Sample records for chuyn giao tri

  1. Effects of structural differences on the NMR chemical shifts in cinnamic acid derivatives: Comparison of GIAO and GIPAW calculations

    NASA Astrophysics Data System (ADS)

    Szeleszczuk, Łukasz; Pisklak, Dariusz Maciej; Zielińska-Pisklak, Monika; Wawer, Iwona


    In this article we report the results of combined theoretical and experimental structural studies on cinnamic acid derivatives (CADs), one of the main groups of secondary metabolites present in various medicinal plant species and food products of plant origin. The effects of structural differences in CADs on their spectroscopic properties were studied in detail by both: solid-state NMR and GIAO/GIPAW calculations. Theoretical computations were used in order to perform signal assignment in 13C CP/MAS NMR spectra of the cinnamic, o-coumaric, m-coumaric, p-coumaric, caffeic, ferulic, sinapic and 3,4-dimethoxycinnamic acids, and to evaluate the accuracy of GIPAW and GIAO methodology.

  2. 1H, 13C MAS NMR and GIAO-CPHF calculations of chloramphenicol, thiamphenicol and their pyrrole analogues

    NASA Astrophysics Data System (ADS)

    Żołek, Teresa; Paradowska, Katarzyna; Krajewska, Dorota; Różański, Andrzej; Wawer, Iwona


    The 13C CP MAS and 1H MAS NMR and ab initio (GIAO-CPHF) calculations were used to obtain structural information on two known antibiotics: chloramphenicol, and thiamphenicol, and two new analogues: DL- threo-1-(1-methyl-4-nitro-pyrrole-2-yl)-2-dichloroacetamidopropane-1,3-diol and DL- threo-1-(1-methylsulfonylpyrrole-3-yl)-2-dichloroacetamidopropane-1,3-diol.

  3. Synthesis, spectroscopic (UV-vis and GIAO NMR), crystallographic and theoretical studies of triazine heterocyclic derivatives

    NASA Astrophysics Data System (ADS)

    Khan, Salman A.; Obaid, Abdullah Y.; Al-Harbi, Laila M.; Arshad, Muhammad Nadeem; Şahin, Onur; Ersanlı, Cem Cüneyt; Abdel-Rehman, R. M.; Asiri, Abdullah M.; Hursthouse, Michael B.


    This work presents the synthesis and characterization of triazine heterocyclic derivatives. The spectroscopic properties like nuclear magnetic resonance [NMR, (1H and 13C)] were recorded in CDCl3 solution and Ultraviolet-Visible (UV-vis) absorption spectrums of compounds, 5,6-diphenyl-[1,2,4]triazin-3-ylamine (1), (5,6-diphenyl-[1,2,4]triazin-3-yl)-hydrazine (2) and 5,6-diphenyl-4H-[1,2,4] triazine-3-thione (3), were recorded in the range of 200-800 nm, using chloroform as base solvent. Molecular geometry of compounds with triazine heterocyclic derivative in the ground state have been calculated using the density functional theory (DFT) with 6-31G(d,p) basis set and compared with the X-ray experimental data. The calculated results show that the optimized geometry can well reproduce the crystal structures. Total static dipole moment (μ), the average linear polarizability (α) and the first hyperpolarizability (β) values of the investigated molecules have been computed using the same methods. The energetic behavior of compounds in solvent media has been examined using B3LYP method with the 6-31G(d,p) basis set by applying the polarizable continuum model (PCM). The total energy of compounds decreases with increasing polarity of the solvent. Frontier molecular orbitals and the molecular electrostatic potential (MEP), 1H NMR, and 13C NMR of three triazine derivatives were investigated using theoretical calculations. The linear polarizabilities and first hyperpolarizabilities of the studied molecules indicate that the compounds 1-3 can be used as a good nonlinear optical material (NLO). Isotropic chemical shifts were calculated using the gauge-invariant atomic orbital (GIAO) method. Comparison of the NMR chemical shifts, absorption wavelengths with the experimental values revealed that DFT and time dependent-density functional theory (TD-DFT) method produce generally closer to good results.

  4. (13)C, (15)N CPMAS NMR and GIAO DFT calculations of stereoisomeric oxindole alkaloids from Cat's Claw (Uncaria tomentosa).


    Paradowska, Katarzyna; Wolniak, Michał; Pisklak, Maciej; Gliński, Jan A; Davey, Matthew H; Wawer, Iwona


    Oxindole alkaloids, isolated from the bark of Uncaria tomentosa [Willd. ex Schult.] Rubiaceae, are considered to be responsible for the biological activity of this herb. Five pentacyclic and two tetracyclic alkaloids were studied by solid-state NMR and theoretical GIAO DFT methods. The (13)C and (15)N CPMAS NMR spectra were recorded for mitraphylline, isomitraphylline, pteropodine (uncarine C), isopteropodine (uncarine E), speciophylline (uncarine D), rhynchophylline and isorhynchophylline. Theoretical GIAO DFT calculations of shielding constants provide arguments for identification of asymmetric centers and proper assignment of NMR spectra. These alkaloids are 7R/7S and 20R/20S stereoisomeric pairs. Based on the (13)C CP MAS chemical shifts the 7S alkaloids (delta C3 70-71ppm) can be easily and conveniently distinguished from 7R (deltaC3 74.5-74.9ppm), also 20R (deltaC20 41.3-41.7ppm) from the 20S (deltaC20 36.3-38.3ppm). The epiallo-type isomer (3R, 20S) of speciophylline is characterized by a larger (15)N MAS chemical shift of N4 (64.6ppm) than the allo-type (3S, 20S) of isopteropodine (deltaN4 53.3ppm). (15)N MAS chemical shifts of N1-H in pentacyclic alkaloids are within 131.9-140.4ppm. PMID:19019638

  5. GIAO-DFT isotropic magnetic shielding constants and spin-spin coupling of tartaric acid in water solution

    NASA Astrophysics Data System (ADS)

    Fideles, Bruna; Oliveira, Leonardo B. A.; Colherinhas, Guilherme


    We investigate the nuclear isotropic shielding constants and spin-spin coupling for oxygen and carbons atoms of isomers of tartaric acid in gas phase and in water solutions by Monte Carlo simulation and quantum mechanics calculations using the GIAO-B3LYP approach. Solute polarization effects are included iteratively and play an important role in the quantitative determination of shielding constants. Our MP2/aug-cc-pVTZ results show substantial increases of the dipole moment in solution as compared with the gas phase results (61-221%). The solvent effects on the σ(13O) values are in general small. More appreciable solvent effects can be seen on the σ(17O) and J(Csbnd O).

  6. Molecular structure of actein: 13C CPMAS NMR, IR, X-ray diffraction studies and theoretical DFT-GIAO calculations

    NASA Astrophysics Data System (ADS)

    Jamróz, Marta K.; Bąk, Joanna; Gliński, Jan A.; Koczorowska, Agnieszka; Wawer, Iwona


    Actein is a prominent triterpene glycoside occurring in Actaea racemosa. The triterpene glycosides are believed to be responsible for the estrogenic activity of an extract prepared from this herb. We determined in the crystal structure of actein by X-ray crystallography to be monoclinic P2(1) chiral space group. Refining the disorder, we determined 70% and 30% of contributions of ( S)- and ( R)-actein, respectively. The IR and Raman spectra suggest that actein forms at least four different types of hydrogen bonds. The 13C NMR spectra of actein were recorded both in solution and solid state. The 13C CPMAS spectrum of actein displays multiplet signals, in agreement with the crystallographic data. The NMR shielding constants were calculated for actein using GIAO approach and a variety of basis sets: 6-31G**, 6-311G**, 6-31+G**, cc-pVDZ, cc-pVDZ-su1 and 6-31G**-su1, as well as IGLO approach combined with the IGLO II basis set. The best results (RMSD of 1.6 ppm and maximum error of 3.4 ppm) were obtained with the 6-31G**-su1 basis set. The calculations of the shielding constants are helpful in the interpretation of the 13C CPMAS NMR spectra of actein and actein's analogues.

  7. Effect of 1,10-phenanthroline aromaticity in carboxylic acids:1H NMR spectroscopy, GIAO calculations and thermodynamic properties

    NASA Astrophysics Data System (ADS)

    Machado, Camila M. B.; Santos, Vanessa F. C.; Belarmino, Marcia K. D. L.; França, José A. A.; Moura, Gustavo L. C.; Lima, Nathalia B. D.


    Hydrogen bonding represents a class of chemical interactions, which are directly responsible for several physical properties, such as: energetic stabilities, boiling points, vibrational modes, bond lengths, etc. In this article, we examine from the point of view of 1H NMR spectroscopy and GIAO calculations, the effects associated with the process of formation of the hydrogen bonds as they appear in the chemical shifts of the acidic hydrogens in the complexes between nitrogenated compounds, PHEN, BIPY and DIBIPY, and carboxylic acids, HOOCH, HOOCCH3 and HOOCC6H5. All computational simulations were performed using the quantum chemical methods B3LYP/6-31++G(d,p) and ωB97X-D/def2-TZVP. The 1H NMR spectroscopy results showed that, in both cases, the hydrogen nucleus of the OH group is the most affected in the process of hydrogen bond formation. For the complexes involving PHEN we observed that the hydrogen nucleus is more strongly shielded when compared with this signal in the corresponding complexes involving BIPY and DIBIPY.

  8. ADHD: Tips to Try


    ... How Can I Help a Friend Who Cuts? ADHD: Tips to Try KidsHealth > For Teens > ADHD: Tips to Try Print A A A Text Size en español TDAH: Consejos que puedes probar ADHD , or attention deficit hyperactivity disorder, is a medical ...

  9. Trying to Conceive


    ... español ) Trying to conceive Related information Basal body temperature chart (PDF, 555 KB) Ovulation and due date ... of your fertile times. They are: Basal body temperature method – Basal body temperature is your temperature at ...


    EPA Science Inventory

    The Toxics Release Inventory (TRI) site is designed to provide information on toxic chemical releases including collected data, guidance documents, program planning, background, history, and, program contacts, among other things. The data included in this homepage have been submi...

  11. Successful combination of computationally inexpensive GIAO 13C NMR calculations and artificial neural network pattern recognition: a new strategy for simple and rapid detection of structural misassignments.


    Sarotti, Ariel M


    GIAO NMR chemical shift calculations coupled with trained artificial neural networks (ANNs) have been shown to provide a powerful strategy for simple, rapid and reliable identification of structural misassignments of organic compounds using only one set of both computational and experimental data. The geometry optimization, usually the most time-consuming step in the overall procedure, was carried out using computationally inexpensive methods (MM+, AM1 or HF/3-21G) and the NMR shielding constants at the affordable mPW1PW91/6-31G(d) level of theory. As low quality NMR prediction is typically obtained with such protocols, the decision making was foreseen as a problem of pattern recognition. Thus, given a set of statistical parameters computed after correlation between experimental and calculated chemical shifts the classification was done using the knowledge derived from trained ANNs. The training process was carried out with a set of 200 molecules chosen to provide a wide array of chemical functionalities and molecular complexity, and the results were validated with a set of 26 natural products that had been incorrectly assigned along with their 26 revised structures. The high prediction effectiveness observed makes this method a suitable test for rapid identification of structural misassignments, preventing not only the publication of wrong structures but also avoiding the consequences of such a mistake. PMID:23779148

  12. DFT-GIAO 1H and 13C NMR prediction of chemical shifts for the configurational assignment of 6beta-hydroxyhyoscyamine diastereoisomers.


    Muñoz, Marcelo A; Joseph-Nathan, Pedro


    (1)H and (13)C NMR chemical shift calculations using the density functional theory-gauge including/invariant atomic orbitals (DFT-GIAO) approximation at the B3LYP/6-311G++(d,p) level of theory have been used to assign both natural diastereoisomers of 6beta-hydroxyhyoscyamine. The theoretical chemical shifts of the (1)H and (13)C atoms in both isomers were calculated using a previously determined conformational distribution, and the theoretical and experimental values were cross-compared. For protons, the obtained average absolute differences and root mean square (rms) errors for each comparison showed that the experimental chemical shifts of dextrorotatory and levorotatory 6beta-hydroxyhyoscyamines correlated well with the theoretical values calculated for the (3R,6R,2'S) and (3S,6S,2'S) configurations, respectively, whereas for (13)C atoms the calculations were unable to differentiate between isomers. The nature of the relatively large chemical shift differences observed in nuclei that share similar chemical environments between isomers was asserted from the same calculations. It is shown that the anisotropic effect of the phenyl group in the tropic ester moiety, positioned under the tropane ring, has a larger shielding effect over one ring side than over the other one. PMID:19373852

  13. Preparation, GIAO NMR Calculations and Acidic Properties of Some Novel 4,5-dihydro-1H-1,2,4-triazol-5-one Derivatives with Their Antioxidant Activities

    PubMed Central

    Yüksek, Haydar; Alkan, Muzaffer; Cakmak, Ismail; Ocak, Zafer; Bahçeci, Şule; Calapoğlu, Mustafa; Elmastaş, Mahfuz; Kolomuç, Ali; Aksu, Havva


    Six novel 3-alkyl(aryl)-4-(p-nitrobenzoylamino)-4,5-dihydro-1H-1,2,4-triazol-5- ones (2a-f) were synthesized by the reactions of 3-alkyl(aryl)-4-amino-4,5-dihydro-1H- 1,2,4-triazol-5-ones (1a-f) with p-nitrobenzoyl chloride and characterized by elemental analyses and IR, 1H-NMR, 13C-NMR and UV spectral data. The newly synthesized compounds 2 were titrated potentiometrically with tetrabutylammonium hydroxide in four non-aqueous solvents such as acetone, isopropyl alcohol, tert-butyl alcohol and N,N-dimethylformamide, and the half-neutralization potential values and the corresponding pKa values were determined for all cases. Thus, the effects of solvents and molecular structure upon acidity were investigated. In addition, isotropic 1H and 13C nuclear magnetic shielding constants of compounds 2 were obtained by the gauge-including-atomic-orbital (GIAO) method at the B3LYP density functional level. The geometry of each compound has been optimized using the 6-311G basis set. Theoretical values were compared to the experimental data. Furthermore, these new compounds and five recently reported 3-alkyl-4-(2-furoylamino)-4,5-dihydro-1H-1,2,4-triazol-5-ones (3a–c,e,f) were screened for their antioxidant activities. PMID:19325716

  14. Try Another Way. Training Manual.

    ERIC Educational Resources Information Center

    Gold, Marc

    Intended for use in training conferences, the manual describes the philosophy and procedures of Try Another Way, an approach for teaching moderately, severely and profoundly mentally retarded persons and developmentally disabled persons difficult to train. An alternative definition of retardation is proposed which stresses level of functioning…

  15. Analysis of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rate within the scope of econophysics

    NASA Astrophysics Data System (ADS)

    Deviren, Bayram; Kocakaplan, Yusuf; Keskin, Mustafa; Balcılar, Mehmet; Özdemir, Zeynel Abidin; Ersoy, Ersan


    In this study, we analyze the Turkish Lira/US Dollar (TRY/USD), Turkish Lira/Euro (TRY/EUR), Turkish Lira/Japanese Yen (TRY/JPY) and Turkish Lira/Swiss Franc (TRY/CHF) exchange rates in the global financial crisis period to detect the bubbles and crashes in the TRY by using a mathematical methodology developed by Watanabe et al. (2007). The methodology defines the bubbles and crashes in financial market price fluctuations by considering an exponential fitting of the associated data. This methodology is applied to detect the bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rates from January, 1, 2005 to December, 20, 2013. In this mathematical methodology, the whole period of bubbles and crashes can be determined purely from past data, and the start of bubbles and crashes can be identified even before its bursts. In this way, the periods of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF are determined, and the beginning and end points of these periods are detected. The results show that the crashes in the TRY/CHF exchange rate are commonly finished earlier than in the other exchange rates; hence it is probable that the crashes in the other exchange rates would be finished soon when the crashes in the TRY/CHF exchange rate ended. We also find that the periods of crashes in the TRY/EUR exchange rate take longer time than in the other exchange rates. This information can be used in risk management and/or speculative gain. The crashes' periods in the TRY/EUR and TRY/USD exchange rates are observed to be relatively longer than in the other exchange rates.

  16. Ab initio/GIAO-CCSD(T) (13)C NMR study of the rearrangement and dynamic aspects of rapidly equilibrating tertiary carbocations, C6H13(+) and C7H15(+).


    Olah, George A; Prakash, G K Surya; Rasul, Golam


    The rearrangement pathways of the equilibrating tertiary carbocations, 2,3-dimethyl-2-butyl cation (C6H13(+), 1), 2,3,3-trimethyl-2-butyl cation (C7H15(+), 5) and 2,3-dimethyl-2-pentyl cation (C7H15(+), 8 and 9) were investigated using the ab initio/GIAO-CCSD(T) (13)C NMR method. Comparing the calculated and experimental (13)C NMR chemical shifts of a series of carbocations indicates that excellent prediction of δ(13)C could be achieved through scaling. In the case of symmetrical equilibrating cations (1 and 5) the Wagner-Meerwein 1,2-hydride and 1,2-methide shifts, respectively, produce the same structure. This indicates that the overall (13)C NMR chemical shifts are conserved and independent of temperature. However, in the case of unsymmetrical equilibrating cations (8 and 9) the Wagner-Meerwein shift produces different tertiary structures, which have slightly different thermodynamic stabilities and, thus, different spectra. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level structure 8 is only 90 calories/mol more stable than structure 9. Based on computed (13)C NMR chemical shift calculations, mole fractions of these isomers were determined by assuming the observed chemical shifts are due to the weighted average of the chemical shifts of the static ions. PMID:26192716

  17. Synthesis, determination of p Ka values and GIAO NMR calculations of some new 3-alkyl-4-( p-methoxybenzoylamino)-4,5-dihydro-1 H-1,2,4-triazol-5-ones

    NASA Astrophysics Data System (ADS)

    Yüksek, Haydar; Alkan, Muzaffer; Bahçeci, Şule; Cakmak, Ismail; Ocak, Zafer; Baykara, Haci; Aktaş, Ozlem; Ağyel, Elif


    3-Alkyl-4-amino-4,5-dihydro-1 H-1,2,4-triazol-5-ones ( 2) reacted with p-methoxybenzoyl chloride to afford the corresponding 3-alkyl-4-( p-methoxybenzoylamino)-4,5-dihydro-1 H-1,2,4-triazol-5-ones ( 3). Five newly synthesized compounds have been characterized by elemental analyses, IR, 1H NMR, 13C NMR and UV spectral data. The newly synthesized compounds 3 were titrated potentiometrically with tetrabutylammonium hydroxide in four non-aqueous solvents such as acetonitrile, isopropyl alcohol, tert-butyl alcohol and N, N-dimethylformamide, and the half-neutralization potential values and the corresponding p Ka values were determined for all cases. Thus, the effects of solvents and molecular structure upon acidity were investigated. In addition, isotropic 1H and 13C nuclear magnetic shielding constants of compounds 3 were obtained by the gauge-including-atomic-orbital (GIAO) method at the B3LYP density functional level. The geometry of each compound has been optimized using the 6-311G basis set. Theoretical values were compared to the experimental data.

  18. Study of stereospecificity of 1H, 13C, 15N and 77Se shielding constants in the configurational isomers of the selenophene-2-carbaldehyde azine by NMR spectroscopy and MP2-GIAO calculations.


    Afonin, Andrei V; Pavlov, Dmitry V; Albanov, Alexander I; Levanova, Ekaterina P; Levkovskaya, Galina G


    In the (1)H and (13)C NMR spectra of selenophene-2-carbaldehyde azine, the (1)H-5, (13)C-3 and (13)C-5 signals of the selenophene ring are shifted to higher frequencies, whereas those of the (1)H-1, (13)C-1, (13)C-2 and (13)C-4 are shifted to lower frequencies on going from the EE to ZZ isomer or from the E moiety to the Z moiety of EZ isomer. The (15)N chemical shift is significantly larger in the EE isomer relative to the ZZ isomer and in the E moiety relative to the Z moiety of EZ isomer. A very pronounced difference (60-65 mg/g) between the (77)Se resonance positions is revealed in the studied azine isomers, the (77)Se peak being shifted to higher frequencies in the ZZ isomer and in the Z moiety of EZ isomer. The trends in the changes of the measured chemical shifts are reasonably reproduced by the GIAO calculations at the MP2 level of the (1)H, (13)C, (15)N and (77)Se shielding constants in the energy-favorable conformation with the syn orientation of both selenophene rings relative to the C = N groups. The NBO analysis suggests that such an arrangement of the selenophene rings may take place because of a higher energy of some intramolecular interactions. PMID:22002712

  19. Tri-soft shell technique.


    Arshinoff, Steve A; Norman, Richard


    Soft-shell techniques exist for lower viscosity dispersive with higher viscosity cohesive ophthalmic viscosurgical devices (OVDs) (soft-shell technique [SST]), viscoadaptive OVDs with balanced salt solution (ultimate soft-shell technique), intraoperative floppy-iris syndrome (soft-shell bridge), and many specific modifications for disinserted zonular fibers, frayed iris strands, Fuchs endothelial dystrophy, small holes in the posterior capsule with protruding vitreous, capsular dye use, and others. Soft-shell techniques exist because it is rheologically impossible to control the surgical environment with a single OVD as well as with an ordered combination of rheologically different OVDs. Surgeons frequently confuse these techniques because of their multitude. This paper unifies all SSTs into a single improved tri-soft shell technique (TSST), from which basic specific applications to unusual circumstances are simple and intuitive. As shown with previous SSTs, the TSST allows surgeons to perform complex tasks with greater surgical facility and to protect endothelial cells better than with single OVDs. PMID:23889867

  20. Can't sleep? Try these tips


    ... Can’t sleep? Try these tips To use the sharing features ... time. But if it happens often, lack of sleep can affect your health and make it hard ...

  1. Scientists Try to Stop Another Deadly Virus


    ... Try to Stop Another Deadly Virus Junin, an Ebola-like disease in Argentina, has a death rate ... companies that developed a similar treatment against the Ebola virus during the 2014-2015 outbreak. That drug, ...

  2. Looks-Conscious Teens Trying Risky Supplements


    ... gov/medlineplus/news/fullstory_159576.html Looks-Conscious Teens Trying Risky Supplements Unregulated products can harm health, ... be role models, but that comes with the power of success and celebrity, he said. "Professional sports ...

  3. TriKota v 1.0

    SciTech Connect



    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantification algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.

  4. TriKota v 1.0


    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantificationmore » algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.« less

  5. Global Gene Regulation by Fusarium Transcription Factors Tri6 and Tri10 Reveals Adaptations for Toxin Biosynthesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Trichothecenes are isoprenoid mycotoxins in wheat infected with the filamentous fungus Fusarium graminearum. Some fungal genes for trichothecene biosynthesis (Tri genes) are known to be under control of transcription factors encoded by Tri6 and Tri10. Tri6 and Tri10 deletion mutants were constructed...

  6. Tri-District Arts Consortium Summer Program.

    ERIC Educational Resources Information Center

    Kirby, Charlotte O.


    The Tri-District Arts Consortium in South Carolina was formed to serve artistically gifted students in grades six-nine. The consortium developed a summer program offering music, dance, theatre, and visual arts instruction through a curriculum of intense training, performing, and hands-on experiences with faculty members and guest artists. (JDD)

  7. A tri-serine tri-lactone scaffold for the quantification of citrate in urine.


    Akdeniz, Ali; Caglayan, Mehmet Gokhan; Anzenbacher, Pavel


    Tri-serine tri-lactone based C3 symmetry fluorescent sensors were synthesized. Citrate is shown to bind to sensors, while displaying an increase in fluorescence intensity for the sensor with thiourea and a quenching for the sensor with sulfonamide. Information-rich responses of the sensors enable us to discriminate structurally similar anions, including mono-, di- and tri-carboxylates with 100% correct classification. A simple two-sensor array enables the determination of the concentration of citrate in urine without any sample preparation with high accuracy (error < 2%). PMID:26669653

  8. Tri-axial tactile sensing element

    NASA Astrophysics Data System (ADS)

    Castellanos-Ramos, Julián.; Navas-González, Rafael; Vidal-Verdú, F.


    A 13 x 13 square millimetre tri-axial taxel is presented which is suitable for some medical applications, for instance in assistive robotics that involves contact with humans or in prosthetics. Finite Element Analysis is carried out to determine what structure is the best to obtain a uniform distribution of pressure on the sensing areas underneath the structure. This structure has been fabricated in plastic with a 3D printer and a commercial tactile sensor has been used to implement the sensing areas. A three axis linear motorized translation stage with a tri-axial precision force sensor is used to find the parameters of the linear regression model and characterize the proposed taxel. The results are analysed to see to what extent the goal has been reached in this specific implementation.

  9. Tri-bimaximal Mixing from Cascades

    SciTech Connect

    Takahashi, Ryo


    We investigate fermion mass matrices of the cascade form which lead to the tri-bimaximal mixing in the lepton sector. The cascade neutrino matrix predicts a parameter-independent relation among the observables, which are the neutrino mixing angles and mass squared differences. The relation predicts that the atmospheric neutrino mixing angle is close to maximal. We also study phenomenological aspect of the cascade form in supersymmetric theory, which are lepton flavor violation and thermal leptogenesis. A dynamical realivation of the cascade mass matrix are also presented in U(1) flavor theory.

  10. Synthesis of di-, tri- and tetracyclopropylhydrazines.


    Shestakov, Aleksandr N; Kuznetsov, Mikhail A


    Previously unknown 1,1-dicyclopropylhydrazine was obtained in two steps starting from dicyclopropylamine. It serves as a convenient starting material to tri- and tetracyclopropylhydrazines, which have not been described in the literature either. Tricyclopropylhydrazine was prepared in an overall four-step sequence featuring the de Meijere-Chaplinski modification of the Kulinkovich reaction as a key step. Tetracyclopropylhydrazine was obtained by the reductive amination of the cyclopropanone ethyl trimethylsilyl acetal with 1,1-dicyclopropylhydrazine or with the parent hydrazine. Synthetic utility of these cyclopropylhydrazine building blocks is presented as well. PMID:26734692

  11. Convertible, tri-mode solar conversion system

    NASA Astrophysics Data System (ADS)

    Kelly, D. A.

    A convertible, tri-mode solar collection system has been developed to provide year-round operation in the Northeastern U.S. Employing a plastic hot air duct-box in addition to conventional linear parabolic concentrators and thermal storage units, the system is able to provide wintertime hot air for residential heating and summertime steam for electrical power generation. Because of its superior utilization factor, it is expected that the device will pay back for an initial investment in a significantly shorter time than present alternatives

  12. A Transgenic Tri-Modality Reporter Mouse

    PubMed Central

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.


    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This “Tri-Modality Reporter Mouse” system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R2=0.89 for TdTomato vs Fluc, R2=0.94 for Fluc vs TTK, R2=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R2=0.99 for bioluminescence imaging (BLI)). Both BLI (R2=0.93) and micro-PET (R2=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R2=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell research

  13. Toxic Release Inventory (TRI), 1989. Data file

    SciTech Connect

    Not Available


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a National Inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the States of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups. Another important user group is likely to be concerned citizens who, on their own or through public interest groups and public libraries, can use TRI to ask questions about chemical releases in their communities.

  14. Try-in Pastes Versus Resin Cements: A Color Comparison.


    Vaz, Edenize Cristina; Vaz, Maysa Magalhães; Rodrigues Gonçalves de Oliveira, Maria Beatriz; Takano, Alfa Emília; de Carvalho Cardoso, Paula; de Torres, Érica Miranda; Gonzaga Lopes, Lawrence


    This study aimed to compare the color of ceramic veneer restorations using different shades of try-in pastes and resin cement. Researchers found no differences between try-in pastes and resin cements after cementation. PMID:27213935

  15. Characterization of Tri-lab Tantalum Plate.

    SciTech Connect

    Buchheit, Thomas E.; Cerreta, Ellen K.; Deibler, Lisa Anne; Chen, Shu-Rong; Michael, Joseph R.


    This report provides a detailed characterization Tri-lab Tantalum (Ta) plate jointly purchased from HCStark Inc. by Sandia, Los Alamos and Lawrence Livermore National Laboratories. Data in this report was compiled from series of material and properties characterization experiments carried out at Sandia (SNL) and Los Alamos (LANL) Laboratories through a leveraged effort funded by the C2 campaign. Results include microstructure characterization detailing the crystallographic texture of the material and an increase in grain size near the end of the rolled plate. Mechanical properties evaluations include, compression cylinder, sub-scale tension specimen, micohardness and instrumented indentation testing. The plate was found to have vastly superior uniformity when compare with previously characterized wrought Ta material. Small but measurable variations in microstructure and properties were noted at the end, and at the top and bottom edges of the plate.

  16. Tri-Center Analysis: Determining Measures of Trichotomous Central Tendency for the Parametric Analysis of Tri-Squared Test Results

    ERIC Educational Resources Information Center

    Osler, James Edward


    This monograph provides an epistemological rational for the design of a novel post hoc statistical measure called "Tri-Center Analysis". This new statistic is designed to analyze the post hoc outcomes of the Tri-Squared Test. In Tri-Center Analysis trichotomous parametric inferential parametric statistical measures are calculated from…

  17. Development and evaluation of WillTry: An instrument for measuring children’s willingness to try fruits and vegetables

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This paper describes the development and evaluation of the WillTry instrument, a psychometric tool, designed to measure children’s willingness to try fruits and vegetables. WillTry surveys were interviewer-administered to 284 children in an elementary school, and in summer day camps located in rura...

  18. Still confusing, TRI reporting requires careful organization

    SciTech Connect

    Costa, R. )


    Since 1988, Sec. 313 of the Emergency Planning and Community Right-to-Know Act (EPCRA) has required manufacturing facilities to report annually on toxic chemical releases and offsite transfers of more than 300 toxic chemicals above certain threshold quantities. EPCRA, a stand-alone regulation that also is incorporated in SARA as Title III, mandates that only facilities whose primary business is manufacturing products for commercial use report under the Toxic Chemical Release Inventory (TRI) program. The list of regulated chemicals is dynamic. A petition process allows anyone to request additions or deletions from the chemical list, based on established toxicity criteria. The criteria involve health effects -- including evidence of reproductive dysfunction, neurological disorders, heritable genetic mutations, cancer, and teratogenic and other effects -- as well as significant adverse impacts to the environment. EPA must respond within 180 days to a petition, and any changes to the list must be promulgated under federal regulatory procedures. A petition submitted by a state governor becomes law if EPA fails to act within 180 days.

  19. Toxic release inventory, (TRI), 1991. Data file

    SciTech Connect


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a national inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad-based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups.

  20. Toxic Release Inventory (TRI), 1990. Data file

    SciTech Connect

    Not Available


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a National Inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the States of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups.

  1. PyTRiP - a toolbox and GUI for the proton/ion therapy planning system TRiP

    NASA Astrophysics Data System (ADS)

    Toftegaard, J.; Petersen, J. B.; Bassler, N.


    Purpose: Only very few treatment planning systems (TPS) are capable of handling heavy ions. Commercial heavy ion TPS are costly and normally restrict the possibility to implement new functionalities. PyTRiP provides Python bindings and a platform-independent graphical user interface (GUI) for the heavy ion treatment program TRiP, and adds seamless support of DICOM files. We aim to provide a front-end for TRiP which does not require any special computer skills. Methods: PyTRiP is written in Python combined with C for fast computing. Routines for DICOM file import/export to TRiPs native file format are implemented. The GUI comes as an executable with all its dependencies including PyTRiP making it easy to install on Windows, Mac and Linux. Results: PyTRiP is a comprehensive toolbox for handling TRiP. Treatment plans are handled using an object oriented structure. Bindings to TRiP (which only runs on Linux, either locally or on a remote server) are performed through a single function call. GUI users can intuitively create treatment plans without much knowledge about the TRiP user interface. Advanced users still have full access to all TRiP functionality. The user interface comes with a comprehensive plotting tool, which can visualize 2D contours, volume histograms, as well as dose- and linear energy transfer (LET) distributions. Conclusion: We developed a powerful toolbox for ion therapy research using TRiP as backend. The corresponding GUI allows to easily and intuitively create, calculate and visualize treatment plans. TRiP is thereby more accessible and simpler to use.

  2. See Behind the Numbers at WSU Tri-Cities

    SciTech Connect

    Fisher, Brad; Kluse, Michael; Novich, Carolynn M.


    The enrollment numbers for WSU were released this week. The enrollment at the Tri-Cities campus remained flat, but these numbers do not tell the full story of WSU Tri-Cities and the many things we have to celebrate about our local campus. WSU Tri-Cities has gone through significant growth and change over the past several years and has fostered closer ties to its alumni, the community, region and state.

  3. Tri-Cities Index of Innovation and Technology

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.; Butner, Ryan S.


    In 2001 and 2004, the Economic Development Office of Pacific Northwest National Laboratory published companion reports to the Washington Technology Center Index studies that provided additional information on the Tri-Cities (Kennewick-Richland-Pasco) area of the state, its technology businesses, and important advantages that the Tri-Cities have as places to live and do business. These reports also compared the Tri-Cities area to other technology-based metropolitan areas in the Pacific Northwest and nation along critical dimensions known to be important to technology firms. This report updates the material in these earlier reports, and highlights a growing Tri-Cities metropolitan area.

  4. Bismuth tri-iodide radiation detector development

    NASA Astrophysics Data System (ADS)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  5. Financial Statement Audit Report of Tri-County Community College.

    ERIC Educational Resources Information Center

    Campbell, Ralph

    This report presents the results of the Tri-County Community College financial statement audit for the fiscal year ending on June 30, 1998. Tri-County Community College is a component of the State of North Carolina, thus the authority to audit is granted by Article 5A of G.S. 147. The accounts and operations of the institution were subject to…

  6. TriBITS (Tribal Build, Integrate, and Test System)


    TriBITS is a configuration, build, test, and reporting system that uses the Kitware open-source CMake/CTest/CDash system. TriBITS contains a number of custom CMake/CTest scripts and python scripts that extend the functionality of the out-of-the-box CMake/CTest/CDash system.

  7. Global Gene Regulation by Fusarium Transcription Factors Tri6 and Tri10 Reveals Adaptations for Toxin Biosynthesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Trichothecenes are isoprenoid mycotoxins and harmful contaminants of wheat infected with the filamentous fungus Fusarium graminearum. The expression of some fungal genes for trichothecene biosynthesis (Tri genes) are known to be under control of transcription factors encoded by the genes Tri6 and Tr...


    PubMed Central

    Wolfson, Mark; Pockey, Jessica R.; Reboussin, Beth A.; Sutfin, Erin L.; Egan, Kathleen L.; Wagoner, Kimberly G.; Spangler, John G.


    Background Dissolvable tobacco products (DTPs) have been introduced into test markets in the U.S. We sought to gauge level of interest in trying these products and correlates of interest among potential consumers. Methods A web-based survey of freshman at 11 universities in North Carolina (NC) and Virginia (VA) was conducted in fall 2010. Multivariable logistic regression analyses were used to identify correlates of students’ likelihood to try DTPs. Results Weighted prevalence of likelihood to try DTPs was 3.7%. Significant correlates of likelihood to try included male gender, current cigarette smoking, current snus use, sensation seeking, lifetime illicit drug use, and perceived health risk of using DTPs. Among current smokers, current snus use, current use of chewing tobacco, and considering quitting smoking were associated with likelihood to try DTPs. Conclusions While overall interest in trying these products was low, current users of cigarettes and snus were much more likely than others in trying a free sample. Some current smokers may consider DTPs to be an aid to smoking cessation, although the population-level impact of introducing these products is unknown. PMID:24309296

  9. Many Breast Cancer Patients Try Alternative Medicine First


    ... Many Breast Cancer Patients Try Alternative Medicine First: Study But delay ... 12, 2016 (HealthDay News) -- Women with early stage breast cancer who turn to alternative medicine may delay recommended ...

  10. 77 FR 52309 - Tri County Resource Advisory Committee

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... ACTION: Notice of meeting. SUMMARY: The Tri County Resource Advisory Committee will meet in Deer Lodge... meeting will be held at 1002 Hollenback Road, Deer Lodge, Montana at the USDA Service Center...

  11. Many Breast Cancer Patients Try Alternative Medicine First


    ... fullstory_158806.html Many Breast Cancer Patients Try Alternative Medicine First: Study But delay in getting chemotherapy may ... with early stage breast cancer who turn to alternative medicine may delay recommended chemotherapy, a new study suggests. ...

  12. Learner Performance Accounting: A Tri-Cycle Process

    ERIC Educational Resources Information Center

    Brown, Thomas C.; McCleary, Lloyd E.


    The Tri-Cycle Process described in the model permits for the first time an integrated system for designing an individualized instructional system that would permit a rational, diagnosis-prescription-evaluation system keyed to an accounting system. (Author)

  13. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    NASA Technical Reports Server (NTRS)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.


    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  14. Tri-Cities research may help biofuels take flight

    SciTech Connect

    Madison, Alison L.


    Monthly economic diversity column for the Tri-City Herald. Excerpt: If you stop and think about it, some pretty interesting stuff has roots in the Tri-Cities, but reaches far beyond. Many Tri-Citians have gone on to be professional athletes, entertainers, scientists and engineers, doctors, lawyers, and humanitarians to name just a few. And a lot of groundbreaking discoveries - many born of strategic collaborations resulting from purposeful economic development efforts - have emerged from work at our local national laboratory. Just recently, Pacific Northwest National Laboratory entered into a $2M collaboration with Seattle biofuel producer Imperium Renewables and other partners to develop a new method to make renewable jet fuels. Successful development of the catalytic process, which converts biomass-based alcohols into renewable drop-in jet fuels, could lead to additional renewable jet fuel production facilities being built and operated in the Pacific Northwest.

  15. The Food Friends: Encouraging Preschoolers to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura; Anderson, Jennifer


    In response to concerns about children's eating behaviors, the Colorado Nutrition Network developed and tested Food Friends--Making New Foods Fun for Kids. The program was designed as a 12-week social marketing campaign aimed at encouraging preschool-age children to try new foods, such as Ugli Fruit, couscous, and daikon radish. Tasting novel…

  16. Queens Tri-School Confederation, 1991-92 Evaluation Report.

    ERIC Educational Resources Information Center

    Hannah, Susan; Dworkowitz, Barbara

    An evaluation was done of the Queens Tri-School Confederation, three high schools in the New York City Public Schools funded by a federal grant from the Magnet Schools Assistance Program. The grant provided Hillcrest, Jamaica, and Thomas A. Edison High Schools with funds to develop or expand emergency technician programs at Hillcrest; a law…

  17. Mooney Institute Tries to Blend Unionism, School Reform

    ERIC Educational Resources Information Center

    Honawar, Vaishali


    Teachers' unions are rarely seen as hands-on school reformers, but the Tom Mooney Institute for Teacher & Union Leadership thinks they should be, and is trying to get a new generation of local union leaders ready for such roles. The institute is an offshoot of the 13-year-old Teachers Union Reform Network of NEA and AFT Locals, or TURN, which…

  18. Cutting Back on Wine? Try a Smaller Glass


    ... FAQs Contact Us Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Latest Health News → Article URL of this page: Cutting Back on Wine? Try a Smaller Glass Even ...

  19. A Theoretical Analysis of the English "Try and V" Construction

    ERIC Educational Resources Information Center

    Tsuchida, Takehiro


    Examining grammatically idiosyncratic English expressions often helps reveal not only to ESL (English as a second language) teachers and learners but also to experts on English how intricately language is composed. This paper aims to expound one such idiomatic expression of the "try and V" construction by exploring the phenomenon from diverse…

  20. As Students Scatter Online, Colleges Try to Keep Up

    ERIC Educational Resources Information Center

    Mangan, Katherine


    While e-mail remains the official method of communication on most campuses, colleges are expanding their presence in the virtual world, trying to reach students where they hang out. But without careful planning, that can lead to a scattershot approach as new platforms keep popping up and students' attention becomes increasingly dispersed. The…

  1. Genetic-algorithm-based tri-state neural networks

    NASA Astrophysics Data System (ADS)

    Uang, Chii-Maw; Chen, Wen-Gong; Horng, Ji-Bin


    A new method, using genetic algorithms, for constructing a tri-state neural network is presented. The global searching features of the genetic algorithms are adopted to help us easily find the interconnection weight matrix of a bipolar neural network. The construction method is based on the biological nervous systems, which evolve the parameters encoded in genes. Taking the advantages of conventional (binary) genetic algorithms, a two-level chromosome structure is proposed for training the tri-state neural network. A Matlab program is developed for simulating the network performances. The results show that the proposed genetic algorithms method not only has the features of accurate of constructing the interconnection weight matrix, but also has better network performance.

  2. Tri-band microstrip antenna design for wireless communication applications

    NASA Astrophysics Data System (ADS)

    Sami, Gehan; Mohanna, Mahmoud; Rabeh, Mohamed L.


    This paper introduces a novel rectangular tri-band patch antenna that is fabricated and measured for wireless communication systems. The introduced antenna is designed for WLAN and WiMAX applications. The desired tri-band operation was obtained by proper loading for a rectangular patch antenna using slots and shorting pins. The optimal location and dimension for the loaded elements were obtained with the aid of interfacing a Genetic Algorithm (GA) model with an Ansoft High Frequency Structural Simulator (HFSS). The results obtained from our simulated antenna show 5.8% impedance matching band width at 2.4 GHz, 3.7% at 3.5 GHz and 1.57% at 5.7 GHz. In addition, an equivalent circuit of the proposed antenna is introduced using the least square curve fitting optimization technique.

