optics observations of class I protostars show a lower binary frequency relative to the class 0 phase, a declining trend that continues through the class II/III stages to the field population. This loss of companions is a natural consequence of dynamical interplay in small multiple systems, leading to ejection of members. We discuss observational consequences of this dynamical evolution, and its influence on circumstellar disks, and we review the evolution of circumbinary disks and their role in defining binary mass ratios. Special attention is paid to eclipsing PMS binaries, which allow for observational tests of evolutionary models of early stellar evolution. Many stars are born in clusters and small groups, and we discuss how interactions in dense stellar environments can significantly alter the distribution of binary separations through dissolution of wider binaries. The binaries and multiples we find in the field are the survivors of these internal and external destructive processes, and we provide a detailed overview of the multiplicity statistics of the field, which form a boundary condition for all models of binary evolution. Finally, we discuss various formation mechanisms for massive binaries, and the properties of massive trapezia.

Searching for Solar System Wide Binaries with Pan-STARRS-1

NASA Astrophysics Data System (ADS)

Holman, Matthew J.; Protopapas, P.; Tholen, D. J.

2007-10-01

Roughly 60% of the observing time of the Pan-STARRS-1 (PS1) telescope will be dedicated to a "3pi steradian" survey with an observing cadence that is designed for the detection of near-Earth asteroids and slow-moving solar system bodies. Over this course of its 3.5 year cience mission, this unprecedented survey will discover nearly every asteroid, Trojan, Centaur, long-period comet, short-period comet, and trans-neptunian object (TNO) brighter than magnitude R=23. This census will be used to address a large number of questions regarding the physical and dynamical properties of the various small body populations of the solar system. Roughly 1-2% of TNOs are wide binaries with companions at separations greater than 1 arcsec and brightness differences less than 2 magnitudes (Kern & Elliot 2006; Noll et al 2007). These can be readily detected by PS1; we will carry out such a search with PS1 data. To do so, we will modify the Pan-STARRS Moving Object Processing System (MOPS) such that it will associate the components of resolved or marginally resolved binaries, link such pairs of detections obtained at different epochs, and the estimate the relative orbit of the binary. We will also determine the efficiency with which such binaries are detected as a function of the binary's relative orbit and the relative magnitudes of the components. Based on an estimated 7000 TNOs that PS1 will discover, we anticipate finding 70-140 wide binaries. The PS1 data, 60 epochs over three years, is naturally suited to determining the orbits of these objects. Our search will accurately determine the binary fraction for a variety of subclasses of TNOs.

Low-mass Pre-He White Dwarf Stars in Kepler Eclipsing Binaries with Multi-periodic Pulsations

NASA Astrophysics Data System (ADS)

Zhang, X. B.; Fu, J. N.; Liu, N.; Luo, C. Q.; Ren, A. B.

2017-12-01

We report the discovery of two thermally bloated low-mass pre-He white dwarfs (WDs) in two eclipsing binaries, KIC 10989032 and KIC 8087799. Based on the Kepler long-cadence photometry, we determined comprehensive photometric solutions of the two binary systems. The light curve analysis reveals that KIC 10989032 is a partially eclipsed detached binary system containing a probable low-mass WD with the temperature of about 10,300 K. Having a WD with the temperature of about 13,300, KKIC 8087799 is typical of an EL CVn system. By utilizing radial velocity measurements available for the A-type primary star of KIC 10989032, the mass and radius of the WD component are determined to be 0.24+/- 0.02 {M}⊙ and 0.50+/- 0.01 {R}⊙ , respectively. The values of mass and radius of the WD in KIC 8087799 are estimated as 0.16 ± 0.02 M ⊙ and 0.21 ± 0.01 R ⊙, respectively, according to the effective temperature and mean density of the A-type star derived from the photometric solution. We therefore introduce KIC 10989032 and KIC 8087799 as the eleventh and twelfth dA+WD eclipsing binaries in the Kepler field. Moreover, both binaries display marked multi-periodic pulsations superimposed on binary effects. A preliminary frequency analysis is applied to the light residuals when subtracting the synthetic eclipsing light curves from the observations, revealing that the light pulsations of the two systems are both due to the δ Sct-type primaries. We hence classify KIC 10989032 and KIC 8087799 as two WD+δ Sct binaries.