  3. Development of the Tri-ATHLETE Lunar Vehicle Prototype

    NASA Technical Reports Server (NTRS)

    Heverly, Matt; Matthews, Jaret; Frost, Matt; Quin, Chris


    The Tri-ATHLETE (All Terrain Hex Limed Extra Terrestrial Explorer) vehicle is the second generation of a wheel-on-limb vehicle being developed to support the return of humans to the lunar surface. This paper describes the design, assembly, and test of the Tri-ATHLETE robotic system with a specific emphasis on the limb joint actuators. The design and implementation of the structural components is discussed, and a novel and low cost approach to approximating flight-like cabling is also presented. The paper concludes with a discussion of the "second system effect" and other lessons learned as well as results from a three week long field trial of the vehicle in the Arizona desert.

  4. 108. Doughton Park Recreation Area Comfort Station. Instead of trying ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    108. Doughton Park Recreation Area Comfort Station. Instead of trying to hide this building, it was decided to let it be seen. A salt box design reflecting a mountain building was chosen, it had a sloping split shingle roof matching the hill side with a front porch placed on the lower side. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  5. The tri-spade drill for endosseous dental implant installation.


    Kay, J F; Gilman, L; May, T C


    Many aspects of endosseous dental implant practice have been addressed over the past several decades. While most of this attention has centered on the dental implant body itself and, most recently, on various aspects of prosthetic restoration, the installation armamentarium for site preparation and implant placement has been neglected. Drills, in particular, have received minimal attention, with most drills currently used for implant placement being identical, or nearly identical, to century-old wood or metal cutting instruments. The tri-spade drill design represents an innovation that has evolved from analysis of currently used implant drills, drill mechanics, and the mechanical and physical properties of bone, in consideration of the clinical realities of contemporary endosseous implant placement. The tri-spade drill design, which features three cutting edges, is much more stable in the hands of the practicing clinician. It reduces crestal chatter upon entry into the bone site (a stable drilling situation), resulting in a more perfectly prepared final hole for placement of a cylindrical root-form dental implant. The drill tip angle is designed specifically for use with bone; the reaming action associated with the sharpened cutting edges adjacent to the large side flutes also allows for efficient debris removal. The tri-spade drill design represents an incremental increase in the dental implant armamentarium and efficacy for the installation of endosseous cylindrical dental implants. PMID:1813652

  6. Tri-layered elastomeric scaffolds for engineering heart valve leaflets

    PubMed Central

    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L.; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B.; Mayer, John E.; Khademhosseini, Ali


    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(-caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) growth within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  7. Bayer bilateral denoising on TriMedia3270

    NASA Astrophysics Data System (ADS)

    Phelippeau, H.; Akil, M.; Dias Rodrigues, B.; Talbot, H.; Bara, S.


    Digital cameras are now commonly included in several digital devices such as mobile phones. They are present everywhere and have become the principal image capturing tool. Inherent to light and semiconductors properties, sensor noise [10] continues to be an important factor of image quality [12], especially in low light conditions. Removing the noise with mathematical solutions appears thus unavoidable to obtain an acceptable image quality. However, embedded devices are limited by processing capabilities and power consumption and thus cannot make use of the full range of complex mathematical noise removing solutions. The bilateral filter [6] appears to be an interesting compromise between implementation complexity and noise removing performances. Especially, the Bayer [5] bilateral filter proposed in [11] is well adapted for single sensor devices. In this paper, we simulate and optimize the Bayer bilateral filter execution on a common media-processor: the TM3270 [4] from the NXP Semiconductors TriMedia family. To do so we use the TriMedia Compilation System (TCS). We applied common optimization techniques (such as LUT, loop unrolling, convenient data type representation) as well as custom TriMedia operations. We finally propose a new Bayer bilateral filter formulation dedicated to the TM3270 architecture that yields an execution improvement of 99.6% compared to the naÃve version. This improvement results in real-time video processing at VGA resolution at the 350MHz clock rate.

  8. Dental hygienists' work environment: motivating, facilitating, but also trying.


    Candell, A; Engström, M


    The aim of the present study was to describe dental hygienists' experiences of their physical and psychosocial work environment. The study was descriptive in design and used a qualitative approach. Eleven dental hygienists participated in the study and data were collected during spring 2008 using semi-structured interviews. The material was analysed using qualitative content analysis. The results showed that the dental hygienists experienced their work environment as motivating and facilitating, but at the same time as trying. The three categories revealed a theme: Being controlled in a modern environment characterized by good relationships. Motivating factors were the good relationship with co-workers, managers and patients, seeing the results of your work, having your own responsibility and making your own decisions. The new, pleasant and modern clinics, good cooperation between co-workers and varying duties were described as facilitating factors. The trying factors, as described by the dental hygienists, were above all being controlled by time limits or by some elements of the work, such as teamwork. The dental hygienists also felt stress because appointments were too-short. To conclude, the participants described their work environment as trying in several ways, despite the modern clinics and good relationships. PMID:20624190

  9. Tri-layered elastomeric scaffolds for engineering heart valve leaflets.


    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B; Mayer, John E; Khademhosseini, Ali


    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported the growth of valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  10. Government action on diabetes prevention: time to try something new.


    Kaldor, Jenny C; Magnusson, Roger S; Colagiuri, Stephen


    Type 2 diabetes mellitus, driven by overweight and obesity linked to unhealthy diets, is the fastest-growing non-communicable disease in Australia. Halting the rise of diabetes will require a paradigm shift from personal to shared responsibility, with greater accountability from Australian governments and the food industry. It will also require governments to try something different to the prevailing approaches emphasising education and the provision of information. We propose four priority areas where government regulation could strengthen Australia's response. Those areas relate to mandatory front-of-pack food labelling, regulating junk food advertising, better oversight of food reformulation and taxing sugar-sweetened beverages. PMID:26068689

  11. An innovative tri-directional broadband piezoelectric energy harvester

    SciTech Connect

    Su, Wei-Jiun Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  12. Parametric design of tri-axial nested Helmholtz coils

    SciTech Connect

    Abbott, Jake J.


    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  13. Diplomats try to establish greenhouse gas emissions-reduction rules

    NASA Astrophysics Data System (ADS)

    Showstack, Randy

    Ministers and other senior officials will participate in the next follow-up to the Kyoto Protocol to the United Nations Framework Convention on Climate Change when they deliberate on how to reduce greenhouse gas emissions at a November 2-13 meeting in Buenos Aires, Argentina."The Kyoto conference on the Climate Change Convention was a high-profile event because for the first time industrialized countries adopted emission-reduction targets that are legally binding," said Michael Zammit Cutajar, executive secretary of the convention. "In Buenos Aires, governments will try to establish the rules of the game for reaching these targets.""

  14. Diplomats try to establish greenhouse gas emissions-reduction rules

    NASA Astrophysics Data System (ADS)

    Showstack, Randy

    Ministers and other senior officials will participate in the next follow-up to the Kyoto Protocol to the United Nations Framework Convention on Climate Change when they deliberate on how to reduce greenhouse gas emissions at a November 2-13 meeting in Buenos Aires, Argentina.“The Kyoto conference on the Climate Change Convention was a high-profile event because for the first time industrialized countries adopted emission-reduction targets that are legally binding,” said Michael Zammit Cutajar, executive secretary of the convention. “In Buenos Aires, governments will try to establish the rules of the game for reaching these targets."”

  15. Tri-functional cannula for retinal endovascular surgery


    Weiss, Jonathan D.


    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  16. An innovative tri-directional broadband piezoelectric energy harvester

    NASA Astrophysics Data System (ADS)

    Su, Wei-Jiun; Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  17. Multimatrix models and tri-Sasaki Einstein spaces

    SciTech Connect

    Herzog, Christopher P.; Pufu, Silviu S.; Tesileanu, Tiberiu; Klebanov, Igor R.


    Localization methods reduce the path integrals in N{>=}2 supersymmetric Chern-Simons gauge theories on S{sup 3} to multimatrix integrals. A recent evaluation of such a two-matrix integral for the N=6 superconformal U(N)xU(N) Aharony-Bergman-Jafferis-Maldacena theory produced detailed agreement with the AdS/CFT correspondence, explaining, in particular, the N{sup 3/2} scaling of the free energy. We study a class of p-matrix integrals describing N=3 superconformal U(N){sup p} Chern-Simons gauge theories. We present a simple method that allows us to evaluate the eigenvalue densities and the free energies in the large N limit keeping the Chern-Simons levels k{sub i} fixed. The dual M-theory backgrounds are AdS{sub 4}xY, where Y are seven-dimensional tri-Sasaki Einstein spaces specified by the k{sub i}. The gravitational free energy scales inversely with the square root of the volume of Y. We find a general formula for the p-matrix free energies that agrees with the available results for volumes of the tri-Sasaki Einstein spaces Y, thus providing a thorough test of the corresponding AdS{sub 4}/CFT{sub 3} dualities. This formula is consistent with the Seiberg duality conjectured for Chern-Simons gauge theories.

  18. Hanford and the Tri-Cities economy 1997

    SciTech Connect

    Scott, M.J.


    The missions of the US Department of Energy`s Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). While the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the local Tri-Cities economy for purposes of this study. In the Federal fiscal year (FY) 1997 (October 1, 1996 through September 30, 1997), the total impact of DOE`s local $1.7 billion budget was felt through payrolls and local purchases of goods and services that totaled about $774 million. Directly or indirectly, the DOE/RL budget sustained an estimated 36% of all local employment (30,300 out of 84,800 jobs) and up to 67% of local wage income.

  19. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.


    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K


    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment. PMID:27451184

  20. Experimental Investigation and Modeling of Integrated Tri-generation Systems

    NASA Astrophysics Data System (ADS)

    Cetinkaya, Eda

    Energy demand in the world is increasing with population growth and higher living standards. Today, the need for energy requires a focus on renewable sources without abandoning fossil fuels. Efficient use of energy is one of the most important tasks in modern energy systems to achieve. In addition to the energy need, growing environmental concerns are linked with energy is emerged. Multi-purpose energy generation allows a higher efficiency by generating more outputs with the same input in the same system. Tri-generation systems are expected to provide at least three commodities, such as heating, cooling, desalination, storable fuel production and some other useful outputs, in addition to power generation. In this study, an experimental investigation of gasification is presented and two integrated tri-generation systems are proposed. The first integrated tri-generation system (System 1) utilizes solar energy as input and the outputs are power, fresh water and hot water. It consists of four sub-systems, namely solar power tower system, desalination system, Rankine cycle and organic Rankine cycle (ORC). The second integrated tri-generation system (System 2) utilizes coal and biomass as input and the outputs are power, fuel and hot water. It consists of five sub-systems: gasification plant, Brayton cycle, Rankine cycle, Fischer-Tropsch synthesis plant and an organic Rankine cycle (ORC). Experimental investigation includes coal and biomass gasification, where the experimental results of synthesis gas compositions are utilized in the analysis of the second systems. To maximize efficiency, heat losses from the system should be minimized through a recovery system to make the heat a useful commodity for other systems, such as ORCs which can utilize the low-grade heat. In this respect, ORCs are first analyzed for three different configurations in terms of energy and exergy efficiencies altering working fluids to increase the power output. Among two types of coal and one type

  1. Experimental Validation of the Piezoelectric Triple Hybrid Actuation System (TriHYBAS)

    NASA Technical Reports Server (NTRS)

    Xu, Tian-Bing; Jiang, Xiaoning; Su, Ji


    A piezoelectric triple hybrid actuation system (TriHYBAS) has been developed. In this brief presentation of the validation process the displacement profile of TriHYBAS and findings regarding displacement versus applied voltage are highlighted.

  2. PLA branching with anhydrides and tri-functional aziridine

    NASA Astrophysics Data System (ADS)

    Gu, Liangliang; Xu, Yuewen; Naredla, Rajasekhar; Hoye, Thomas; Macosko, Christopher

    Branched PLA was prepared by melt blending with tri-functional aziridine (T-Az) and pyromellitic dianhydride (PMDA). 1HNMR, gel permeation chromatography (GPC) and rheology were used to characterize the topological structures of branched PLA. Fast reaction between PLA carboxyl end group and T-Az resulted in 3-arm stars and increased the molecular weight. However, the 3-arm stars did not show strain hardening behavior under extensional flow. After modifying PLA hydroxyl end group with PMDA, PLA can react with T-Az on both chain ends and form long chain branched structure, which showed strain hardening in extension. It was found that that only 10% of the PLA hydroxyl end groups reacted with PMDA. This work is supported by Center for Sustainable Polymers.

  3. A Newly Developed Tri-Leaflet Polymeric Heart Valve Prosthesis

    PubMed Central

    Gaetano, Francesco De; Bagnoli, Paola; Zaffora, Adriano; Pandolfi, Anna; Serrani, Marta; Brubert, Jacob; Stasiak, Joanna; Moggridge, Geoff D.; Costantino, Maria Laura


    The potential of polymeric heart valves (PHV) prostheses is to combine the hemodynamic performances of biological valves with the durability of mechanical valves. The aim of this work is to design and develop a new tri-leaflet prosthetic heart valve (HV) made from styrenic block copolymers. A computational finite element model was implemented to optimize the thickness of the leaflets, to improve PHV mechanical and hydrodynamic performances. Based on the model outcomes, 8 prototypes of the designed valve were produced and tested in vitro under continuous and pulsatile flow conditions, as prescribed by ISO 5840 Standard. A specially designed pulse duplicator allowed testing the PHVs at different flow rates and frequency conditions. All the PHVs met the requirements specified in ISO 5840 Standard in terms of both regurgitation and effective orifice area (EOA), demonstrating their potential as HV prostheses. PMID:27274605

  4. Tri-band small monopole antenna based on SRR units

    NASA Astrophysics Data System (ADS)

    Shehata, Gehan; Mohanna, Mahmoud; Rabeh, Mohammed Lotfy


    In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5) and WLAN (5.2) bands. In our proposal, a coplanar waveguide (CPW) fed circular-disk monopole antenna is coupled with three split ring resonator (SRR) units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA) at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  5. Aspects of Cooling at the TRI{mu}P Facility

    SciTech Connect

    Willmann, L.; Berg, G. P.; Dammalapati, U.; De, S.; Dendooven, P.; Dermois, O.; Jungmann, K.; Mol, A.; Onderwater, C. J. G.; Rogachevskiy, A.; Sohani, M.; Traykov, E.; Wilschut, H. W.


    The Tri{mu}P facility at KVI is dedicated to provide short lived radioactive isotopes at low kinetic energies to users. It comprised different cooling schemes for a variety of energy ranges, from GeV down to the neV scale. The isotopes are produced using beam of the AGOR cyclotron at KVI. They are separated from the primary beam by a magnetic separator. A crucial part of such a facility is the ability to stop and extract isotopes into a low energy beamline which guides them to the experiment. In particular we are investigating stopping in matter and buffer gases. After the extraction the isotopes can be stored in neutral atoms or ion traps for experiments. Our research includes precision studies of nuclear {beta}-decay through {beta}-{nu} momentum correlations as well as searches for permanent electric dipole moments in heavy atomic systems like radium. Such experiments offer a large potential for discovering new physics.

  6. Tri-modal microscope for head and neck tissue identification.


    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline


    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features. PMID:27231585

  7. Physical mechanism of the (tri)critical point generation

    SciTech Connect

    Bugaev, K. A. Ivanytskyi, A. I.; Nikonov, E. G.; Petrov, V. K.; Sorin, A. S.; Zinovjev, G. M.


    We discuss some ideas resulting from a phenomenological relation recently declared between the tension of string connecting the static quark-antiquark pair and surface tension of corresponding cylindrical bag. This relation analysis leads to the temperature of vanishing surface tension coefficient of the QGP bags at zero baryonic charge density as T{sub {sigma}} = 152.9 {+-} 4.5 MeV. We develop the view point that this temperature value is not a fortuitous coincidence with the temperature of (partial) chiral symmetry restoration as seen in the lattice QCD simulations. Besides, we argue that T{sub {sigma}} defines the QCD (tri)critical endpoint temperature and claim that a negative value of surface tension coefficient recently discovered is not a sole result but is quite familiar for ordinary liquids at the supercritical temperatures.

  8. Tri-modal microscope for head and neck tissue identification

    PubMed Central

    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline


    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features. PMID:27231585

  9. Development of high-performance tri-layer material

    NASA Astrophysics Data System (ADS)

    Owe-Yang, D. C.; Yano, Toshiharu; Ueda, Takafumi; Iwabuchi, Motoaki; Ogihara, Tsutomu; Shirai, Shozo


    As chip size and pattern size continue to shrink, the thickness of photo resist is getting thinner and thinner. One of the major reasons is to prevent the small resist features from collapse. It's very challenging to get enough etch resistance from such thin resist thickness. An approach of Si-tri-layer stack which consists of resist, Si ARC (Si contenting anti-reflection coating), organic underlayer from top to bottom has been adopted by many IC makers in the manufacturing of 45 nm node. Even higher resist etching selectivity is needed for 32 nm node. Si ARC, of Si content as high as 43%, provides good etch selectivity. At the same time, tri-layer also provides good control over reflectivity in high NA immersion lithography. However, there are several well know issues concern Si-rich ARC. Resist compatibility and shelf life are on top of the list. An aim of our development work was to overcome those issues in order to produce manufacturing-worthy Si-rich ARC. Several synthesis methods were investigated to form Si-rich ARC film with different properties. Collapse of resist patterns is used as an indicator of lithographic compatibility. Lithographic performance was checked by accelerated shelf life tests at high temperature in order to predict the shelf life at room temperature. It was found that adhesion between resist and Si-rich ARC is improved when contact angle of Si-rich ARC is increased to more than 60 degree. Certain synthesis methods improve shelf life. After optimization of film properties and synthesis methods of Si-rich ARC, SHB-A940 series have best litho compatibility and shelf life is six months at storage temperature below 10°C.

  10. Do subfertile women adjust their habits when trying to conceive?

    PubMed Central

    Joelsson, Lana Salih; Berglund, Anna; Wånggren, Kjell; Lood, Mikael; Rosenblad, Andreas; Tydén, Tanja


    Aim The aim of this study was to investigate lifestyle habits and lifestyle adjustments among subfertile women trying to conceive. Materials and methods Women (n = 747) were recruited consecutively at their first visit to fertility clinics in mid-Sweden. Participants completed a questionnaire. Data were analyzed using logistic regression, t tests, and chi-square tests. Results The response rate was 62% (n = 466). Mean duration of infertility was 1.9 years. During this time 13.2% used tobacco daily, 13.6% drank more than three cups of coffee per day, and 11.6% consumed more than two glasses of alcohol weekly. In this sample, 23.9% of the women were overweight (body mass index, BMI 25–29.9 kg/m2), and 12.5% were obese (BMI ≥30 kg/m2). Obese women exercised more and changed to healthy diets more frequently than normal-weight women (odds ratio 7.43; 95% confidence interval 3.7–14.9). Six out of ten women (n = 266) took folic acid when they started trying to conceive, but 11% stopped taking folic acid after some time. Taking folic acid was associated with a higher level of education (p < 0.001). Conclusions Among subfertile women, one-third were overweight or obese, and some had other lifestyle factors with known adverse effects on fertility such as use of tobacco. Overweight and obese women adjusted their habits but did not reduce their body mass index. Women of fertile age would benefit from preconception counseling, and the treatment of infertility should routinely offer interventions for lifestyle changes. PMID:27216564

  11. An empirical study of the effect of granting multiple tries for online homework

    NASA Astrophysics Data System (ADS)

    Kortemeyer, Gerd


    When deploying online homework in physics courses, an important consideration is how many tries learners should be allowed to solve numerical free-response problems. While on the one hand, this number should be large enough to allow learners mastery of concepts and avoid copying, on the other hand, granting too many allowed tries encourages counter-productive behavior. We investigate data from an introductory calculus-based physics course that allowed different numbers of tries in different semesters. It turns out that the probabilities for successfully completing or abandoning problems during a particular try are independent of the number of tries already made, which indicates that students do not learn from their earlier tries. We also find that the probability for successfully completing a problem during a particular try decreases with the number of allowed tries, likely due to increased carelessness or guessing, while the probability to give up on a problem after a particular try is largely independent of the number of allowed tries. These findings lead to a mathematical model for learner usage of multiple tries, which predicts an optimum number of five allowed tries.

  12. Fusarium graminearum Tri12p influences virulence to wheat and trichothecene accumulation

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The gene Tri12 encodes a predicted Major Facilitator Superfamily protein suggested to play a role in export of trichothecene mycotoxins produced by Fusarium species. However it is currently unclear how the Tri12 protein (Tri12p) may influence trichothecene sensitivity and virulence of the wheat path...

  13. Pregnancy Intentions Among Women Who Do Not Try: Focusing On Women Who Are Okay Either Way

    PubMed Central

    Greil, Arthur L.; Shreffler, Karina M.


    Are women who are intentional about pregnancy (trying to or trying not to get pregnant) systematically different from women who are “okay either way” about getting pregnant? We use a currently sexually active subsample (n = 3,771) of the National Survey of Fertility Barriers, a random digit dialing telephone survey of reproductive-aged women (ages 25–45) in the United States. We compare women who are trying to, trying not to, or okay either way about getting pregnant on attitudes, social pressures, life course and status characteristics using bivariate analyses (chi-square tests for categorical and ANOVA tests for continuous variables). Multivariate multinomial logistic regression provides adjusted associations. Most women say that they are trying not to get pregnant (71%) or are okay either way (23%); few are trying to get pregnant. Among women with no prior pregnancies (n = 831), more say that they are trying to get pregnant (14%) but a similar percentage are okay either way (26%). Several characteristics distinguish those trying to from those okay: fertility intentions, importance of motherhood, age, parity, race/ethnicity and self identifying a fertility problem. Additional characteristics are associated with trying not to get pregnant compared to being okay: ideal number of children, wanting a baby, trusting conception, relationship satisfaction, race ethnicity, economic hardship, and attitudes about career success. Women who are “okay either way” about pregnancy should be assessed separately from women who are intentional (trying to, trying not to) about pregnancy. PMID:20449643

  14. Hanford Diversification and the Tri-Cities Economy FY 1999

    SciTech Connect

    SCOTT, M.J.


    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study. In the federal fiscal year (FY) 1999 (October 1, 1998 through September 30, 1999), the total impact of DOE'S local $1.59 billion budget was felt through payrolls of $542 million and local purchases of goods and services of $226 million. The total local spending of $768 million was up slightly from the FY 1998 total of $765 million. Taking into account the multiplier effects of this spending, the DOE/RL budget sustained an estimated 32% of all local employment (28,250 out of 88,100 jobs) and about 35% of local earned income (almost $1.08 billion out of $3.08 billion). The decrease in these percentages from last year's report reflects an update of the model's economic structure based on the 1997 economic census year, a correction of a programming error in the model found during the update, and a broader definition of earnings that includes proprietor income, not just wages (see the Appendix for revisions to the previous forecasts). DOE budget increases in FY 2000 are expected to result in no change to the number of local DOE contractor jobs and about a $29 million increase in direct local spending.

  15. Coinage metal complexes supported by the tri- and tetraphosphine ligands.


    Dau, Minh Thuy; Shakirova, Julia R; Karttunen, Antti J; Grachova, Elena V; Tunik, Sergey P; Melnikov, Alexey S; Pakkanen, Tapani A; Koshevoy, Igor O


    A series of tri- and tetranuclear phosphine complexes of d(10) metal ions supported by the polydentate ligands, bis(diphenylphosphinomethyl)phenylphosphine (PPP) and tris(diphenylphosphinomethyl)phosphine (PPPP), were synthesized. All the compounds under study, [AuM2(PPP)2](3+) (M = Au (1), Cu (2), Ag (3)), [M4(PPPP)2](4+) (M = Ag (4), Au (5)), [AuAg3(PPPP)2](4+) (6), and [Au2Cu2(PPPP)2(NCMe)4](4+) (7), were characterized crystallographically. The trinuclear clusters 1-3 contain a linear metal core, while in the isostructural tetranuclear complexes 4-6 the metal framework has a plane star-shaped arrangement. Cluster 7 adopts a structural motif that involves a digold unit bridged by two arms of the PPPP phosphines and decorated two spatially separated Cu(I) ions chelated by the remaining P donors. The NMR spectroscopic investigation in DMSO solution revealed the heterometallic clusters 2, 3, and 6 are stereochemically nonrigid and undergo reversible metal ions redistribution between several species, accompanied by their solvation-desolvation. The complexes 1-3 and 5-7 exhibit room temperature luminescence in the solid state (Φem = 6-64%) in the spectral region from 450 to 563 nm. The phosphorescence observed originates from the triplet excited states, determined by the metal cluster-centered dσ* → pσ transitions. PMID:24750114

  16. Toxic Release Inventory (TRI): United States and territories, 1987

    SciTech Connect

    Not Available


    The Toxic Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment. The set contains all of the data provided on the magnetic tape version. Twelve indexes allow easy access to the data. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. The data include (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, released to publicly owned treatment works, or transferred to off-site waste disposal facilities. All releases are in pounds per year.

  17. Toxic Release Inventory (TRI): United States and territories, 1988

    SciTech Connect

    Not Available


    The Toxic Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment. The set contains all of the data provided on the magnetic tape version. Twelve indexes allow easy access to the data. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. The data include (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, released to publicly owned treatment works, or transferred to off-site waste disposal facilities. All releases are in pounds per year.

  18. Practical application of a tri-axial intensity array

    NASA Astrophysics Data System (ADS)

    Young, Victor W.; Hines, Paul C.; Hutt, Daniel L.; Humphrey, Victor F.


    Sound intensity is a vector quantity representing the magnitude and direction of propagating energy within an acoustic field. In an underwater environment, a single omni-directional hydrophone can be used to measure instantaneous acoustic pressure and a finite difference approximation applied to the pressure signals from a pair of such hydrophones can be used to calculate particle velocity in a single direction. Because the time average of the product of instantaneous pressure and particle velocity is intensity, a pair of hydrophones is all that is required to measure a single component of the intensity vector. The complete three-dimensional intensity vector can be calculated using three orthogonal pairs of hydrophones. To evaluate this concept a tri-axial array consisting of three orthogonal pairs of omni-directional hydrophones has been developed and tested on both calibrated sources at a laboratory facility and sources of opportunity during sea trails in littoral waters. The use of this array to calculate the intensity vector and thereby localize both near-field and far-field acoustic sources and characterize the directionality of ambient noise fields will be discussed. The impact of signal-to-noise ratio and the effect of self-noise will also be examined.

  19. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  20. The Tri-Optic II: Embracing the family voice.


    Fogarty, Colleen T; Mauksch, Larry B


    In June, 2015, for the issue marking the passing of Donald Bloch, the intellectual founder of the collaborative health care movement, we wrote an editorial called, "The Tri-Optic: Next step for Collaborative Family Healthcare" (Mauksch & Fogarty, 2015). Bloch had famously proposed the "dual optic": the partnership of Dr. Biomedicine and Dr. Psychosocial (Bloch, 1988). Our readers, including many Collaborative Family Healthcare Association (CFHA) members, understand the value of a family perspective and are grappling with the next steps to truly integrate family and systems thinking into all levels of health care. A current exploration about the last 10 years of articles published in the journal by Tai Mendenhall, a member or our editorial board (personal communication, 2015), has found that the most common topic of focus is family health and functioning in 28% of the articles. This focus was also evident to varying degrees in all the plenaries at the 2015 CFHA conference held in Portland, Oregon. we pose the following questions to the FSH readership and CFHA community: Where are we, individually and collectively, with our knowledge about families as resources in and influences on health care? How are we teaching our learners about family-oriented care? How do we integrate family thinking into our various models of care? How do models of behavioral health integration include the family context in patient care? PMID:26963776

  1. Tunable Anomalous Supercurrent in a topological tri-junction SQUID

    NASA Astrophysics Data System (ADS)

    Kurter, C.; Finck, A. D. K.; Ghaemi, P.; Hor, Y. S.; van Harlingen, D. J.


    There has been intense interest in realizing Majorana fermions (MFs) in solid-state systems. Circuits of Josephson junctions (JJs) made of closely spaced s-wave superconductors on 3D topological insulators have been proposed to host zero energy Andreev bound states (ABSs) that act like MFs. Here, we present signatures of an anomalous supercurrent carried by topologically non-trivial low energy ABSs in a Nb/Bi2Se3/Nb tri-junction SQUID where two of the three superconducting leads are connected by a loop. An electrostatic top gate allows strong modulation of the supercurrent despite a high bulk contribution to the normal state conductance. In response to a magnetic field threading flux within the superconducting loop, we find unconventional SQUID oscillations enclosed by an envelope associated with a clear diffraction pattern, indicating spatially uniform and symmetric JJs. At a critical gate voltage, when the trivial 2DEG at the surface is nearly depleted, we observe a sharp drop in the critical current, signaling a topological phase transition in which the nature of the supercurrent-carrying states is transformed. This transition is accompanied by qualitative changes in the SQUID oscillations, magnetic diffraction pattern, and temperature dependence of the critical current. We acknowledge funding from Microsoft Station-Q.

  2. TRY – a global database of plant traits

    PubMed Central

    Kattge, J; Díaz, S; Lavorel, S; Prentice, I C; Leadley, P; Bönisch, G; Garnier, E; Westoby, M; Reich, P B; Wright, I J; Cornelissen, J H C; Violle, C; Harrison, S P; Van Bodegom, P M; Reichstein, M; Enquist, B J; Soudzilovskaia, N A; Ackerly, D D; Anand, M; Atkin, O; Bahn, M; Baker, T R; Baldocchi, D; Bekker, R; Blanco, C C; Blonder, B; Bond, W J; Bradstock, R; Bunker, D E; Casanoves, F; Cavender-Bares, J; Chambers, J Q; Chapin, F S; Chave, J; Coomes, D; Cornwell, W K; Craine, J M; Dobrin, B H; Duarte, L; Durka, W; Elser, J; Esser, G; Estiarte, M; Fagan, W F; Fang, J; Fernández-Méndez, F; Fidelis, A; Finegan, B; Flores, O; Ford, H; Frank, D; Freschet, G T; Fyllas, N M; Gallagher, R V; Green, W A; Gutierrez, A G; Hickler, T; Higgins, S I; Hodgson, J G; Jalili, A; Jansen, S; Joly, C A; Kerkhoff, A J; Kirkup, D; Kitajima, K; Kleyer, M; Klotz, S; Knops, J M H; Kramer, K; Kühn, I; Kurokawa, H; Laughlin, D; Lee, T D; Leishman, M; Lens, F; Lenz, T; Lewis, S L; Lloyd, J; Llusià, J; Louault, F; Ma, S; Mahecha, M D; Manning, P; Massad, T; Medlyn, B E; Messier, J; Moles, A T; Müller, S C; Nadrowski, K; Naeem, S; Niinemets, Ü; Nöllert, S; Nüske, A; Ogaya, R; Oleksyn, J; Onipchenko, V G; Onoda, Y; Ordoñez, J; Overbeck, G; Ozinga, W A; Patiño, S; Paula, S; Pausas, J G; Peñuelas, J; Phillips, O L; Pillar, V; Poorter, H; Poorter, L; Poschlod, P; Prinzing, A; Proulx, R; Rammig, A; Reinsch, S; Reu, B; Sack, L; Salgado-Negret, B; Sardans, J; Shiodera, S; Shipley, B; Siefert, A; Sosinski, E; Soussana, J-F; Swaine, E; Swenson, N; Thompson, K; Thornton, P; Waldram, M; Weiher, E; White, M; White, S; Wright, S J; Yguel, B; Zaehle, S; Zanne, A E; Wirth, C


    Plant traits – the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs – determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world's 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation – but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial

  3. Try-A Global Database of Plant Traits

    SciTech Connect

    Thornton, Peter E


    Plant traits the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world s 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial vegetation in

  4. AIDS and journalism. Trying to tell too clear a story.


    Cohen, J


    Much in science is complex. Scientists, by definition, work within the realm of complex hypothesis, empirical evidence, and proof. Questions, answers, details, complexities; that is the domain of the scientist. Journalists, on the other hand, are paid to develop and present stories which are clearly read and interpreted by the general public. The mechanics and dynamics of HIV and AIDS are among the most complex scientific challenges in the history of humankind. Journalists calling upon scientists to obtain and report clear, concise, information about the agent and its resulting pandemic are therefore surely not always going to receive simple, readily reportable responses. HIV is a moving target upon which research continues. While there are some definitively affirmative and some definitively negative factors about HIV, the gray areas and speculation remain vast. The author gives a few examples of AIDS stories which the media mishandled because they were trying to tell too clear a story. He then discusses stories flawed because scientists managed to present clear information about which journalists were overly skeptical. In one case, the public was informed that AIDS vaccines were not working, with headlines which insinuated that the vaccines themselves were causing infections. None of the vaccines, however, contained infectious materials. As a result, people became overly fearful of participating in HIV vaccine trials. Coverage of the potential identification of HIV-3 was premature and only scared people, while Rolling Stone magazine's article hypothesizing the origin of HIV via trials of a contaminated polio vaccine in the Belgium Congo in the late 1950s should not have been published. Clear answers about HIV/AIDS are few and far between, but interesting and significant stories can still be found; they are just hard to tell. PMID:12319130

  5. Tri-isobutylphosphate: a prenatal toxicity study in rats.


    Ruckman, S A; Green, O P; Palmer, A K; Klimisch, H J


    To assess the prenatal toxicity to rats of the anti-foaming agent, tri-isobutylphosphate (CAS 126-71-6), a study was conducted in which daily dosages of 0, 100, 300 and 1000 mg/kg were administered to different treatment groups by gavage from day 6 to 15 of pregnancy. Dams were killed and foetuses examined on day 20 of pregnancy. Maternal effects during the dosing period included a dosage-related increase in the frequency, persistence and severity of post dosing salivation in all test groups and significantly increased water consumption at 1000 mg/kg. Bodyweight gain at 1000 and 300 mg/kg was lower than that of controls but the differences were not statistically significant. The lowest dosage of 100 mg/kg could be considered as the maternal 'lowest observed adverse effect level' (LOAEL) or 'no observed adverse effect level' (NOAEL) according to whether increased salivation is perceived to be a true toxic effect or simply a reaction to the taste of the test material. Neither litter values nor the prevalence of foetuses with abnormalities indicated any embryotoxic effects (including teratogenicity) at any dosage. The most notable feature of the results was the occurrence of a cluster of foetuses with the congenital abnormality referred to as 'hunched posture syndrome' or 'squat foetus syndrome'. However, the incidence of this finding was similar to that noted among background data for the same strain and, in the absence of any other embryotoxic findings, was considered likely to have arisen coincidentally. PMID:10355544

  6. Network of nano-droplets by a tri-block polymer

    NASA Astrophysics Data System (ADS)

    Sharifi, Soheil; Doodman, Esmaeil


    Mixtures of oil in water nano-droplets with two molecular weights of a tri-block polymer was studied by quasi elastic light scattering and small angle X-ray scattering. The results showed that the size and interaction of droplets didn't change with increase of the tri-block polymer length but the order parameters increased. The increase of length of the tri-block biopolymer changed the dynamics of the droplets. A network formation is resulted with increase of the amount of tri-block polymer in the microemulsions.

  7. Modulation of STAT3 Folding and Function by TRiC/CCT Chaperonin

    PubMed Central

    Kasembeli, Moses; Lau, Wilson Chun Yu; Roh, Soung-Hun; Eckols, T. Kris; Frydman, Judith; Chiu, Wah; Tweardy, David J.


    Signal transducer and activator of transcription 3 (Stat3) transduces signals of many peptide hormones from the cell surface to the nucleus and functions as an oncoprotein in many types of cancers, yet little is known about how it achieves its native folded state within the cell. Here we show that Stat3 is a novel substrate of the ring-shaped hetero-oligomeric eukaryotic chaperonin, TRiC/CCT, which contributes to its biosynthesis and activity in vitro and in vivo. TRiC binding to Stat3 was mediated, at least in part, by TRiC subunit CCT3. Stat3 binding to TRiC mapped predominantly to the β-strand rich, DNA-binding domain of Stat3. Notably, enhancing Stat3 binding to TRiC by engineering an additional TRiC-binding domain from the von Hippel-Lindau protein (vTBD), at the N-terminus of Stat3, further increased its affinity for TRiC as well as its function, as determined by Stat3's ability to bind to its phosphotyrosyl-peptide ligand, an interaction critical for Stat3 activation. Thus, Stat3 levels and function are regulated by TRiC and can be modulated by manipulating its interaction with TRiC. PMID:24756126

  8. Tri-Laboratory Linux Capacity Cluster 2007 SOW

    SciTech Connect

    Seager, M


    well, the budget demands are extreme and new, more cost effective ways of fielding these systems must be developed. This Tri-Laboratory Linux Capacity Cluster (TLCC) procurement represents the ASC first investment vehicle in these capacity systems. It also represents a new strategy for quickly building, fielding and integrating many Linux clusters of various sizes into classified and unclassified production service through a concept of Scalable Units (SU). The programmatic objective is to dramatically reduce the overall Total Cost of Ownership (TCO) of these 'capacity' systems relative to the best practices in Linux Cluster deployments today. This objective only makes sense in the context of these systems quickly becoming very robust and useful production clusters under the crushing load that will be inflicted on them by the ASC and SSP scientific simulation capacity workload.

  9. Compression response of tri-axially braided textile composites

    NASA Astrophysics Data System (ADS)

    Song, Shunjun


    This thesis is concerned with characterizing the compression stiffness and compression strength of 2D tri-axially braided textile composites (2DTBC). Two types of 2DTBC are considered differing only on the resin type, while the textile fiber architecture is kept the same with bias tows at 45 degrees to the axial tows. Experimental, analytical and computational methods are described based on the results generated in this study. Since these composites are manufactured using resin transfer molding, the intended and as manufactured composite samples differ in their microstructure due to consolidation and thermal history effects in the manufacturing cycle. These imperfections are measured and the effect of these imperfections on the compression stiffness and strength are characterized. Since the matrix is a polymer material, the nonuniform thermal history undergone by the polymer at manufacturing (within the composite and in the presence of fibers) renders its properties to be non-homogenous. The effects of these non-homogeneities are captured through the definition of an equivalent in-situ matrix material. A method to characterize the mechanical properties of the in-situ matrix is also described. Fiber tow buckling, fiber tow kinking and matrix microcracking are all observed in the experiments. These failure mechanisms are captured through a computational model that uses the finite element (FE) technique to discretize the structure. The FE equations are solved using the commercial software ABAQUS version 6.5. The fiber tows are modeled as transversely isotropic elastic-plastic solids and the matrix is modeled as an isotropic elastic-plastic solid with and without microcracking damage. Because the 2DTBC is periodic, the question of how many repeat units are necessary to model the compression stiffness and strength are examined. Based on the computational results, the correct representative unit cell for this class of materials is identified. The computational models and

  10. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Competitor Group is sponsoring the TriRock Triathlon, consisting of 2000 swimmers swimming a...

  11. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed Rulemaking A... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA. (a) Location. The limits of the safety...

  12. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    ERIC Educational Resources Information Center

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  13. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2010 CFR


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  14. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2012 CFR


    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  15. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  16. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2011 CFR


    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  17. Leucine metabolism regulates TRI6 expression and affects deoxynivalenol production and virulence in Fusarium graminearum.


    Subramaniam, Rajagopal; Narayanan, Swara; Walkowiak, Sean; Wang, Li; Joshi, Manisha; Rocheleau, Hélène; Ouellet, Thérèse; Harris, Linda J


    TRI6 is a positive regulator of the trichothecene gene cluster and the production of trichothecene mycotoxins [deoxynivalenol (DON)] and acetylated forms such as 15-Acetyl-DON) in the cereal pathogen Fusarium graminearum. As a global transcriptional regulator, TRI6 expression is modulated by nitrogen-limiting conditions, sources of nitrogen and carbon, pH and light. However, the mechanism by which these diverse environmental factors affect TRI6 expression remains underexplored. In our effort to understand how nutrients affect TRI6 regulation, comparative digital expression profiling was performed with a wild-type F. graminearum and a Δtri6 mutant strain, grown in nutrient-rich conditions. Analysis showed that TRI6 negatively regulates genes of the branched-chain amino acid (BCAA) metabolic pathway. Feeding studies with deletion mutants of MCC, encoding methylcrotonyl-CoA-carboxylase, one of the key enzymes of leucine metabolism, showed that addition of leucine specifically down-regulated TRI6 expression and reduced 15-ADON accumulation. Constitutive expression of TRI6 in the Δmcc mutant strain restored 15-ADON production. A combination of cellophane breach assays and pathogenicity experiments on wheat demonstrated that disrupting the leucine metabolic pathway significantly reduced disease. These findings suggest a complex interaction between one of the primary metabolic pathways with a global regulator of mycotoxin biosynthesis and virulence in F. graminearum. PMID:26248604

  18. 76 FR 25278 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriMet Bridge Project, Willamette River... is proposing the establishment of a safety zone during the construction of the TriMet Bridge on the..., 2008, issue of the Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a...

  19. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  20. 76 FR 60781 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA... 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate Tribal government (55 FR 30632). EPA's...

  1. Technology transfer and commercialization initiatives at TRI/Austin: Resources and examples

    SciTech Connect

    Matzkanin, G.A.; Dingus, M.L.


    Located at TRI/Austin, and operated under a Department of Defense contract, is the Nondestructive Testing Information Analysis Center (NTIAC). This is a full service Information Analysis Center sponsored by the Defense Technical Information Center (DTIC), although services of NTIAC are available to other government agencies, government contractors, industry and academia. The principal objective of NTIAC is to help increase the productivity of the nation`s scientists, engineers, and technical managers involved in, or requiring, nondestructive testing by providing broad information analysis services of technical excellence. TRI/Austin is actively pursuing commercialization of several products based on results from outside funded R and D programs. As a small business, TRI/Austin has limited capabilities for large scale fabrication, production, marketing or distribution. Thus, part of a successful commercialization process involves making appropriate collaboration arrangements with other organizations to augment TRI/Austin`s capabilities. Brief descriptions are given here of two recent commercialization efforts at TRI/Austin.

  2. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  3. TriLoNet: Piecing Together Small Networks to Reconstruct Reticulate Evolutionary Histories.


    Oldman, James; Wu, Taoyang; van Iersel, Leo; Moulton, Vincent


    Phylogenetic networks are a generalization of evolutionary trees that can be used to represent reticulate processes such as hybridization and recombination. Here, we introduce a new approach called TriLoNet (Trinet Level- one Network algorithm) to construct such networks directly from sequence alignments which works by piecing together smaller phylogenetic networks. More specifically, using a bottom up approach similar to Neighbor-Joining, TriLoNet constructs level-1 networks (networks that are somewhat more general than trees) from smaller level-1 networks on three taxa. In simulations, we show that TriLoNet compares well with Lev1athan, a method for reconstructing level-1 networks from three-leaved trees. In particular, in simulations we find that Lev1athan tends to generate networks that overestimate the number of reticulate events as compared with those generated by TriLoNet. We also illustrate TriLoNet's applicability using simulated and real sequence data involving recombination, demonstrating that it has the potential to reconstruct informative reticulate evolutionary histories. TriLoNet has been implemented in JAVA and is freely available at PMID:27189565

  4. Color agreement between nanofluorapatite ceramic discs associated with try-in pastes and with resin cements.


    Rigoni, Paulo; Amaral, Flávia Lucisano Botelho do; França, Fabiana Mantovani Gomes; Basting, Roberta Tarkany


    The aim of this study was to evaluate the in vitro color agreement between nanofluorapatite ceramic discs (e.max Ceram / Ivoclar Vivadent / A2) associated with try-in pastes and those bonded with resin cements (Vitique / DMG/ try-in shade A2½ and cement shade A2½, Variolink II / Ivoclar Vivadent / try-in shade A1 and cement shade A1, and Choice 2 / Bisco / try-in shade A2 and cement shade A2), and to evaluate the shade stability of the discs bonded with resin cements. The shades of composite resin discs (Lliss / FGM / A2) and nanofluorapatite ceramic discs with try-in pastes or cements were evaluated according to the Vita Classical shade guide by a digital spectrophotometer (Micro EspectroShade, MHT) immediately after placing the try-in pastes or resin cements between composite resin discs and ceramic discs. Other evaluations were performed at 2, 5, and 6 day intervals after cementation with the resin cements. All ceramic discs that received try-in pastes presented an A2 shade. There was no statistical difference in the shade of the ceramic specimens fixed with different cements at the different intervals, as evaluated by the Friedman test (p > 0.05). Two try-in pastes presented shade compatibility with those recommended by the manufacturers. There was no similarity of shades between the ceramic discs with try-in pastes and those with the respective resin cements. Shade stability was observed in ceramic discs with resin cements within the intervals evaluated. PMID:23184164

  5. Various notions of positivity for bi-linear maps and applications to tri-partite entanglement

    NASA Astrophysics Data System (ADS)

    Han, Kyung Hoon; Kye, Seung-Hyeok


    We consider bi-linear analogues of s-positivity for linear maps. The dual objects of these notions can be described in terms of Schmidt ranks for tri-tensor products and Schmidt numbers for tri-partite quantum states. These tri-partite versions of Schmidt numbers cover various kinds of bi-separability, and so we may interpret witnesses for those in terms of bi-linear maps. We give concrete examples of witnesses for various kinds of three qubit entanglement.

  6. Apolar distal pocket mutants of yeast cytochrome c peroxidase: Binding of imidazole, 1-methylimidazole and 4-nitroimidazole to the triAla, triVal, and triLeu variants

    PubMed Central

    Bidwai, Anil; Ayala, Caitlan; Vitello, Lidia B.; Erman, James E.


    Imidazole binding to three apolar distal heme pocket mutants of yeast cytochrome c peroxidase (CcP) has been investigated between pH 4 and 8. The three CcP variants have Arg-48, Trp-51, and His-52 mutated to either all alanine, CcP(triAla), all valine, CcP(triVal), or all leucine residues, CcP(triLeu). The imidazole binding curves for all three mutants are biphasic indicating that each of the mutants exist in at least two conformational states with different affinities for imidazole. At pH 7, the high-affinity conformations of the three CcP mutants bind imidazole between 3.8 and 4.7 orders of magnitude stronger than that of wild-type CcP while the low-affinity conformations have binding affinities about 2.5 orders of magnitude larger than wild-type CcP. Imidazole binding to the three CcP mutants is pH dependent with the strongest binding observed at high pH. Apparent pKa values for the transition in binding vary between 5.6 and 7.5 for the high-affinity conformations and between 6.2 and 6.8 for the low-affinity conformations of the CcP triple mutants. The kinetics of imidazole binding are also biphasic. The fast phase of imidazole binding to CcP(triAla) and CcP(triLeu) is linearly dependent on the imidazole concentration while the slow phase is independent of imidazole concentration. Both phases of imidazole binding to CcP(triVal) have a hyperbolic dependence on the imidazole concentration. The apparent association rate constants vary between 30 and 170 M−1s−1 while the apparent dissociation rate constants vary between 0.05 and 0.43 s−1. The CcP triple mutants have higher binding affinities for 1-methylimidazole and 4-nitroimidazole than does wild-type CcP. PMID:25900360

  7. 78 FR 7993 - Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... rulemaking (SNPRM) to amend Class D and Class E airspace in the Tri-Cities, TN, area (77 FR 59573). The SNPRM... read as follows: ] Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR... originally proposed in the NPRM of April 28, 2012 (77 FR 21505). Interested parties were invited...

  8. 77 FR 59573 - Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... in the Tri- Cities, TN area. DATES: Comments must be received on or before November 13, 2012... FR, 21505). The comment period closed May 25, 2012. No comments were received. Subsequent to... address and phone number) between 9 a.m. and 5 p.m., Monday through Friday, except Federal Holidays....

  9. The molecular architecture of the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Leitner, Alexander; Joachimiak, Lukasz A.; Bracher, Andreas; Mönkemeyer, Leonie; Walzthoeni, Thomas; Chen, Bryan; Pechmann, Sebastian; Holmes, Susan; Cong, Yao; Ma, Boxue; Ludtke, Steve; Chiu, Wah; Hartl, F. Ulrich; Aebersold, Ruedi; Frydman, Judith


    Summary TRiC/CCT is a highly conserved and essential chaperonin that uses ATP cycling to facilitate folding of approximately 10% of the eukaryotic proteome. This 1 MDa hetero-oligomeric complex consists of two stacked rings of eight paralogous subunits each. Previously proposed TRiC models differ substantially in their subunit arrangements and ring register. Here, we integrate chemical crosslinking, mass spectrometry and combinatorial modeling to reveal the definitive subunit arrangement of TRiC. In vivo disulfide mapping provided additional validation for the crosslinking-derived arrangement as the definitive TRiC topology. This subunit arrangement allowed the refinement of a structural model using existing X-ray diffraction data. The new structure explains all available crosslink experiments, provides a rationale for previously unexplained structural features and reveals a surprising asymmetry of charges within the chaperonin folding chamber. PMID:22503819

  10. Lithium cell technology and safety report of the Tri-Service Lithium Safety Committee

    NASA Technical Reports Server (NTRS)

    Reiss, E.


    The organization of the Tri-Service Lithium Safety Committee is described. The following areas concerning lithium batteries are discussed: transportation--DOT Exemption 7052, FAA; disposal; storage; individual testing/test results; and battery design and usage.

  11. Spin and valley resolved Landau level crossing in tri-layer ABA stacked graphene

    NASA Astrophysics Data System (ADS)

    Datta, Biswajit; Gupta, Vishakha; Borah, Abhinandan; Watanabe, Kenji; Taniguchi, Takashi; Deshmukh, Mandar

    We present quantum Hall measurements on a high quality encapsulated tri-layer graphene device. Low temperature field effect mobility of this device is around 500,000 cm2/Vs and we see SdH oscillations at a magnetic field as low as 0.3 T. Quantum Hall measurements confirm that the chosen tri layer graphene is Bernal (ABA) stacked. Due to the presence of both mass-less monolayer like Dirac fermions and massive bi-layer like Dirac fermions in Bernal stacked tri-layer graphene, there are Landau level crossings between monolayer and bi-layer bands in quantum Hall regime. Although most of the Landau Level crossings are predominantly present on the electron sides, we also observe signatures of the crossings on the hole side. This behaviour is consistent with the asymmetry of electron and hole in ABA tri-layer graphene. We observe a series of crossings of the spin and valley resolved Landau Levels.

  12. 77 FR 65545 - Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council and North American Electric Reliability Corporation; Notice of Complaint Take notice that... petition requesting resolution of the conflict between Western Electric Coordinating Council and...


    EPA Science Inventory

    In 1994, the Strategic Environmental Research and Development Program (SERDP) funded a Tri-Service effort to accelerate the development and fielding of environmental sensing technologies to extend the capabilities of the Site Characterization and Analysis Penetrometer System (SCA...

  14. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2011 CFR


    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in...

  15. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2010 CFR


    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in...

  16. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    SciTech Connect

    Garvey, Graeme S.; McCormick, Susan P.; Alexander, Nancy J.; Rayment, Ivan


    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the 'in vivo' characterization of Deltatri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified.

  17. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT.


    Joachimiak, Lukasz A; Walzthoeni, Thomas; Liu, Corey W; Aebersold, Ruedi; Frydman, Judith


    The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical, and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate-binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to TRiC's unique ability to fold obligate substrates. PMID:25416944

  18. Colour matching of composite resin cements with their corresponding try-in pastes.


    Kampouropoulos, D; Gaintantzopoulou, M; Papazoglou, E; Kakaboura, A


    Two shades of four resin cements (Calibra, Clearfil Esthetic, Insure, Variolink II), in light- and dual-curing modes, were tested for colour matching with their corresponding try-in pastes, immediately after photopolymerization and after 24-hour dry and dark storage. Colour measurements were performed for 0.8 mm-thick specimens through a 0.8mm-thick ceramic plate. For each resin cement, colour differences (deltaE) were calculated between the two curing modes, and between the corresponding try-in paste, at baseline and after 24h. deltaE>0 values were detected between all resin cements and their try-in pastes, which were brand/shade/curing mode depended. The try-in pastes of the Variolink II system demonstrated the best colour matching (deltaE<2). Try-in pastes of Calibra and Insure, at both curing modes, did not match at an acceptable value, the shade of their corresponding resin cements (deltaE>3.3). Calibra presented the highest colour differences. deltaE values of the Clearfil Esthetic system immediately after photo-activation ranged between 2 and 3 units. A ceramic restoration may fail aesthetically as a result of not acceptable colour match (deltaE>3.3) between the shade of certain resin cements and their relevant try-in pastes. PMID:25134367

  19. Tri-Gas Pressurization System Testing and Modeling for Cryogenic Applications

    NASA Technical Reports Server (NTRS)

    Taylor, B.; Polsgrove, R.; Stephens, J.; Hedayat, A.


    The use of Tri-gas in rocket propulsion systems is somewhat of a new technology. This paper defines Tri-gas as a mixture of gases composed largely of helium with a small percentage of a stoichiometric mixture of hydrogen and oxygen. When exposed to a catalyst the hydrogen and oxygen in the mixture combusts, significantly raising the temperature of the mixture. The increase in enthalpy resulting from the combustion process significantly decreases the required quantity of gas needed to pressurize the ullage of the vehicle propellant tanks. The objective of this effort was to better understand the operating characteristics of Tri-gas in a pressurization system with low temperature applications. In conjunction with ongoing programs at NASA Marshall Space Flight Center, an effort has been undertaken to evaluate the operating characteristics of Tri-gas through modeling and bench testing. Through improved understanding of the operating characteristics, the risk of using this new technology in a launch vehicle propulsion system was reduced. Bench testing of Tri-gas was a multistep process that targeted gas characteristics and performance aspects that pose a risk to application in a pressurization system. Pressurization systems are vital to propulsion system performance. Keeping a target ullage pressure in propulsions tanks is necessary to supply propellant at the conditions and flow rates required to maintain desired engine functionality. The first component of testing consisted of sampling Tri-gas sources that had been stagnant for various lengths of time in order to determine the rate at which stratification takes place. Second, a bench test was set up in which Tri-gas was sent through a catalyst bed. This test was designed to evaluate the performance characteristics of Tri-gas, under low temperature inlet temperatures, in a flight-like catalyst bed reactor. The third, most complex, test examined the performance characteristics of Tri-gas at low temperature temperatures

  20. TRY-5 Is a Sperm-Activating Protease in Caenorhabditis elegans Seminal Fluid

    PubMed Central

    Smith, Joseph R.; Stanfield, Gillian M.


    Seminal fluid proteins have been shown to play important roles in male reproductive success, but the mechanisms for this regulation remain largely unknown. In Caenorhabditis elegans, sperm differentiate from immature spermatids into mature, motile spermatozoa during a process termed sperm activation. For C. elegans males, sperm activation occurs during insemination of the hermaphrodite and is thought to be mediated by seminal fluid, but the molecular nature of this activity has not been previously identified. Here we show that TRY-5 is a seminal fluid protease that is required in C. elegans for male-mediated sperm activation. We observed that TRY-5::GFP is expressed in the male somatic gonad and is transferred along with sperm to hermaphrodites during mating. In the absence of TRY-5, male seminal fluid loses its potency to transactivate hermaphrodite sperm. However, TRY-5 is not required for either hermaphrodite or male fertility, suggesting that hermaphrodite sperm are normally activated by a distinct hermaphrodite-specific activator to which male sperm are also competent to respond. Within males, TRY-5::GFP localization within the seminal vesicle is antagonized by the protease inhibitor SWM-1. Together, these data suggest that TRY-5 functions as an extracellular activator of C. elegans sperm. The presence of TRY-5 within the seminal fluid couples the timing of sperm activation to that of transfer of sperm into the hermaphrodite uterus, where motility must be rapidly acquired. Our results provide insight into how C. elegans has adopted sex-specific regulation of sperm motility to accommodate its male-hermaphrodite mode of reproduction. PMID:22125495

  1. TriAnnot: A Versatile and High Performance Pipeline for the Automated Annotation of Plant Genomes.


    Leroy, Philippe; Guilhot, Nicolas; Sakai, Hiroaki; Bernard, Aurélien; Choulet, Frédéric; Theil, Sébastien; Reboux, Sébastien; Amano, Naoki; Flutre, Timothée; Pelegrin, Céline; Ohyanagi, Hajime; Seidel, Michael; Giacomoni, Franck; Reichstadt, Mathieu; Alaux, Michael; Gicquello, Emmanuelle; Legeai, Fabrice; Cerutti, Lorenzo; Numa, Hisataka; Tanaka, Tsuyoshi; Mayer, Klaus; Itoh, Takeshi; Quesneville, Hadi; Feuillet, Catherine


    In support of the international effort to obtain a reference sequence of the bread wheat genome and to provide plant communities dealing with large and complex genomes with a versatile, easy-to-use online automated tool for annotation, we have developed the TriAnnot pipeline. Its modular architecture allows for the annotation and masking of transposable elements, the structural, and functional annotation of protein-coding genes with an evidence-based quality indexing, and the identification of conserved non-coding sequences and molecular markers. The TriAnnot pipeline is parallelized on a 712 CPU computing cluster that can run a 1-Gb sequence annotation in less than 5 days. It is accessible through a web interface for small scale analyses or through a server for large scale annotations. The performance of TriAnnot was evaluated in terms of sensitivity, specificity, and general fitness using curated reference sequence sets from rice and wheat. In less than 8 h, TriAnnot was able to predict more than 83% of the 3,748 CDS from rice chromosome 1 with a fitness of 67.4%. On a set of 12 reference Mb-sized contigs from wheat chromosome 3B, TriAnnot predicted and annotated 93.3% of the genes among which 54% were perfectly identified in accordance with the reference annotation. It also allowed the curation of 12 genes based on new biological evidences, increasing the percentage of perfect gene prediction to 63%. TriAnnot systematically showed a higher fitness than other annotation pipelines that are not improved for wheat. As it is easily adaptable to the annotation of other plant genomes, TriAnnot should become a useful resource for the annotation of large and complex genomes in the future. PMID:22645565

  2. Radiation measurement platform for balloon flights based on the TriTel silicon detector telescope

    NASA Astrophysics Data System (ADS)

    Zabori, Balazs; Hirn, Attila; Pazmandi, Tamas; Apathy, Istvan; Szanto, Peter; Deme, Sandor

    Several measurements have been performed on the cosmic radiation field from the surface of the Earth up to the maximum altitudes of research airplanes. However the cosmic radiation field is not well known between 15 km and 30 km. Our experiment idea based on to study the radiation environment in the stratosphere. The main technical goals of our experiment were to test at first time the TriTel 3D silicon detector telescope system for future ISS missons and to develop a balloon technology platform for advanced cosmic radiation and dosimetric measurements. The main scientific goals were to give an assessment of the cosmic radiation field at the altitude of the BEXUS balloons, to use the TriTel system to determine dosimetric and radiation quantities during the ballon flight and to intercompare the TriTel and Pille results to provide a correction factor definition method for the Pille ISS measurements. To fulfil the scientific and technological objectives several different dosimeter systems were included in the experiment: an advanced version of the TriTel silicon detector telescope, Geiger-Müller counters, Pille passive thermoluminescent dosimeters and Solid State Nuclear Track Detectors. The experiment was built by students from Hungarian universities and flew on board the BEXUS stratospheric balloon in Northern Sweden (from ESRANGE Space Center). The float altitude was approximately 28.6 km and the total flight time was about 4 hours. The active instruments measured in real time and the ground team received the collected data continuously during the mission. The main technical goals were received since the operation of the TriTel experienced no failures and the experiment worked as it expected. This paper presents the scientific goals and results. From the TriTel measurements the deposited energy spectra, the Linear Energy Transfer spectra, the average quality factor of the cosmic radiation as well as the absorbed dose and the dose equivalent were determined for the

  3. TriAnd and its siblings: satellites of satellites in the Milky Way halo

    NASA Astrophysics Data System (ADS)

    Deason, A. J.; Belokurov, V.; Hamren, K. M.; Koposov, S. E.; Gilbert, K. M.; Beaton, R. L.; Dorman, C. E.; Guhathakurta, P.; Majewski, S. R.; Cunningham, E. C.


    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main-sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered Pan-Andromeda Archaeological Survey (PAndAS) stream share a common heliocentric distance (D ˜ 20 kpc), position on the sky, and line-of-sight velocity (VGSR ˜ 50 km s-1). Similarly, A-type, giant, and main-sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 satellite show that TriAnd is prevalent in these fields, with a velocity and distance similar to Segue 2. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall on to the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are `satellites of satellites', and the large, metal-rich TriAnd overdensity is the remains of the group central.

  4. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.


    Freund, Adam; Zhong, Franklin L; Venteicher, Andrew S; Meng, Zhaojing; Veenstra, Timothy D; Frydman, Judith; Artandi, Steven E


    Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies, and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking using a high-content genome-wide siRNA screen in human cells for factors required for Cajal body localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance, and human disease. PMID:25467444

  5. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Joachimiak, Lukasz A.; Walzthoeni, Thomas; Liu, Corey; Aebersold, Ruedi; Frydman, Judith


    Summary The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved, pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to its unique ability to fold obligate substrates. PMID:25416944

  6. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1

    PubMed Central

    Freund, Adam; Zhong, Franklin L.; Venteicher, Andrew S.; Meng, Zhaojing; Veenstra, Timothy D.; Frydman, Judith; Artandi, Steven E.


    SUMMARY Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking, using a high content genome-wide siRNA screen in human cells for factors required for Cajal body-localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance and human disease. PMID:25467444

  7. Molecular architecture of the human U4/U6.U5 tri-snRNP.


    Agafonov, Dmitry E; Kastner, Berthold; Dybkov, Olexandr; Hofele, Romina V; Liu, Wen-Ti; Urlaub, Henning; Lührmann, Reinhard; Stark, Holger


    The U4/U6.U5 triple small nuclear ribonucleoprotein (tri-snRNP) is a major spliceosome building block. We obtained a three-dimensional structure of the 1.8-megadalton human tri-snRNP at a resolution of 7 angstroms using single-particle cryo-electron microscopy (cryo-EM). We fit all known high-resolution structures of tri-snRNP components into the EM density map and validated them by protein cross-linking. Our model reveals how the spatial organization of Brr2 RNA helicase prevents premature U4/U6 RNA unwinding in isolated human tri-snRNPs and how the ubiquitin C-terminal hydrolase-like protein Sad1 likely tethers the helicase Brr2 to its preactivation position. Comparison of our model with cryo-EM three-dimensional structures of the Saccharomyces cerevisiae tri-snRNP and Schizosaccharomyces pombe spliceosome indicates that Brr2 undergoes a marked conformational change during spliceosome activation, and that the scaffolding protein Prp8 is also rearranged to accommodate the spliceosome's catalytic RNA network. PMID:26912367

  8. Tri-layer wrinkling as a mechanism for anchoring center initiation in the developing cerebellum.


    Lejeune, Emma; Javili, Ali; Weickenmeier, Johannes; Kuhl, Ellen; Linder, Christian


    During cerebellar development, anchoring centers form at the base of each fissure and remain fixed in place while the rest of the cerebellum grows outward. Cerebellar foliation has been extensively studied; yet, the mechanisms that control anchoring center initiation and position remain insufficiently understood. Here we show that a tri-layer model can predict surface wrinkling as a potential mechanism to explain anchoring center initiation and position. Motivated by the cerebellar microstructure, we model the developing cerebellum as a tri-layer system with an external molecular layer and an internal granular layer of similar stiffness and a significantly softer intermediate Purkinje cell layer. Including a weak intermediate layer proves key to predicting surface morphogenesis, even at low stiffness contrasts between the top and bottom layers. The proposed tri-layer model provides insight into the hierarchical formation of anchoring centers and establishes an essential missing link between gene expression and evolution of shape. PMID:27252048

  9. Try-It-On: Experiential Learning of Holistic Stress Management in a Graduate Nursing Curriculum.


    Gregg, S Renee; Twibell, K Renee


    The aim of this article is to relate how nursing students in a graduate curriculum can learn, personally practice, and prepare to disseminate stress management strategies to patients. Advanced practice nurses often provide care for patients experiencing stress-related disorders while concurrently trying to manage their own high levels of stress. Through the innovative Try-It-On teaching-learning strategy, graduate students experimented with holistic stress management approaches, with the intention of sharing with patients what worked effectively. Student comments on course evaluations were positive regarding Try-It-On. In the pilot trial of a quantitative survey to expand the evaluation of the strategy, students who trialed holistic stress management techniques reported satisfaction, engagement, perceived relevance, and intention to trial techniques with patients in future clinical courses. Modeling role modeling theory and the Kirkpatrick evaluation model guided the project, which filled gaps in current knowledge about experiential learning in graduate nursing programs. PMID:26597999

  10. Characterization of new glycolipid biosurfactants, tri-acylated mannosylerythritol lipids, produced by Pseudozyma yeasts.


    Fukuoka, Tokuma; Morita, Tomotake; Konishi, Masaaki; Imura, Tomohiro; Kitamoto, Dai


    Mannosylerythritol lipids (MELs) are glycolipid biosurfactants produced by Pseudozyma yeasts. They show not only the excellent interfacial properties but also versatile biochemical actions. In the course of MEL production from soybean oil by P. antarctica and P. rugulosa, some new extracellular glycolipids (more hydrophobic than the previously reported di-acylated MELs) were found in the culture medium. The most hydrophobic one was identified as 1-O-alka(e)noyl-4-O-[(4',6'-di-O-acetyl-2',3'-di-O-alka(e)noyl)-beta-D-mannopyranosyl]-D-erythritol, namely tri-acylated MEL. Others were tri-acylated MELs bearing only one acetyl group. The tri-acylated MEL could be prepared by the lipase-catalyzed esterification of a di-acylated MEL with oleic acid implying that the new glycolipids are synthesized from di-acylated MELs in the culture medium containing the residual fatty acids. PMID:17417694

  11. How big is a Cp? Novel cycloheptatrienyl zirconium complexes with tri-, tetra- and pentasubstituted cyclopentadienyl ligands.


    Bauer, Heiko; Glöckner, Andreas; Tagne Kuate, Alain C; Schäfer, Sebastian; Sun, Yu; Freytag, Matthias; Tamm, Matthias; Walter, Marc D; Sitzmann, Helmut


    The new bulky cyclopentadienyl anions 1,2,4-tri(cyclopentyl)cyclopentadienide and 2,3-diisopropyl-1,4-dimethyl-5-trimethylsilyl-cyclopentadienide were prepared. These and the already known 1,2,4-tri(cyclohexyl)-, 1,2,4-tri(isopropyl)-, 2,3-diisopropyl-1,4-dimethyl-, 1,3,4-triisopropyl-2,5-dimethyl-, pentaphenyl-, and p-butylphenyl-tetraphenyl-cyclopentadienide as well as tert-butylindenide were coordinated to the cycloheptatrienylzirconium fragment [(CHT)ZrCl(tmeda)]. The nine zirconium complexes of the [(CHT)Zr(Cp)] type were characterized by elemental analysis and NMR spectroscopy. For five of the sandwich complexes X-ray crystal structure determination could be carried out; structures of the four others were obtained by DFT calculations. The data serve as a basis for cone angle measurements of cyclopentadienyl ligands to evaluate the steric demand of these ligands. PMID:25222005

  12. The TriBeam system: Femtosecond laser ablation in situ SEM

    SciTech Connect

    Echlin, McLean P.; Straw, Marcus; Randolph, Steven; Filevich, Jorge; Pollock, Tresa M.


    Femtosecond laser ablation offers the unique ability to remove material at rates that are orders of magnitude faster than existing ion beam technologies with little or no associated damage. By combining ultrafast lasers with state-of-the-art electron microscopy equipment, we have developed a TriBeam system capable of targeted, in-situ tomography providing chemical, structural, and topographical information in three dimensions of near mm{sup 3} sized volumes. The origins, development, physics, current uses, and future potential for the TriBeam system are described in this tutorial review. - Graphical abstract: Display Omitted - Highlights: • An emerging tool, the TriBeam, for in situ femtosecond (fs) laser ablation is presented. • Fs laser ablation aided tomography at the mm{sup 3}-scale is demonstrated. • Fs laser induced deposition of Pt is demonstrated at sub-diffraction limit resolution. • Fs laser surface structuring is reviewed as well as micromachining applications.

  13. Analysis of weak signal detection based on tri-stable system under Levy noise

    NASA Astrophysics Data System (ADS)

    Li-Fang, He; Ying-Ying, Cui; Tian-Qi, Zhang; Gang, Zhang; Ying, Song


    Stochastic resonance system is an effective method to extract weak signal. However, system output is directly influenced by system parameters. Aiming at this, the Levy noise is combined with a tri-stable stochastic resonance system. The average signal-to-noise ratio gain is regarded as an index to measure the stochastic resonance phenomenon. The characteristics of tri-stable stochastic resonance under Levy noise is analyzed in depth. First, the method of generating Levy noise, the effect of tri-stable system parameters on the potential function and corresponding potential force are presented in detail. Then, the effects of tri-stable system parameters w, a, b, and Levy noise intensity amplification factor D on the resonant output can be explored with different Levy noises. Finally, the tri-stable stochastic resonance system is applied to the bearing fault detection. Simulation results show that the stochastic resonance phenomenon can be induced by tuning the system parameters w, a, and b under different distributions of Levy noise, then the weak signal can be detected. The parameter intervals which can induce stochastic resonances are approximately equal. Moreover, by adjusting the intensity amplification factor D of Levy noise, the stochastic resonances can happen similarly. In bearing fault detection, the detection effect of the tri-stable stochastic resonance system is superior to the bistable stochastic resonance system. Project supported by the National Natural Science Foundation of China (Grant No. 61371164), the Chongqing Municipal Distinguished Youth Foundation, China (Grant No. CSTC2011jjjq40002), and the Research Project of Chongqing Municipal Educational Commission, China (Grant No. KJ130524).

  14. More than just great quotes: An introduction to the Canadian Tri-Council’s qualitative requirements

    PubMed Central

    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L


    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council’s nine requirements. PMID:24421811

  15. Hanford and the Tri-Cities Economy: Historical Trends 1970-2008

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.


    This white paper examines the effect that the Hanford Site has had on the Tri-Cities economy from 1970-2008. Total area employment levels, population, and the real estate market are compared to DOE contractor employment and funding levels, which tended to follow each other until the mid-1990s. Since 1994, area employment, total incomes, population and the real estate market have increased significantly despite very little changes in Hanford employment levels. The data indicate that in recent history, the Tri-Cities economy has become increasingly independent of Hanford.

  16. Hanford and the tri-cities economy: Review and outlook, March 1989

    SciTech Connect

    Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.


    The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

  17. Diversity of tri-functional histidine biosynthesis gene (his) in cereal Phaeosphaeria species

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The full length genomic sequences of tri-functional histidine biosynthesis (his) gene were obtained and compared from cereal Phaeosphaeria species by PCR amplification. The his gene coding sequence in wheat-biotype P. nodorum (PN-w) was 2697 bp in size. The his genes in barley-biotype P. nodorum (PN...

  18. 76. ARAII. After SL1 explosion, operators shielded crane cab try ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    76. ARA-II. After SL-1 explosion, operators shielded crane cab try to open door of SL-1 tank building. January 6, 1961. Ineel photo no. 61-80. Photographer: Holmes. - Idaho National Engineering Laboratory, Army Reactors Experimental Area, Scoville, Butte County, ID

  19. Traversing State Boundaries with Distance Education: The Tri-State Agricultural Distance Delivery Alliance.

    ERIC Educational Resources Information Center

    Anderson, Erik T.; Makus, Larry; Fanno, Wayne; Swan, Mike

    The Tri-State Agricultural Distance Delivery Alliance (TADDA) is a new distance education consortium. The three land grant universities in the Pacific Northwest (the University of Idaho, Oregon State University, and Washington State University) developed TADDA in cooperation with Eastern Oregon University and four of the region's community…

  20. Columbia Basin College Facts & Impacts: A Report to the Tri-Cities Community, 2000.

    ERIC Educational Resources Information Center

    Columbia Basin Coll., Pasco, WA.

    This booklet presents the 2000 Facts and Impacts report to the Tri-Cities community served by Columbia Basin College (CBC). It provides a snapshot of the college in the late 1990s. Following a message from CBC's president and a list of the members of the Board of Trustees, legislators (District 8), legislators (District 16), president, vice…

  1. Flexible inverted polymer solar cells with an indium-free tri-layer cathode

    SciTech Connect

    El Hajj, Ahmad; Lucas, Bruno Schirr-Bonnans, Martin; Ratier, Bernard; Kraft, Thomas M.; Torchio, Philippe


    Indium tin oxide (ITO)-free inverted polymer solar cells (PSCs) have been fabricated without the need of an additional electron transport layer. The indium-free transparent electrode consists of a tri-layer stack ZnO (30 nm)/Ag (14 nm)/ZnO (30 nm) deposited on glass and plastic substrates via ion-beam sputtering. The tri-layer electrodes exhibit similar physical properties to its ITO counterpart, specifically yielding high transmittance and low resistivity (76.5% T at 550 nm, R{sub sq} of 8 Ω/◻) on plastic substrates. The novel tri-layer electrode allows for the fabrication of inverted PSCs without the additional ZnO interfacial layer commonly deposited between ITO and the photoactive layer. This allows for the preparation of thinner plastic solar cells using less material than conventional architectures. Initial studies involving the newly realized architecture (tri-layer electrode/P3HT:PCBM/PEDOT:PSS/Ag) have shown great promise for the transition from ITO to other viable electrodes in organic electronics.

  2. Evaluation of tri-steps modified styrene-butadiene-styrene block copolymer membrane for wound dressing.


    Yang, Jen Ming; Huang, Huei Tsz


    Tri-steps modified styrene-butadiene-styrene block copolymer (SBS) membrane was prepared with epoxidation, ring opening reaction with maleated ionomer and layer-by-layer assembled polyelectrolyte technique. The tri-steps modified SBS membrane was characterized by infrared spectroscopy and X-ray photoelectron spectroscope (XPS). The structures of the modified SBS membranes were identified with methylene blue and azocarmine G. The content of amino group on the surface of the modified membrane was calculated from uptake of an acid dye. The values of the contact angle, water absorption, water vapor transmission rate and the adsorption of fibronectin on the membranes were determined. To evaluate the biocompatibility of the tri-steps modified SBS membrane, the cytotoxicity, antibacterial and growth profile of the cell culture of 3T3 fibroblasts on the membrane were evaluated. The bactericidal activity was found on the modified SBS. From the cell culture of 3T3 fibroblasts on the membrane, it revealed that the cells not only remained viable but also proliferated on the surface of the tri-steps modified SBS membranes. As the membranes are sterile semipermeable with bactericidal activity and transparent allowing wound checks, they can be considered for shallow wound with low exudates. PMID:24364963

  3. Bioprospecting for TRI101 in Fusarium: Searching for a Better Enzyme to Detoxify Deoxynivalenol (DON)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The mycotoxin deoxynivalenol (DON) is a common contaminant of wheat and barley in the United States. New strategies to mitigate the threat of DON need to be developed and implemented. Previous research has shown the value of an enzyme (TRI101) to modify DON and reduce its toxicity. Recent work by...

  4. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    ERIC Educational Resources Information Center

    Abdulwahed, Mahmoud; Nagy, Zoltan K.


    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  5. Making Mission Statements Operational: Perceptions of Principals from Tri-Association Schools

    ERIC Educational Resources Information Center

    Fayad, Juan David; Yoshida, Roland K.


    Researchers and theorists in the management and educational leadership fields have debated the importance of mission statements. This study investigated this issue within the context of American schools that are members of the Tri-Association (Mexico, Central America, Colombia, and the Caribbean). The results showed that about the same percentage…

  6. Investment in hydrogen tri-generation for wastewater treatment plants under uncertainties

    NASA Astrophysics Data System (ADS)

    Gharieh, Kaveh; Jafari, Mohsen A.; Guo, Qizhong


    In this article, we present a compound real option model for investment in hydrogen tri-generation and onsite hydrogen dispensing systems for a wastewater treatment plant under price and market uncertainties. The ultimate objective is to determine optimal timing and investment thresholds to exercise initial and subsequent options such that the total savings are maximized. Initial option includes investment in a 1.4 (MW) Molten Carbonate Fuel Cell (MCFC) fed by mixture of waste biogas from anaerobic digestion and natural gas, along with auxiliary equipment. Produced hydrogen in MCFC via internal reforming, is recovered from the exhaust gas stream using Pressure Swing Adsorption (PSA) purification technology. Therefore the expansion option includes investment in hydrogen compression, storage and dispensing (CSD) systems which creates additional revenue by selling hydrogen onsite in retail price. This work extends current state of investment modeling within the context of hydrogen tri-generation by considering: (i) Modular investment plan for hydrogen tri-generation and dispensing systems, (ii) Multiple sources of uncertainties along with more realistic probability distributions, (iii) Optimal operation of hydrogen tri-generation is considered, which results in realistic saving estimation.

  7. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    NASA Astrophysics Data System (ADS)

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This startlingly quick score, though, is of interest to physics players as well as rugby players. Howells' try serves as an intriguing way to involve students in one of the "core competencies" of physicists—to model events in the real world. And with the Rugby World Cup taking place in 2015 in England, and rugby sevens making its debut in the 2016 Summer Olympics in Brazil (U.S. teams have qualified for both events), rugby is increasing in popularity in America and is even gaining some coverage on television. Thanks to You-Tube, Howells' try is readily available to serve as a laboratory experiment for students to analyze.

  8. Factors associated with BMI, weight perceptions and trying to lose weight in African-American smokers.

    PubMed Central

    Lee, Rebecca E.; Harris, Kari Jo; Catley, Delwyn; Shostrom, Valerie; Choi, Simon; Mayo, Matthew S.; Okuyemi, Kola; Kaur, Harsohena; Ahluwalia, Jasjit S.


    This study examined sociodemographic, behavioral and psychosocial factors associated with BMI, weight perceptions and trying to lose weight among African-American smokers (N=600, M=44.2 years, 70% female). Sixty-eight percent of the sample were overweight or obese (sample BMI M=28.0, SD=6.7). Three separate, simultaneous multivariable regression models were used to determine which factors were associated with BMI, weight perceptions and trying to lose weight. Poorer health, female gender and high-school education or higher were significantly associated with higher BMIs (p<0.05). Being female (OR=5.8, 95% CI=3.6-9.3) and having a higher BMI (OR=0.6, 95% CI=0.5-0.6) was associated with perception of overweight and smoking more cigarettes per day (OR=1.0, 95% CI=1.0-1.1), and perceiving oneself as overweight (OR=14.1, 95% CI=8.2-24.2) was associated with trying to lose weight. Participants somewhat underestimated their BMI in their weight perceptions. Those who perceived themselves as overweight were more likely to be trying to lose weight; therefore, increasing participant awareness of actual BMI status may lead to improved weight-control efforts in African-American smokers. Several expected associations with outcomes were not found, suggesting that BMI and weight constructs are not well-understood in this population. PMID:15719872

  9. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    ERIC Educational Resources Information Center

    Grier-Reed, Tabitha; Ganuza, Zoila


    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  10. Middle School Learners' Ontological "Trying-on" of Dimensions: A Phenomenological Investigation

    ERIC Educational Resources Information Center

    Valentine, Keri Duncan; Kopcha, Theodore J.


    This paper shares findings from a post-intentional phenomenological study aimed at understanding learners' experience investigating space and dimension concepts in a fifth and sixth grade mathematics class. Findings indicate experiences in this study manifest as an ontological "trying-on" of geometric dimensions (e.g., through…

  11. 77 FR 25080 - Safety Zones; TriMet Bridge Project, Willamette River, Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...The Coast Guard is establishing safety zones encompassing the work trestles and construction cranes involved in the construction of the TriMet Bridge on the Willamette River, in Portland, OR. This action is necessary to ensure the safety of recreational vessels and commercial vessels transiting in close proximity to cranes and overhead work associated with this construction project. These......

  12. Challenges and Mental Health Experiences of Lesbian and Bisexual Women Who Are Trying to Conceive

    ERIC Educational Resources Information Center

    Yager, Christina; Brennan, David; Steele, Leah S.; Epstein, Rachel; Ross, Lori E.


    To date, there is little evidence to inform social work practice with lesbian and bisexual women who are trying to conceive (TTC). The authors report a preliminary examination of the mental health experiences of lesbian and bisexual women who are TTC, through a comparison with lesbian and bisexual women in the postpartum period (PP). Thirty-three…

  13. Metallic conductance at the interface of tri-color titanate superlattices

    SciTech Connect

    Kareev, M. Cao, Yanwei; Liu, Xiaoran; Middey, S.; Meyers, D.; Chakhalian, J.


    Ultra-thin tri-color (tri-layer) titanate superlattices ([3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}/3 u.c. YTiO{sub 3}], u.c. = unit cells) were grown in a layer-by-layer way on single crystal TbScO{sub 3} (110) substrates by pulsed laser deposition. High sample quality and electronic structure were characterized by the combination of in-situ photoelectron and ex-situ structure and surface morphology probes. Temperature-dependent sheet resistance indicates the presence of metallic interfaces in both [3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layers and all the tri-color structures, whereas a [3 u.c. YTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layer shows insulating behavior. Considering that in the bulk YTiO{sub 3} is ferromagnetic below 30 K, the tri-color titanate superlattices provide an opportunity to induce tunable spin-polarization into the two-dimensional electron gas with Mott carriers.

  14. "How To Succeed in Business Without Really Trying." Spotlight on Theater Notes.

    ERIC Educational Resources Information Center

    Carr, John C.

    This booklet presents a variety of materials concerning the current revival of the 1961 play "How to Succeed in Business Without Really Trying." After a brief introduction to the play, the booklet discusses the plot of the play, how it went from best seller to prize-winning musical, biographical information on the lead actor (Matthew Broderick)…

  15. 78 FR 43971 - Amendment of Class E Airspace; Tri-Cities, TN

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Class D and E airspace in the Tri-Cities, TN, area (78 FR 7993). The line defining the exclusion of...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p....

  16. A Tri-Reference Point Theory of Decision Making under Risk

    ERIC Educational Resources Information Center

    Wang, X. T.; Johnson, Joseph G.


    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…


    EPA Science Inventory

    On November 12-13, 1999, Approximately 300 people attended the Delmarva Coastal Bays Conference III: Tri-State Approaches to Preserving Aquatic Resources (CBCIII). The conference was organized by the Assateague Coastal Trust with planning and financial assistance from twenty-one ...