Genes for all metals--a bacterial view of the periodic table. The 1996 Thom Award Lecture.

PubMed

Silver, S

1998-01-01

Bacterial chromosomes have genes for transport proteins for inorganic nutrient cations and oxyanions, such as NH4+, K+, Mg2+, Co2+, Fe3+, Mn2+, Zn2+ and other trace cations, and PO4(3-), SO4(2-) and less abundant oxyanions. Together these account for perhaps a few hundred genes in many bacteria. Bacterial plasmids encode resistance systems for toxic metal and metalloid ions including Ag+, AsO2-, AsO4(3-), Cd2+, Co2+, CrO4(2-), Cu2+, Hg2+, Ni2+, Pb2+, TeO3(2-), Tl+ and Zn2+. Most resistance systems function by energy-dependent efflux of toxic ions. A few involve enzymatic (mostly redox) transformations. Some of the efflux resistance systems are ATPases and others are chemiosmotic ion/proton exchangers. The Cd(2+)-resistance cation pump of Gram-positive bacteria is membrane P-type ATPase, which has been labeled with 32P from [gamma-32P]ATP and drives ATP-dependent Cd2+ (and Zn2+) transport by membrane vesicles. The genes defective in the human hereditary diseases of copper metabolism, Menkes syndrome and Wilson's disease, encode P-type ATPases that are similar to bacterial cadmium ATPases. The arsenic resistance system transports arsenite [As(III)], alternatively with the ArsB polypeptide functioning as a chemiosmotic efflux transporter or with two polypeptides, ArsB and ArsA, functioning as an ATPase. The third protein of the arsenic resistance system is an enzyme that reduces intracellular arsenate [As(V)] to arsenite [As(III)], the substrate of the efflux system. In Gram-negative cells, a three polypeptide complex functions as a chemiosmotic cation/protein exchanger to efflux Cd2+, Zn2+ and Co2+. This pump consists of an inner membrane (CzcA), an outer membrane (CzcC) and a membrane-spanning (CzcB) protein that function together.

TWO STARS TWO WAYS: CONFIRMING A MICROLENSING BINARY LENS SOLUTION WITH A SPECTROSCOPIC MEASUREMENT OF THE ORBIT

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yee, Jennifer C.; Johnson, John Asher; Eastman, Jason

Light curves of microlensing events involving stellar binaries and planetary systems can provide information about the orbital elements of the system due to orbital modulations of the caustic structure. Accurately measuring the orbit in either the stellar or planetary case requires detailed modeling of subtle deviations in the light curve. At the same time, the natural, Cartesian parameterization of a microlensing binary is partially degenerate with the microlens parallax. Hence, it is desirable to perform independent tests of the predictions of microlens orbit models using radial velocity (RV) time series of the lens binary system. To this end, we presentmore » 3.5 years of RV monitoring of the binary lens system OGLE-2009-BLG-020 L, for which Skowron et al. constrained all internal parameters of the 200–700 day orbit. Our RV measurements reveal an orbit that is consistent with the predictions of the microlens light curve analysis, thereby providing the first confirmation of orbital elements inferred from microlensing events.« less

Extreme close approaches in hierarchical triple systems with comparable masses

NASA Astrophysics Data System (ADS)

Haim, Niv; Katz, Boaz

2018-06-01

We study close approaches in hierarchical triple systems with comparable masses using full N-body simulations, motivated by a recent model for type Ia supernovae involving direct collisions of white dwarfs (WDs). For stable hierarchical systems where the inner binary components have equal masses, we show that the ability of the inner binary to achieve very close approaches, where the separation between the components of the inner binary reaches values which are orders of magnitude smaller than the semi-major axis, can be analytically predicted from initial conditions. The rate of close approaches is found to be roughly linear with the mass of the tertiary. The rate increases in systems with unequal inner binaries by a marginal factor of ≲ 2 for mass ratios 0.5 ≤ m1/m2 ≤ 1 relevant for the inner white-dwarf binaries. For an average tertiary mass of ˜0.3M⊙ which is representative of typical M-dwarfs, the chance for clean collisions is ˜1% setting challenging constraints on the collisional model for type Ia's.