  18. Exciton Binding Energy in Organic-Inorganic Tri-Halide Perovskites.


    Askar, Abdelrahman M; Shankar, Karthik


    The recent dramatic increase in the power conversion efficiencies of organic-inorganic tri-halide perovskite solar cells has triggered intense research worldwide and created a paradigm shift in the photovoltaics field. It is crucial to develop a solid understanding of the photophysical processes underlying solar cell operation in order to both further improve the photovoltaic performance of perovskite solar cells as well as to exploit the broader optoelectronic applications of the tri-halide perovskites. In this short review, we summarize the main research findings about the binding energy of excitons in tri-halide perovskite materials and find that a value in the range of 2-22 meV at room temperature would be a safe estimate. Spontaneous free carrier generation is the dominant process taking place directly after photoexcitation in organic-inorganic tri-halide perovskites at room temperature, which eliminates the exciton diffusion bottleneck present in organic solar cells and constitutes a major contributing factor to the high photovoltaic performance of this material. PMID:27427650

  19. Columbia Basin College Facts & Impacts: A Report to the Tri-Cities Community.

    ERIC Educational Resources Information Center

    Knutzen, Judi; LaGrange, Jill; Jones, Ty

    This fact book for Columbia Basin College (CBC) (Washington) covers seven subject areas: (1) mission statement; (2) access; (3) academics; (4) career and workforce development; (5) basic skills; (6) cultural enrichment; and (7) physical and emotional well-being. Report highlights include: (1) in 2001, CBC presented to the Tri-Cities community a…

  20. Tri-P-LETS: Changing the Face of High School Computer Science

    ERIC Educational Resources Information Center

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James


    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  1. Dynamics and coherence resonance of tri-stable energy harvesting system

    NASA Astrophysics Data System (ADS)

    Haitao, Li; Weiyang, Qin; Chunbo, Lan; Wangzheng, Deng; Zhiyong, Zhou


    To improve the efficiency of energy harvesting, this paper presents a tri-stable energy harvesting device, which can realize inter-well oscillation at low-frequency base excitation and obtain a high harvesting efficiency by tri-stable coherence resonance. First, the model of a magnetic coupling tri-stable piezoelectric energy harvester is established and the corresponding equations are derived. The formula for the magnetic repulsion force between three magnets is given. Then, the dynamic responses of a system subject to harmonic excitation and Gaussian white noise excitation are explored by a numerical method and validated by experiments. Compared with a bi-stable energy harvester, the threshold for inter-well oscillation to occur can be moved forward to the low frequency, and the tri-stable device can create a dense high output voltage and power at the low intensity of stochastic excitation. Results show that for a definite deterministic or stochastic excitation, the system can be optimally designed such that it increases the frequency bandwidth and achieves a high energy harvesting efficiency at coherence resonance.

  2. Wake structure of axial-flow hydrokinetic turbines in tri-frame arrangement

    NASA Astrophysics Data System (ADS)

    Chawdhary, Saurabh; Yang, Xiaolei; Hill, Craig; Khosronejad, Ali; Guala, Michele; Sotiropoulos, Fotis


    Marine and hydro-kinetic (MHK) energy hold promise for future of sustainable energy generation. Tri-frame of turbines, three turbines mounted on vertices of a triangle, are an effective way to build a power producing array of hydrokinetic turbines in marine environment. Large eddy simulation (LES) is used to simulate the flow past a tri-frame and characterize its wake. Full geometry of all three turbines in the tri-frame is resolved using the Curvilinear Immersed Boundary (CURVIB) method of Kang et al. (2011). High fidelity solution of flow field is obtained owing to the inclusion of detailed geometry of the turbines. Excellent agreement is obtained with the experiments conducted in a flume at Saint Anthony Falls Laboratory (SAFL). The wake evolution of the three turbines is compared to that of an isolated single turbine. The differences in wake dynamics are highlighted to elucidate the importance of turbine wake interaction in an array. The simulations indicate lower levels of TKE and lower levels of momentum deficit in the wake of the upstream turbine of tri-frame compared to the other turbines. Analysis of the far wake recovery is useful for the optimal MHK array design. This work was supported by NSF grant IIP-1318201. The simulations were carried out at the Minnesota Supercomputing Institute.

  3. The TRY Foundation: A Case Study in Private Community Development Organizations.

    ERIC Educational Resources Information Center

    McClure, Paul T.

    This is a case study of the TRY Foundation, a privately funded non-profit corporation devoting its resources to "community and human development in disadvantaged areas." Activities sponsored by its primate unit, the Willowbrook Chapter of Watts, Los Angeles, include: thrift shop, preventive dentistry clinic, Operation Vegetable Basket--which…

  4. "Just Try Harder and You Will Shine": A Study of 20 Lazy Children

    ERIC Educational Resources Information Center

    Gilmore, Linda; Boulton-Lewis, Gillian


    Attributions of laziness, reflected in teacher comments such as "Just try harder and you will shine", may mask specific cognitive, learning, attentional or emotional problems that could explain low motivation in some children. This paper reports findings from an investigation of 20 children, aged 7 to 10 years, who were regarded as lazy…

  5. A Theory of Institutional Change and Control: Tri-Partite Power. Revised.

    ERIC Educational Resources Information Center

    Shapiro, Arthur

    This paper describes the Tri-Partite Theory of institutional change, which proposes that organizations in general and educational institutions in particular pass through three phases, each dominated by a specific personality type: person-orientation (loyalty to a charismatic leader as the basis of motivation); plan-orientation (functions…

  6. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    ERIC Educational Resources Information Center

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette


    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  7. Youth Experience of Trying to Get off the Street: What Has Helped and Hindered

    ERIC Educational Resources Information Center

    Brown, Tracy L.; Amundson, Norman E.


    This qualitative study involved 20 youth (18 males, 1 female, 1 transgender, ages 19-24) living in Vancouver, British Columbia, who reported 259 critical incidents of what helped or hindered their experiences as they tried to get off the street. What helped included (a) taking responsibility, (b) engaging in constructive activities, (c) friends…

  8. Design of tri-level excitation signals for broadband bioimpedance spectroscopy.


    Yang, Yuxiang; Wang, Lianhuan; Wang, Peipei; Yang, Xiufang; Zhang, Fu; Wen, He; Teng, Zhaosheng


    Bioimpedance spectroscopy (BIS) measurement methods have been evolving from the traditional frequency-sweep approach to the multi-frequency simultaneous measurement technique which can drastically reduce measuring time and will be increasingly attractive for time-varying biological applications. Multi-frequency mixed (MFM) signals with sparsely distributed spectra are desirable for broadband BIS measurement. This paper proposes a synthesis method to design a series of tri-level MFM signals which contain only three values (+1, 0, -1), and has majority energy distributed on its (2(n))th primary harmonics. Tri-level MFM signals have both high energy efficiency and a low crest factor. An impedance measurement experiment excited by an 8th-order tri-level MFM signal on a RC three-element equivalent model has been performed, and the results on 8 primary harmonic frequencies ranging from 8 to 1024 kHz show a high accuracy with the mean amplitude relative error of 0.41% and mean phase absolute error of 0.18°, which has validated the feasibility of the tri-level MFM signals for broadband BIS measurement. PMID:26261063

  9. 77 FR 23409 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... are located. In 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate tribal government (55 FR 30632... preambles to the proposed and final rules. Id.; 54 FR 12992 (March 29, 1989). These amendments,...

  10. Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37

    PubMed Central

    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G.; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  11. Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.


    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  12. Shock initiation of the tri-amino-tri-nitro-benzene based explosive PBX 9502 cooled to -55 bold">°C

    NASA Astrophysics Data System (ADS)

    Gustavsen, Richard L.; Gehr, Russell J.; Bucholtz, Scott M.; Alcon, Robert R.; Bartram, Brian D.


    We report a series of shock initiation experiments on PBX 9502 cooled to -55 °C. PBX 9502 consists of 95% dry aminated tri-amino-tri-nitro-benzene (TATB) and 5% poly-chloro-trifluoro-ethylene5 (Kel-F 800) binder. PBX 9502 samples were shock initiated by projectile impact from a two stage gas gun. Buildup to detonation was measured with 10 or more particle velocity gauges embedded at different depths in the sample. Three shock wave trackers measured the position of the shock front with time. Particle velocity vs. time wave-profiles and coordinates for onset of detonation were obtained as a function of the impact stress or pressure. PBX 9502 sample temperatures were monitored using type-E thermocouples, two inside the sample and two on the sample surface. Additional thermocouples were mounted on other parts of the cooling apparatus. Wave profiles from embedded gauges are qualitatively similar to those observed at 23 °C. However, at -55 °C, PBX 9502 is much less sensitive than at 23 °C. For example, at an inpact stress of 15.4 GPa, the distance to detonation at -55 °C is 7.8 mm. At 23 °C, the distance is 4.3 mm.

  13. High Performance Computing for Dsm Extraction from ZY-3 Tri-Stereo Imagery

    NASA Astrophysics Data System (ADS)

    Lu, Shuning; Huang, Shicun; Pan, Zhiqiang; Deng, Huawu; Stanley, David; Xin, Yubin


    ZY-3 has been acquiring high quality imagery since its launch in 2012 and its tri-stereo (three-view or three-line-array) imagery has become one of the top choices for extracting DSM (Digital Surface Model) products in China over the past few years. The ZY-3 tri-stereo sensors offer users the ability to capture imagery over large regions including an entire territory of a country, such as China, resulting in a large volume of ZY-3 tri-stereo scenes which require timely (e.g., near real time) processing, something that is not currently possible using traditional photogrammetry workstations. This paper presents a high performance computing solution which can efficiently and automatically extract DSM products from ZY-3 tri-stereo imagery. The high performance computing solution leverages certain parallel computing technologies to accelerate computation within an individual scene and then deploys a distributed computing technology to increase the overall data throughput in a robust and efficient manner. By taking advantage of the inherent efficiencies within the high performance computing environment, the DSM extraction process can exploit all combinations offered from a set of tri-stereo images (forward-backword, forward-nadir and backword-nadir). The DSM results merged from all of the potential combinations can minimize blunders (e.g., incorrect matches) and also offer the ability to remove potential occlusions which may exist in a single stereo pair, resulting in improved accuracy and quality versus those that are not merged. Accelerated performance is inherent within each of the individual steps of the DSM extraction workflow, including the collection of ground control points and tie points, image bundle adjustment, the creation of epipolar images, and computing elevations. Preliminary experiments over a large area in China have proven that the high performance computing system can generate high quality and accurate DSM products in a rapid manner.

  14. Male injection drug users try new drugs following U.S. deportation to Tijuana, Mexico

    PubMed Central

    Robertson, Angela M.; Rangel, M. Gudelia; Lozada, Remedios; Vera, Alicia; Ojeda, Victoria D.


    Background Among male injection drug users (IDUs) in Tijuana, Mexico, U.S. deportation is associated with HIV transmission. Changing drug use behaviors following deportation, including the use of new drugs, may increase HIV risk but are understudied. We identify correlates of trying new drugs following male IDUs’ most recent U.S. deportation to Mexico. Methods In 2010, we recruited 328 deported male IDUs in Tijuana, Mexico. Questionnaires collected retrospective data on drug use and other HIV risk behaviors throughout migratory events. Logistic regression identified correlates of trying new drugs/combinations following their most recent deportations. Informed consent was obtained from all participants. Results Nearly one in six men (n=52, 16%) tried new drugs following their most recent deportation, including heroin (n=31), methamphetamine (n=5), and heroin/methamphetamine combined (n=17). Trying new drugs following deportation was independently associated with U.S. incarceration (adjusted odds ratio [AOR]= 3.96; 95% confidence interval [C.I.] 1.78, 8.84), increasing numbers of U.S. deportations (AOR=1.11 per deportation; C.I. 1.03, 1.20), feeling sad following deportation (AOR 2.69; C.I. 1.41, 5.14), and perceiving that one’s current lifestyle increases HIV/AIDS risk (AOR 3.91; C.I. 2.05, 7.44). Conclusions Trying new drugs following U.S. deportation may be related to the unique contexts and stressors experienced by drug-abusing migrants as they attempt to reestablish their lives in Mexico. Findings imply an unmet need for health and social programs to alleviate pre-and post-deportation stressors faced by undocumented and return migrants in the U.S.-Mexico context. PMID:21835559

  15. Crystal structures of three complexes of zinc chloride with tri-tert-butyl­phosphane

    PubMed Central

    Finke, Aaron D.; Gray, Danielle L.; Moore, Jeffrey S.


    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl­phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis­[chlorido­bis­(tri-tert-butyl­phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter­act weakly with C—H groups on the phosphane ligand. In the presence of THF, monomeric di­chlorido­(tetra­hydro­furan-κO)(tri-tert-butyl­phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra­hedral Zn complex has weak C—H⋯Cl inter­actions between the Cl atoms and phosphane and THF C—H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl­phospho­nium aqua­tri­chlorido­zincate 1,2-di­chloro­ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3]+ [(H2O)ZnCl3]−·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3]− anions from hydrogen-bonding inter­actions between the water H atoms and Cl atoms that propagate along the b axis. PMID:26870580

  16. Quantification of Tri5 gene, expression, and deoxynivalenol production during the malting of barley.


    Vegi, Anuradha; Schwarz, Paul; Wolf-Hall, Charlene E


    Fusarium can survive, grow, and produce mycotoxins during malting. We evaluated the percentage of barley kernels infected with Fusarium (FI) and deoxynivalenol (DON) concentration in three barley treatments (high-quality, naturally infected, and Fusarium graminearum inoculated barley) during various stages of malting. We also applied real-time polymerase chain reaction (real-time PCR) and real-time reverse transcriptase PCR (real-time RT-PCR) methods to quantify trichothecene-producing (Tri5) DNA concentration and expression, respectively. We observed that FI significantly (P<0.05) increased during the germination stage of malting in all barley treatments. Temperatures of 49°C and higher during kilning reduced the FI in high-quality barley treatments, but for inoculated treatments temperatures in excess of 60°C were needed to reduce FI. The Tri5 DNA concentration ranged from non-detectable to 3.9 ng/50mg, 0.1 to 109.8 ng/50mg and 3.4 to 397.5 ng/50 mg in malted high-quality, inoculated and naturally infected barley treatments respectively. Strong gene expression (Tri5) in naturally infected barley treatments was found during the third day of germination, when compared to high-quality and inoculated barley treatments during malting. Deoxynivalenol was present even at high kilning temperatures, as DON is heat stable. The average DON concentration ranged from non-detectable to 0.1 μg/g, non-detectable to 1.1 μg/g, and 1.5 to 45.9 μg/g during various stages of malting in high-quality, inoculated and infected barley and malt samples respectively. Overall, the last 2 days of germination and initial stages of kilning were peak stages for FI, Tri5 gene production, Tri5 gene expression and DON production. PMID:21871683

  17. Crystal structures of three complexes of zinc chloride with tri-tert-butyl-phosphane.


    Finke, Aaron D; Gray, Danielle L; Moore, Jeffrey S


    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl-phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis-[chlorido-bis-(tri-tert-butyl-phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter-act weakly with C-H groups on the phosphane ligand. In the presence of THF, monomeric di-chlorido-(tetra-hydro-furan-κO)(tri-tert-butyl-phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra-hedral Zn complex has weak C-H⋯Cl inter-actions between the Cl atoms and phosphane and THF C-H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl-phospho-nium aqua-tri-chlorido-zincate 1,2-di-chloro-ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3](+) [(H2O)ZnCl3](-)·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3](-) anions from hydrogen-bonding inter-actions between the water H atoms and Cl atoms that propagate along the b axis. PMID:26870580

  18. Fusarium Tri4 encodes a key multifunctional cytochrome P450 monooxygenase for four consecutive oxygenation steps in trichothecene biosynthesis

    SciTech Connect

    Tokai, Takeshi; Koshino, Hiroyuki; Takahashi-Ando, Naoko; Sato, Masayuki; Fujimura, Makoto; Kimura, Makoto . E-mail:


    Fusarium Tri4 encodes a cytochrome P450 monooxygenase (CYP) for hydroxylation at C-2 of First committed intermediate trichodiene (TDN) in the biosynthesis of trichothecenes. To examine whether this CYP further participates in subsequent oxygenation steps leading to isotrichotriol (4), we engineered Saccharomyces cerevisiae for de novo production of the early intermediates by introducing cDNAs of Fusarium graminearum Tri5 (FgTri5 encoding TDN synthase) and Tri4 (FgTri4). From a culture of the engineered yeast grown on induction medium (final pH 2.7), we identified two intermediates, 2{alpha}-hydroxytrichodiene (1) and 12,13-epoxy-9,10-trichoene-2{alpha}-ol (2), and a small amount of non-Fusarium trichothecene 12,13-epoxytrichothec-9-ene (EPT). Other intermediates isotrichodiol (3) and 4 were identified in the transgenic yeasts grown on phosphate-buffered induction medium (final pH 5.5-6.0). When Trichothecium roseum Tri4 (TrTri4) was used in place of FgTri4, 4 was not detected in the culture. The three intermediates, 1, 2, and 3, were converted to 4,15-diacetylnivalenol (4,15-diANIV) when fed to a toxin-deficient mutant of F. graminearum with the FgTri4 {sup +} genetic background (viz., by introducing a FgTri5 {sup -} mutation), but were not metabolized by an FgTri4 {sup -} mutant. These results provide unambiguous evidence that FgTri4 encodes a multifunctional CYP for epoxidation at C-12,13, hydroxylation at C-11, and hydroxylation at C-3 in addition to hydroxylation at C-2.

  19. Characteristics of smokers who have never tried to quit: evidence from the British Opinions and Lifestyle Survey

    PubMed Central


    Background An understanding of the characteristics of smokers who have never tried to quit may be useful to help identify and target these individuals and encourage them to attempt to give up smoking. Using national survey data we investigated variables associated with smokers reporting never having tried to quit. Methods Using data from the 2007 and 2009 UK Office for National Statistics Opinions and Lifestyle Survey we identified all self-reported current smokers aged 16+. The primary outcome was response to the question ‘have you ever tried to quit smoking?’ Univariable and multivariable logistic regression quantified the association between this outcome and several potential explanatory variables, including age, sex, socioeconomic status, health status, smoking behaviour, and knowledge of the dangers of smoking. Results Desire to quit was the most significant independent predictor of whether a smoker reported never having tried to quit. Smokers who reported that their health was good or very good were more likely to report never having tried to quit than those whose health was fair, bad or very bad (OR 1.59, 95% CI 1.05-2.41). Smokers who reported that no family members, friends or colleagues had been trying to get them to quit smoking in the last year were more likely to report never having tried to quit than those who reported that someone was trying to persuade them (OR 1.57, 95% CI 1.09-2.28). Smokers who hadn’t received any cessation advice from a health professional in the last five years which they considered to be helpful were also more likely to report never having tried to quit. Conclusions Smokers who do not want to quit, who are in good health, whose friends and family are not trying to get them to quit, and who do not report receiving helpful advice to quit from a health professional, are more likely to report never having tried to quit. PMID:24721488

  20. Three-dimensional shape measurement of small object based on tri-frequency heterodyne method

    NASA Astrophysics Data System (ADS)

    Liu, Shouqi; Feng, Wei; Zhang, Qican; Liu, Yuankun


    Among temporal phase unwrapping methods based on structured light projection, tri-frequency heterodyne method, with the merits of less projected fringe, high precision and high reliability, has become a practical method in objects three-dimensional (3D) shape measurement. In this paper, a 3D shape measuring system was developed with a digital micromirror device (DMD) and synchronously trigged CCD camera. The 3D shape of a measured object was reconstructed from the deformed fringe patterns based on tri-frequency heterodyne method. The practical experiments were carried on some coins, and the results show that the system can restore their 3D shape on the tested partition with an accuracy of microns. This measurement system is prominent in 3D shape measurement of small or tiny objects, sample testing, and many other application fields.

  1. NASA Marshall Space Flight Center Tri-gas Thruster Performance Characterization

    NASA Technical Reports Server (NTRS)

    Dorado, Vanessa; Grunder, Zachary; Schaefer, Bryce; Sung, Meagan; Pedersen, Kevin


    Historically, spacecraft reaction control systems have primarily utilized cold gas thrusters because of their inherent simplicity and reliability. However, cold gas thrusters typically have a low specific impulse. It has been determined that a higher specific impulse can be achieved by passing a monopropellant fluid mixture through a catalyst bed prior to expulsion through the thruster nozzle. This research analyzes the potential efficiency improvements from using tri-gas, a mixture of hydrogen, oxygen, and an inert gas, which in this case is helium. Passing tri-gas through a catalyst causes the hydrogen and oxygen to react and form water vapor, ultimately heating the exiting fluid and generating a higher specific impulse. The goal of this project was to optimize the thruster performance by characterizing the effects of varying several system components including catalyst types, catalyst lengths, and initial catalyst temperatures.

  2. Elastic behavior of methyltrimethoxysilane based aerogels reinforced with tri-isocyanate.


    Nguyen, Bao Chau N; Meador, Mary Ann B; Medoro, Alexandra; Arendt, Victoria; Randall, Jason; McCorkle, Linda; Shonkwiler, Brian


    The elastic properties and/or flexibility of polymer reinforced silica aerogels having methyltrimethoxysilane (MTMS) and bis(trimethoxysilylpropyl)amine (BTMSPA) making up the silica structure are examined. The dipropylamine spacer from BTMSPA is used both to provide a flexible linking group in the silica structure, and as a reactive site via its secondary amine for reaction with a tri-isocyanate, Desmodur N3300A. The tri-isocyanate provides an extended degree of branching or reinforcement, resulting in increased compressive strength of the aerogel monoliths while the overall flexibility arising from the underlying silica structure is maintained. The compressive moduli of the reinforced aerogel monoliths in this study range from 0.001 to 158 MPa. Interestingly, formulations across this entire range of modulus recover nearly all of their length after two compressions to 25% strain. Differences in pore structure of the aerogels due to processing conditions and solvent are also discussed. PMID:20426430

  3. Contribution of the Type II Chaperonin, TRiC/CCT, to Oncogenesis

    PubMed Central

    Roh, Soung-Hun; Kasembeli, Moses; Bakthavatsalam, Deenadayalan; Chiu, Wah; Tweardy, David J.


    The folding of newly synthesized proteins and the maintenance of pre-existing proteins are essential in sustaining a living cell. A network of molecular chaperones tightly guides the folding, intracellular localization, and proteolytic turnover of proteins. Many of the key regulators of cell growth and differentiation have been identified as clients of molecular chaperones, which implies that chaperones are potential mediators of oncogenesis. In this review, we briefly provide an overview of the role of chaperones, including HSP70 and HSP90, in cancer. We further summarize and highlight the emerging the role of chaperonin TRiC (T-complex protein-1 ring complex, also known as CCT) in the development and progression of cancer mediated through its critical interactions with oncogenic clients that modulate growth deregulation, apoptosis, and genome instability in cancer cells. Elucidation of how TRiC modulates the folding and function of oncogenic clients will provide strategies for developing novel cancer therapies. PMID:26561808

  4. The growth and crystallography of bismuth tri-iodide crystals grown by vapor transport

    SciTech Connect

    Nason, D.; Keller, L.


    A single crystal of bismuth tri-iodide (BiI{sub 3}) of dimensions 1.2 {times} 1.2 {times} 0.4 cm{sup 3} has been grown by physical vapor transport. The lattice parameters of the hexagonal crystal and its polycrystaleme powder precursor were measured by x-ray diffraction (XRD) and were in agreement, indicating that the vapor phase growth and sublimation purification processing at temperatures below 330{degree}C did not significantly affect the stoichiometry. X-ray rocking measurements of the single crystal showed low angle boundaries of the order of 0.05{degree}. In tests as gamma radiation detectors, neither melt grown nor vapor grown crystals were satisfactory, but the vapor grown crystals were promising. Several observations suggest that better performance may be achievable with purer bismuth tri-iodide.

  5. Tri-Gate Normally-Off GaN Power MISFET

    SciTech Connect

    Lu, B; Matioli, E; Palacios, T


    We present a new normally-off GaN transistor-the tri-gate normally-off GaN metal-insulator-semiconductor field-effect transistor (MISFET). Due to the excellent channel control of a new 3-D gate structure, a breakdown voltage of 565 V has been achieved at a drain leakage current of 0.6 mu A/mm and V-gs = 0. The new device has an on/off current ratio of more than eight orders of magnitude and a subthreshold slope of 86 +/- 9 mV/decade. The threshold voltage of the new device is 0.80 +/- 0.06 V with a maximum drain current of 530 mA/mm. These results confirm the great potential of the tri-gate normally-off GaN-on-Si MISFETs for the next generation of power electronics.

  6. Ligands with an NPNPN-framework and their application in chromium catalysed ethene tri-/tetramerization.


    Peulecke, N; Müller, B H; Spannenberg, A; Höhne, M; Rosenthal, U; Wöhl, A; Müller, W; Alqahtani, A; Al Hazmi, M


    Novel Cr(iii) catalysts supported by linear phosph(iii)azanes of the type R(1)R(2)N-P(Ph)-NR(3)-P(Ph)-NR(4)R(5) have been prepared, all of which, upon activation with MMAO-3A, are highly active for ethene tri-/tetramerization with considerable selectivity. The effect of ligand substitution as well as solvent on the catalytic performance has been examined. PMID:27151679

  7. Crystal structures of three 3,4,5-tri-meth-oxy-benzamide-based derivatives.


    Gomes, Ligia R; Low, John Nicolson; Oliveira, Catarina; Cagide, Fernando; Borges, Fernanda


    The crystal structures of three benzamide derivatives, viz. N-(6-hy-droxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C16H25NO5, (1), N-(6-anilinohex-yl)-3,4,5-tri-meth-oxy-benzamide, C22H30N2O4, (2), and N-(6,6-di-eth-oxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C20H33NO6, (3), are described. These compounds differ only in the substituent at the end of the hexyl chain and the nature of these substituents determines the differences in hydrogen bonding between the mol-ecules. In each mol-ecule, the m-meth-oxy substituents are virtually coplanar with the benzyl ring, while the p-meth-oxy substituent is almost perpendicular. The carbonyl O atom of the amide rotamer is trans related with the amidic H atom. In each structure, the benzamide N-H donor group and O acceptor atoms link the mol-ecules into C(4) chains. In 1, a terminal -OH group links the mol-ecules into a C(3) chain and the combined effect of the C(4) and C(3) chains is a ribbon made up of screw related R 2 (2)(17) rings in which the ⋯O-H⋯ chain lies in the centre of the ribbon and the tri-meth-oxy-benzyl groups forms the edges. In 2, the combination of the benzamide C(4) chain and the hydrogen bond formed by the terminal N-H group to an O atom of the 4-meth-oxy group link the mol-ecules into a chain of R 2 (2)(17) rings. In 3, the mol-ecules are linked only by C(4) chains. PMID:27308017

  8. Toxic Release Inventory (TRI), Pennsylvania, 1989 (in Macintosh Excel format) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. All releases are in pounds per year.

  9. Quantum nature of ROT and TRI asymmetries in the ternary fission of nuclei

    NASA Astrophysics Data System (ADS)

    Bunakov, V. E.; Kadmensky, S. G.; Kadmensky, S. S.


    Effects of T-odd asymmetry in ternary-nuclear-fission reactions induced by polarized cold neutrons are considered within quantum theory. It is shown that the asymmetry coefficient can be expressed in terms of experimental angular distributions of third particles in reactions induced by unpolarized neutrons. The explicit form of this coefficient makes it possible to explain the difference in the magnitudes and signs of the TRI and ROT effects observed experimentally for different targets.

  10. The tri-Hamiltonian dual system of supersymmetric two boson system

    NASA Astrophysics Data System (ADS)

    Zhang, Mengxia; Tian, Kai; Zhang, Lei


    The dual system of the supersymmetric two boson system is constructed through the approach of tri-Hamiltonian duality, and inferred from this duality, its zero-curvature representation is also figured out. Furthermore, the dual system is shown to be equivalent to a N = 2 supersymmetric Camassa-Holm equation, and this relation results in a new linear spectral problem for the N = 2 supersymmetric Camassa-Holm equation.

  11. 76 FR 53054 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...The U.S. Coast Guard will establish a safety zone during the construction of the TriMet Bridge on the Willamette River, in Portland, OR. This action is necessary to ensure the safety of recreational vessels and commercial vessels transiting in close proximity to cranes and overhead work associated with this construction project. During the enforcement period, all vessels will be required to......

  12. Operator Interface and Control Software for the Reconfigurable Surface System Tri-ATHLETE

    NASA Technical Reports Server (NTRS)

    Norris, Jeffrey S.; Vona, Marsette A.; Rus, Daniela


    Graphical operator interface methods have been developed for modular, reconfigurable articulated surface systems in general, and a specific instantiation thereof for JPL's Tri-ATHLETE. The All- Terrain Hex-Limbed Extra-Terrestrial Explorer Robot (ATHLETE) has six limbs with six kinematic degrees of freedom each. The core advancement of this work was the development of a novel set of algorithms for dynamically maintaining a reduced coordinate model of any connected assembly of robot modules.

  13. Ambipolar Organic Tri-Gate Transistor for Low-Power Complementary Electronics.


    Torricelli, Fabrizio; Ghittorelli, Matteo; Smits, Edsger C P; Roelofs, Christian W S; Janssen, René A J; Gelinck, Gerwin H; Kovács-Vajna, Zsolt M; Cantatore, Eugenio


    Ambipolar transistors typically suffer from large off-current inherently due to ambipolar conduction. Using a tri-gate transistor it is shown that it is possible to electrostatically switch ambipolar polymer transistors from ambipolar to unipolar mode. In unipolar mode, symmetric characteristics with an on/off current ratio of larger than 10(5) are obtained. This enables easy integration into low-power complementary logic and volatile electronic memories. PMID:26573767

  14. The architecture of the spliceosomal U4/U6.U5 tri-snRNP

    PubMed Central

    Nguyen, Thi Hoang Duong; Galej, Wojciech P.; Bai, Xiao-chen; Savva, Christos G.; Newman, Andrew J.; Scheres, Sjors H. W.; Nagai, Kiyoshi


    U4/U6.U5 tri-snRNP is a 1.5 MDa pre-assembled spliceosomal complex comprising U5 snRNA, extensively base-paired U4/U6 snRNAs and >30 proteins, including the key components Prp8, Brr2 and Snu114. The tri-snRNP combines with a pre-mRNA substrate bound to U1 and U2 snRNPs and transforms into a catalytically active spliceosome following extensive compositional and conformational changes triggered by unwinding of the U4/U6 snRNAs. CryoEM single-particle reconstruction of yeast tri-snRNP at 5.9Å resolution reveals the essentially complete organization of its RNA and protein components. The single-stranded region of U4 snRNA between its 3′-stem-loop and the U4/U6 snRNA stem I is loaded into the Brr2 helicase active site ready for unwinding. Snu114 and the N-terminal domain of Prp8 position U5 snRNA to insert its Loop I, which aligns the exons for splicing, into the Prp8 active site cavity. The structure provides crucial insights into the activation process and the active site of the spliceosome. PMID:26106855

  15. Close-in blasting at the TRI-MET light rail tunnels in Portland, Oregon

    SciTech Connect

    Revey, G.F.; Painter, D.Z.


    Frontier/Traylor Joint Venture is presently constructing a section of the Tri-County Metropolitan Transit District of Oregon`s (TRI-MET) Westside Light Rail System. This new section will extend Portland`s existing transit system to the western suburbs of Beaverton and Hillsboro. The drill-blast excavations at this project include 10,000 feet of 20 foot tunnel, 18 cross passages, three shafts, an underground railway station, and a U-wall open cut. From a blast designer`s perspective, this job has been extremely challenging. Blast vibration is limited to 0.5 ips at 200 feet or at the nearest structure, and airblast is limited to 129 dB--linear peak and 96 dB--C scale. The tunnels pass under heavily built up areas and have top of tunnel to surface cover distances as low as 70 feet. Surface blasting in the 26,000 cubic yard U-wall excavation was limited to five short nighttime periods due to its proximity to the very busy highway 26. This paper describes the techniques that were used to develop safe blasting designs for the TRI-MET Surface blasts and tunnel rounds. It also discusses the measures that were necessary to mitigate noise, vibration, and flyrock.

  16. The Training and Research Institute for Residential Youth Centers, Inc. (TRI-RYC). Final Report, 1969-1970.

    ERIC Educational Resources Information Center

    Training and Research Inst. for Residential Youth Centers, Inc., New Haven, CT.

    This report describes and details the experiences of the Training and Research Institute for Residential Youth Centers (TRI-RYC) during its first year of operation. The TRI-RYC was established by the Department of Labor, Office of Special Manpower Programs, to provide a capability for initiating, training staff for, and evaluating the…

  17. The Targeted Reading Intervention (TRI): A Classroom Teacher Tier 2 Intervention to Help Struggling Readers in Early Elementary School

    ERIC Educational Resources Information Center

    Vernon-Feagans, Lynne; Amendum, Steve; Kainz, Kirsten; Ginsburg, Marnie


    The two studies presented in this report were designed to test the effectiveness of a new diagnostic-based reading intervention for classroom teachers, called the Targeted Reading Intervention (TRI). This TRI Tier 2 intervention stressed diagnostic teaching as the key to helping struggling readers make rapid progress in reading in the regular…

  18. Plasma immersion ion implantation for sub-22 nm node devices: FD-SOI and Tri-Gate

    SciTech Connect

    Duchaine, J.; Milesi, F.; Coquand, R.; Barraud, S.; Reboh, S.; Gonzatti, F.; Mazen, F.; Torregrosa, Frank


    Here, we present and discuss the electrical characteristics of fully depleted MOSFET transistors of planar and tridimensional architecture, doped by Plasma Immersion Ion Implantation (PIII) or Beam Line Ion Implantation (BLII). Both techniques delivered similar and satisfactory results in considering the planar architecture. For tri-dimensional Tri-Gate transistors, the results obtained with PIII are superior.

  19. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2014 CFR


    ... 33 Navigation and Navigable Waters 2 2014-07-01 2014-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator...

  20. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2012 CFR


    ... 33 Navigation and Navigable Waters 2 2012-07-01 2012-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator...

  1. 75 FR 24799 - Safety Zone; Tri-City Water Follies Hydroplane Races Practice Sessions, Columbia River, Kennewick...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Tri-City Water Follies Hydroplane Races..., Washington for hydroplane race practice sessions being held in preparation for the Tri-City Water Follies... provide for the safety of life and property on navigable waters. Under 5 U.S.C. 553(d)(3), the Coast...

  2. Mexican American First-Generation/Low-Income Students: A Rural Community College, TRiO Student Support Services Experience

    ERIC Educational Resources Information Center

    O'Meara, Daniel J.


    This study is an ethnographic inquiry into the beliefs and perceptions of first-generation/low-income Mexican American students in a rural community college located near the U.S.-Mexico border. It explored their experiences as TRiO Student Support Services participants. TRiO Student Support Services plays an increasingly vital role helping…

  3. 78 FR 17652 - Tri-State Generation and Transmission Association, Inc. v. Public Service Company of New Mexico...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Public Service... Energy Regulatory Commission (Commission), 18 CFR 385.206 and 18 CFR 385.212, Tri-State Generation...

  4. First analysis of eight Algol-type systems: V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri

    NASA Astrophysics Data System (ADS)

    Zasche, P.


    Analyzing available photometry from the Super WASP and other databases, we performed the very first light curve analysis of eight eclipsing binary systems V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri. All of these systems were found to be detached ones of Algol-type, having the orbital periods of the order of days. 722 new times of minima for these binaries were derived and presented, trying to identify the period variations caused by the third bodies in these systems.

  5. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    PubMed Central

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such “fume events”. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24–48 hours after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  6. An Effective Tri-Clustering Algorithm Combining Expression Data with Gene Regulation Information

    PubMed Central

    Li, Ao; Tuck, David


    Motivation Bi-clustering algorithms aim to identify sets of genes sharing similar expression patterns across a subset of conditions. However direct interpretation or prediction of gene regulatory mechanisms may be difficult as only gene expression data is used. Information about gene regulators may also be available, most commonly about which transcription factors may bind to the promoter region and thus control the expression level of a gene. Thus a method to integrate gene expression and gene regulation information is desirable for clustering and analyzing. Methods By incorporating gene regulatory information with gene expression data, we define regulated expression values (REV) as indicators of how a gene is regulated by a specific factor. Existing bi-clustering methods are extended to a three dimensional data space by developing a heuristic TRI-Clustering algorithm. An additional approach named Automatic Boundary Searching algorithm (ABS) is introduced to automatically determine the boundary threshold. Results Results based on incorporating ChIP-chip data representing transcription factor-gene interactions show that the algorithms are efficient and robust for detecting tri-clusters. Detailed analysis of the tri-cluster extracted from yeast sporulation REV data shows genes in this cluster exhibited significant differences during the middle and late stages. The implicated regulatory network was then reconstructed for further study of defined regulatory mechanisms. Topological and statistical analysis of this network demonstrated evidence of significant changes of TF activities during the different stages of yeast sporulation, and suggests this approach might be a general way to study regulatory networks undergoing transformations. PMID:19838334

  7. Integrated piezoelectric actuators in deep drawing tools to reduce the try-out

    NASA Astrophysics Data System (ADS)

    Neugebauer, Reimund; Mainda, Patrick; Kerschner, Matthias; Drossel, Welf-Guntram; Roscher, Hans-Jürgen


    Tool making is a very time consuming and expensive operation because many iteration loops are used to manually adjust tool components during the try-out process. That means that trying out deep drawing tools is 30% of the total costs. This is the reason why an active deep drawing tool was developed at the Fraunhofer Institute for Machine Tools and Forming Technology IWU in cooperation with Audi and Volkswagen to reduce the costs and production rates. The main difference between the active and conventional deep drawing tools is using piezoelectric actuators to control the forming process. The active tool idea, which is the main subject of this research, will be presented as well as the findings of experiments with the custom-built deep drawing tool. This experimental tool was designed according to production requirements and has been equipped with piezoelectric actuators that allow active pressure distribution on the sheet metal flange. The disposed piezoelectric elements are similar to those being used in piezo injector systems for modern diesel engines. In order to achieve the required force, the actuators are combined in a cluster that is embedded in the die of the deep drawing tool. One main objective of this work, i.e. reducing the time-consuming try-out-period, has been achieved with the experimental tool which means that the actuators were used to set static pressure distribution between the blankholder and die. We will present the findings of our analysis and the advantages of the active system over a conventional deep drawing tool. In addition to the ability of changing the static pressure distribution, the piezoelectric actuator can also be used to generate a dynamic pressure distribution during the forming process. As a result the active tool has the potential to expand the forming constraints to make it possible to manage forming restrictions caused by light weight materials in future.

  8. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers.


    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M; Nachon, Florian; Masson, Patrick; Furlong, Clement E; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such "fume events". Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  9. Uptake of tri-p-cresyl phosphate (TCP) in soybean plants

    SciTech Connect

    Casterline, J.L. Jr.; Ku, Y.; Barnett, N.M.


    Because of the possible release of TCP to the environment, this study was undertaken to determine the uptake and translocation of TCP by soybean plants, using pure tri-p-cresyl phosphate (TpCP) as a model compound. The authors wished to learn the propensity of TpCP to move into the food crops from the soil. This study was not concerned with phytotoxicity, but with the possibility of foods becoming contaminated with TCP through the use of sludge or waste-water on agricultural lands.

  10. Measurement of Creep on the Calaveras Fault at Coyote Dam using Terrestrial Radar Interferometry (TRI).

    NASA Astrophysics Data System (ADS)

    Baker, B.; Cassotto, R.; Fahnestock, M. A.; Werner, C. L.; Boettcher, M. S.


    The Calaveras fault in central California is part of the San Andreas fault system. Coyote Dam, an earthen dam that straddles the fault ~13km northeast of Gilroy, experiences creep style deformation that ranges from 10 to 15 mm/yr. Uncertainty in the location of the fault, coupled with the historic rate of deformation, affect the dam's safety factor. Assessing the impact of fault creep on the dam's stability is paramount to its safety evaluation, but is difficult to resolve due to limited spatial and temporal sampling of conventional methods. Terrestrial radar interferometry (TRI), like satellite-based observations, produces high spatial resolution maps of ground deformation. Unlike space-based sensors, TRI can be readily deployed and the observation geometry selected to get the maximum line of sight (LOS) signal. TRI also benefits from high temporal sampling which can be used to reduce errors related to atmospheric phase delays and high temporal sampling also facilitates tracking rapidly moving features such as landslides and glaciers. GAMMA Portable Radar Interferometer (GPRI) measurements of Coyote Dam rock faces were made from concrete piers built upstream and downstream of the dam. The GPRI operates at a radar frequency of 17.2 GHz with a spatial resolution at the dam of approximately 0.9 m x 2.0 m. Changes in LOS path length smaller than 0.1mm can be measured. Data were acquired approximately every 2 to 3 weeks over a 7-month period to map the fault trace through the dam faces. Our study exploits the dense record of observations obtained, and the relatively short distance of the radar to the dam to minimize atmospheric affects. We investigate how the deformation evolves in time and the orientation of fault through the dam, including the strike and dip as measured along the dam surface. Our results show rates consistent with GPS data and regional satellite observations, but produce a much more detailed map of the fault on the dam than possible with GPS or

  11. Dynamics of Leslie-Gower type generalist predator in a tri-trophic food web system

    NASA Astrophysics Data System (ADS)

    Priyadarshi, A.; Gakkhar, S.


    In this paper, the dynamics of a tri-trophic food web system consists of Leslie-Gower type generalist predator has been explored. The system is bounded under certain conditions. The Hopf-bifurcation has been established in the phase planes. The bifurcation diagrams exhibit coexistence of all three species in the form of periodic/chaotic solutions. The "snail-shell" chaotic attractor has very high Lyapunov exponents. The coexistence in the form of stable equilibrium is also possible for lower values of parameters. The two-parameter bifurcation diagrams are drawn for critical parameters.