Acceleration by pulsar winds in binary systems

NASA Technical Reports Server (NTRS)

Harding, Alice K.; Gaisser, T. K.

1990-01-01

In the absence of accretion torques, a pulsar in a binary system will spin down due to electromagnetic dipole radiation and the spin-down power will drive a wind of relativistic electron-positron pairs. Winds from pulsars with short periods will prevent any subsequent accretion but may be confined by the companion star atmosphere, wind, or magnetosphere to form a standing shock. The authors investigate the possibility of particle acceleration at such a pulsar wind shock and the production of very high energy (VHE) and ultra high energy (UHE) gamma rays from interactions of accelerated protons in the companion star's wind or atmosphere. They find that in close binaries containing active pulsars, protons will be shock accelerated to a maximum energy dependent on the pulsar spin-down luminosity. If a significant fraction of the spin-down power goes into particle acceleration, these systems should be sources of VHE and possibly UHE gamma rays. The authors discuss the application of the pulsar wind model to binary sources such as Cygnus X-3, as well as the possibility of observing VHE gamma-rays from known binary radio pulsar systems.

Binary black hole in a double magnetic monopole field

NASA Astrophysics Data System (ADS)

Rodriguez, Maria J.

2018-01-01

Ambient magnetic fields are thought to play a critical role in black hole jet formation. Furthermore, dual electromagnetic signals could be produced during the inspiral and merger of binary black hole systems. In this paper, we derive the exact solution for the electromagnetic field occurring when a static, axisymmetric binary black hole system is placed in the field of two magnetic or electric monopoles. As a by-product of this derivation, we also find the exact solution of the binary black hole configuration in a magnetic or electric dipole field. The presence of conical singularities in the static black hole binaries represent the gravitational attraction between the black holes that also drag the external two monopole field. We show that these off-balance configurations generate no energy outflows.

EPIC 219217635: A Doubly Eclipsing Quadruple System Containing an Evolved Binary

NASA Astrophysics Data System (ADS)

Borkovits, T.; Albrecht, S.; Rappaport, S.; Nelson, L.; Vanderburg, A.; Gary, B. L.; Tan, T. G.; Justesen, A. B.; Kristiansen, M. H.; Jacobs, T. L.; LaCourse, D.; Ngo, H.; Wallack, N.; Ruane, G.; Mawet, D.; Howell, S. B.; Tronsgaard, R.

2018-05-01

We have discovered a doubly eclipsing, bound, quadruple star system in the field of K2 Campaign 7. EPIC 219217635 is a stellar image with Kp = 12.7 that contains an eclipsing binary (`EB') with PA = 3.59470 d and a second EB with PB = 0.61825 d. We have obtained followup radial-velocity (`RV') spectroscopy observations, adaptive optics imaging, as well as ground-based photometric observations. From our analysis of all the observations, we derive good estimates for a number of the system parameters. We conclude that (1) both binaries are bound in a quadruple star system; (2) a linear trend to the RV curve of binary A is found over a 2-year interval, corresponding to an acceleration, \\dot{γ }= 0.0024 ± 0.0007 cm s-2; (3) small irregular variations are seen in the eclipse-timing variations (`ETVs') detected over the same interval; (4) the orbital separation of the quadruple system is probably in the range of 8-25 AU; and (5) the orbital planes of the two binaries must be inclined with respect to each other by at least 25°. In addition, we find that binary B is evolved, and the cooler and currently less massive star has transferred much of its envelope to the currently more massive star. We have also demonstrated that the system is sufficiently bright that the eclipses can be followed using small ground-based telescopes, and that this system may be profitably studied over the next decade when the outer orbit of the quadruple is expected to manifest itself in the ETV and/or RV curves.