  12. Studies on novel single crystals of tri-nitrophenol methyl p-hydroxybenzoate

    NASA Astrophysics Data System (ADS)

    Vesta, C.; Uthrakumar, R.; Vinitha, G.; Ramalingam, A.; Jerome Das, S.


    Good quality single crystal of tri-nitrophenol methyl p-hydroxybenzoate (TNMPHB) has been successfully grown from aqueous solution by a slow evaporation technique. Single-crystal X-ray diffraction analysis confirms that the crystal formed by crystallizing in triclinic system with space group P1¯ is of a new kind. The functional groups of the compound are confirmed qualitatively by FT-IR spectral analysis. An optical absorption study on this sample reveals the minimum absorption region is well suited for optical applications. Thermal analysis carried out on the compound reveals that the sample is stable up to 187 °C.

  13. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    SciTech Connect

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such 'fume events'. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. -- Highlights: Black-Right-Pointing-Pointer Travel on jet airplanes is associated with an illness, aerotoxic syndrome. Black-Right-Pointing-Pointer A possible cause is exposure to tricresyl

  14. Holmium Nitrate Complexation with Tri-n-butyl Phosphate in Supercritical Carbon Dioxide

    SciTech Connect

    Robert V. Fox; R. Duane Ball; Peter de B. Harrington; Harry W. Rollins; Chien M. Wai


    Holmium nitrate pentahydrate was reacted with tri-n-butyl phosphate in supercritical carbon dioxide at 308 K. The products of the complexation reaction were measured under supercritical fluid conditions using UV-vis spectroscopy. The solubility of the metal complexes in the supercritical fluid phase was measured. The mole-ratio titration method was used to determine the stoichiometry of the soluble complexes. Conditional extraction coefficients were calculated from spectral data using least-squares regression and hard-equilibria models. Data indicate that the holmium nitrate-tributyl phosphate system forms 1:2 and 1:4 holmium-tributyl phosphate complexes.

  15. The investigation of single, dual and tri-band frequency selective surface

    NASA Astrophysics Data System (ADS)

    Aziz, Mohamad Zoinol Abidin Abd.; Shukor, Mahfuzah Md.; Mustafa, Nur Hanim; Fauzi, Noor Azamiah Md; Ahmad, Badrul Hisham; Suaidi, Mohamad Kadim; Johar, Fauzi Mohd; Salleh, Siti Nadzirah; Azmin, Farah Ayuni; Malek, Mohd Fareq Abd.


    The single, dual and tri-band Frequency Selective Surface (FSS) design structure is designed and simulated by using CST Microwave Studio software. The reflection (S11) and transmission (S21) of the design FSS structure is analyzed based on the six types of configuration that have been set up. All configurations are simulated with the same size of the FSS design structure. The hybrid material (FR4 and glass) affects the transmission and reflection signals of the FSS which led to the compact structure. The measurement results are agreed for all FSS design structures but the difference is due to the transmission losses.

  16. Antimalarial Isocyano and Isothiocyanato Sesquiterpenes with Tri- and Bicyclic Skeletons from the Nudibranch Phyllidia ocellata.


    White, Andrew M; Pierens, Gregory K; Skinner-Adams, Tina; Andrews, Katherine T; Bernhardt, Paul V; Krenske, Elizabeth H; Mollo, Ernesto; Garson, Mary J


    Five new isocyano/isothiocyanato sesquiterpenes (1-5) with tri- or bicyclic carbon skeletons have been characterized from Australian specimens of the nudibranch Phyllidia ocellata. Spectroscopic analyses at 900 MHz were informed by DFT calculations. The 1S, 5S, 8R configuration of 2-isocyanoclovene (1) was determined by X-ray crystallographic analysis of formamide 6. A biosynthetic pathway to clovanes 1 and 2 from epicaryolane precursors is proposed. Isocyanides 1, 2, and 4 showed activity against Plasmodium falciparum (IC50 0.26-0.30 μM), while isothiocyanate 3 and formamide 6 had IC50 values of >10 μM. PMID:26056748

  17. Biological and chemical study of fused tri- and tetracyclic indazoles and analogues with important antiparasitic activity

    NASA Astrophysics Data System (ADS)

    Díaz-Urrutia, Christian A.; Olea-Azar, Claudio A.; Zapata, Gerald A.; Lapier, Michel; Mura, Francisco; Aguilera-Venegas, Benjamín; Arán, Vicente J.; López-Múñoz, Rodrigo A.; Maya, Juan D.

    A series of fused tri- and tetracyclic indazoles and analogues compounds (NID) with potential antiparasitic effects were studied using voltamperometric and spectroscopic techniques. Nitroanion radicals generated by cyclic voltammetry were characterized by electron spin resonance spectroscopy (ESR) and their spectral lines were explained and analyzed using simulated spectra. In addition, we examined the interaction between radical species generated from nitroindazole derivatives and glutathione (GSH). Biological assays such as activity against Trypanosoma cruzi and cytotoxicity against macrophages were carried out. Finally, spin trapping and molecular modeling studies were also done in order to elucidate the potentials action mechanisms involved in the trypanocidal activity.

  18. New Developments in TRI{mu}P and RIASH at KVI

    SciTech Connect

    Dendooven, P.


    The status of the TRI{mu}P facility at KVI is reviewed. Recent results on ion catcher devices are described. A thermo-ionizer for use with alkali and earth-alkali elements is close to completion. Concerning the use of superfluid helium as stopping medium, evidence that second sound pulses can be used to extract ions from the helium surface has been obtained. Based on the observation of highly efficient ion transport in helium, neon and argon gas below about 100 K, we propose the operation of noble gas ion catchers at cryogenic temperatures.

  19. Use of the TriSpan Coil to Facilitate the Transcatheter Occlusion of Pulmonary Arteriovenous Malformation

    SciTech Connect

    Cil, Barbaros E. E-mail:; Erdogan, Cueneyt; Akmangit, Ilkay; Cekirge, Saruhan; Balkanci, Ferhun


    Pulmonary arteriovenous malformation (PAVM) is a rare vascular malformation of the lung which may occur as an isolated entity or in association with hereditary hemorrhagic telangiectasia (HHT). Because of considerable risk of serious complications such as cerebral embolism, brain abscess and pulmonary hemorrhage, definitive treatment should be considered in most patients. Embolization with coils or detachable balloons is currently the preferred treatment. Paradoxical embolization of coils and balloons may happen, especially in patients with PAVMs with large feeding arteries. In this report we present our initial experience with the use of the TriSpan coil to lower the risk of coil migration during the transcatheter occlusion of PAVMs.

  20. Multiple-try Metropolis Hastings for modeling extreme PM10 data

    NASA Astrophysics Data System (ADS)

    Amin, Nor Azrita Mohd; Adam, Mohd Bakri; Ibrahim, Noor Akma


    Awareness of catastrophic events brings the attention to work out the relationship of these events by using statistical analysis of Extreme Value Theory (EVT). This study focused on extreme PM10 data using a Gumbel distribution which is one of the Extreme Value distributions. The parameters were estimated using the new Bayesian approach in extreme called Multiple Try Metropolis-Hastings algorithms. We compared this approach with another Markov Chain Monte Carlo approach which is the classical Metropolis-Hastings algorithm and the frequentist approach, Maximum Likelihood Estimation. It appears that these three approaches provide comparable results. Data are taken for Pasir Gudang station for year 1996 to 2010.

  1. Presumable Scenario of One of the Collinear Cluster Tri-Partition Modes

    NASA Astrophysics Data System (ADS)

    Pyatkov, Yu. V.; Kamanin, D. V.; Alexandrov, A. A.; Alexandrova, I. A.; Kondratyev, N. A.; Kuznetsova, E. A.; Jacobs, N.; Malaza, V.; Pham Minh, D.; Zhuchko, V. E.

    Collinear cluster tri-partition (CCT) channel in 252Cf(sf) was studied using COMETA apparatus. The setup consists of a double arm time of flight heavy ion spectrometer with two mosaic "stop" detectors. Also included in the setup is a neutron registration channel based on 3He filled counters. Specific CCT mode manifesting itself as a rectangular structure in the mass-mass plot of detected fragments was revealed both by neutron gating and direct detection of all three decay partners. Presumable scenario which stands behind the mode observed is discussed.

  2. Fabrication of Planar, Layered Nanoparticles Using Tri-layer Resist Templates

    PubMed Central

    Hu, Wei; Zhang, Mingliang; Wilson, Robert J.; Koh, Ai Leen; Wi, Jung-Sub; Tang, Mary; Sinclair, Robert; Wang, Shan X.


    A simple and universal pathway to produce free multilayer synthetic nanoparticles is developed based on lithography, vapor phase deposition and a tri-layer resist lift off and release process. The fabrication method presented in this work is ideal for production of a broad range of nanoparticles, either free in solution or still attached to an intact release layer, with unique magnetic, optical, radioactive, electronic and catalytic properties. Multi-modal capabilities are implicit in the layered architecture. As an example, directly fabricated magnetic nanoparticles are evaluated to illustrate the structural integrity of thin internal multilayers and the nanoparticle stability in aggressive biological environments, which is highly desired for biomedical applications. PMID:21415483

  3. Public report for options to make the Toxic Release Inventory (TRI) data base accessible to the public

    SciTech Connect

    Not Available


    This paper presents appropriate options for implementation of a publicly accessible Toxic Release Inventory (TRI) data base, analyzes and evaluates the costs and benefits of those options, and recommends one or more of the best alternatives for making the TRI data base available to the public. The analysis addresses only the data-base options. It does not address other means of public access to TRI data, e.g., printed versions of the data or Freedom of Information Act (FOIA) requests, other than to note the potential effect of other means on usage of the data base.

  4. Fabrication of C60 Tri-Diethyl Malonate Membrane via an Electrospinning Method and Its Antibacterial Property.


    Li, Hui; Chen, Shou; Peng, Xiaohua; Sun, Jiangning; Shu, Chunying; Jiang, Li; Wang, Chunru


    A homogeneous C60 tri-diethyl malonate membrane was fabricated by a facile electro-spinning method. Comprehensive characterizations of its assembling structure, such as SEM, TEM, TGA, UV-vis, and FTIR, were carried out. Different fullerene derivatives show different assembling characters during the electrospining process. Notably, C60 tri-diethyl malonate with close-knite structures can form a stable structure after removing the assistant polymer of PVP. The antibacterial experiments of C60 tri-diethyl malonate membrane were performed, and the results revealed that this membrane owns excellent antibacterial activity. PMID:27455662

  5. Effective detection method for falls according to the distance between two tri-axial accelerometers

    NASA Astrophysics Data System (ADS)

    Kim, Jae-Hyung; Park, Geun-Chul; Kim, Soo-Hong; Kim, Soo-Sung; Lee, Hae-Rim; Jeon, Gye-Rok


    Falls and fall-related injuries are a significant problem in the elderly population. A number of different approaches for detecting falls and activities of daily living (ADLs) have been conducted in recent years. However, distinguishing between real falls and certain fall-like ADL is often difficult. The aim of this study is to discriminate falls from fall-like ADLs such as jogging, jumping, and jumping down. The distance between two tri-axial accelerometers attached to the abdomen and the sternum was increased from 10 to 30 cm in 10-cm intervals. Experiments for falls and ADLs were performed to investigate the feasibility of the detection system for falls developed in this study. When the distances between the two tri-axial electrometers were 20 and 30 cm, fall-like ADLs were effectively distinguished from falls. The thresholds for three parameters — SVM, Diff Z, and Sum_diff_Z — were set; falls could be distinguished from ADL action sequences when the SVM value was larger than 4 g (TH1), the Diff_Z parameter was larger than 1.25 g (TH2), and the Sum_diff_Z parameter was larger than 15 m/s (TH3). In particular, when the SVM, Diff_Z, and Sum_diff_Z parameter were sequentially applied to thresholds (TH1, TH2, and TH3), fall-like ADL action sequences were accurately discriminated from falls.

  6. Biomechanical and metabolic responses to seat-tube angle variation during cycling in tri-athletes.


    Bisi, Maria Cristina; Ceccarelli, Mattia; Riva, Federico; Stagni, Rita


    One of the most physically demanding parts of triathlon is the transition from cycling to running. Many tri-athletes believe that increasing seat-tube angle (STA) can bring advantages in the following running part. The aim of this study was to evaluate the effects of inverting the support of the seat, for increasing STA, on the metabolic response and on the muscle activation pattern, maintaining a controlled kinematic. Moreover, a muscle-skeletal model was applied to evaluate the hypothesis that increasing STA changes force-producing capabilities of muscles crossing the hip. Ten tri-athletes cycled at two different power levels and with two different STA's. Gas exchange data, kinematics and surface electromyography (sEMG) were acquired during the tests. sEMG was measured from eight muscles of the right side of the body. A model of muscle mechanics and energy expenditure was applied to estimate variations of force production capabilities and muscle energy consumption between the two STA configurations. Inverting the support of the seat showed no significant effects on kinematic, Oxygen consumption, muscle activations and muscle power production capabilities. Nevertheless, an interesting advantage can be the tendency to less activate gastrocnemius and biceps femoris: this could lead to minor muscle fatigue during the following running phase. PMID:22595701

  7. Three coordination polymers based on different carboxylates, metals and a tri(4-imidazolylphenyl)amine ligand

    NASA Astrophysics Data System (ADS)

    Wu, Hua; Shi, Chenjie; Zhao, Yanqing; Jiang, Yutong; Tao, Yuehong


    In this paper, three new coordination complexes based on a flexible tri(4-imidazolylphenyl)amine (Tipa) ligand, namely [Co(Tipa)(L1)2]·H2O (1), [Zn2(Tipa)(L1)4(H2O)]·2H2O (2) and [Mn(Tipa)(L2)]·2H2O (3), where HL1 = benzoic acid H2L2 = 5-OH-1,3-benzenedicarboxylic acid and Tipa = tri(4-imidazolylphenyl)amine, have been synthesized under the hydrothermal condition and characterized by single-crystal X-ray diffraction, elemental analysis and IR spectra. Compound 1 exhibits a 1D ladder chain with the benzoic anions hanging on the two sides of the chain. For compound 2, it shows a fascinating 1D zigzag chain. Compound 3 displays (3,5)-connected (42·6)(42·67·8) topology, where the identical 2D networks entangle in highly rare parallel fashions to give a fascinating 2D → 3D framework with polycatenation and polyrotaxane characters. Moreover, the photoluminescent properties for the compounds 2 and 3 were also investigated.

  8. Hole trapping in tri- p-tolylamine-doped poly(styrene)

    NASA Astrophysics Data System (ADS)

    Borsenberger, P. M.; Gruenbaum, W. T.; Wolf, U.; Bässler, H.


    Hole mobilities have been measured in tri- p-tolylamine-doped poly(styrene) containing different concentrations of di- p-tolyl- p-anisylamine (DTA), di- p-anisyl- p-tolylamine (DAT), and tri- p-anisylamine (TAA). DTA, DAT and TAA are traps with depths of 0.08, 0.15 and 0.22 eV. The mobilities decrease with increasing trap concentration and trap depth while the field and temperature dependencies remain unchanged. The prefactor mobilities are independent of trap concentrations and depths. The results are discussed within the framework of the recent simulations of Wolf et al. The results are in good agreement and confirm the argument that for shallow trapping the basic phenomenology of transport, as revealed by the field and temperature dependencies of the mobility, remain unchanged. Quantitatively, the effects of traps can be accounted for by the replacement of the energy width of the hopping site manifold by an effective width whose square increases linearly with trap depth and the logarithm of the trap concentration.

  9. Wireless portable electrocardiogram and a tri-axis accelerometer implementation and application on sleep activity monitoring.


    Chang, Kang-Ming; Liu, Shin-Hong


    Night-to-night variability of sleep activity requires more home-based portable sleep monitoring instead of clinical polysomnography examination in the laboratory. In this article, a wireless sleep activity monitoring system is described. The system is light and small for the user. Sleep postures, such as supine or left/right side, were observed by a signal from a tri-axis accelerometer. An overnight electrocardiogram was also recorded with a single lead. Using an MSP430 as microcontroller, both physiological signals were transmitted by a Bluetooth chip. A Labview-based interface demonstrated the recorded signal and sleep posture. Three nights of sleep recordings were used to examine night-to-night variability. The proposed system can record overnight heart rate. Results show that sleep posture and posture change can be precisely detected via tri-axis accelerometer information. There is no significant difference within subject data sets, but there are statistically significant differences among subjects, both for heart rate and for sleep posture distribution. The wireless transmission range is also sufficient for home-based users. PMID:21413872

  10. Two new polytypes of 2,4,6-tri­bromo­benzo­nitrile

    PubMed Central

    Britton, Doyle; Noland, Wayland E.; Tritch, Kenneth J.


    Three polymorphs of 2,4,6-tri­bromo­benzo­nitrile (RCN), C7H2Br3N, two of which are novel and one of which is a redetermination of the original structure first determined by Carter & Britton [(1972). Acta Cryst. B28, 945–950] are found to be polytypic. Each has a layer structure which differs only in the stacking of the layers. Each layer is composed of mol­ecules associated through C N⋯Br contacts which form R 2 2(10) rings. Two such rings are associated with each N atom; one with each ortho-Br atom. No new polytypes of 1,3,5-tri­bromo-2-iso­cyano­benzene (RNC) were found but a re-determination of the original structure by Carter et al. [(1977). Cryst. Struct. Commun. 6, 543–548] is presented. RNC was found to be isostructural with one of the novel polytypes of RCN. Unit cells were determined for 23 RCN samples and 11 RNC samples. Polytypes could not be distinguished based on crystal habits. In all four structures, each mol­ecule of the asymmetric unit lies across a mirror plane. PMID:26958382

  11. Along the Ta Diffusion Path Through a Boron and Oxygen Containing Tri-layer Structure

    NASA Astrophysics Data System (ADS)

    Ying, Ji-Feng; Ji, Rong; Wang, Chen Chen; Ter Lim, Sze; Xie, Huiqing; Gerard, Ernult F.


    Diffusion and migration of elements are commonly observed in the fabrication of multilayer thin-film devices, including those of STT-RAM. The CoFeB/MgO/CoFeB tri-layer thin-film stack has been widely used in the design of STT-RAM devices as the functional magnetic-tunnel-junction (MTJ) structure. Such issues faced in the fabrication of these devices have been extensively researched from the stand point of engineering the materials property and structure to achieve the best MTJ performance. In this work, we conducted a detailed examination of the chemical-state change of the Ta and B in a CoFeB/MgO/CoFeB/Ta film stack by using x-ray photoelectron spectroscopy (XPS) and time-of-flight secondary ion mass spectrometry. We showed that the chemical-state change of Ta and B is a result of the Ta diffusion phenomena through the CoFeB/MgO/CoFeB tri-layer structure. In particular, we report the evidences of the formation of TaB x O y compound at some considerable depth away from the Ta layer. Also of value to XPS spectroscopy, the Ta binding energy for such TaB x O y compound is reported for the first time.

  12. The transverse space-charge force in tri-gaussian distribution

    SciTech Connect

    Ng, K.Y.; /Fermilab


    In tracking, the transverse space-charge force can be represented by changes in the horizontal and vertical divergences, {Delta}x{prime} and {Delta}y{prime} at many locations around the accelerator ring. In this note, they are going to list some formulas for {Delta}x{prime} and {delta}y{prime} arising from space-charge kicks when the beam is tri-Gaussian distributed. They will discuss separately a flat beam and a round beam. they are not interested in the situation when the emittance growth arising from space charge becomes too large and the shape of the beam becomes weird. For this reason, they can assume the bunch still retains its tri-Gaussian distribution, with its rms sizes {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} increasing by certain factors. Thus after each turn, {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} can be re-calculated.

  13. A Tri-part Model for Genetics Literacy: Exploring Undergraduate Student Reasoning About Authentic Genetics Dilemmas

    NASA Astrophysics Data System (ADS)

    Shea, Nicole A.; Duncan, Ravit Golan; Stephenson, Celeste


    Genetics literacy is becoming increasingly important as advancements in our application of genetic technologies such as stem cell research, cloning, and genetic screening become more prevalent. Very few studies examine how genetics literacy is applied when reasoning about authentic genetic dilemmas. However, there is evidence that situational features of a reasoning task may influence how students apply content knowledge as they generate and support arguments. Understanding how students apply content knowledge to reason about authentic and complex issues is important for considering instructional practices that best support student thinking and reasoning. In this conceptual report, we present a tri-part model for genetics literacy that embodies the relationships between content knowledge use, argumentation quality, and the role of situational features in reasoning to support genetics literacy. Using illustrative examples from an interview study with early career undergraduate students majoring in the biological sciences and late career undergraduate students majoring in genetics, we provide insights into undergraduate student reasoning about complex genetics issues and discuss implications for teaching and learning. We further discuss the need for research about how the tri-part model of genetics literacy can be used to explore students' thinking and reasoning abilities in genetics.

  14. Tri-Metal Layered Semitransparent Electrode for Red Phosphorescent Organic Light-Emitting Diodes.


    Lee, Jae Woo; Lee, Ho Won; Lee, Song Eun; Yang, Hyung Jin; Lee, Sung Kyu; Hwang, Kyo Min; Park, Soo Na; Yoon, Seung Soo; Kim, Young Kwan


    In this paper, we fabricated tri-metal layered thin film semitransparent electrodes consisting of a thin conductive metal layer, sandwiched between two nickel layers. An equal red phosphorescent organic light-emitting diode (PHOLED) structure was deposited on the anodes of indium tin oxide (ITO) and three types of tri-metal layers (Ni/Al/Ni, Ni/Cu/Ni, and Ni/Ag/Ni, thickness of 3/7/3 nm in common) on a glass substrate. The optical and electrical performances of the device using Ni/Ag/Ni were improved more than the performances of the other devices due to the micro-cavity effect in accordance with the various electrode characteristics. Moreover, we fabricated the same red PHOLED structures on a flexible substrate, as a consequence, showed competitive emission characteristics compared to the devices fabricated on a glass substrate. Therefore, this study could succeed to additional research on flexible display panel and light-emitting devices with ITO-free electrodes. PMID:26726477

  15. Application of a tri-axial accelerometer to estimate jump frequency in volleyball.


    Jarning, Jon M; Mok, Kam-Ming; Hansen, Bjørge H; Bahr, Roald


    Patellar tendinopathy is prevalent among athletes, and most likely associated with a high jumping load. If methods for estimating jump frequency were available, this could potentially assist in understanding and preventing this condition. The objective of this study was to explore the possibility of using peak vertical acceleration (PVA) or peak resultant acceleration (PRA) measured by an accelerometer to estimate jump frequency. Twelve male elite volleyball players (22.5 ± 1.6 yrs) performed a training protocol consisting of seven typical motion patterns, including jumping and non-jumping movements. Accelerometer data from the trial were obtained using a tri-axial accelerometer. In addition, we collected video data from the trial. Jump-float serving and spike jumping could not be distinguished from non-jumping movements using differences in PVA or PRA. Furthermore, there were substantial inter-participant differences in both the PVA and the PRA within and across movement types (p < 0.05). These findings suggest that neither PVA nor PRA measured by a tri-axial accelerometer is an applicable method for estimating jump frequency in volleyball. A method for acquiring real-time estimates of jump frequency remains to be verified. However, there are several alternative approaches, and further investigations are needed. PMID:25902964

  16. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV.


    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad


    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability. PMID:27171084

  17. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV

    PubMed Central

    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad


    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability. PMID:27171084

  18. Transient thermal analysis of a tri-axial HTS cable on fault current condition

    NASA Astrophysics Data System (ADS)

    Hu, N.; Cao, K.; Wang, D.; Song, M.; Miyagi, D.; Tsuda, M.; Hamajima, T.


    High-temperature superconducting (HTS) tri-axial cable, which consists of three concentric phases, was developed as a potential commercial solution for next generation distribution power network. In our previous research, we simulate the transient thermal behavior of the cable by solving the heat equation using one-dimension difference method. The result shows that it takes time to recover the cable temperature to the steady-state operation level due to a low thermal conductivity of the insulation layer after a fault. However for a long cable system, when middle phase in concentric structure is rated under an over current, accumulated heat from middle phase might continually warm up the liquid nitrogen (LN2) flow by heat transfer even the over current has been stopped. In this research, we improve the numerically calculation which includes the consideration of flowing liquid nitrogen and the heat transfer in both radius and longitudinal directions. A long tri-axial cable system thermal stability is discussed based on the calculation results.

  19. Estimating activity-related energy expenditure under sedentary conditions using a tri-axial seismic accelerometer.


    van Hees, Vincent T; van Lummel, Rob C; Westerterp, Klaas R


    Activity-related energy expenditure (AEE) is difficult to quantify, especially under sedentary conditions. Here, a model was developed using the detected type of physical activity (PA) and movement intensity (MI), based on a tri-axial seismic accelerometer (DynaPort MiniMod; McRoberts B.V., The Hague, the Netherlands), with energy expenditure for PA as a reference. The relation between AEE (J/min/kg), MI, and the type of PA was determined for standardized PAs as performed in a laboratory including: lying, sitting, standing, and walking. AEE (J/min/kg) was calculated from total energy expenditure (TEE) and sleeping metabolic rate (SMR) as assessed with indirect calorimetry ((TEEx0.9)-SMR). Subsequently, the model was validated over 23-h intervals in a respiration chamber. Subjects were 15 healthy women (age: 22+/-2 years; BMI: 24.0+/-4.0 kg/m2). Predicted AEE in the chamber was significantly related to measured AEE both within (r2=0.81+/-0.06, P<0.00001) and between (r2=0.70, P<0.001) subjects. The explained variation in AEE by the model was higher than the explained variation by MI alone. This shows that a tri-axial seismic accelerometer is a valid tool for estimating AEE under sedentary conditions. PMID:19282829

  20. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2010 CFR


    ... responsible parties (PRPs). After you ask them for payment, you should give PRPs 60 days either to pay you, express their intent to pay you, or indicate willingness to negotiate. You must also try to get...

  1. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2011 CFR


    ... responsible parties (PRPs). After you ask them for payment, you should give PRPs 60 days either to pay you, express their intent to pay you, or indicate willingness to negotiate. You must also try to get...

  2. The insula modulates arousal-induced reluctance to try novel tastes through adrenergic transmission in the rat

    PubMed Central

    Rojas, Sebastián; Diaz-Galarce, Raúl; Jerez-Baraona, Juan Manuel; Quintana-Donoso, Daisy; Moraga-Amaro, Rodrigo; Stehberg, Jimmy


    Reluctance to try novel tastes (neophobia) can be exacerbated in arousing situations, such as when children are under social stress or in rodents, when the new taste is presented in a high arousal context (HA) compared to a low arousal context (LA). The present study aimed at determining whether adrenergic transmission at the Insula regulates the reluctance to try novel tastes induced by arousing contexts. To this end, a combination of systemic and intra-insular manipulations of adrenergic activity was performed before the novel taste (saccharin 0.1%) was presented either in LA or HA contexts in rats. Our results show that systemic adrenergic activity modulates reluctance to try novel tastes. Moreover, intra-insular microinjections of propranolol or norepinephrine (NE) were found to modulate the effects of arousing contexts on reluctance to try novel tastes. Finally, intra-insular propranolol blocked epinephrine-induced increased reluctance, while intra-insular NE blocked oral propranolol-induced decreases in reluctance and increased the reluctance to try novel tastes presented in low arousing contexts. In conclusion, our results suggest that the insula is a critical site for regulating the effects of arousal in the reluctance to try novel tastes via the adrenergic system. PMID:26175672

  3. Generation of BiKEs and TriKEs to Improve NK Cell-Mediated Targeting of Tumor Cells.


    Felices, Martin; Lenvik, Todd R; Davis, Zachary B; Miller, Jeffrey S; Vallera, Daniel A


    Cancer immunotherapies have gained significant momentum over the past decade, particularly with the advent of checkpoint inhibitors and CAR T-cells. While the latter personalized targeted immunotherapy has revolutionized the field, a need for off-the-shelf therapies remains. The ability of NK cells to quickly lyse antibody-coated tumors and potently secrete cytokines without prior priming has made NK cells ideal candidates for antigen-specific immunotherapy. NK cells have been targeted to tumors through two main strategies: mono-specific antibodies and bi/tri-specific antibodies. Mono-specific antibodies drive NK cell antibody-dependent cell-mediated cytotoxicity (ADCC) of tumor cells. Bi/tri-specific antibodies drive re-directed lysis of tumor cells through binding of a tumor antigen and direct binding and crosslinking of the CD16 receptor on NK cells, thus bypassing the need for binding of the Fc portion of mono-specific antibodies. This chapter focuses on the generation of bi- and tri-specific killer engagers (BiKEs and TriKEs) meant to target NK cells to tumors. BiKEs and TriKEs are smaller molecules composed of 2-3 variable portions of antibodies with different specificities, and represent a novel and more versatile strategy compared to traditional bi- and tri-specific antibody platforms. PMID:27177679

  4. Tri-band optical coherence tomography for lipid and vessel spectroscopic imaging

    NASA Astrophysics Data System (ADS)

    Yu, Luoqin; Kang, Jiqiang; Wang, Xie; Wei, Xiaoming; Chan, Kin-Tak; Lee, Nikki P.; Wong, Kenneth K. Y.


    Optical coherence tomography (OCT) has been utilized for various functional imaging applications. One of its highlights comes from spectroscopic imaging, which can simultaneously obtain both morphologic and spectroscopic information. Assisting diagnosis and therapeutic intervention of coronary artery disease is one of the major directions in spectroscopic OCT applications. Previously Tanaka et al. have developed a spectral domain OCT (SDOCT) to image lipid distribution within blood vessel [1]. In the meantime, Fleming et al. have demonstrated optical frequency domain imaging (OFDI) by a 1.3-μm swept source and quadratic discriminant analysis model [2]. However, these systems suffered from burdensome computation as the optical properties' variation was calculated from a single-band illumination that provided limited contrast. On the other hand, multi-band OCT facilitates contrast enhancement with separated wavelength bands, which further offers an easier way to distinguish different materials. Federici and Dubois [3] and Tsai and Chan [4] have demonstrated tri-band OCT systems to further enhance the image contrast. However, these previous work provided under-explored functional properties. Our group has reported a dual-band OCT system based on parametrically amplified Fourier domain mode-locked (FDML) laser with time multiplexing scheme [5] and a dual-band FDML laser OCT system with wavelength-division multiplexing [6]. Fiber optical parametric amplifier (OPA) can be ideally incorporated in multi-band spectroscopic OCT system as it has a broad amplification window and offers an additional output range at idler band, which is phase matched with the signal band. The sweeping ranges can thus overcome traditional wavelength bands that are limited by intra-cavity amplifiers in FDML lasers. Here, we combines the dual-band FDML laser together with fiber OPA, which consequently renders a simultaneous tri-band output at 1.3, 1.5, and 1.6 μm, for intravascular applications

  5. When It Hurts (and Helps) to Try: The Role of Effort in Language Learning

    PubMed Central

    Finn, Amy S.; Lee, Taraz; Kraus, Allison; Hudson Kam, Carla L.


    Compared to children, adults are bad at learning language. This is counterintuitive; adults outperform children on most measures of cognition, especially those that involve effort (which continue to mature into early adulthood). The present study asks whether these mature effortful abilities interfere with language learning in adults and further, whether interference occurs equally for aspects of language that adults are good (word-segmentation) versus bad (grammar) at learning. Learners were exposed to an artificial language comprised of statistically defined words that belong to phonologically defined categories (grammar). Exposure occurred under passive or effortful conditions. Passive learners were told to listen while effortful learners were instructed to try to 1) learn the words, 2) learn the categories, or 3) learn the category-order. Effortful learners showed an advantage for learning words while passive learners showed an advantage for learning the categories. Effort can therefore hurt the learning of categories. PMID:25047901

  6. Analysis of a stochastic tri-trophic food-chain model with harvesting.


    Liu, Meng; Bai, Chuanzhi


    We consider a tri-trophic stochastic food-chain model with harvesting. We first establish critical values between persistence in mean and extinction for each species. The results show that persistence and extinction of a species only depends on the demographic impacts of environmental stochasticity on the species and species at lower tropic levels; however, the mean abundance of a species depends on the impacts of environmental stochasticity at all trophic levels. Then we consider stability in distribution of the model. Finally, we provide a necessary and sufficient condition for existence of optimal harvesting strategy and give the optimal harvesting effort and maximum of sustainable yield. The results show that the optimal harvesting strategy is closely related to the stochastic noises in the model. PMID:26846770

  7. Growth of bi- and tri-layered graphene on silicon carbide substrate via molecular dynamics simulation

    NASA Astrophysics Data System (ADS)

    Min, Tjun Kit; Lim, Thong Leng; Yoon, Tiem Leong


    Molecular dynamics (MD) simulation with simulated annealing method is used to study the growth process of bi- and tri-layered graphene on a 6H-SiC (0001) substrate via molecular dynamics simulation. Tersoff-Albe-Erhart (TEA) potential is used to describe the inter-atomic interactions among the atoms in the system. The formation temperature, averaged carbon-carbon bond length, pair correlation function, binding energy and the distance between the graphene formed and the SiC substrate are quantified. The growth mechanism, graphitization of graphene on the SiC substrate and characteristics of the surface morphology of the graphene sheet obtained in our MD simulation compare well to that observed in epitaxially grown graphene experiments and other simulation works.

  8. The measurement of tri-linear gauge boson couplings at e+e- colliders

    NASA Astrophysics Data System (ADS)

    Couture, Gilles; Gintner, Mikuláš; Godfrey, Stephen


    We describe a detailed study of the process e+e-→lvlqq¯ and the measurement of tri-linear gauge boson couplings (TGV's) at LEP200 and at a 500 GeV and 1 TeV NLC. We included all tree level Feynman diagrams contributing to the four-fermion final states including gauge boson widths and non-resonance contributions. We employed a maximum likelihood analysis of a five dimensional differential cross section of angular distributions. This approach appears to offer an optimal strategy for measurement of TGV's. LEP200 will improve existing measurements of TGV's but not enough to see loop contributions of new physics. Measurements at the NLC will be roughly 2 orders of magnitude more precise which would probe the effects of new physics at the loop level.

  9. Digital TV tri-state delta modulation system for Space Shuttle ku-band downlink

    NASA Technical Reports Server (NTRS)

    Udalov, S.; Huth, G. K.; Roberts, D.; Batson, B. H.


    A tri-state delta modulation/demodulation (TSDM) technique which provides for efficient run-length coding of constant-intensity segments of a TV picture is described. Aspects of the hardware implementation of a high-speed TSDM transmitter and receiver for black-and-white TV or field-sequential color or NTSC format color are reviewed. Run-length encoding of the TSDM output can consistently reduce the required channel data rate well below one bit per sample. As compared with a bistate delta modulation system, the present technique eliminates granularity in the reconstructed video without degrading rise or fall times. About 40 chips are used by TSDM when used to handle the luminance information in a color link. A possible overall space and ground functional configuration to accommodate Shuttle digital TV with scrambling for privacy is presented.

  10. ASC Tri-lab Co-design Level 2 Milestone Report 2015

    SciTech Connect

    Hornung, Rich; Jones, Holger; Keasler, Jeff; Neely, Rob; Pearce, Olga; Hammond, Si; Trott, Christian; Lin, Paul; Vaughan, Courtenay; Cook, Jeanine; Hoekstra, Rob; Bergen, Ben; Payne, Josh; Womeldorff, Geoff


    In 2015, the three Department of Energy (DOE) National Laboratories that make up the Advanced Sci- enti c Computing (ASC) Program (Sandia, Lawrence Livermore, and Los Alamos) collaboratively explored performance portability programming environments in the context of several ASC co-design proxy applica- tions as part of a tri-lab L2 milestone executed by the co-design teams at each laboratory. The programming environments that were studied included Kokkos (developed at Sandia), RAJA (LLNL), and Legion (Stan- ford University). The proxy apps studied included: miniAero, LULESH, CoMD, Kripke, and SNAP. These programming models and proxy-apps are described herein. Each lab focused on a particular combination of abstractions and proxy apps, with the goal of assessing performance portability using those. Performance portability was determined by: a) the ability to run a single application source code on multiple advanced architectures, b) comparing runtime performance between \

  11. Behaviorally plastic host-plant use by larval Lepidoptera in tri-trophic food webs.


    Singer, Michael S


    Plant-insect interactions research emphasizes adaptive plasticity of plants and carnivores, such as parasitoids, implying a relatively passive role of herbivores. Current work is addressing this deficit, with exciting studies of behavioral plasticity of larval Lepidoptera (caterpillars). Here I use select examples to illustrate the diversity of behaviorally plastic host-plant use by caterpillars, including anti-predator tactics, self-medication, and evasion of dynamic plant defenses, as proof of the agency of caterpillar behavior in plant-insect interactions. I emphasize the significance of adaptive behavioral plasticity of caterpillars in the context of tri-trophic interactions. Recent research on trait-mediated indirect interactions places adaptive behavioral plasticity of herbivores at the center of community and food web dynamics, with far-reaching consequences of issues such as community stability. PMID:27436647

  12. Tri-State Generation and Transmission Association's Springverville unit 3 earns POWER's highest honor

    SciTech Connect

    Peltier, R.


    It is said that pioneers take the arrows. In the case of Springerville Unit 3 - a 418 MW(net) expansion of a Tucson Electric Power facility in Arizona and the first pulverized coal-fired units built in the US in more than decade, the arrows were many. Although Tri-State (the developer), Tuscon Electric (the host), and Bechtel Power (the EPC contractor) were wounded by delayed deliveries of major equipment, bankruptcy of a major supplier, and a labor shortage, the companies showed their pioneering spirit and completed the project ahead of schedule. For ushering in a new generation of clean and desperately needed baseload capacity, Springerville Unit 3 is POWER magazine's 2006 Plant of the Year. 9 figs.

  13. STS-96 M.S. Tokarev tries gas mask as part of a TCDT

    NASA Technical Reports Server (NTRS)


    STS-96 Mission Specialist Valery Ivanovich Tokarev, with the Russian Space Agency, tries on an oxygen gas mask during Terminal Countdown Demonstration Test (TCDT) activities at Launch Pad 39B. The TCDT provides the crew with simulated countdown exercises, emergency egress training and opportunities to inspect the mission payloads in the orbiter's payload bay. Other crew members taking part in the TCDT are Commander Kent V. Rominger, Pilot Rick Douglas Husband, and Mission Specialists Tamara E. Jernigan (Ph.D.), Daniel Barry (M.D., Ph.D.), Ellen Ochoa (Ph.D.) and Julie Payette, with the Canadian Space Agency. Scheduled for liftoff on May 20 at 9:32 a.m., STS-96 is a logistics and resupply mission for the International Space Station, carrying such payloads as a Russian crane, the Strela; a U.S.-built crane; the Spacehab Oceaneering Space System Box (SHOSS), a logistics items carrier; and STARSHINE, a student-led experiment.

  14. Adaptive sliding mode control of tri-layer conjugated polymer actuators

    NASA Astrophysics Data System (ADS)

    Wang, Xiangjiang; Alici, Gursel; Nguyen, Chuc Huu


    This paper proposes an adaptive sliding mode control methodology to enhance the positioning ability of conducting polymer actuators typified by tri-layer conjugated polymer actuators. This is motivated by the search for an effective control strategy to command such actuators to a desired configuration in the presence of parametric uncertainties and unmodeled disturbances. After analyzing the stability of the adaptive sliding mode control system, experiments were conducted to demonstrate its satisfactory tracking ability, based on a series of experimental results. Implementation of the control law requires a valid model of the conducting polymer actuator and boundaries of the uncertainties and disturbances. Based on the theoretical and experimental results presented, the adaptive sliding mode control methodology is very attractive in the field of smart actuators which contain significant uncertainties and disturbances.

  15. Tri And Rot Effects In Ternary Fission: What Can Be Learned?

    NASA Astrophysics Data System (ADS)

    Gönnenwein, F.; Gagarski, A.; Petrov, G.; Guseva, I.; Zavarukhina, T.; Mutterer, M.; von Kalben, J.; Kopatch, Yu.; Tiourine, G.; Trzaska, W.; Sillanpäa, M.; Soldner, T.; Nesvizhevsky, V.


    Inducing fission by polarized neutrons allows studying subtle effects of the dynamics of the process. In the present experiments ternary fission of 235U and 239Pu was investigated with cold neutrons in the (n,f) reaction at the Institut Laue-Langevin, Grenoble. Asymmetries in the emission of ternary particles were discovered by making use of the neutron spin flipping. It was found that two effects are interfering. There is first an asymmetry in the total yields of ternary particles having been called the TRI-effect. Second, it was observed that the angular distributions of ternary particles are shifted back and forth when flipping the neutron spin. This shift was named ROT effect. Guided by trajectory calculations of the three-body decay, the signs and sizes of the ROT effect are interpreted in terms of the K-numbers of the transition states at the saddle point of fission.