The journey of Typhon-Echidna as a binary system through the planetary region

NASA Astrophysics Data System (ADS)

Araujo, R. A. N.; Galiazzo, M. A.; Winter, O. C.; Sfair, R.

2018-06-01

Among the current population of the 81 known trans-Neptunian binaries (TNBs), only two are in orbits that cross the orbit of Neptune. These are (42355) Typhon-Echidna and (65489) Ceto-Phorcys. In this work, we focused our analyses on the temporal evolution of the Typhon-Echidna binary system through the outer and inner planetary systems. Using numerical integrations of the N-body gravitational problem, we explored the orbital evolutions of 500 clones of Typhon, recording the close encounters of those clones with planets. We then analysed the effects of those encounters on the binary system. It was found that only {≈ }22 per cent of the encounters with the giant planets were strong enough to disrupt the binary. This binary system has an ≈ 3.6 per cent probability of reaching the terrestrial planetary region over a time-scale of approximately 5.4 Myr. Close encounters of Typhon-Echidna with Earth and Venus were also registered, but the probabilities of such events occurring are low ({≈}0.4 per cent). The orbital evolution of the system in the past was also investigated. It was found that in the last 100 Myr, Typhon might have spent most of its time as a TNB crossing the orbit of Neptune. Therefore, our study of the Typhon-Echidna orbital evolution illustrates the possibility of large cometary bodies (radii of 76 km for Typhon and 42 km for Echidna) coming from a remote region of the outer Solar system and that might enter the terrestrial planetary region preserving its binarity throughout the journey.

ζ1 + ζ2 Reticuli binary system: a puzzling chromospheric activity pattern

NASA Astrophysics Data System (ADS)

Flores, M.; Saffe, C.; Buccino, A.; Jaque Arancibia, M.; González, J. F.; Nuñez, N. E.; Jofré, E.

2018-05-01

We perform, for the first time, a detailed long-term activity study of the binary system ζ Ret. We use all available HARPS spectra obtained between the years 2003 and 2016. We build a time series of the Mount Wilson S index for both stars, then we analyse these series by using Lomb-Scargle periodograms. The components ζ1 Ret and ζ2 Ret that belong to this binary system are physically very similar to each other and also similar to our Sun, which makes it a remarkable system. We detect in the solar-analogue star ζ2 Ret a long-term activity cycle with a period of ˜10 yr, similar to the solar one (˜11 yr). It is worthwhile to mention that this object satisfies previous criteria for a flat star and for a cycling star simultaneously. Another interesting feature of this binary system is a high ˜0.220 dex difference between the average log (R^' }_HK) activity levels of both stars. Our study clearly shows that ζ1 Ret is significantly more active than ζ2 Ret. In addition, ζ1 Ret shows an erratic variability in its stellar activity. In this work, we explore different scenarios trying to explain this rare behaviour in a pair of coeval stars, which could help to explain the difference in this and other binary systems. From these results, we also warn that for the development of activity-age calibrations (which commonly use binary systems and/or stellar clusters as calibrators) the whole history of activity available for the stars involved should be taken into account.

Astronomy in Denver: Spectropolarimetric Observations of 5 Wolf-Rayet Binary Stars with SALT/RSS

NASA Astrophysics Data System (ADS)

Fullard, Andrew; Ansary, Zyed; Azancot Luchtan, Daniel; Gallegos, Hunter; Luepker, Martin; Hoffman, Jennifer L.; Nordsieck, Kenneth H.; SALT observation team

2018-06-01

Mass loss from massive stars is an important yet poorly understood factor in shaping their evolution. Wolf-Rayet (WR) stars are of particular interest due to their stellar winds, which create large regions of circumstellar material (CSM). They are also supernova and possible gamma-ray burst (GRB) progenitors. Like other massive stars, WR stars often occur in binaries, where interaction can affect their mass loss rates and provide the rapid rotation thought to be required for GRB production. The diagnostic tool of spectropolarimetry, along with the potentially eclipsing nature of a binary system, helps us to better characterize the CSM created by the stars’ colliding winds. Thus, we can determine mass loss rates and infer rapid rotation. We present spectropolarimetric results for five WR+O eclipsing binary systems, obtained with the Robert Stobie Spectrograph at the South African Large Telescope, between April 2017 and April 2018. The data allow us to map both continuum and emission line polarization variations with phase, which constrains where different CSM components scatter light in the systems. We discuss our initial findings and interpretations of the polarimetric variability in each binary system, and compare the systems.