  16. Crystal structure of bromido-nitro-syl-bis(tri-phenyl-phosphane-κP)nickel(II).


    Hockley, Rose; Irshad, Hira; Sheriff, Tippu S; Motevalli, Majid; Marinakis, Sarantos


    The asymmetric unit of the title complex, [NiBr(NO){P(C6H5)3}2], comprises two independent mol-ecules each with a similar configuration. The Ni(II) cation is coordinated by one bromide anion, one nitrosyl anion and two tri-phenyl-phosphane mol-ecules in a distorted BrNP2 tetra-hedral coordination geometry. The coordination of the nitrosyl group is non-linear, the Ni-N-O angles being 150.2 (5) and 151.2 (5)° in the two independent mol-ecules. In the crystal, mol-ecules are linked by weak C-H⋯Br hydrogen bonds and weak C-H⋯π inter-actions into a three-dimensional supra-molecular architecture. PMID:26029415

  17. Experimental study of time-dependent dielectric breakdown in tri-gate nanowire transistor

    NASA Astrophysics Data System (ADS)

    Ota, Kensuke; Tanaka, Chika; Numata, Toshinori; Matsushita, Daisuke; Saitoh, Masumi


    We systematically investigate the size dependence of the time-dependent dielectric breakdown (TDDB) in a tri-gate nanowire transistor (NW Tr.). It is newly found that TDDB reliability is degraded in NW Tr. as compared with that in a planar transistor owing to the locally enhanced electric field at the NW corner. Moreover, in the region with a width (W) less than 40 nm, nanowire width reduction leads to a shorter time to gate dielectric breakdown indicating additional degradation of TDDB reliability in NW Tr. with smaller W. Although TDDB in three-dimensional (3D) MOS structures such as a trench MOS capacitor has already been reported, the size dependence of TDDB in scaled NW Tr. is firstly discussed in this paper since a trench capacitor is different from recent NW Tr. in structure, device size, gate dielectric thickness, and scaling effect on TDDB.

  18. Tri-band transparent cross-polarization converters using a chiral metasurface

    NASA Astrophysics Data System (ADS)

    Shi, Hong-Yu; Li, Jian-Xing; Zhang, An-Xue; Wang, Jia-Fu; Xu, Zhuo


    A chiral metasurface is proposed to realize a tri-band polarization angle insensitive cross-polarization converter. The unit cell of the chiral metamaterial is composed by four twisted anisotropic structure pairs in four-fold rotation symmetry. The simulation results show that this device can work at 9.824 GHz, 11.39 GHz, and 13.37 GHz with low loss and a high polarization conversion ratio (PCR) of more than 99%. The proposed design can transmit the co-polarization wave at 14.215 GHz, like a frequency selective surface. The study of the current and electric fields distributions indicates that the cross-polarization transmission is due to electric dipole coupling.

  19. Measurement of Few Body Interactions in Tri-Atomic Molecular Dissociation into Three Charged Particles

    NASA Astrophysics Data System (ADS)

    Mueller, Dennis; Jordon-Thaden, Brandon; Weise, Lisa; Jaecks, Duane


    Threshold ionization of atoms by electron impact remains an area of interest. Near threshold, where the total energy of the system is approximately zero, the motion of charged particles is highly correlated. Similarly, near threshold dissociation into three or more charges particles is involve highly correlated motion as the particles slowly move apart under the influence of the long-range Coulomb interaction. We will present a novel approach to gain insight into these interactions, where no simplifying approximations such as placing one of the particles near the center-of-mass, is theoretically viable. In these triple coincidence experiments, the final state momenta of all particles are measured with sub-meV resolution sufficient to resolve rovibrational levels. This allows us to determine the initial state of the tri-atomic molecular ion.

  20. 1-nm-thick graphene tri-layer as the ultimate copper diffusion barrier

    SciTech Connect

    Nguyen, Ba-Son; Lin, Jen-Fin


    We demonstrate the thinnest ever reported Cu diffusion barrier, a 1-nm-thick graphene tri-layer. X-ray diffraction patterns and Raman spectra show that the graphene is thermally stable at up to 750 °C against Cu diffusion. Transmission electron microscopy images show that there was no inter-diffusion in the Cu/graphene/Si structure. Raman analyses indicate that the graphene may have degraded into a nanocrystalline structure at 750 °C. At 800 °C, the perfect carbon structure was damaged, and thus the barrier failed. The results of this study suggest that graphene could be the ultimate Cu interconnect diffusion barrier.

  1. Midterm survivorship of a press-fit, plasma-sprayed, tri-spike acetabular component.


    Klaassen, Mark A; Martínez-Villalobos, Mario; Pietrzak, William S; Mangino, Gerardo P; Guzman, Delfino Carranza


    Press-fit acetabular cups without screw holes can limit migration of particulate wear debris and reduce risk of acetabular osteolysis and device loosening. The Tri-Spike cup (Biomet, Inc, Warsaw, Ind) includes a titanium alloy plasma spray porous surface and does not require screw fixation. We retrospectively examined the incidence of cup loosening and acetabular osteolysis after implantation of 45 cups (44 patients) with mean follow-up of 7.3 years (range, 4-9 years). Only one patient (one cup) had evidence of less than 1 mm of retroacetabular radiolucency at 3 years (nonprogressive), which was found to remain firmly fixed during revision of the aseptically loosened femoral component. No cups were removed or revised at latest follow-up. Projected Kaplan-Meier survivorship at 9 years was 100% for cup loosening/revision and 97.8% for radiolucency. PMID:18534453

  2. Growth of bi- and tri-layered graphene on silicon carbide substrate via molecular dynamics simulation

    SciTech Connect

    Min, Tjun Kit; Yoon, Tiem Leong; Lim, Thong Leng


    Molecular dynamics (MD) simulation with simulated annealing method is used to study the growth process of bi- and tri-layered graphene on a 6H-SiC (0001) substrate via molecular dynamics simulation. Tersoff-Albe-Erhart (TEA) potential is used to describe the inter-atomic interactions among the atoms in the system. The formation temperature, averaged carbon-carbon bond length, pair correlation function, binding energy and the distance between the graphene formed and the SiC substrate are quantified. The growth mechanism, graphitization of graphene on the SiC substrate and characteristics of the surface morphology of the graphene sheet obtained in our MD simulation compare well to that observed in epitaxially grown graphene experiments and other simulation works.

  3. Emergence of collective modes and tri-dimensional structures from epithelial confinement

    NASA Astrophysics Data System (ADS)

    Deforet, M.; Hakim, V.; Yevick, H. G.; Duclos, G.; Silberzan, P.


    Many in vivo processes, including morphogenesis or tumour maturation, involve small populations of cells within a spatially restricted region. However, the basic mechanisms underlying the dynamics of confined cell assemblies remain largely to be deciphered and would greatly benefit from well-controlled in vitro experiments. Here we show that confluent epithelial cells cultured on finite population-sized domains, exhibit collective low-frequency radial displacement modes as well as stochastic global rotation reversals. A simple mathematical model, in which cells are described as persistent random walkers that adapt their motion to that of their neighbours, captures the essential characteristics of these breathing oscillations. As these epithelia mature, a tri-dimensional peripheral cell cord develops at the domain edge by differential extrusion, as a result of the additional degrees of freedom of the border cells. These results demonstrate that epithelial confinement alone can induce morphogenesis-like processes including spontaneous collective pulsations and transition from 2D to 3D.

  4. The Navy's role in the vacuum tube electronics program. I - The tri-Service program

    NASA Astrophysics Data System (ADS)

    Parker, Robert K.; Abrams, Richard H.


    A unified program for the development of vacuum tube electronics based on tri-Service needs to take advantage of existing technical opportunities is discussed. Attention is given to two high-risk, high-payoff-investment areas, namely, wideband RF amplifiers based on gated electron emitters, such as field-emitter arrays, and second-generation fast-wave amplifiers for mm-wave radar. Second-generation fast-wave amplifiers utilize advances in second-generation gyroamplifier technology. The microwave power module program is discussed. This program supports the development of a supercomponent that integrates a solid-state driver, a vacuum electronic power booster and power conditioning to support shared-aperture array applications at affordable costs. The role of industry, academia, and government are addressed.

  5. Crystal structure of phenyl 2,4,5-tri­chloro­benzene­sulfonate

    PubMed Central

    Riley, Sean; Staples, Richard J.; Biros, Shannon M.; Ngassa, Felix N.


    The title compound, C12H7Cl3O3S, was synthesized via a nucleophilic substitution reaction between phenol and 2,4,5-tri­chloro­benzene­sulfonyl chloride. The two aryl rings are oriented gauche to one another around the sulfonate S—O bond, with a C—S—O—C torsion angle of −70.68 (16)°, and the two rings are inclined to one another by 72.40 (7)°. In the crystal, mol­ecules are linked via various C—Cl⋯π inter­actions, forming ribbons propagating along [100]. Neighboring ribbons are linked by a weak C—Cl⋯π inter­action, forming layers parallel to (010). PMID:27308043

  6. Semiclassical description of TRI asymmetry in ternary fission induced by cold polarized neutrons

    SciTech Connect

    Bunakov, V. E.; Kadmensky, S. G.


    The possibility of semiclassically describing T-even TRI-type asymmetry in ternary fission induced by polarized neutrons is considered on the basis of employing Coriolis interaction that takes into account the coupling of a light charged particle to the collective rotation of a polarized fissile nucleus. It is shown that allowance for this interaction makes it possible to explain qualitatively the magnitudes of two asymmetry effects observed in light-charge-particle emission both within the semiclassical and within the quantum-mechanical approach. The difference in the relative magnitudes and signs of the effects between different target nuclei is associated with the interference contributions to the cross section from neighboring neutron resonances and therefore cannot be explained within the semiclassical approach.

  7. A comparison of methods to detect postural transitions using a single tri-axial accelerometer.


    Godfrey, Alan; Barry, Gillian; Mathers, John C; Rochester, Lynn


    Two algorithms for evaluating postural transitions (PTs) in cohorts of 40 healthy younger and 40 older adults are described and evaluated. The time of sit-to-stand (SiSt) and stand-to-sit (StSi) transitions and their duration were measured with two tri-axial accelerometers, one on the chest and one on the lower back. Each algorithm was optimized for these sensor placements. The first algorithm for sensor placement on the chest used a scalar product and vertical velocity estimates. The second algorithm for sensor placement on the lower back used a vector magnitude and a discrete wavelet transform. Both algorithms performed excellently in PT classification for younger and older adults (>86%). However, the chest based sensor and algorithm were better for estimating transition duration (TD) with ICCs to video analysis ranging from 0.678 to 0.969. PMID:25571421

  8. Asymptotic stability of tri-trophic food chains sharing a common resource.


    Vrkoč, Ivo; Křivan, Vlastimil


    One of the key results of the food web theory states that the interior equilibrium of a tri-trophic food chain described by the Lotka-Volterra type dynamics is globally asymptotically stable whenever it exists. This article extends this result to food webs consisting of several food chains sharing a common resource. A Lyapunov function for such food webs is constructed and asymptotic stability of the interior equilibrium is proved. Numerical simulations show that as the number of food chains increases, the real part of the leading eigenvalue, while still negative, approaches zero. Thus the resilience of such food webs decreases with the number of food chains in the web. PMID:26498384

  9. Crystal structure of benzyl­tri­phenyl­phospho­nium chloride monohydrate

    PubMed Central

    Ahmad, Jimmy; Abdul Halim, Siti Nadiah; How, Fiona N.-F.


    The title compound, Ph3(PhCH2)P+·Cl−·H2O, was obtained unintentionally as the product of an attempted synthesis of a silver di­thio­carbamate complex using benzyl­tri­phenyl­phospho­nium as the counter-ion. The asymmetric unit consists of a phospho­nium cation and a chloride anion, and a water mol­ecule of crystallization. In the crystal, the chloride ion is linked to the water mol­ecule by an O—H⋯Cl hydrogen bond. The three units are further linked via C—H⋯Cl and C—H⋯O hydrogen bonds and C—H⋯ π inter­actions, forming a three-dimensional structure. PMID:26090195

  10. The effects of compressive sensing on extracted features from tri-axial swallowing accelerometry signals

    NASA Astrophysics Data System (ADS)

    Sejdić, Ervin; Movahedi, Faezeh; Zhang, Zhenwei; Kurosu, Atsuko; Coyle, James L.


    Acquiring swallowing accelerometry signals using a comprehensive sensing scheme may be a desirable approach for monitoring swallowing safety for longer periods of time. However, it needs to be insured that signal characteristics can be recovered accurately from compressed samples. In this paper, we considered this issue by examining the effects of the number of acquired compressed samples on the calculated swallowing accelerometry signal features. We used tri-axial swallowing accelerometry signals acquired from seventeen stroke patients (106 swallows in total). From acquired signals, we extracted typically considered signal features from time, frequency and time-frequency domains. Next, we compared these features from the original signals (sampled using traditional sampling schemes) and compressively sampled signals. Our results have shown we can obtain accurate estimates of signal features even by using only a third of original samples.

  11. Characterization of cadmium selenide electrodeposited from diethylene glycol solution containing tri-n-butylphosphine selenide

    SciTech Connect

    Sanders, B.W.; Cocivera, M.


    Thin film cadmium selenide has been prepared by a new electrochemical process in which the film is deposited at the cathode from a nonaqueous solution containing tri-n-butylphosphine selenide as the selenium source. The films are found to be less dense than those prepared using selenosulfite ion. The as-deposited films appear free of cracks and pinholes when deposited on titanium, but cracks develop when the films are annealed. A stoichiometric composition is obtained for the film over a 0.4V potential range. Power conversion efficiencies for films prepared under a variety of conditions range from 1.0 to 4.2% for surface areas ca. 1.0 cm/sup 2/. The presence of large concentrations of chloride ion in the deposition solution seems to have little effect on the composition or photoresponse of the film. Diethylene glycol appears to be a better solvent than propylene carbonate for this deposition process.

  12. Tri-City Herald OpEd: Electric Vehicles are a smart choice

    SciTech Connect

    Christensen, Peter C.; Haas, Anne M.


    Why are so many of us at the Pacific Northwest National Laboratory, a national thought leader in power industry issues located right here in the Tri-Cities, so bullish on the future of EVs? And why do we think it's so important that this country, especially THIS part of the country, be leaders in the adoption of EVs? Is it that we all just happen to like driving polluting golf carts? The answer is that, like most everyone else, most of us here at PNNL drive to work every day, and like most people, we care about the cost of gasoline and the impact that burning imported oil has on the environment and on our foreign policy. The reality is that electric vehicles are simply more efficient, pollute much less, use locally-generated energy, and cost MUCH less to drive.

  13. Age and fertility: can women wait until their early thirties to try for a first birth?


    McDonald, John W; Rosina, Alessandro; Rizzi, Ester; Colombo, Bernardo


    Postponing the start of childbearing raises the question of fertility postponed versus fertility foregone. One of the limitations of previous studies of 'How late can you wait?' is that any observed decline in the probability of conception with age could be due to a decline in fecundability with age or due to a decline in coital frequency with age or due to both factors. Using data from a multinational longitudinal study conducted to determine the daily probability of conception among healthy subjects, a discrete-time event history model with long-term survivors (sterile population) is used to study the relationship between age and fecundability for childless women, while controlling for the pattern of intercourse within a menstrual cycle. The findings suggest that women can wait until their early thirties to try for a first birth, providing that they are not already sterile, as the magnitude of the decline in fecundability is very modest and of little practical importance. PMID:21944061

  14. Toxic Release Inventory (TRI), Idaho, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  15. Toxic Release Inventory (TRI), Nebraska, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  16. Toxic Release Inventory (TRI), Michigan, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  17. Toxic Release Inventory (TRI), California, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  18. Toxic Release Inventory (TRI), Mssissippi, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  19. Toxic Release Inventory (TRI), Louisiana, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  20. Toxic Release Inventory (TRI), Vermont, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  1. Toxic Release Inventory (TRI), Tennessee, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  2. Toxic Release Inventory (TRI), Missouri, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  3. Toxic Release Inventory (TRI), Kansas, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off-site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  4. Toxic Release Inventory (TRI), Washington, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  5. Toxic Release Inventory (TRI), Massachusetts, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  6. Toxic Release Inventory (TRI), Alabama, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year.Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  7. Toxic Release Inventory (TRI), Kentucky, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off-site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  8. Toxic Release Inventory (TRI), Florida, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  9. Toxic Release Inventory (TRI), Colorado, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  10. Toxic Release Inventory (TRI), Utah, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  11. Toxic Release Inventory (TRI), Maine, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  12. Toxic Release Inventory (TRI), Georgia, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  13. Toxic Release Inventory (TRI), Pennsylvania, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility; the first nine digit alphanumeric number a facility holds under the National Pollutant Discharge Elimination Systems.

  14. Toxic Release Inventory (TRI), Montana, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  15. Toxic Release Inventory (TRI), Arkansas, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  16. Toxic Release Inventory (TRI), Hawaii, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  17. Toxic Release Inventory (TRI), Oklahoma, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  18. Toxic Release Inventory (TRI), Delaware, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  19. Toxic Release Inventory (TRI), Arizona, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  20. Toxic Release Inventory (TRI), Texas, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  1. Toxic Release Inventory (TRI), Wisconsin, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  2. Toxic Release Inventory (TRI), Wyoming, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  3. Toxic Release Inventory (TRI), Oregon, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  4. Toxic Release Inventory (TRI), Alaska, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year.Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  5. Toxic Release Inventory (TRI), Maryland, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  6. Toxic Release Inventory (TRI), Minnesota, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  7. Toxic Release Inventory (TRI), Indiana, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  8. Toxic Release Inventory (TRI), Connecticut, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility; the first nine digit alphanumeric number a facility holds under the National Pollutant Discharge Elimination Systems.

  9. Toxic Release Inventory (TRI), Illinois, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  10. Toxic Release Inventory (TRI), Iowa, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99- 499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  11. Toxic Release Inventory (TRI), Ohio, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  12. Toxic Release Inventory (TRI), Nevada, 1991 and 1992 (in Dbase III plus) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment for the area indicated. Section 313 of the Emergency Planning and Community Right-to- Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. With this information, States and communities, working with industrial facilities required to comply with this law, will be better able to protect public health and the environment. The TRI data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. Beginning with the 1991 reports, facilities also are required to provide information about pollution prevention and source reduction activities. New data elements include quantities of the listed chemical recycled and used for energy recovery on-site; quanties transferred off- site for recycling and energy recovery. Source reduction activities, and methods used to indentify those activities. All releases are in pounds per year. Also provided is the FIPS code corresponding to the facility state and county; the unique ID number assigned by Dun and Bradstreet to the parent company of the reporting facility as well as the name of the corporation or other business entity that owns or controls the reporting facility.

  13. [Tri-Level Infrared Spectroscopic Identification of Hot Melting Reflective Road Marking Paint].


    Li, Hao; Ma, Fang; Sun, Su-qin


    In order to detect the road marking paint from the trace evidence in traffic accident scene, and to differentiate their brands, we use Tri-level infrared spectroscopic identification, which employs the Fourier transform infrared spectroscopy (FTIR), the second derivative infrared spectroscopy(SD-IR), two-dimensional correlation infrared spectroscopy(2D-IR) to identify three different domestic brands of hot melting reflective road marking paints and their raw materials in formula we Selected. The experimental results show that three labels coatings in ATR and FTIR spectrograms are very similar in shape, only have different absorption peak wave numbers, they have wide and strong absorption peaks near 1435 cm⁻¹, and strong absorption peak near 879, 2955, 2919, 2870 cm⁻¹. After enlarging the partial areas of spectrograms and comparing them with each kind of raw material of formula spectrograms, we can distinguish them. In the region 700-970 and 1370-1 660 cm⁻¹ the spectrograms mainly reflect the different relative content of heavy calcium carbonate of three brands of the paints, and that of polyethylene wax (PE wax), ethylene vinyl acetate resin (EVA), dioctyl phthalate (DOP) in the region 2800-2960 cm⁻¹. The SD-IR not only verify the result of the FTIR analysis, but also further expand the microcosmic differences and reflect the different relative content of quartz sand in the 512-799 cm-1 region. Within the scope of the 1351 to 1525 cm⁻¹, 2D-IR have more significant differences in positions and numbers of automatically peaks. Therefore, the Tri-level infrared spectroscopic identification is a fast and effective method to distinguish the hot melting road marking paints with a gradually improvement in apparent resolution. PMID:26964206

  14. Advanced oxidation kinetics of aqueous tri alkyl phosphate flame retardants and plasticizers

    PubMed Central

    Watts, Michael J.; Linden, Karl G.


    Tri alkyl phosphate esters are a class of anthropogenic organics commonly found in surface waters of Europe and North America, due to their frequent application as flame retardants, plasticizers, and solvents. Four tri alkyl phosphate esters were evaluated to determine second-order rates of reaction with ultraviolet- and ozone-generated •OH in water. In competition with nitrobenzene in UV irradiated hydrogen peroxide solutions tris(2-butoxyethyl) phosphate (TBEP) was fastest to react with •OH (kOH,TBEP=1.03×1010 M-1s-1), followed sequentially by tributyl phosphate (TBP), tris(2-chloroethyl) phosphate (TCEP), and tris(2-chloroisopropyl) phosphate (TCPP) (kOH,TBEP=6.40×109, kOH,TBEP=5.60×108, & kOH,TBEP=1.98×10 M-1s-1). A two-stage process was used to test the validity of the determined kOH for TBEP and the fastest reacting halogenated alkyl phosphate, TCEP. First, •OH oxidation of TCEP and TBEP, in competition with nitrobenzene, was measured in ozonated hydrogen peroxide solutions. Applying multiple regression analysis, it was determined that the UV-H2O2 and O3-H2O2 data sets were statistically identical for each compound. The subsequent validated kOH were used to predict TCEP and TBEP photodegradation in neutral pH, model surface water after chemical oxidant addition and UV irradiation (up to 1000 mJ/cm2). The insignificant difference, between the predicted TBEP and TCEP photodegradation and a best-fit of the first-order exponential decay function to the observed TBEP and TCEP concentrations with increasing UV fluence, was further evidence of the validity of the determined kOH. TBEP oxidation rates were similar in the surface waters tested. Substantial TCEP oxidation in the model surface water required a significant increase in H2O2. PMID:19475974

  15. Tri-party underground symbiosis between a weevil, bacteria and a desert plant.


    Shelef, Oren; Helman, Yael; Friedman, Ariel-Leib-Leonid; Behar, Adi; Rachmilevitch, Shimon


    Inhabitants of arid ecosystems face severe nitrogen and water limitations. Inventive adaptations by organisms occupying such habitats are essential for survival. This study describes a tri-party symbiotic interaction between a plant (Salsola inermis), a beetle (Conorhynchus pistor), and a bacterium (Klebsiella pneumonia). The weevil survives by living within a mud structure affixed to the plant roots, thus benefiting from increased carbon and water, and refuge from predators and parasites. Active nitrogen-fixing bacteria harbored within the weevil's gut mediate this interaction, by supplying nitrogen to the system, which eventually promotes seed development. We studied the correlation between the weevil's existence and (i) root carbon and nitrogen content, (ii) soil water content and (iii) seed weight. Roots hosting weevils contained more nitrogen, heavier seeds and less carbon. In addition, water content was higher around the roots than in open spaces a short distance from the plant stem. Bacterial studies and nitrogen-fixation analyses, including molecular and chemical assays, indicated atmospheric nitrogen fixation in the larval stage and identified the bacterium. The coexistence of weevil and bacterial behavior coinciding with the plant's life cycle was revealed here by a long period of field observations. Out of over 60,000 known weevils, this is the only report of a weevil living most of its life underground without harming plants. The unique tri-party interaction described herein shows the important ecological role of desert plant roots and provides an example of a sustainable consortium of living organisms coping with the challenging desert environment. PMID:24244267

  16. Health risk assessment of exposure to TriCresyl Phosphates (TCPs) in aircraft: a commentary.


    de Ree, Hans; van den Berg, Martin; Brand, Teus; Mulder, Gerard J; Simons, Ries; Veldhuijzen van Zanten, Brinio; Westerink, Remco H S


    Possible exposure to TriCresyl Phosphates (TCPs) has led to concerns among airline crew members. One isomer, Tri-ortho-Cresyl Phosphate (ToCP) is known to be neurotoxic and exposure to ToCP via contaminated cabin air has been suggested to be associated with the alleged Aerotoxic syndrome. The symptoms associated with Aerotoxic syndrome are diverse, including headaches, loss of balance, numbness and neurobehavioral abnormalities such as emotional instability, depression and cognitive dysfunction. Other ortho-isomers are toxic as well, but the non-ortho isomers are regarded as less toxic. In a collaborative effort to increase insight into the possible association between exposure to TCPs via contaminated cabin air and Aerotoxic syndrome, we performed an exposure- and toxicological risk assessment. Measurements in KLM 737 aircraft have demonstrated the presence of non-ortho isomers in low concentrations, though ToCP and other ortho-isomers could not be detected. Based on this exposure assessment, we established a toxicological risk model that also takes into account human differences in bioactivation and detoxification to derive a hazard quotient. From this model it appears unlikely that the health effects and alleged Aerotoxic syndrome are due to exposure to ToCP. Alternative explanations for the reported symptoms are discussed, but evaluation of the current findings in light of the criteria for occupational disease leads to the conclusion that the Aerotoxic Syndrome cannot be regarded as such. Additional research is thus required to unravel the underlying causes for the reported health complaints. PMID:25193069

  17. Auto-DR and Pre-cooling of Buildings at Tri-City Corporate Center

    SciTech Connect

    Yin, Rongxin; Xu, Peng; Kiliccote, Sila


    Over the several past years, Lawrence Berkeley National Laboratory (LBNL) has conducted field tests for different pre-cooling strategies in different commercial buildings within California. The test results indicated that pre-cooling strategies were effective in reducing electric demand in these buildings during peak periods. This project studied how to optimize pre-cooling strategies for eleven buildings in the Tri-City Corporate Center, San Bernardino, California with the assistance of a building energy simulation tool -- the Demand Response Quick Assessment Tool (DRQAT) developed by LBNL's Demand Response Research Center funded by the California Energy Commission's Public Interest Energy Research (PIER) Program. From the simulation results of these eleven buildings, optimal pre-cooling and temperature reset strategies were developed. The study shows that after refining and calibrating initial models with measured data, the accuracy of the models can be greatly improved and the models can be used to predict load reductions for automated demand response (Auto-DR) events. This study summarizes the optimization experience of the procedure to develop and calibrate building models in DRQAT. In order to confirm the actual effect of demand response strategies, the simulation results were compared to the field test data. The results indicated that the optimal demand response strategies worked well for all buildings in the Tri-City Corporate Center. This study also compares DRQAT with other building energy simulation tools (eQUEST and BEST). The comparison indicate that eQUEST and BEST underestimate the actual demand shed of the pre-cooling strategies due to a flaw in DOE2's simulation engine for treating wall thermal mass. DRQAT is a more accurate tool in predicting thermal mass effects of DR events.

  18. Tri-Party Underground Symbiosis between a Weevil, Bacteria and a Desert Plant

    PubMed Central

    Shelef, Oren; Helman, Yael; Friedman, Ariel-Leib-Leonid; Behar, Adi; Rachmilevitch, Shimon


    Inhabitants of arid ecosystems face severe nitrogen and water limitations. Inventive adaptations by organisms occupying such habitats are essential for survival. This study describes a tri-party symbiotic interaction between a plant (Salsola inermis), a beetle (Conorhynchus pistor), and a bacterium (Klebsiella pneumonia). The weevil survives by living within a mud structure affixed to the plant roots, thus benefiting from increased carbon and water, and refuge from predators and parasites. Active nitrogen-fixing bacteria harbored within the weevil's gut mediate this interaction, by supplying nitrogen to the system, which eventually promotes seed development. We studied the correlation between the weevil's existence and (i) root carbon and nitrogen content, (ii) soil water content and (iii) seed weight. Roots hosting weevils contained more nitrogen, heavier seeds and less carbon. In addition, water content was higher around the roots than in open spaces a short distance from the plant stem. Bacterial studies and nitrogen-fixation analyses, including molecular and chemical assays, indicated atmospheric nitrogen fixation in the larval stage and identified the bacterium. The coexistence of weevil and bacterial behavior coinciding with the plant's life cycle was revealed here by a long period of field observations. Out of over 60,000 known weevils, this is the only report of a weevil living most of its life underground without harming plants. The unique tri-party interaction described herein shows the important ecological role of desert plant roots and provides an example of a sustainable consortium of living organisms coping with the challenging desert environment. PMID:24244267

  19. Taste education reduces food neophobia and increases willingness to try novel foods in school children

    PubMed Central

    Park, Bo-Kyung


    BACKGROUND/OBJECTIVES This study measured the effects of a taste education program developed in Korea on food neophobia and willingness to try novel foods in school children. SUBJECTS/METHODS One-hundred and twenty school children (aged 7-9 years) residing in Seoul participated in 12 sessions of a taste education program for 3 months. The Korean taste education program was adapted from "Les classes du goût" by J. Puisais and modified to suit a Korean education environment. The study subjected school children to pre- and post-programs on food neophobia and willingness to try novel foods (WTNF), in addition to children's food neophobia in their parents. A total of 101 survey data were analyzed using SPSS 18.0. RESULTS Regarding the effects of taste education, scores of food neophobia significantly decreased (P < 0.01) in the posttest, mean (m) score (4.10 ± 1.19) decreased compared to the pretest (4.39 ± 1.00), and WTNF significantly increased (P < 0.001) in the pretest (m) score (0.48 ± 0.33) compared to the pretest (0.32 ± 0.34). This result indicates verification of the study hypothesis. CONCLUSIONS Food neophobia scale (FNS), an index that measures personal food preference [12], showed a very weak correlation with behavioral willingness to taste novel foods (WTNF). Therefore, it is expected that the two scales measure different things. However, considering that the traits of food neophobia are not easily changed, the taste education program was administered in a remarkably effective manner. PMID:27087907

  20. Vasorelaxation Study and Tri-Step Infrared Spectroscopy Analysis of Malaysian Local Herbs

    PubMed Central

    Tan, Chu Shan; Loh, Yean Chun; Ahmad, Mariam; Zaini Asmawi, Mohd.; Yam, Mun Fei


    Objectives: The aim of this paper is to investigate the activities of Malaysian local herbs (Clinacanthus nutans Lindau, Strobilanthes crispus, Murdannia bracteata, Elephantopus scaber Linn., Pereskia bleo, Pereskia grandifolia Haw., Vernonia amygdalina, and Swietenia macrophylla King) for anti-hypertensive and vasorelaxant activity. An infrared (IR) macro-fingerprinting technique consisting of conventional fourier transform IR (FTIR), second-derivative IR (SD-IR), and two-dimensional correlation IR (2D-correlation IR) analyses were used to determine the main constituents and the fingerprints of the Malaysian local herbs. Methods: The herbs were collected, ground into powder form, and then macerated by using three different solvents: distilled water, 50% ethanol, and 95% ethanol, respectively. The potentials of the extracts produced from these herbs for use as vasorelaxants were determined. Additionally, the fingerprints of these herbs were analyzed by using FTIR spectra, SD-IR spectra, and 2D-correlation IR spectra in order to identify their main constituents and to provide useful information for future pharmacodynamics studies. Results: Swietenia macrophylla King has the highest potential in terms of vasorelaxant activity, followed by Vernonia amygdalina, Pereskia bleo, Strobilanthes crispus, Elephantopus scaber Linn., Pereskia grandifolia Haw., Clinacanthus nutans Lindau, and Murdannia bracteata. The tri-step IR macro-fingerprint of the herbs revealed that most of them contained proteins. Pereskia bleo and Pereskia grandifolia Haw. were found to contain calcium oxalate while Swietenia macrophylla King was found to contain large amounts of flavonoids. Conclusion: The flavonoid content of the herbs affects their vasorelaxant activity, and the tri-step IR macro- fingerprint method can be used as an analytical tool to determine the activity of a herbal medicine in terms of its vasorelaxant effect. PMID:27386148

  1. Endocardial left ventricle feature tracking and reconstruction from tri-plane trans-esophageal echocardiography data

    NASA Astrophysics Data System (ADS)

    Dangi, Shusil; Ben-Zikri, Yehuda K.; Cahill, Nathan; Schwarz, Karl Q.; Linte, Cristian A.


    Two-dimensional (2D) ultrasound (US) has been the clinical standard for over two decades for monitoring and assessing cardiac function and providing support via intra-operative visualization and guidance for minimally invasive cardiac interventions. Developments in three-dimensional (3D) image acquisition and transducer design and technology have revolutionized echocardiography imaging enabling both real-time 3D trans-esophageal and intra-cardiac image acquisition. However, in most cases the clinicians do not access the entire 3D image volume when analyzing the data, rather they focus on several key views that render the cardiac anatomy of interest during the US imaging exam. This approach enables image acquisition at a much higher spatial and temporal resolution. Two such common approaches are the bi-plane and tri-plane data acquisition protocols; as their name states, the former comprises two orthogonal image views, while the latter depicts the cardiac anatomy based on three co-axially intersecting views spaced at 600 to one another. Since cardiac anatomy is continuously changing, the intra-operative anatomy depicted using real-time US imaging also needs to be updated by tracking the key features of interest and endocardial left ventricle (LV) boundaries. Therefore, rapid automatic feature tracking in US images is critical for three reasons: 1) to perform cardiac function assessment; 2) to identify location of surgical targets for accurate tool to target navigation and on-target instrument positioning; and 3) to enable pre- to intra-op image registration as a means to fuse pre-op CT or MR images used during planning with intra-operative images for enhanced guidance. In this paper we utilize monogenic filtering, graph-cut based segmentation and robust spline smoothing in a combined work flow to process the acquired tri-plane TEE time series US images and demonstrate robust and accurate tracking of the LV endocardial features. We reconstruct the endocardial LV

  2. 77 FR 43591 - Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River Energy, LLC; Notice of Filing

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Energy Regulatory Commission Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River... North Country Ethanol (Tri-State), and Red River Energy, LLC (Red River) filed an application, pursuant....P. in Richland County, North Dakota, to the Tri- State's ethanol facility near Rosholt, in...

  3. 75 FR 25310 - Port Harbor Railroad, Inc.-Lease and Operation Exemption-Line of Tri-City Regional Port District

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Surface Transportation Board Port Harbor Railroad, Inc.--Lease and Operation Exemption--Line of Tri-City Regional Port District Port Harbor Railroad, Inc. (Port Harbor), a noncarrier, has filed a verified notice of exemption under 49 CFR 1150.31 to lease from Tri- City Regional Port District (Tri-City), and...

  4. Identification of the third/extra allele for forensic application in cases with TPOX tri-allelic pattern.


    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; da Motta, Carlos Henrique Ares Silveira; Rodenbusch, Rodrigo; Gusmão, Leonor; Alho, Clarice Sampaio


    Genotyping of polymorphic short tandem repeats (STRs) loci is widely used in forensic DNA analysis. STR loci eventually present tri-allelic pattern as a genotyping irregularity and, in that situation, the doubt about the tri-allele locus frequency calculation can reduce the analysis strength. In the TPOX human STR locus, tri-allelic genotypes have been reported with a widely varied frequency among human populations. We investigate whether there is a single extra allele (the third allele) in the TPOX tri-allelic pattern, what it is, and where it is, aiming to understand its genomic anatomy and to propose the knowledge of this TPOX extra allele from genetic profile, thus preserving the two standard TPOX alleles in forensic analyses. We looked for TPOX tri-allelic subjects in 75,113 Brazilian families. Considering only the parental generation (mother+father) we had 150,226 unrelated subjects evaluated. From this total, we found 88 unrelated subjects with tri-allelic pattern in the TPOX locus (0.06%; 88/150,226). Seventy three of these 88 subjects (73/88; 83%) had the Clayton's original Type 2 tri-allelic pattern (three peaks of even intensity). The remaining 17% (15/88) show a new Type 2 derived category with heterozygote peak imbalance (one double dose peak plus one regular sized peak). In this paper we present detailed data from 66 trios (mother+father+child) with true biological relationships. In 39 of these families (39/66; 59%) the extra TPOX allele was transmitted either from the mother or from the father to the child. Evidences indicated the allele 10 as the extra TPOX allele, and it is on the X chromosome. The present data, which support the previous Lane hypothesis, improve the knowledge about tri-allelic pattern of TPOX CODIS' locus allowing the use of TPOX profile in forensic analyses even when with tri-allelic pattern. This evaluation is now available for different forensic applications. PMID:25549886

  5. A direct regulatory interaction between chaperonin TRiC and stress-responsive transcription factor HSF1.


    Neef, Daniel W; Jaeger, Alex M; Gomez-Pastor, Rocio; Willmund, Felix; Frydman, Judith; Thiele, Dennis J


    Heat shock transcription factor 1 (HSF1) is an evolutionarily conserved transcription factor that protects cells from protein-misfolding-induced stress and apoptosis. The mechanisms by which cytosolic protein misfolding leads to HSF1 activation have not been elucidated. Here, we demonstrate that HSF1 is directly regulated by TRiC/CCT, a central ATP-dependent chaperonin complex that folds cytosolic proteins. A small-molecule activator of HSF1, HSF1A, protects cells from stress-induced apoptosis, binds TRiC subunits in vivo and in vitro, and inhibits TRiC activity without perturbation of ATP hydrolysis. Genetic inactivation or depletion of the TRiC complex results in human HSF1 activation, and HSF1A inhibits the direct interaction between purified TRiC and HSF1 in vitro. These results demonstrate a direct regulatory interaction between the cytosolic chaperone machine and a critical transcription factor that protects cells from proteotoxicity, providing a mechanistic basis for signaling perturbations in protein folding to a stress-protective transcription factor. PMID:25437552

  6. A synthetic strategy to xylose-containing thioglycoside tri- and tetrasaccharide building blocks corresponding to Cryptococcus neoformans capsular polysaccharide structures.


    Guazzelli, Lorenzo; Ulc, Rebecca; Rydner, Lina; Oscarson, Stefan


    As part of an ongoing project aimed at developing vaccine candidates against Cryptococcus neoformans the preparation of tri- and tetrasaccharide thioglycoside building blocks, to be used in construction of structurally defined part structures of C. neoformans GXM capsular polysaccharide, was investigated. Using a naphthalenylmethyl (NAP) ether as a temporary protecting group and trichloroacetimidate donors in optimized glycosylations the target building blocks, ethyl 6-O-acetyl-2,4-di-O-benzyl-3-O-(2-naphthalenylmethyl)-α-D-mannopyranosyl-(1→3)-[2,3,4-tri-O-benzyl-β-D-xylopyranosyl-(1→2)]-4,6-di-O-benzyl-1-thio-α-D-mannopyranoside (16) and ethyl 2,3,4-tri-O-benzyl-β-D-xylopyranosyl-(1→2)-4,6-di-O-benzyl-3-O-(2-naphthalenylmethyl)-α-D-mannopyranosyl-(1→3)-[2,3,4-tri-O-benzyl-β-D-xylopyra-nosyl-(1→2)]-6-O-acetyl-4-O-benzyl-1-thio-α-D-mannopyranoside (21), were efficiently prepared. These synthesized thiosaccharide building blocks were then used as donors in high-yielding (~90%) DMTST promoted glycosylations to a spacer-containing acceptor to, after deprotection, afford GXM polysaccharide part structures ready for protein conjugation to give vaccine candidates. Also, the NAP groups in the building blocks were removed to obtain tri- and tetrasaccharide acceptors suitable for further elongation towards larger thiosaccharide building blocks. PMID:25986781

  7. Synthesis, Structure, and Reactivity ofbis(1,2,4-tri-t-butylcyclopentadienyl) Complexes of Cerium

    SciTech Connect

    Werkema, Evan L.


    The sterically demanding 1,2,4-tri-t-butylcyclopentadienylligand (1,2,4-(Me3C)3C5H2, hereafter Cp') has been used to preparemonomeric cerium metallocenes, Cp 2CeX (X = Cl, I, OSO2CF3), which areused to synthesize the benzyl, Cp'2CeCH2C6H5. The benzyl is a usefulstarting material for preparing other complexes in the Cp'2CeZ system (Z= BF4, F, NH2, C6H5, H). X-ray crystal structures of Cp'2CeOSO2CF3,Cp'2CeF, Cp'2CeCH2C6H5, and Cp'2CeH are presented. The benzyl slowlydecomposes in solution to toluene and a metallacycle,[Cp'][(Me3C)2C5H2(CMe2CH2)]Ce. The ring CMe3 groups of both themetallacycle and the hydride, Cp'2CeH, can be fully deuterated byprolonged exposure to C6D6, providing a useful labeling tool inmechanistic studies.The hydride activates C-F and/or C-H bonds influorobenzenes, C6HxF6-x , x = 0-5. The reactions are selective, with theselectivity depending on the presence of two fluorines ortho to thereaction site more than on the type of bond activated. Complexes of thetype Cp'2CeC6HxF5-x , x = 0-4, are formed as intermediates, which slowlydecompose in solution to Cp'2CeF and fluorobenzynes, C6HxF4-x, x = 0-4,which are trapped. The rate at which Cp'2CeC6HxF5-x complexes decomposeincreases as the number of fluorines decreases. Complexes with oneortho-fluorine decompose much faster than those with two ortho-fluorines.The metallacycle activates only C-H bonds in fluorobenzenes, permittingthe synthesis of specific Cp'2CeC6HxF5-x complexes. The crystal structureof Cp'2CeC6F5 is presented. The hydride and the metallacycle react withfluoromethanes, CH4-xFx, x = 1-3, through postulated Cp'2CeCH3-xFxintermediates to generate Cp'2CeF and other products. The other products,CH4, tri-t-butylbenzenes, tri-t-butylfluorobenzenes, and a presumedmetallocene cerium fluoride with one Cp' and one (Me2EtC)(Me3C)2C5H2ligand, suggest a decomposition pathway for Cp'2CeCH3-xFx , x = 1-3, thatinvolves carbenes or carbenoids, which are trapped. The hydridepolymerizes ethylene, but

  8. Non-equivalent roles of two periplasmic subunits in the function and assembly of triclosan pump TriABC from Pseudomonas aeruginosa.


    Weeks, Jon W; Nickels, Logan M; Ntreh, Abigail T; Zgurskaya, Helen I


    In Gram-negative bacteria, multidrug efflux transporters function in complexes with periplasmic membrane fusion proteins (MFPs) that enable antibiotic efflux across the outer membrane. In this study, we analyzed the function, composition and assembly of the triclosan efflux transporter TriABC-OpmH from Pseudomonas aeruginosa. We report that this transporter possesses a surprising substrate specificity that encompasses not only triclosan but the detergent SDS, which are often used together in antibacterial soaps. These two compounds interact antagonistically in a TriABC-dependent manner and negate antibacterial properties of each other. Unlike other efflux pumps that rely on a single MFP for their activities, two different MFPs, TriA and TriB, are required for triclosan/SDS resistance mediated by TriABC-OpmH. We found that analogous mutations in the α-helical hairpin and membrane proximal domains of TriA and TriB differentially affect triclosan efflux and assembly of the complex. Furthermore, our results show that TriA and TriB function as a dimer, in which TriA is primarily responsible for stabilizing interactions with the outer membrane channel, whereas TriB is important for the stimulation of the transporter. We conclude that MFPs are engaged into complexes as asymmetric dimers, in which each protomer plays a specific role. PMID:26193906

  9. Development and Use of a Reverse Transcription-PCR Assay To Study Expression of Tri5 by Fusarium Species In Vitro and In Planta

    PubMed Central

    Doohan, F. M.; Weston, G.; Rezanoor, H. N.; Parry, D. W.; Nicholson, P.


    The Tri5 gene encodes trichodiene synthase, which catalyzes the first reaction in the trichothecene biosynthetic pathway. In vitro, a direct relationship was observed between Tri5 expression and the increase in deoxynivalenol production over time. We developed a reverse transcription (RT)-PCR assay to quantify Tri5 gene expression in trichothecene-producing strains of Fusarium species. We observed an increase in Tri5 expression following treatment of Fusarium culmorum with fungicides, and we also observed an inverse relationship between Tri5 expression and biomass, as measured by β-d-glucuronidase activity, during colonization of wheat (cv. Avalon) seedlings by F. culmorum. RT-PCR analysis also showed that for ears of wheat cv. Avalon inoculated with F. culmorum, there were different levels of Tri5 expression in grain and chaff at later growth stages. We used the Tri5-specific primers to develop a PCR assay to detect trichothecene-producing Fusarium species in infected plant material. PMID:10473385

  10. Enhanced Lacto-Tri-Peptide Bio-Availability by Co-Ingestion of Macronutrients.


    Ten Have, Gabriella A M; van der Pijl, Pieter C; Kies, Arie K; Deutz, Nicolaas E P


    Some food-derived peptides possess bioactive properties, and may affect health positively. For example, the C-terminal lacto-tri-peptides Ile-Pro-Pro (IPP), Leu-Pro-Pro (LPP) and Val-Pro-Pro (VPP) (together named here XPP) are described to lower blood pressure. The bioactivity depends on their availability at the site of action. Quantitative trans-organ availability/kinetic measurements will provide more insight in C-terminal tri-peptides behavior in the body. We hypothesize that the composition of the meal will modify their systemic availability. We studied trans-organ XPP fluxes in catheterized pigs (25 kg; n=10) to determine systemic and portal availability, as well as renal and hepatic uptake of a water-based single dose of synthetic XPP and a XPP containing protein matrix (casein hydrolyte, CasH). In a second experiment (n=10), we compared the CasH-containing protein matrix with a CasH-containing meal matrix and the modifying effects of macronutrients in a meal on the availability (high carbohydrates, low quality protein, high fat, and fiber). Portal availability of synthetic XPP was 0.08 ± 0.01% of intake and increased when a protein matrix was present (respectively 3.1, 1.8 and 83 times for IPP, LPP and VPP). Difference between individual XPP was probably due to release from longer peptides. CasH prolonged portal bioavailability with 18 min (absorption half-life, synthetic XPP: 15 ± 2 min, CasH: 33 ± 3 min, p<0.0001) and increased systemic elimination with 20 min (synthetic XPP: 12 ± 2 min; CasH: 32 ± 3 min, p<0.0001). Subsequent renal and hepatic uptake is about 75% of the portal release. A meal containing CasH, increased portal 1.8 and systemic bioavailability 1.2 times. Low protein quality and fiber increased XPP systemic bioavailability further (respectively 1.5 and 1.4 times). We conclude that the amount and quality of the protein, and the presence of fiber in a meal, are the main factors that increase the systemic bioavailability of food

  11. Challenges in Sustaining Faculty Development Programmes: Lessons Learnt from More Than Twenty Years of Trying

    PubMed Central

    Jaafar, Rogayah


    SYNOPSIS: Faculty Development Programme (FDP) encompasses all the activities that help faculty members to improve their capacity to become more effective instructors as well as to perform other components of their multi faceted tasks such as conducting research, contributing to administrative activities and writing publishable materials (Jason, 1980). It is a tool for improving the educational vitality of our institutions through attention to the competencies needed by individual teachers and to the institutional policies required to promote academic excellence (Wilkerson, Irby, 1998). One of the main long term objectives of FDP in the medical and health sciences field, is the preparation of excellent teachers who will in turn be able to train and mentor future generations of excellent health workers who will be able to provide excellent health care services to patients and the community to improve health outcomes and quality of life. Therefore, it is imperative that educational institutions start the loop by offering sound and relevant FDP for its teaching fraternity. For successful faculty development to happen, changes must take place at three basic levels ie attitudes, process and structure. There must also be serious efforts to identify areas of needs of the targeted programme participants at needs assessment. The School of Medical Sciences, Universiti Sains Malaysia, embarked on a systematic FDP since 1986. We have learnt a lot in the course of more than two decades of offering the programme: lessons from pleasant and gratifying as well as trying and challenging circumstances. This presentation will highlight some of the more important challenges we faced in trying to sustain our institutional FDP (such as needs assessment, relevance, acceptance and cost effectiveness) as well as strategies that were employed to overcome some of the difficulties with planning, implementing, evaluating and sustaining the FDP. Findings of our FDP evaluation over the past 22

  12. Paleotopographic control of landslides in lacustrine deposits (Trièves plateau, French western Alps)

    NASA Astrophysics Data System (ADS)

    Bièvre, Grégory; Kniess, Ulrich; Jongmans, Denis; Pathier, Erwan; Schwartz, Stéphane; van Westen, Cees J.; Villemin, Thierry; Zumbo, Vilma


    Paleotopography in Quaternary sedimentary environments can be an important factor that controls landslide movement. This study investigates the relation between paleotopography and landslide activity in two adjacent landslides in glaciolacustrine sediments located in the Trièves area (French western Alps). Although both are in slopes underlain by the same lacustrine deposits, the Avignonet and Harmalière landslides exhibit major differences in morphology and displacement rates. Through a combination of geological mapping, airborne light detection and ranging (LiDAR) data, aerial photographs, global positioning system (GPS), and seismic noise measurements, a three-dimensional impression was made of both landslides. The analysis reveals that the difference in kinematics between the two mass movements can be traced back to at least 50 years ago. The results show that the Harmalière slide, which failed catastrophically in 1981, is still much more active than the Avignonet landslide. The fear was that the Avignonet landslide might develop in a similar catastrophic manner, threatening a number of houses constructed on the landslide. A geophysical survey based on ambient noise measurements allowed us to map the base of the lacustrine clays, and the results indicate the presence of a N-S ridge of hard sediments (Jurassic bedrock and/or compact alluvial layers) on the eastern side of the Avignonet landslide. This ridge disappears when approaching the Harmalière landslide and makes a place to what can be interpreted as a NW-SE oriented paleovalley of the river Drac. We proposed that the ridge acts as a buttress that could mechanically prevent the Avignonet landslide from evolving as fast as the Harmalière. Furthermore, the NW-SE paleovalley located under the Harmalière landslide corresponds to the motion direction of the slide. Therefore, the different behaviour of the two landslides is partly controlled by the paleotopographic setting of Lake Trièves during the last

  13. First Measurements of Polar Mesospheric Summer Echoes by a Tri-static Radar System

    NASA Astrophysics Data System (ADS)

    La Hoz, C.


    Polar Mesospheric Summer Echoes (PMSE) have been observed for the first time by a tri-static radar system comprising the EISCAT VHF (224 MHz, 0.67 m Bragg wavelength) active radar in Tromso (Norway) and passive receiving stations in Kiruna, (Sweden) and Sodankyla (Finland). The antennas at the receiving stations, originally part of the EISCAT tri-static UHF radar system at 930 MHz, have been refitted with new feeder systems at the VHF frequency of the transmitter in Tromso. The refitted radar system opens new opportunities to study PMSE for its own sake and as a tracer of the dynamics of the polar mesosphere, a region that is difficult to investigate by other means. The measurements show that very frequently both remote receiving antennas detect coherent signals that are much greater than the regular incoherent scattering due to thermal electrons and coinciding in time and space with PMSE measured by the transmitter station in Tromso. This represents further evidence that PMSE is not aspect sensitive, as was already indicated by a less sensitive radar system in a bi-static configuration, and implying that the underlying atmospheric turbulence, at least at sub-meter scales, is isotropic in agreement with Kolmogorov's hypothesis. Measurements also show that the vertical rate of fall of persistent features of PMSE is the same as the vertical line of sight velocity inferred from the doppler shift of the PMSE signals. This equivalence forms the basis for using PMSE as a tracer of the dynamics of the background mesosphere. Thus, it is possible to measure the 3-dimensional velocity field in the PMSE layer over the intersection volume of the three antennas. Since the signals have large signal-to-noise ratios (up to 30 dB), the inferred velocities have high accuracies and good time resolutions. This affords the possibility to make estimates of momentum flux in the mesosphere deposited by overturning gravity waves. Gravity wave momentum flux is believed to be the engine of a

  14. Preliminary Survey on TRY Forest Traits and Growth Index Relations - New Challenges

    NASA Astrophysics Data System (ADS)

    Lyubenova, Mariyana; Kattge, Jens; van Bodegom, Peter; Chikalanov, Alexandre; Popova, Silvia; Zlateva, Plamena; Peteva, Simona


    Forest ecosystems provide critical ecosystem goods and services, including food, fodder, water, shelter, nutrient cycling, and cultural and recreational value. Forests also store carbon, provide habitat for a wide range of species and help alleviate land degradation and desertification. Thus they have a potentially significant role to play in climate change adaptation planning through maintaining ecosystem services and providing livelihood options. Therefore the study of forest traits is such an important issue not just for individual countries but for the planet as a whole. We need to know what functional relations between forest traits exactly can express TRY data base and haw it will be significant for the global modeling and IPBES. The study of the biodiversity characteristics at all levels and functional links between them is extremely important for the selection of key indicators for assessing biodiversity and ecosystem services for sustainable natural capital control. By comparing the available information in tree data bases: TRY, ITR (International Tree Ring) and SP-PAM the 42 tree species are selected for the traits analyses. The dependence between location characteristics (latitude, longitude, altitude, annual precipitation, annual temperature and soil type) and forest traits (specific leaf area, leaf weight ratio, wood density and growth index) is studied by by multiply regression analyses (RDA) using the statistical software package Canoco 4.5. The Pearson correlation coefficient (measure of linear correlation), Kendal rank correlation coefficient (non parametric measure of statistical dependence) and Spearman correlation coefficient (monotonic function relationship between two variables) are calculated for each pair of variables (indexes) and species. After analysis of above mentioned correlation coefficients the dimensional linear regression models, multidimensional linear and nonlinear regression models and multidimensional neural networks models are

  15. High quality ZnS/Au/ZnS transparent conductive tri-layer films deposited by pulsed laser deposition

    NASA Astrophysics Data System (ADS)

    Wang, Caifeng; Li, Qingshan; Wang, Jisuo; Zhang, Lichun; Zhao, Fengzhou; Dong, Fangying


    ZnS/Au/ZnS tri-layer films were deposited on quartz glass substrates by pulsed laser deposition. The influence of Au layer thickness on optical and electrical properties of the tri-layer ZnS/Au/ZnS was studied. X-ray diffractometer (XRD) and scanning electron microscope were employed to characterize the crystalline structure and surface morphology of the tri-layer films. Hall measurements, ultraviolet and visible spectrophotometer, four-point probe were used to explore the optoelectronic properties of the ZnS/Au/ZnS. The increase of Au layer thickness resulted in the decreased resistivity, the increased carrier concentration, and the declined transmittance in the visible light region.

  16. Tri-band spectroscopic optical coherence tomography based on optical parametric amplification for lipid and vessel visualization

    NASA Astrophysics Data System (ADS)

    Yu, Luoqin; Kang, Jiqiang; Jinata, Chandra; Wang, Xie; Wei, Xiaoming; Chan, Kin Tak; Lee, Nikki P.; Wong, Kenneth K. Y.


    A tri-band spectroscopic optical coherence tomography (SOCT) system has been implemented for visualization of lipid and blood vessel distribution. The tri-band swept source, which covers output spectrum in 1.3, 1.5, and 1.6 μm wavelength windows, is based on a dual-band Fourier domain mode-locked laser and a fiber optical parametric amplifier. This tri-band SOCT can further differentiate materials, e.g., lipid and artery, qualitatively by contrasting attenuation coefficients difference within any two of these bands. Furthermore, ex vivo imaging of both porcine artery with artificial lipid plaque phantom and mice with coronary artery disease were demonstrated to showcase the capability of our SOCT.

  17. Laparoscopic Resection of Cholecystocolic Fistula and Subtotal Cholecystectomy by Tri-Staple in a Type V Mirizzi Syndrome

    PubMed Central

    Yetişir, Fahri; Şarer, Akgün Ebru; Acar, Hasan Zafer; Parlak, Omer; Basaran, Basar; Yazıcıoğlu, Omer


    The Mirizzi syndrome (MS) is an impacted stone in the cystic duct or Hartmann's pouch that mechanically obstructs the common bile duct (CBD). We would like to report laparoscopic subtotal cholecystectomy (SC) and resection of cholecystocolic fistula by the help of Tri-Staple™ in a case with type V MS and cholecystocolic fistula, for first time in the literature. A 24-year-old man was admitted to emergency department with the complaint of abdominal pain, intermittent fever, jaundice, and diarrhea. Two months ago with the same complaint, ERCP was performed. Laparoscopic resection of cholecystocolic fistula and subtotal cholecystectomy were performed by the help of Tri-Staple. At the eight-month follow-up, he was symptom-free with normal liver function tests. In a patient with type V MS and cholecystocolic fistula, laparoscopic resection of cholecystocolic fistula and SC can be performed by using Tri-Staple safely. PMID:26904324

  18. Permeability of dye through poly(urea-urethane) microcapsule membrane prepared from mixtures of di- and tri-isocyanate.


    Chang, Chih Pong; Chang, Jer Chen; Ichikawa, Kimio; Dobashi, Toshiaki


    Poly(urea-urethane) microcapsules were prepared by the interfacial polymerization with using mixtures of tri- and di-isocyanate monomers as wall forming materials, and dioctyl phthalate containing an oil-soluble dye as a core material. The time course of the dye release in dispersing tetrahydrofuran was measured as a function of the weight fraction of tri-isocyanate monomer in the total monomer w and the core/wall material-weight ratio g. The dye release curves were well represented by an exponential function C=Ceq(1-e-t/tau), where C is the concentration of the dye in the dispersing medium, Ceq that at equilibrium state, t the elution time and tau is a time constant. tau increased linearly against w at high g, suggesting controllability of the release rate of microcapsules by varying tri-isocyanate/di-isocyanate ratio. PMID:16081257

  19. Initiation Temperature for Runaway Tri-n-Butyl Phosphate/Nitric Acid Reaction

    SciTech Connect

    Rudisill, T.S.


    During a review of the H-Canyon authorization basis, Defense Nuclear Facility Safety Board (DNFSB) staff members questioned the margin of safety associated with a postulated tri-n-butyl phosphate (TBP)/nitric acid runaway reaction due to the inadvertent heating of a canyon tank containing greater than 3000 lbs (1362 kg) of TBP. The margin of safety was partially based on experiments and calculations performed by the Actinide Technology Section (ATS) to support deletion of indication of tank agitation as a Safety Class System. In the technical basis for deletion of this system, ATS personnel conservatively calculated the equilibrium temperature distribution of a canyon tank containing TBP and nitric acid layers which were inadvertently heated by a steam jet left on following a transfer. The maximum calculated temperature (128 degrees C) was compared to the minimum initiation temperature for a runaway reaction (greater than 130 degrees C) documented by experimental work in the mid 195 0s. In this work, the initiation temperature as a function of nitric acid concentration was measured for 0 and 20 wt percent dissolved solids. The DNFSB staff members were concerned that data for 0 wt percent dissolved solids were not conservative given the facts that data for 20 wt percent dissolved solids show initiation temperatures at or below 130 degrees C and H-Canyon solutions normally contained a small amount of dissolved solids.

  20. Weather data for simplified energy calculation methods. Volume III. Western United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 24 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  1. Weather data for simplified energy calculation methods. Volume II. Middle United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective of this report is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 22 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  2. Magnetization dependent rectification in (Ga,Mn)As tri-layer tunnel junctions

    NASA Astrophysics Data System (ADS)

    Hashimoto, Y.; Amano, H.; Iye, Y.; Katsumoto, S.


    Current rectification in (Ga,Mn)As tri-layer magnetic tunnel junctions (MTJs) is found to be controllable through the alignment of magnetizations, which can be changed with small current injections. The tunneling magnetoresistance (TMR) at 4.2K is 120% in amplitude, showing three step structure, which corresponds to the alignment of magnetizations. With a minor field loop, the alignment of magnetization can be anti-parallel for the top and the bottom layers and then current injections with alternative direction can reverse the direction of the magnetization in the middle layer. The threshold current is as low as 2 × 104A/cm2. We have found the junctions have small rectification effect up to 8GHz, which is strongly dependent on the alignment of the magnetization. Hence the direction of the rectification as well as the amplitude can be switched by the bi-directional current injections. The rectification can be explained within the Julliere model with enegy dependence of the density of states. To check this we performed tunneling measurements and obtained positive results.

  3. Design Methodology for Magnetic Field-Based Soft Tri-Axis Tactile Sensors.


    Wang, Hongbo; de Boer, Greg; Kow, Junwai; Alazmani, Ali; Ghajari, Mazdak; Hewson, Robert; Culmer, Peter


    Tactile sensors are essential if robots are to safely interact with the external world and to dexterously manipulate objects. Current tactile sensors have limitations restricting their use, notably being too fragile or having limited performance. Magnetic field-based soft tactile sensors offer a potential improvement, being durable, low cost, accurate and high bandwidth, but they are relatively undeveloped because of the complexities involved in design and calibration. This paper presents a general design methodology for magnetic field-based three-axis soft tactile sensors, enabling researchers to easily develop specific tactile sensors for a variety of applications. All aspects (design, fabrication, calibration and evaluation) of the development of tri-axis soft tactile sensors are presented and discussed. A moving least square approach is used to decouple and convert the magnetic field signal to force output to eliminate non-linearity and cross-talk effects. A case study of a tactile sensor prototype, MagOne, was developed. This achieved a resolution of 1.42 mN in normal force measurement (0.71 mN in shear force), good output repeatability and has a maximum hysteresis error of 3.4%. These results outperform comparable sensors reported previously, highlighting the efficacy of our methodology for sensor design. PMID:27563908

  4. Weather data for simplified energy calculation methods. Volume I. Eastern United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective of this report is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 23 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  5. Mono- and tri-cationic porphyrin–monoclonal antibody conjugates: photodynamic activity and mechanism of action

    PubMed Central

    Smith, Karen; Malatesti, Nela; Cauchon, Nicole; Hunting, Darel; Lecomte, Roger; van Lier, Johan E; Greenman, John; Boyle, Ross W


    Two cationic porphyrins bearing an isothiocyanate group for conjugation to monocolonal antibodies have been synthesized. The two porphyrins conjugated efficiently to three monoclonal antibodies (anti-CD104, anti-CD146 and anti-CD326), which recognize antigens commonly over-expressed on a range of tumour cells. In vitro, all conjugates retained the phototoxicity of the porphyrin and the immunoreactivity of the antibody. Mechanistic studies showed that conjugates formed from the mono- and tri-cationic porphyrin and anti-CD104 antibody mediated apoptosis following irradiation with non-thermal red light of 630 ± 15 nm wavelength. In vivo antibody conjugates caused suppression of human LoVo tumour growth in immunodeficient NIH III mice, similar to the commercial photodynamic therapy (PDT) agent Photofrin®, but at administered photosensitizer doses that were more than two orders of magnitude lower. Positron emission tomography (PET) following PDT showed a large, early increase in uptake of 18fluorodeoxyglucose (FDG) by tumours treated with the anti-CD104 conjugates. This effect was not observed with Photofrin® or with conjugates formed from the same photosensitizers conjugated to an irrelevant antibody. PMID:21039468

  6. Modelling and characteristic analysis of tri-axle trucks with hydraulically interconnected suspensions

    NASA Astrophysics Data System (ADS)

    Ding, Fei; Han, Xu; Luo, Zhen; Zhang, Nong


    In this paper, a new hydraulically interconnected suspension (HIS) system is proposed for the implementation of a resistance control for the pitch and bounce modes of tri-axle heavy trucks. A lumped-mass half-truck model is established using the free-body diagram method. The equations of motion of a mechanical and hydraulic coupled system are developed by incorporating the hydraulic strut forces into the mechanical subsystem as externally applied forces. The transfer matrix method (TMM) is used to evaluate the impedance matrix of the hydraulic subsystem consisting of models of fluid pipes, damper valves, accumulators, and three-way junctions. The TMM is further applied to find the quantitative relationships between the hydraulic strut forces and boundary flow of the mechanical-fluid interactive subsystem. The modal analysis method is employed to perform the vibration analysis between the trucks with the conventional suspension and the proposed HIS. Comparison analysis focuses on free vibration with identified eigenvalues and eigenvectors, isolation vibration capacity, and force vibration in terms of the power spectrum density responses. The obtained results show the effectiveness of the proposed HIS system in reducing the pitch motion of sprung mass and simultaneously maintaining the ride comfort. The pitch stiffness is increased while the bounce stiffness is slightly softened. The peak values of sprung mass and wheel hop motions are greatly reduced, and the vibration decay rate of sprung mass is also significantly increased.

  7. Hierarchical classifier approach to physical activity recognition via wearable smartphone tri-axial accelerometer.


    Yusuf, Feridun; Maeder, Anthony; Basilakis, Jim


    Physical activity recognition has emerged as an active area of research which has drawn increasing interest from researchers in a variety of fields. It can support many different applications such as safety surveillance, fraud detection, and clinical management. Accelerometers have emerged as the most useful and extensive tool to capture and assess human physical activities in a continuous, unobtrusive and reliable manner. The need for objective physical activity data arises strongly in health related research. With the shift to a sedentary lifestyle, where work and leisure tend to be less physically demanding, research on the health effects of low physical activity has become a necessity. The increased availability of small, inexpensive components has led to the development of mobile devices such as smartphones, providing platforms for new opportunities in healthcare applications. In this study 3 subjects performed directed activity routines wearing a smartphone with a built in tri-axial accelerometer, attached on a belt around the waist. The data was collected to classify 11 basic physical activities such as sitting, lying, standing, walking, and the transitions in between them. A hierarchical classifier approach was utilised with Artificial Neural Networks integrated in a rule-based system, to classify the activities. Based on our evaluation, recognition accuracy of over 89.6% between subjects and over 91.5% within subject was achieved. These results show that activities such as these can be recognised with a high accuracy rate; hence the approach is promising for use in future work. PMID:23823307

  8. Tri-state delta modulation system for Space Shuttle digital TV downlink

    NASA Technical Reports Server (NTRS)

    Udalov, S.; Huth, G. K.; Roberts, D.; Batson, B. H.


    Future requirements for Shuttle Orbiter downlink communication may include transmission of digital video which, in addition to black and white, may also be either field-sequential or NTSC color format. The use of digitized video could provide for picture privacy at the expense of additional onboard hardware, together with an increased bandwidth due to the digitization process. A general objective for the Space Shuttle application is to develop a digitization technique that is compatible with data rates in the 20-30 Mbps range but still provides good quality pictures. This paper describes a tri-state delta modulation/demodulation (TSDM) technique which is a good compromise between implementation complexity and performance. The unique feature of TSDM is that it provides for efficient run-length encoding of constant-intensity segments of a TV picture. Axiomatix has developed a hardware implementation of a high-speed TSDM transmitter and receiver for black-and-white TV and field-sequential color. The hardware complexity of this TSDM implementation is summarized in the paper.

  9. Selective Binding of AIRAPL Tandem UIMs to Lys48-Linked Tri-Ubiquitin Chains.


    Rahighi, Simin; Braunstein, Ilana; Ternette, Nicola; Kessler, Benedikt; Kawasaki, Masato; Kato, Ryuichi; Matsui, Tsutomu; Weiss, Thomas M; Stanhill, Ariel; Wakatsuki, Soichi


    Lys48-linked ubiquitin chains act as the main targeting signals for protein degradation by the proteasome. Here we report selective binding of AIRAPL, a protein that associates with the proteasome upon exposure to arsenite, to Lys48-linked tri-ubiquitin chains. AIRAPL comprises two ubiquitin-interacting motifs in tandem (tUIMs) that are linked through a flexible inter-UIM region. In the complex crystal structure UIM1 binds the proximal ubiquitin, whereas UIM2 (the double-sided UIM) binds non-symmetrically to the middle and distal ubiquitin moieties on either side of the helix. Specificity of AIRAPL for Lys48-linked ubiquitin chains is determined by UIM2, and the flexible inter-UIM linker increases avidity by placing the two UIMs in an orientation that facilitates binding of the third ubiquitin to UIM1. Unlike middle and proximal ubiquitins, distal ubiquitin binds UIM2 through a novel surface, which leaves the Ile44 hydrophobic patch accessible for binding to the proteasomal ubiquitin receptors. PMID:26876100

  10. Induction of apoptosis in the blue mussel Mytilus galloprovincialis by tri-n-butyltin chloride.


    Micić, M; Bihari, N; Labura, Z; Müller, W E; Batel, R


    Induction of apoptosis by tri-n-butyltin (TBT) in gill tissue of the mussel Mytilus galloprovincialis was investigated. The terminal dUTP nick-end labeling technique (TUNEL) was used to detect cells displaying DNA fragmentation within gill structures. Genomic DNA fragmentation was detected as characteristically ladder-like pattern of DNA fragments induced by single injection of different doses of TBT (1-5 microg/g) below the mantle, directly into the pallial fluid, after 24 h of incubation. DNA degradation of higher order DNA structure, as well as reduced G(0)/G(1) cell cycle region (the sub-G(1) region) was detectable after 1.5 h of TBT incubation. Presence of apoptotic cells in mussels' gills was indicated by the selective loss of G(2)/M cells concomitant with the appearance of cells with decreased DNA content in S and G(0)/G(1) cell cycle regions. The effect of the TBT on cell cycle in a mussel gill was a dose related and exposure time depending. The possible mechanism of induction of apoptosis in vivo in gill tissue of mussel treated with TBT is discussed. PMID:11551622

  11. Tri-axial telecoil hearing aid for improved connection to public induction loops.


    Riehle, Timothy H; Knuesel, Robert J; Lichter, Patrick A; Panescu, Dorin


    Telecoils in hearing aids serve a dual purpose: to enhance telephone conversation and enable hearing aids to serve as a wireless interface for public audio broadcasts. When broadcasting audio signals, the signal is transmitted to the telecoil sensor (a magnetic field sensor located in the hearing aid) via magnetic energy from an induction wire loop located near the listener. This induction loop can be a small assembly located in the handset of the telephone or a large wire loop within a public venue like a theatre. Current hearing aids detect the magnetic signal using a single telecoil. If the telecoil is not aligned with the magnetic field, the strength of the detected signal is diminished. Unfortunately, public induction loops and telephone handsets seldom share a common alignment to the hearing aid, leading to sub-optimal performance by one or both in hearing aids available today. In this research, a prototype behind-the-ear (BTE) hearing aid with tri-axial telecoils was developed and DSP algorithms to process and combine the three signals were developed. The resulting hearing aid was evaluated in a human trial and provided better performance than a similar quality conventional telecoil hearing aid. PMID:26736209

  12. Flow-dependent expression of ectonucleotide tri(di)phosphohydrolase-1 and suppression of atherosclerosis

    PubMed Central

    Kanthi, Yogendra; Hyman, Matthew C.; Liao, Hui; Baek, Amy E.; Visovatti, Scott H.; Sutton, Nadia R.; Goonewardena, Sascha N.; Neral, Mithun K.; Jo, Hanjoong; Pinsky, David J.


    The ability of cells to detect and respond to nucleotide signals in the local microenvironment is essential for vascular homeostasis. The enzyme ectonucleotide tri(di)phosphohydrolase-1 (ENTPD1, also known as CD39) on the surface of leukocytes and endothelial cells metabolizes locally released, intravascular ATP and ADP, thereby eliminating these prothrombotic and proinflammatory stimuli. Here, we evaluated the contribution of CD39 to atherogenesis in the apolipoprotein E–deficient (ApoE-deficient) mouse model of atherosclerosis. Compared with control ApoE-deficient animals, plaque burden was markedly increased along with circulating markers of platelet activation in Cd39+/–Apoe–/– mice fed a high-fat diet. Plaque analysis revealed stark regionalization of endothelial CD39 expression and function in Apoe–/– mice, with CD39 prominently expressed in atheroprotective, stable flow regions and diminished in atheroprone areas subject to disturbed flow. In mice, disturbed flow as the result of partial carotid artery ligation rapidly suppressed endothelial CD39 expression. Moreover, unidirectional laminar shear stress induced atheroprotective CD39 expression in human endothelial cells. CD39 induction was dependent upon the vascular transcription factor Krüppel-like factor 2 (KLF2) binding near the transcriptional start site of CD39. Together, these data establish CD39 as a regionalized regulator of atherogenesis that is driven by shear stress. PMID:26121751

  13. Transcriptome and H3K27 tri-methylation profiling of Ezh2-deficient lung epithelium.


    Holik, Aliaksei Z; Galvis, Laura A; Lun, Aaron T L; Ritchie, Matthew E; Asselin-Labat, Marie-Liesse


    The adaptation of the lungs to air breathing at birth requires the fine orchestration of different processes to control lung morphogenesis and progenitor cell differentiation. However, there is little understanding of the role that epigenetic modifiers play in the control of lung development. We found that the histone methyl transferase Ezh2 plays a critical role in lung lineage specification and survival at birth. We performed a genome-wide transcriptome study combined with a genome-wide analysis of the distribution of H3K27 tri-methylation marks to interrogate the role of Ezh2 in lung epithelial cells. Lung cells isolated from Ezh2-deficient and control mice at embryonic day E16.5 were sorted into epithelial and mesenchymal populations based on EpCAM expression. This enabled us to dissect the transcriptional and epigenetic changes induced by the loss of Ezh2 specifically in the lung epithelium. Here we provide a detailed description of the analysis of the RNA-seq and ChIP-seq data, including quality control, read mapping, differential expression and differential binding analyses, as well as visualisation methods used to present the data. These data can be accessed from the Gene Expression Omnibus database (super-series accession number GSE57393). PMID:26484284

  14. Transcriptome and H3K27 tri-methylation profiling of Ezh2-deficient lung epithelium

    PubMed Central

    Holik, Aliaksei Z.; Galvis, Laura A.; Lun, Aaron T.L.; Ritchie, Matthew E.; Asselin-Labat, Marie-Liesse


    The adaptation of the lungs to air breathing at birth requires the fine orchestration of different processes to control lung morphogenesis and progenitor cell differentiation. However, there is little understanding of the role that epigenetic modifiers play in the control of lung development. We found that the histone methyl transferase Ezh2 plays a critical role in lung lineage specification and survival at birth. We performed a genome-wide transcriptome study combined with a genome-wide analysis of the distribution of H3K27 tri-methylation marks to interrogate the role of Ezh2 in lung epithelial cells. Lung cells isolated from Ezh2-deficient and control mice at embryonic day E16.5 were sorted into epithelial and mesenchymal populations based on EpCAM expression. This enabled us to dissect the transcriptional and epigenetic changes induced by the loss of Ezh2 specifically in the lung epithelium. Here we provide a detailed description of the analysis of the RNA-seq and ChIP-seq data, including quality control, read mapping, differential expression and differential binding analyses, as well as visualisation methods used to present the data. These data can be accessed from the Gene Expression Omnibus database (super-series accession number GSE57393). PMID:26484284

  15. Fouling effects of tri-n-butylphosphate on reverse osmosis performance and techniques for performance recovery

    SciTech Connect

    Poy, F.L.


    The F/H Effluent Treatment Facility (F/H ETF) must be on-line by November 1988 to treat the low level activity wastes presently being discharged to the F- and H- areas' seepage basins. The three main processes of the F/H ETF are filtration, reverse osmosis, and ion exchange. Any dissolved organics present in the F/H ETF's feed have the potential to affect operation of the reverse osmosis system. Earlier studies with F/H ETF feed simulant and 70 volume percent kerosene and 30 volume percent tri-n-butylphosphate (TBP) additions showed that the kerosene/TBP mixture results in partial fouling of reverse osmosis membranes. A more detailed analysis of the seepage basin feed has shown that TBP is the major dissolved organic compound. Since it is dissolved (soluble to about 400 ppM at 25{degree}C), TBP will be present in the reverse osmosis feed unless removed by a means other than filtration. Thus the fouling effect of TBP (without kerosene) on reverse osmosis performance was investigated. 4 refs., 8 figs., 2 tabs.

  16. Development of a Tri-Axial Cutting Force Sensor for the Milling Process

    PubMed Central

    Li, Yingxue; Zhao, Yulong; Fei, Jiyou; Zhao, You; Li, Xiuyuan; Gao, Yunxiang


    This paper presents a three-component fixed dynamometer based on a strain gauge, which reduces output errors produced by the cutting force imposed on different milling positions of the workpiece. A reformative structure of tri-layer cross beams is proposed, sensitive areas were selected, and corresponding measuring circuits were arranged to decrease the inaccuracy brought about by positional variation. To simulate the situation with a milling cutter moving on the workpiece and validate the function of reducing the output errors when the milling position changes, both static calibration and dynamic milling tests were implemented on different parts of the workpiece. Static experiment results indicate that with standard loads imposed, the maximal deviation between the measured forces and the standard inputs is 4.87%. The results of the dynamic milling test illustrate that with identical machining parameters, the differences in output variation between the developed sensor and standard dynamometer are no larger than 6.61%. Both static and dynamic experimental results demonstrate that the developed dynamometer is suitable for measuring milling force imposed on different positions of the workpiece, which shows potential applicability in machining a monitoring system. PMID:27007374

  17. State of remediation and metal toxicity in the Tri-State Mining District, USA.


    Johnson, Aaron W; Gutiérrez, Mélida; Gouzie, Douglas; McAliley, L Rex


    Mining operations in the Tri-State Mining District of Kansas, Missouri and Oklahoma (TSMD), once one of the major lead and zinc mining areas in the world, had completely ceased by 1970. As mining companies moved out, the land was left with underground tunnels and mine shafts and the surface with abandoned tailings piles, which progressively contaminated groundwater and soil. Despite remedial actions undertaken in the 1980's, areas within the TSMD still contain Cd, Pb, and Zn concentrations exceeding safe levels. Because of the large area and highly dispersed occurrence of wastes, environmental studies generally have been confined either to a stream basin or to a single state. Studies also have differed in their approach and analytical methodologies. An overview of the totality of the TSMD and its present state of contamination is presented here. Data show that metal content in sediments have the following common features: (1) a wide range of Pb and Zn concentrations, up to three orders of magnitude, (2) median values for Cd, Pb and Zn content in sediments and soils were similar among studies, (3) median values for most studies were at or above the guidelines recommended for aquatic habitats, and (4) highest content of Pb and Zn were closely associated with the geographical location of former mining and smelting centers. The above observations imply that mine wastes remain a problem and further remediation is needed. Cost-effective remedial alternatives for this area's geology, climate, and land use, are discussed. PMID:26457623

  18. The photoluminescence properties of tri-colour silicoaluminate phosphors prepared from oil shale ash

    NASA Astrophysics Data System (ADS)

    Zhang, Hui; Song, Yanhua; Sheng, Ye; Zheng, Keyan; Ding, Shizhou; Yuan, Bo; Xu, Xuechun; Zou, Haifeng


    In this paper, high value-added tri-colour phosphors Ba0.96Mg1.88Si2O7:0.02Eu2+, 0.02Dy3+, 0.12Mn2+; CaSr0.995SiO4:0.005Eu2+ and Ba0.91MgAl10O17:0.09Eu2+ were prepared using the white carbon black (hereinafter referred to as WCB) and alumina extracted from oil shale ash as raw materials. The structure and luminescence properties of the samples were characterized by X-ray diffraction (XRD) and photoluminescent spectra. The results show that the red and green phosphors synthesized by WCB exhibited much weaker emission than the phosphors synthesized by pure chemical reagent silica, which is mainly due to the high content of iron in the WCB. After purifying the WCB under laboratory conditions, the luminescence properties were improved and close to that of pure chemical reagent. By comparing with the emission of the samples synthesized with chemical reagents, the results show that the products extracted from oil shale ash can be applied to synthesize luminescent materials which have potential applications in white-light ultraviolet (UV)-LED field.

  19. Medical data sheet in safe havens - A tri-layer cryptic solution.


    Praveenkumar, Padmapriya; Amirtharajan, Rengarajan; Thenmozhi, K; Balaguru Rayappan, John Bosco


    Secured sharing of the diagnostic reports and scan images of patients among doctors with complementary expertise for collaborative treatment will help to provide maximum care through faster and decisive decisions. In this context, a tri-layer cryptic solution has been proposed and implemented on Digital Imaging and Communications in Medicine (DICOM) images to establish a secured communication for effective referrals among peers without compromising the privacy of patients. In this approach, a blend of three cryptic schemes, namely Latin square image cipher (LSIC), discrete Gould transform (DGT) and Rubik׳s encryption, has been adopted. Among them, LSIC provides better substitution, confusion and shuffling of the image blocks; DGT incorporates tamper proofing with authentication; and Rubik renders a permutation of DICOM image pixels. The developed algorithm has been successfully implemented and tested in both the software (MATLAB 7) and hardware Universal Software Radio Peripheral (USRP) environments. Specifically, the encrypted data were tested by transmitting them through an additive white Gaussian noise (AWGN) channel model. Furthermore, the sternness of the implemented algorithm was validated by employing standard metrics such as the unified average changing intensity (UACI), number of pixels change rate (NPCR), correlation values and histograms. The estimated metrics have also been compared with the existing methods and dominate in terms of large key space to defy brute force attack, cropping attack, strong key sensitivity and uniform pixel value distribution on encryption. PMID:25966921

  20. Perfectionism and Effort-Related Cardiac Activity: Do Perfectionists Try Harder?

    PubMed Central

    Harper, Kelly L.; Eddington, Kari M.; Silvia, Paul J.


    Do perfectionists try harder? Previous research on perfectionism and effort has used self-report items and task performance as indicators of effort. The current study investigated whether individual differences in perfectionism predicted effort-related cardiac activity during a mental effort task. Based on past research that suggests adaptive perfectionism is associated with higher effort, it was hypothesized that self-oriented perfectionism (SOP) would predict increased effort on the task. One hundred and eleven college students completed the Multidimensional Perfectionism Scale (MPS) and a self-paced parity task in which they received a small cash reward (3 cents) for each correct response. Impedance cardiography was used to assess autonomic reactivity, and regression models tested whether SOP and socially prescribed perfectionism (SPP) explained autonomic reactivity. Overall, participants showed both sympathetic (faster pre-ejection period; PEP) and parasympathetic activation (elevated high-frequency heart rate variability; HRV) during the task, reflecting higher effort and engagement. Contrary to predictions, individual differences in perfectionism did not moderate cardiac reactivity. These findings draw attention to the importance of assessing physiological components of effort and motivation directly rather than inferring them from task performance or self-reported effort. PMID:27483467

  1. STS-103 Pilot Scott Kelly and MS John Grunsfeld try on oxygen masks

    NASA Technical Reports Server (NTRS)


    In the bunker at Launch Pad 39B, STS-103 Pilot Scott J. Kelly (left) and Mission Specialist John M. Grunsfeld (Ph.D.) (right) try on oxygen masks during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), and Jean-Frangois Clervoy of France and Claude Nicollier of Switzerland, who are with the European Space Agency. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  2. A new TriBeam system for three-dimensional multimodal materials analysis

    NASA Astrophysics Data System (ADS)

    Echlin, McLean P.; Mottura, Alessandro; Torbet, Christopher J.; Pollock, Tresa M.


    The unique capabilities of ultrashort pulse femtosecond lasers have been integrated with a focused ion beam (FIB) platform to create a new system for rapid 3D materials analysis. The femtosecond laser allows for in situ layer-by-layer material ablation with high material removal rates. The high pulse frequency (1 kHz) of ultrashort (150 fs) laser pulses can induce material ablation with virtually no thermal damage to the surrounding area, permitting high resolution imaging, as well as crystallographic and elemental analysis, without intermediate surface preparation or removal of the sample from the chamber. The TriBeam system combines the high resolution and broad detector capabilities of the DualBeamTM microscope with the high material removal rates of the femtosecond laser, allowing 3D datasets to be acquired at rates 4-6 orders of magnitude faster than 3D FIB datasets. Design features that permit coupling of laser and electron optics systems and positioning of a stage in the multiple analysis positions are discussed. Initial in situ multilayer data are presented.