New Eclipsing Contact Binary System in Auriga

NASA Astrophysics Data System (ADS)

Austin, S. J.; Robertson, J. W.; Justice, C.; Campbell, R. T.; Hoskins, J.

2004-05-01

We present data on a newly discovered eclipsing binary system. The serendipitous discovery of this variable star was made by J.W. Robertson analyzing inhomogeneous ensemble photometry of stars in the field of the cataclysmic variable FS Aurigae from Indiana University RoboScope data. We obtained differential time-series BVR photometry during 2003 of this field variable using an ensemble of telescopes including the university observatories at ATU, UCA and joint ventures with amateur observatories in the state of Arkansas (Whispering Pines Observatory and Nubbin Ridge Observatory). The orbital period of this eclipsing system is 0.2508 days. The B-V light curve indicates colors of 1.2 around quadrature, to nearly 1.4 at primary eclipse. Binary star light curve models that best fit the BVR differential photometry suggest that the system is a contact binary overfilling the inner Roche Lobe by 12%, a primary component with a temperature of 4350K, a secondary component with a temperature of 3500K, a mass ratio of 0.37, and an inclination of 83 degrees. We present BVR light curves, an ephemeris, and best fit model parameters for the physical characteristics of this new eclipsing binary system.

pH-dependent Differential Scanning Calorimetry and Dynamic Light Scattering Studies of 21:0 PC and 18:0 PS Lipid Binary System

NASA Astrophysics Data System (ADS)

Ali, Rejwan

2010-03-01

Large unilamallar vesicle has been a model system to study many membrane functions. High Tg lipid systems offer many potential biomedical applications in lipid-based delivery applications. While the optimized vesicle functionalities are achieved by Polyethylene Glycol (PEG) polymer, modified PEG and other functional molecule incorporation, however, the host binary lipid system plays the pivotal role in pH-dependent phase transition based lipid vehicular methods. We have investigated a lipid binary system composed of 21:0 PC (1,2-dihenarachidoyl-sn-glycero-3-phosphocholine) and 18:0 PS(1,2-distearoyl-sn-glycero-3-phospho-L-serine). Preliminary studies implementing differential scanning calorimetry shows pH plays key role in temperature shift and thermotropic phase behavior of the binary system. While dynamic light scattering study shows lipid vesicle size is almost independent of pH changes. We will also present pH-dependent thermodynamic parameters to correlate underlying molecular mechanism in relevant pH-range.

The new eclipsing magnetic binary system E 1114 + 182

NASA Technical Reports Server (NTRS)

Biermann, P.; Schmidt, G. D.; Liebert, J.; Tapia, S.; Strittmatter, P. A.; West, S.; Stockman, H. S.; Kuehr, H.; Lamb, D. Q.

1985-01-01

A comprehensive analysis of E 1114 + 182, the first eclipsing AM Herculis binary system and the shortest-period eclipsing cataclysmic variable known, is presented. The time-resolved X-ray observations which led to the system's recognition as an AM Her system with a roughly 90 minute orbital period are reported. The current optical photometric and polarimetric ephemeris and a description of the system's phase-modulated properties are given. The detailed photometric eclipse profile and the highly variable spectroscopic behavior are addressed. This information is used to determine systemic parameters and derive new information on the line emission regions. The data put severe constraints on current torque models for keeping the binary and white dwarf rotation in phase.

Application of local binary pattern and human visual Fibonacci texture features for classification different medical images

NASA Astrophysics Data System (ADS)

Sanghavi, Foram; Agaian, Sos

2017-05-01

The goal of this paper is to (a) test the nuclei based Computer Aided Cancer Detection system using Human Visual based system on the histopathology images and (b) Compare the results of the proposed system with the Local Binary Pattern and modified Fibonacci -p pattern systems. The system performance is evaluated using different parameters such as accuracy, specificity, sensitivity, positive predictive value, and negative predictive value on 251 prostate histopathology images. The accuracy of 96.69% was observed for cancer detection using the proposed human visual based system compared to 87.42% and 94.70% observed for Local Binary patterns and the modified Fibonacci p patterns.

Characterization of mutants expressing thermostable D1 and D2 polypeptides of photosystem II in the cyanobacterium Synechococcus elongatus PCC 7942.

PubMed

Haraguchi, Norihisa; Kaseda, Jun; Nakayama, Yasumune; Nagahama, Kazuhiro; Ogawa, Takahira; Matsuoka, Masayoshi

2018-06-08

Photosystem II complex embedded in thylakoid membrane performs oxygenic photosynthesis where the reaction center D1/D2 heterodimer accommodates all components of the electron transport chain. To express thermostable D1/D2 heterodimer in a cyanobacterium Synechococcus elongatus PCC 7942, we constructed a series of mutant strains whose psbA1 and psbD1 genes encoding, respectively, the most highly expressed D1 and D2 polypeptides were replaced with those of a thermophilic strain, Thermosynechococcus vulcanus. Because the C-terminal 16 amino acid sequences of D1 polypeptides should be processed prior to maturation but diverge from each other, we also constructed the psbA1ΔC-replaced strain expressing a thermostable D1 polypeptide devoid of the C-terminal extension. The psbA1/psbD1-replaced strain showed decreased growth rate and oxygen evolution rate, suggesting inefficient photosystem II. Immunoblot analyses for thermostable D1, D2 polypeptides revealed that the heterologous D1 protein was absent in thylakoid membrane from any mutant strains with psbA1, psbA1ΔC, and psbA1/psbD1-replacements, whereas the heterologous D2 protein was present in thylakoid membrane as well as purified photosystem II complex from the psbA1/psbD1-replaced strain. In the latter strain, the compensatory expression of psbA3 and psbD2 genes was elevated. These data suggest that heterologous D2 polypeptide could be combined with the host D1 polypeptide to form chimeric D1/D2 heterodimer, whereas heterologous D1 polypeptide even without the C-terminal extension was unable to make complex with the host D2 polypeptide. Since the heterologous D1 could not be detected even in the whole cells of psbA1/psbD1-replaced strain, the rapid degradation of unprocessed or unassembled heterologous D1 was implicated. Copyright © 2018 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

EXTRASOLAR BINARY PLANETS. II. DETECTABILITY BY TRANSIT OBSERVATIONS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lewis, K. M.; Ida, S.; Ochiai, H.

2015-05-20

We discuss the detectability of gravitationally bound pairs of gas-giant planets (which we call “binary planets”) in extrasolar planetary systems that are formed through orbital instability followed by planet–planet dynamical tides during their close encounters, based on the results of N-body simulations by Ochiai et al. (Paper I). Paper I showed that the formation probability of a binary is as much as ∼10% for three giant planet systems that undergo orbital instability, and after post-capture long-term tidal evolution, the typical binary separation is three to five times the sum of the physical radii of the planets. The binary planets aremore » stable during the main-sequence lifetime of solar-type stars, if the stellarcentric semimajor axis of the binary is larger than 0.3 AU. We show that detecting modulations of transit light curves is the most promising observational method to detect binary planets. Since the likely binary separations are comparable to the stellar diameter, the shape of the transit light curve is different from transit to transit, depending on the phase of the binary’s orbit. The transit durations and depth for binary planet transits are generally longer and deeper than those for the single planet case. We point out that binary planets could exist among the known inflated gas-giant planets or objects classified as false positive detections at orbital radii ≳0.3 AU, propose a binary planet explanation for the CoRoT candidate SRc01 E2 1066, and show that binary planets are likely to be present in, and could be detected using, Kepler-quality data.« less