  3. A new TriBeam system for three-dimensional multimodal materials analysis.


    Echlin, McLean P; Mottura, Alessandro; Torbet, Christopher J; Pollock, Tresa M


    The unique capabilities of ultrashort pulse femtosecond lasers have been integrated with a focused ion beam (FIB) platform to create a new system for rapid 3D materials analysis. The femtosecond laser allows for in situ layer-by-layer material ablation with high material removal rates. The high pulse frequency (1 kHz) of ultrashort (150 fs) laser pulses can induce material ablation with virtually no thermal damage to the surrounding area, permitting high resolution imaging, as well as crystallographic and elemental analysis, without intermediate surface preparation or removal of the sample from the chamber. The TriBeam system combines the high resolution and broad detector capabilities of the DualBeam(TM) microscope with the high material removal rates of the femtosecond laser, allowing 3D datasets to be acquired at rates 4-6 orders of magnitude faster than 3D FIB datasets. Design features that permit coupling of laser and electron optics systems and positioning of a stage in the multiple analysis positions are discussed. Initial in situ multilayer data are presented. PMID:22380093

  4. Common binding site for disialyllactose and tri-peptide in C-fragment of tetanus neurotoxin.


    Jayaraman, Seetharaman; Eswaramoorthy, Subramaniam; Kumaran, Desigan; Swaminathan, Subramanyam


    Clostridial neurotoxins are comprised of botulinum (BoNT) and tetanus (TeNT), which share significant structural and functional similarity. Crystal structures of the binding domain of TeNT complexed with disialyllactose (DiSia) and a tri-peptide Tyr-Glu-Trp (YEW) have been determined to 2.3 and 2.2 A, respectively. Both DiSia and YEW bind in a shallow cleft region on the surface of the molecule in the beta-trefoil domain, interacting with a set of common residues, Asp1147, Asp1214, Asn1216, and Arg1226. DiSia and YEW binding at the same site in tetanus toxin provides a putative site that could be occupied either by a ganglioside moiety or a peptide. Soaking experiments with a mixture of YEW and DiSia show that YEW competes with DiSia, suggesting that YEW can be used to block ganglioside binding. A comparison with the TeNT binding domain in complex with small molecules, BoNT/A and /B, provides insight into the different modes of ganglioside binding. PMID:16104015

  5. Exciton Binding energies and effective masses in Organo-lead Tri-Halide Perovskites

    NASA Astrophysics Data System (ADS)

    Portugall, Oliver; Miyata, Atsuhiko; Mitioglu, Anatol; Plochocka, Paulina; Wang, Jacob Tse-Wei; Stranks, Samuel; Snaith, Henry; Nicholas, Robin; Lncmi Toulouse Team; Oxford University Team


    Solid-state perovskite-based solar cells have made a dramatic impact on emerging PV research with efficiencies of over 17% already achieved. However, to date the basic electronic properties of the perovskites such as the electron and hole effective masses and the exciton binding energy are not well known. We have measured both for methyl ammonium lead tri-iodide using magneto absorption in very high magnetic fields up to 150T showing that the exciton binding energy at low temperatures is only 16 meV, a value three times smaller than previously thought and sufficiently small to completely transform the way in which the devices must operate. Landau level spectroscopy shows that the reduced effective mass of 0.104 me is also smaller than previously thought. In addition by using a fast pulse 150T magnet we measure the band structure change due to the structural phase transition that occurs in this system at around 160K. We also observe Landau levels in the high temperature phase as used for device production, which has a very similar effective mass and the analysis suggests an exciton binding energy which is even smaller than in the low temperature phase.

  6. Development of a Tri-Axial Cutting Force Sensor for the Milling Process.


    Li, Yingxue; Zhao, Yulong; Fei, Jiyou; Zhao, You; Li, Xiuyuan; Gao, Yunxiang


    This paper presents a three-component fixed dynamometer based on a strain gauge, which reduces output errors produced by the cutting force imposed on different milling positions of the workpiece. A reformative structure of tri-layer cross beams is proposed, sensitive areas were selected, and corresponding measuring circuits were arranged to decrease the inaccuracy brought about by positional variation. To simulate the situation with a milling cutter moving on the workpiece and validate the function of reducing the output errors when the milling position changes, both static calibration and dynamic milling tests were implemented on different parts of the workpiece. Static experiment results indicate that with standard loads imposed, the maximal deviation between the measured forces and the standard inputs is 4.87%. The results of the dynamic milling test illustrate that with identical machining parameters, the differences in output variation between the developed sensor and standard dynamometer are no larger than 6.61%. Both static and dynamic experimental results demonstrate that the developed dynamometer is suitable for measuring milling force imposed on different positions of the workpiece, which shows potential applicability in machining a monitoring system. PMID:27007374

  7. Egg-Derived Tri-Peptide IRW Exerts Antihypertensive Effects in Spontaneously Hypertensive Rats

    PubMed Central

    Majumder, Kaustav; Chakrabarti, Subhadeep; Morton, Jude S.; Panahi, Sareh; Kaufman, Susan; Davidge, Sandra T.; Wu, Jianping


    Background There is a growing interest in using functional food components as therapy for cardiovascular diseases such as hypertension. We have previously characterized a tri-peptide IRW (Ile-Arg-Trp) from egg white protein ovotransferrin; this peptide showed anti-inflammatory, anti-oxidant and angiotensin converting enzyme (ACE) inhibitor properties in vitro. Given the pathogenic roles played by angiotensin, oxidative stress and inflammation in the spontaneously hypertensive rat (SHR), we tested the therapeutic potential of IRW in this well-established model of hypertension. Methods and Results 16–17 week old male SHRs were orally administered IRW at either a low dose (3 mg/Kg BW) or a high dose (15 mg/Kg BW) daily for 18 days. Blood pressure (BP) and heart rate were measured by telemetry. Animals were sacrificed at the end of the treatment for vascular function studies and measuring markers of inflammation. IRW treatment attenuated mean BP by ~10 mmHg and ~40 mmHg at the low- and high-dose groups respectively compared to untreated SHRs. Heart rate was not affected. Reduction in BP was accompanied by the restoration of diurnal variations in BP, preservation of nitric oxide dependent vasorelaxation, as well as reduction of plasma angiotensin II, other inflammatory markers and tissue fibrosis. Conclusion Our results demonstrate anti-hypertensive effects of IRW in vivo likely mediated through ACE inhibition, endothelial nitric oxide synthase and anti-inflammatory properties. PMID:24312436

  8. The greening of Eastern Europe: Devastated countries try to reverse Communism's environmental toll

    SciTech Connect

    Marshall, P.G.


    Eastern Europe endured the political and economic oppression of Communism for some 40 years - until the revolutions of 1989. But human freedom wasn't the only victim of the Communist regimes. The environment, too, suffered greatly under centrally planned economies that put a priority on production quotas and developing heavy industries while providing no incentives for conservation or pollution controls. Now two huge tasks confront Eastern Europeans as they try to bring order to their countries: They must energize crippled economies and find the resources to clean up four decades of profligate pollution. Western nations are providing help, but far less than is needed. Some experts worry that without more aid, some countries in the region may not hold together under the economic stresses. The two most heavily polluted countries, Czech Republic and Poland, are heavily industrialized and rely on high-sulfur brown coal. This article examines whether the Eastern European countries can, or will, clean up their environments on their own, and what some countries have done so far to improve their environmental laws and organizations.

  9. S/X/Ka Coaxial Feed for the Tri-band of the RAEGE Antennas

    NASA Astrophysics Data System (ADS)

    Tercero, F.; López-Pérez, J. A.; López-Fernádez, J. A.; Pérez, O.


    The tri-band cryogenic receiver for the first light observations of the first RAEGE project antenna in Yebes Observatory is being developed, in the framework of the VLBI2010 project. The 13-m new ring focus antennas are suitable to be fed by a broad-band feed such as the Eleven Feed. However other feed configurations are possible in order to cover narrower bands, such as the S, X, and Ka bands. With this frequency arrangement, the feed makes possible backward compatibility with classical VLBI, and it will be especially useful for the Ka commissioning of the antenna. X/Ka simultaneous observations will also make it possible to link this antenna with other VLBI networks. The feed, designed to illuminate the ring focus antenna, is made of a coaxial waveguide for the S- and X-bands and a circular waveguide for the Ka band. Four outputs from their corresponding field probes at S and X bands must be combined with 180 ° and 90 ° hybrid circuits to get dual-circular polarization. In the Ka band case, the dual-circular polarization is obtained with a septum polarizer. The feed, hybrids, and polarizer will operate at cryogenic temperatures.

  10. Measurement and interpretation of microbial adenosine tri-phosphate (ATP) in aquatic environments.


    Hammes, Frederik; Goldschmidt, Felix; Vital, Marius; Wang, Yingying; Egli, Thomas


    There is a widespread need for cultivation-free methods to quantify viability of natural microbial communities in aquatic environments. Adenosine tri-phosphate (ATP) is the energy currency of all living cells, and therefore a useful indicator of viability. A luminescence-based ATP kit/protocol was optimised in order to detect ATP concentrations as low as 0.0001 nM with a standard deviation of <5%. Using this method, more than 100 water samples from a variety of aquatic environments (drinking water, groundwater, bottled water, river water, lake water and wastewater effluent) were analysed for extracellular ATP and microbial ATP in comparison with flow-cytometric (FCM) parameters. Microbial ATP concentrations ranged between 3% and 97% of total ATP concentrations, and correlated well (R(2)=0.8) with the concentrations of intact microbial cells (after staining with propidium iodide). From this correlation, we calculated an average ATP-per-cell value of 1.75x10(-10)nmol/cell. An even better correlation (R(2)=0.88) was observed between intact biovolume (derived from FCM scatter data) and microbial ATP concentrations, and an average ATP-per-biovolume value of 2.95x10(-9)nmol/microm(3) was calculated. These results support the use of ATP analysis for both routine monitoring and research purposes, and contribute towards a better interpretation of ATP data. PMID:20605621

  11. Static Electric Dipole Polarizabilities of Tri- and Tetravalent U, Np, and Pu Ions

    SciTech Connect

    Parmar, Payal; Peterson, Kirk A.; Clark, Aurora E.


    High-quality static electric dipole polarizabilities have been determined for the ground states of the hard-sphere cations of U, Np, and Pu in the III and IV oxidation states. The polarizabilities have been calculated using the numerical finite field technique in a four-component relativistic framework. Methods including Fock-space coupled cluster (FSCC) and Kramers-restricted configuration interaction (KRCI) have been performed in order to account for electron correlation effects. Comparisons between polarizabilities calculated using Dirac-Hartree-Fock (DHF), FSCC, and KRCI methods have been made using both triple- and quadruple-ζ basis sets for U⁴⁺. In addition to the ground state, this study also reports the polarizability data for the first two excited states of U3+/4+, Np3+/4+, and Pu3+/4+ ions at different levels of theory. The values reported in this work are the most accurate to date calculations for the dipole polarizabilities of the hard-sphere tri- and tetravalent actinide ions and may serve as reference values, aiding in the calculation of various electronic and response properties (for example, intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications.

  12. Study of CO2 recovery in a carbonate fuel cell tri-generation plant

    NASA Astrophysics Data System (ADS)

    Rinaldi, Giorgio; McLarty, Dustin; Brouwer, Jack; Lanzini, Andrea; Santarelli, Massimo


    The possibility of separating and recovering CO2 in a biogas plant that co-produces electricity, hydrogen, and heat is investigated. Exploiting the ability of a molten carbonate fuel cell (MCFC) to concentrate CO2 in the anode exhaust stream reduces the energy consumption and complexity of CO2 separation techniques that would otherwise be required to remove dilute CO2 from combustion exhaust streams. Three potential CO2 concentrating configurations are numerically simulated to evaluate potential CO2 recovery rates: 1) anode oxidation and partial CO2 recirculation, 2) integration with exhaust from an internal combustion engine, and 3) series connection of molten carbonate cathodes initially fed with internal combustion engine (ICE) exhaust. Physical models have been calibrated with data acquired from an operating MCFC tri-generating plant. Results illustrate a high compatibility between hydrogen co-production and CO2 recovery with series connection of molten carbonate systems offering the best results for efficient CO2 recovery. In this case the carbon capture ratio (CCR) exceeds 73% for two systems in series and 90% for 3 MCFC in series. This remarkably high carbon recovery is possible with 1.4 MWe delivered by the ICE system and 0.9 MWe and about 350 kg day-1 of H2 delivered by the three MCFC.

  13. Molecular Dynamics Simulation of Tri-n-Butyl-Phophate Liquid: A Force Field Comparative Study

    SciTech Connect

    Cui, Shengting; de Almeida, Valmor F; Hay, Benjamin; Ye, Xianggui; Khomami, Bamin


    Molecular dynamics (MD) simulations were conducted to compare the performance of four force fields in predicting thermophysical properties of tri-n-butyl-phosphate (TBP) in the liquid phase. The intramolecular force parameters used were from the Assisted Model Building with Energy Refinement (AMBER) force field model. The van der Waals parameters were based on either the AMBER or the Optimized Potential for Liquid Simulation (OPLS) force fields. The atomic partial charges were either assigned by performing quantum chemistry calculations or utilized previously published data, and were scaled to approximate the average experimental value of the electric dipole moment. Canonical ensemble computations based on the aforementioned parameters were performed near the atmospheric pressure and temperature to obtain the electric dipole moment, mass density, and self-diffusion coefficient. In addition, the microscopic structure of the liquid was characterized via pair correlation functions between selected atoms. It has been demonstrated that the electric dipole moment can be approximated within 1% of the average experimental value by virtue of scaled atomic partial charges. The liquid mass density can be predicted within 0.5-1% of its experimentally determined value when using the corresponding charge scaling. However, in all cases the predicted self- diffusion coefficient is significantly smaller than a commonly quoted experimental measurement; this result is qualified by the fact that the uncertainty of the experimental value was not available.

  14. Resonant Enhancement of Charge Density Wave Diffraction in the Rare-Earth Tri-Tellurides

    SciTech Connect

    Lee, W.S.; Sorini, A.P.; Yi, M.; Chuang, Y.D.; Moritz, B.; Yang, W.L.; Chu, J.-H.; Kuo, H.H.; Gonzalez, A.G.Cruz; Fisher, I.R.; Hussain, Z.; Devereau, T.P.; Shen, Z.X.


    We performed resonant soft X-ray diffraction on known charge density wave (CDW) compounds, rare earth tri-tellurides. Near the M{sub 5} (3d - 4f) absorption edge of rare earth ions, an intense diffraction peak is detected at a wavevector identical to that of CDW state hosted on Te{sub 2} planes, indicating a CDW-induced modulation on the rare earth ions. Surprisingly, the temperature dependence of the diffraction peak intensity demonstrates an exponential increase at low temperatures, vastly different than that of the CDW order parameter. Assuming 4f multiplet splitting due to the CDW states, we present a model to calculate X-ray absorption spectrum and resonant profile of the diffraction peak, agreeing well with experimental observations. Our results demonstrate a situation where the temperature dependence of resonant X-ray diffraction peak intensity is not directly related to the intrinsic behavior of the order parameter associated with the electronic order, but is dominated by the thermal occupancy of the valence states.

  15. Treatment of halogenated phenolic compounds by sequential tri-metal reduction and laccase-catalytic oxidation.


    Dai, Yunrong; Song, Yonghui; Wang, Siyu; Yuan, Yu


    Halogenated phenolic compounds (HPCs) are exerting negative effects on human beings and ecological health. Zero-valence metal reduction can dehalogenate HPCs rapidly but cannot mineralize them. Enzymatic catalysis can oxidize phenolic compounds but fails to dehalogenate efficiently, and sometimes even produces more toxic products. In this study, [Fe|Ni|Cu] tri-metallic reduction (TMR) and laccase-catalytic oxidation (LCO) processes were combined to sequentially remove HPCs, including triclosan, tetrabromobisphenol A, and 2-bromo-4-fluorophenol in water. The kinetics, pH and temperature dependences of TMR and LCO were obtained. The detailed TMR, LCO, and TMR-LCO transformation pathways of three HPCs were well described based on the identification of intermediate products and frontier molecular orbitals (FMOs) theory. The results showed that the two-stage process worked synergically: TMR that reductively dehalogenated HPCs followed by LCO that completely removed dehalogenated products. TMR was proven to not only improve biodegradability of HPCs but also reduce the yield of potential carcinogenic by-products. Furthermore, a TMR-LCO flow reactor was assembled and launched for 256 h, during which >95% HPCs and >75% TOC were removed. Meanwhile, monitored by microorganism indicators, 83.2%-92.7% acute toxicity of HPCs was eliminated, and the genotoxicity, produced by LCO, was also avoided by using TMR as pretreatment process. PMID:25596562

  16. Photoconductivity of Nanotapes Self-assembled from meso-Tri(4-sulfonatophenyl)monophenylporphine

    NASA Astrophysics Data System (ADS)

    Yeats, A. L.; Massare, B.; Smith, W. F.; Schwab, A. D.; de Paula, J. C.; Johnston, D. E.; Johnson, A. T.


    We have shown^1 that meso-Tetra(4-sulfonatophenyl)porphine (TPPS4) forms well-defined nanorods in acidic solution. Experiments on related molecules provide insight into the mechanisms for self-assembly and photoconduction. Meso-Tri(4-sulfonatophenyl)monophenylporphine (TPPS3) has one fewer sulfonate group than TPPS4, but is otherwise identical. Previous work^2 has shown that, when deposited onto substrates by rotary evaporation, it forms folded nano-ribbons. We have found that, when deposited via immersion and spin-drying, it forms tape-like aggregates of two distinct heights. The larger width of these nanotapes (compared to TPPS4 nanorods) is expected from the smaller in-solution charge of the monomer. The TPPS3 aggregates exhibit photoconductive properties very similar to those of TPPS4. The aggregates ordinarily form in solution, but can also be surface-catalyzed. ^1 A.D. Schwab et al., Nano Letters 4, 1261 (2004). ^2 J. Crusats et al., Chem Commun. 1588 (2003).

  17. Experimental and Computational Study of Trapped Vortex Combustor Sector Rig with Tri-pass Diffuser

    NASA Technical Reports Server (NTRS)

    Hendricks, Robert C.; Shouse, D. T.; Roquemore, W. M.; Burrus, D. L.; Duncan, B. S.; Ryder, R. C.; Brankovic, A.; Liu, N.-S.; Gallagher, J. R.; Hendricks, J. A.


    The Trapped Vortex Combustor (TVC) potentially offers numerous operational advantages over current production gas turbine engine combustors. These include lower weight, lower pollutant emissions, effective flame stabilization, high combustion efficiency, excellent high altitude relight capability, and operation in the lean burn or RQL (Rich burn/Quick mix/Lean burn) modes of combustion. The present work describes the operational principles of the TVC, and provides detailed performance data on a configuration featuring a tri-pass diffusion system. Performance data include EINOx (NO(sub x) emission index) results for various fuel-air ratios and combustor residence times, combustion efficiency as a function of combustor residence time, and combustor lean blow-out (LBO) performance. Computational fluid dynamics (CFD) simulations using liquid spray droplet evaporation and combustion modeling are performed and related to flow structures observed in photographs of the combustor. The CFD results are used to understand the aerodynamics and combustion features under different fueling conditions. Performance data acquired to date are favorable in comparison to conventional gas turbine combustors. Further testing over a wider range of fuel-air ratios, fuel flow splits, and pressure ratios is in progress to explore the TVC performance. In addition, alternate configurations for the upstream pressure feed, including bi-pass diffusion schemes, as well as variations on the fuel injection patterns, are currently in test and evaluation phases.

  18. Helping children adjust--a Tri-Ministry Study: I. Evaluation methodology.


    Boyle, M H; Cunningham, C E; Heale, J; Hundert, J; McDonald, J; Offord, D R; Racine, Y


    This report describes the evaluation methodology of the Tri-Ministry Study--a school-based trial evaluating the effectiveness of three universal programs: (a) a classwide social skills program (SS), (b) a partner reading program (RE); and, (c) a combination of both (SS & RE), to reduce and prevent behavioural maladjustment among children in the primary division (up to grade 3) of Ontario schools. The trial was done between 1991 and 1995. Sixty schools in 11 boards of education took part and were assigned randomly to program(s) during the study. Contributing to the evaluation database are detailed follow-up assessments (observations, ratings, and standard tests) on 2439 children. Three-level growth trajectory models are used to evaluate program effects. The analysis presented for illustration in this report focuses on reading achievement measured by the Wide Range Achievement Test. A companion paper presents the results of the study and discusses important methodological and programmatic issues applicable to this and other prevention studies in the field. PMID:10576535

  19. Photooxidation and subsequent biodegradability of recalcitrant tri-alkyl phosphates TCEP and TBP in water.


    Watts, Michael J; Linden, Karl G


    Biodegradable organic carbon (BDOC) from OH radical oxidation (UV-H2O2) of the recalcitrant industrial anti-foaming agents and flame retardants, tri-n-butyl phosphate (TBP) and tris(2-chloroethyl) phosphate (TCEP), was quantified with respect to the fraction of the TBP or TCEP photooxidized. For 50-96% contaminant oxidation via OH, BDOC was similar in solutions of either compound, and ranged from 0.25 to 0.5 mg L(-1) (TBP0 and TCEP0 = 5 mg L(-1)). In addition, for this contaminant oxidation range, complete dehalogenation of TCEP was observed, along with a significant change in pH. Oxidation of TCEP results in both H+ and Cl(-) release, while the TBP mineralization pathway results in CO2, H2O, H+, and PO4(3-). For low microg/L levels of TCEP contamination in treated surface waters, UV-H2O2 oxidation of TCEP or TBP would not be expected to impact pH or chloride concentrations, however, a portion of the TCEP or TBP oxidation products, likely in non-halogenated aldehyde form, would become an available carbon source for bacterial growth in storage, distribution, or during further physical treatment. PMID:18986671

  20. Tri-ortho-cresyl phosphate induces autophagy of rat spermatogonial stem cells.


    Liu, Meng-Ling; Wang, Jing-Lei; Wei, Jie; Xu, Lin-Lin; Yu, Mei; Liu, Xiao-Mei; Ruan, Wen-Li; Chen, Jia-Xiang


    Tri-ortho-cresyl phosphate (TOCP) has been widely used as plasticizers, plastic softeners, and flame retardants in industry and reported to have a deleterious effect on the male reproductive system in animals besides delayed neurotoxicity. Our preliminary results found that TOCP could disrupt the seminiferous epithelium in the testis and inhibit spermatogenesis, but the precise mechanism is yet to be elucidated. This study shows that TOCP inhibited viability of rat spermatogonial stem cells in a dose-dependent manner. TOCP could not lead to cell cycle arrest in the cells; the mRNA levels of p21, p27, p53, and cyclin D1 in the cells were also not affected by TOCP. Meanwhile, TOCP did not induce apoptosis of rat spermatogonial stem cells. After treatment with TOCP, however, both LC3-II and the ratio of LC3-II/LC3-I were markedly increased; autophagy proteins ATG5 and beclin 1 were also increased after treatment with TOCP, indicating that TOCP could induce autophagy in the cells. Ultrastructural observation under the transmission electron microscopy indicated that autophagic vesicles in the cytoplasm containing extensively degraded organelles such as mitochondria and endoplasmic reticulum increased significantly after the cells were treated with TOCP. In summary, we have shown that TOCP can inhibit viability of rat spermatogonial stem cells and induce autophagy of the cells, without affecting cell cycle and apoptosis. PMID:25385720

  1. A wearable data acquisition system employing one tri-axis accelerometer - biomed 2009.


    Maki, Hiromichi; Yonezawa, Yoshiharu; Ogawa, Hidekuni; Hahn, Allen W; Caldwell, W Morton


    We have developed a heart rate, respiration rate, posture, behavior and activity data acquisition system for monitoring certain health and activity features during daily life. The recording system consists of one tri-axis accelerometer, six low-power active filters, a low-power 8-bit microcontroller (MC) and a 128MB compact flash memory (CFM). The system is attached to the subject's chest and can simultaneously measure dynamic and static acceleration forces. The microcontroller continuously monitors X, Y and Z axis large dynamic acceleration forces that reveal patient movement. If the patient is moving, the MC detects whether the patient is changing body position, walking or running. If the patient is at rest, the MC detects heart rate and respiration rates from the X axis small dynamic acceleration force. The patient's posture is detected from the X and Y axis static acceleration forces. These detected signals are stored into the CFM, and then the data are downloaded to the laptop computer and used for monitoring the certain of the patient's health conditions. PMID:19369800

  2. Transcriptomics analysis of primary mouse thymocytes exposed to bis(tri-n-butyltin)dioxide (TBTO).


    van Kol, Sandra W M; Hendriksen, Peter J M; van Loveren, Henk; Peijnenburg, Ad


    The biocide bis(tri-n-butyltin)oxide (TBTO) causes thymus atrophy in rodents and is toxic to many cell types of which thymocytes are the most sensitive. To obtain insight in the mechanisms of action of TBTO, we exposed primary mouse thymocytes in vitro for 3, 6 and 11 h to 0.1, 0.5, 1 and 2 μM TBTO. Subsequently, the cells were subjected to whole-genome gene expression profiling. Biological interpretation of the gene expression data revealed that TBTO affects a wide range of processes. Cell proliferation related genes were downregulated by all treatments except for 3 and 6 h 0.5 μM TBTO which upregulated these genes. Treatment with TBTO resulted in upregulation of genes involved in endoplasmatic reticulum (ER) stress, NFkB and TNFα pathways, and genes involved in DNA damage, p53 signaling and apoptosis. Remarkably, TBTO also increased the expression of genes that are known to be upregulated during T cell activation or during negative selection of thymocytes. The effect of TBTO on expression of genes involved in ER stress and apoptosis was confirmed by qPCR. Induction of the T cell activation response was corroborated by demonstrating that TBTO exposure resulted in translocation of NFAT to the nucleus, which is an essential event for T cell activation. PMID:22434021

  3. The U.S. EPA Geographic Information System for mapping environmental releases of Toxic Chemical Release Inventory (TRI) chemicals.


    Stockwell, J R; Sorensen, J W; Eckert, J W; Carreras, E M


    This study characterizes the environmental releases of toxic chemicals of the Toxic Chemical Release Inventory (TRI) in the southeastern United States by using the U.S. Environmental Protection Agency (EPA) Geographic Information System (GIS) to map them. These maps show that the largest quantities of TRI releases in the Southeast are usually near densely populated areas. This GIS mapping approach takes the first steps in defining those areas in the region which may be potential exposure zones and which could be strategic targets for future risk screening efforts in this geographic area. PMID:8502789

  4. Short technical reports. Modification of the TRI reagent procedure for isolation of RNA from polysaccharide- and proteoglycan-rich sources.


    Chomczynski, P; Mackey, K


    A modification of the TRI Reagent procedure has been elaborated for isolation of RNA from polysaccharide- and proteoglycan-rich material. In the modified procedure, RNA is precipitated from the aqueous phase by the combined action of isopropanol and a high-salt concentration. Under these conditions, RNA is effectively precipitated while contaminating polysaccharides and proteoglycans remain in the soluble form. The modified precipitation does not prolong or increase the complexity of the TRI Reagent procedure. The new procedure was tested by isolation of RNA from polysaccharide- and proteoglycan-rich tissues such as rat liver and aorta. PMID:8747660

  5. Crystal structure of benzene-1,3,5-tri-carb-oxy-lic acid-4-pyridone (1/3).


    Staun, Selena L; Oliver, Allen G


    Slow co-crystallization of a solution of benzene-1,3,5-tri-carb-oxy-lic acid with a large excess of 4-hy-droxy-pyridine produces an inter-penetrating, three-dimensional, hydrogen-bonded framework consisting of three 4-pyridone and one benzene-1,3,5-tri-carb-oxy-lic acid mol-ecules, C9H6O6·3C5H5NO. This structure represents an ortho-rhom-bic polymorph of the previously reported C-centered, monoclinic structure [Campos-Gaxiola et al. (2014 ▸). Acta Cryst. E70, o453-o454]. PMID:26594492

  6. Tri-Lateral Noor al Salaam High Concentration Solar Central Receiver Program

    SciTech Connect

    Blackmon, James B


    marketing research, identify opportunities for use of this technology, and to the extent possible, secure an agreement leading to a pre-commercialization demonstration or prototype plant. This was accomplished with the agreement to conduct the Noor al Salaam program as a tri-lateral project between Egypt, Israel, and the U.S. The tri-lateral project was led by the University of Alabama in Huntsville (UAH); this included the Egyptian New and Renewable Energy Authority and the Israeli USISTC participants. This project, known was Noor al Salaam, was funded by the U.S. Agency for International Development (USAID) through the Department of Energy (DOE). The Egyptian activity was under the auspices of the Egyptian Ministry of Energy and Electricity, New and Renewable Energy Authority (NREA) as part of Egypt's plans for renewable energy development. The objective of the Noor al Salaam project was to develop the conditions necessary to obtain funding and construct and operate an approximately 10 to 20 Megawatt hybrid solar/natural gas demonstration power plant in Zaafarana, Egypt that could serve both as a test bed for advanced solar technology evaluations, and as a forerunner to commercial plant designs. This plant, termed Noor Al Salaam, or “Light of Peace”, reached the initial phase of system definition before being curtailed, in part by changes in USAID objectives, coupled with various delays that were beyond the scope of the program to resolve. The background of the USISTF technology development and pre-commercialization effort is provided in this report, together with documentation of the technology developments conducted under the Noor al Salaam program. It should be noted that only a relatively small part of the Noor al Salaam funding was expended over the approximately five years for which UAH was prime contractor before the program was ordered closed (Reference 1) so that the remaining funds could be returned to USAID.

  7. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2014 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  8. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2013 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  9. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2011 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  10. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2012 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  11. triADD: The Risk for Alcohol Abuse, Depression, and Diabetes Multimorbidity in the American Indian and Alaska Native Population

    ERIC Educational Resources Information Center

    Tann, Sheila S.; Yabiku, Scott T.; Okamoto, Scott K.; Yanow, Jessica


    This study examined the risk for alcoholism, diabetes, and depression (triADD) in American Indian/Alaska Native (AI/AN) populations in the U.S. Using the Behavioral Risk Factor Surveillance System, a series of descriptive statistics and regression models were used to examine the interrelationships among these disorders in AI/AN populations.…

  12. Trying to lose weight among non-overweight university students from 22 low, middle and emerging economy countries.


    Peltzer, Karl; Pengpid, Supa


    The aim of this study was to assess the prevalence of trying to lose weight among non-overweight in university students and its sociodemographic and behavioural factors from 22 low and middle income and emerging economy countries. In a cross-sectional survey we took anthropometric measurements and used a self-administered questionnaire among 15997 undergraduate university students (mean age 20.8, Standard deviation=2.8, age range of 16-30 years) from 22 universities in 22 countries. Body mass index (BMI) was used for weight status. Results indicate that 27.1% non-overweight students were trying to lose weight, 34.6% among women and 16.5% among men. Among underweight or normal weight students, 19.0% perceived themselves to be overweight, 11.3% were dieting to lose weight, and 53.5% considered to lose weight of high importance. Multivariate logistic regression found that being female, coming from a low income country, the perception of being overweight, high importance of losing weight, dieting to lose weight, trying to eat fibre, and avoiding foods with fat and cholesterol were associated with trying to lose weight in non-overweight university students. The study found a high prevalence of weight control practices and several specific risk factors were identified that can be utilized in interventions to target unhealthy weight control measures. PMID:25740756

  13. A spliceosome intermediate with loosely associated tri-snRNP accumulates in the absence of Prp28 ATPase activity.


    Boesler, Carsten; Rigo, Norbert; Anokhina, Maria M; Tauchert, Marcel J; Agafonov, Dmitry E; Kastner, Berthold; Urlaub, Henning; Ficner, Ralf; Will, Cindy L; Lührmann, Reinhard


    The precise role of the spliceosomal DEAD-box protein Prp28 in higher eukaryotes remains unclear. We show that stable tri-snRNP association during pre-catalytic spliceosomal B complex formation is blocked by a dominant-negative hPrp28 mutant lacking ATPase activity. Complexes formed in the presence of ATPase-deficient hPrp28 represent a novel assembly intermediate, the pre-B complex, that contains U1, U2 and loosely associated tri-snRNP and is stalled before disruption of the U1/5'ss base pairing interaction, consistent with a role for hPrp28 in the latter. Pre-B and B complexes differ structurally, indicating that stable tri-snRNP integration is accompanied by substantial rearrangements in the spliceosome. Disruption of the U1/5'ss interaction alone is not sufficient to bypass the block by ATPase-deficient hPrp28, suggesting hPrp28 has an additional function at this stage of splicing. Our data provide new insights into the function of Prp28 in higher eukaryotes, and the requirements for stable tri-snRNP binding during B complex formation. PMID:27377154

  14. Arabidopsis TTG2 Regulates TRY Expression through Enhancement of Activator Complex-Triggered Activation[C][W

    PubMed Central

    Pesch, Martina; Dartan, Burcu; Birkenbihl, Rainer; Somssich, Imre E.; Hülskamp, Martin


    Trichome patterning in Arabidopsis thaliana is regulated by a regulatory feedback loop of the trichome promoting factors TRANSPARENT TESTA GLABRA1 (TTG1), GLABRA3 (GL3)/ENHANCER OF GL3 (EGL3), and GL1 and a group of homologous R3MYB proteins that act as their inhibitors. Together, they regulate the temporal and spatial expression of GL2 and TTG2, which are considered to control trichome cell differentiation. In this work, we show that TTG2 is a specific activator of TRY (but not CPC or GL2). The WRKY protein TTG2 binds to W-boxes in a minimal promoter fragment of TRY, and these W-boxes are essential for rescue of the try mutant phenotype. We further show that TTG2 alone is not able to activate TRY expression, but rather drastically enhances the activation by TTG1 and GL3. As TTG2 physically interacts with TTG1 and because TTG2 can associate with GL3 through its interaction with TTG1, we propose that TTG2 enhances the activity of TTG1 and GL3 by forming a protein complex. PMID:25304203

  15. A spliceosome intermediate with loosely associated tri-snRNP accumulates in the absence of Prp28 ATPase activity

    PubMed Central

    Boesler, Carsten; Rigo, Norbert; Anokhina, Maria M.; Tauchert, Marcel J.; Agafonov, Dmitry E.; Kastner, Berthold; Urlaub, Henning; Ficner, Ralf; Will, Cindy L.; Lührmann, Reinhard


    The precise role of the spliceosomal DEAD-box protein Prp28 in higher eukaryotes remains unclear. We show that stable tri-snRNP association during pre-catalytic spliceosomal B complex formation is blocked by a dominant-negative hPrp28 mutant lacking ATPase activity. Complexes formed in the presence of ATPase-deficient hPrp28 represent a novel assembly intermediate, the pre-B complex, that contains U1, U2 and loosely associated tri-snRNP and is stalled before disruption of the U1/5′ss base pairing interaction, consistent with a role for hPrp28 in the latter. Pre-B and B complexes differ structurally, indicating that stable tri-snRNP integration is accompanied by substantial rearrangements in the spliceosome. Disruption of the U1/5′ss interaction alone is not sufficient to bypass the block by ATPase-deficient hPrp28, suggesting hPrp28 has an additional function at this stage of splicing. Our data provide new insights into the function of Prp28 in higher eukaryotes, and the requirements for stable tri-snRNP binding during B complex formation. PMID:27377154

  16. Impulsivity and polysubstance use: A systematic comparison of delay discounting in mono, dual, and tri-substance use

    PubMed Central

    Moody, Lara; Franck, Christopher; Hatz, Laura; Bickel, Warren K.


    Understanding the association between polysubstance use and impulsivity is pertinent to treatment planning and efficacy. Delay discounting, a measure of impulsivity, supplies the rate at which a reinforcer loses value as the temporal delay to its receipt increases. Excessive delay discounting has been widely observed among drug using individuals; though, the impact of using more than one substance has been only minimally studied. Here, after controlling for demographic variables, we systematically compare delay discounting in community controls, heavy smokers, alcohol-dependent, and cocaine-dependent individuals to assess the impact of non-, mono-, dual-, and tri-substance use. All substance-using groups discount significantly more than community controls (p < 0.05). Additionally, groups that smoke cigarettes in addition to another substance dependency discount significantly more than cigarette smoking alone (p < 0.05). Lastly, tri-substance users who were alcohol-dependent, cocaine-dependent and heavy cigarette smokers discount significantly more than heavy smokers (p < 0.01). However, tri-substance users do not discount significantly more than any dual-substance group. Tri-substance use is associated with greater impulsivity than mono-substance smoking, but no greater impulsivity than dual-substance users, suggesting a ceiling effect on discounting when more than two substances are in use. The present study suggests that smokers who engage in additional substance use may experience worse treatment outcomes given that excessive discounting is predictive of poor therapeutic outcomes in several studies. PMID:26691847

  17. 78 FR 12716 - Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri-Cities, Tennessee...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Foreign-Trade Zones Board Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri-Cities, Tennessee/Virginia Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the Foreign-Trade Zones Board (the Board) adopts the following...

  18. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2010 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  19. Symmetry-free cryo-EM structures of the chaperonin TRiC along its ATPase-driven conformational cycle

    PubMed Central

    Cong, Yao; Schröder, Gunnar F; Meyer, Anne S; Jakana, Joanita; Ma, Boxue; Dougherty, Matthew T; Schmid, Michael F; Reissmann, Stefanie; Levitt, Michael; Ludtke, Steven L; Frydman, Judith; Chiu, Wah


    The eukaryotic group II chaperonin TRiC/CCT is a 16-subunit complex with eight distinct but similar subunits arranged in two stacked rings. Substrate folding inside the central chamber is triggered by ATP hydrolysis. We present five cryo-EM structures of TRiC in apo and nucleotide-induced states without imposing symmetry during the 3D reconstruction. These structures reveal the intra- and inter-ring subunit interaction pattern changes during the ATPase cycle. In the apo state, the subunit arrangement in each ring is highly asymmetric, whereas all nucleotide-containing states tend to be more symmetrical. We identify and structurally characterize an one-ring closed intermediate induced by ATP hydrolysis wherein the closed TRiC ring exhibits an observable chamber expansion. This likely represents the physiological substrate folding state. Our structural results suggest mechanisms for inter-ring-negative cooperativity, intra-ring-positive cooperativity, and protein-folding chamber closure of TRiC. Intriguingly, these mechanisms are different from other group I and II chaperonins despite their similar architecture. PMID:22045336

  20. Tri-service thermal flash test facility. Summary report. Final report 15 Dec 78-15 Dec 79

    SciTech Connect

    Wilt, B.H.; Servais, R.A.; Olson, N.J.


    This report describes the status of the Tri-Service Thermal Nuclear Flash Test Facility. It describes the improvements in facility capabilities that were incorporated during the the past 12 months to enhance thermal flash simulation. The report also summarizes all tests for the continuation of a comprehensive data base.

  1. Tri-Axial Accelerometry and Heart Rate Telemetry: Relation and Agreement with Behavioral Observation in Elementary Physical Education

    ERIC Educational Resources Information Center

    Scruggs, Philip W.; Beveridge, Sandy K.; Clocksin, Brian D.


    The relation and agreement of tri-axial accelerometry and heart rate telemetry in measuring moderate to vigorous physical activity were examined in association to behavioral observation during 1st- and 2nd-grade physical education. In Study 1, physical activity measures of heart rate and behavioral observation were collected on 346 participants…

  2. Tri-cresyl phosphate neuropathy in Sri Lanka: a clinical and neurophysiological study with a three year follow up.

    PubMed Central

    Senanayake, N


    Clinical and neurophysiological findings in twenty patients intoxicated with tri-cresyl phosphate following consumption of contaminated gingili oil are reported. Marked distal axonopathy, high incidence of pyramidal tract dysfunction and minimal sensory abnormalities were the cardinal features. Despite pronounced motor weakness in the early stages, the patients showed remarkable improvement during a three year follow up. PMID:7310416

  3. Extraction of titanium(IV) gallate into tri-iso-octylam1ne and its spectrophotometric determination.


    Athavale, V T; Krishnamurthy, K R; Venkateswarlu, C


    Extraction of titanium(IV) gallate species into tri-iso-octylamine (TIOA) has been studied to develop a spectrophotometric method for the determination of titanium. The behaviour of common ions, under the conditions for quantitative extraction of titanium, is reported. Examples are given of application of the method to analysis of steels, reactor-grade thoria, and silicate rocks. PMID:18960298

  4. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2013 CFR


    ... 33 Navigation and Navigable Waters 2 2013-07-01 2013-07-01 false Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR. 165.T13-209 Section 165.T13-209 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS...

  5. Palisade Russet and Teton Russet: Two New Potato Cultivars from the Northwest (Tri-State) Potato Variety Development Program

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The Tri-State Potato Variety Development Program released two potato cultivars in 2011: Palisade Russet and Teton Russet. Palisade Russet (PR) is notable for having resistance to foliar and tuber late blight. PR is also resistant to Verticillium wilt, black dot, and pink rot, and has a moderate re...

  6. Opportunities in the Classroom or Cafeteria for a "Tasting Challenge" to Influence First Grade Students' Willingness to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura L.; Conlon, Tara; Cunningham-Sabo, Leslie; Johnson, Susan L.


    Purpose/Objective: To develop and implement a "Tasting Challenge" activity that is feasible for schools to influence and measure the willingness of elementary students to try new foods. Methods: The Tasting Challenge was as part of a classroom activity. Children were individually offered jicama and edamame to taste and rate (yummy, ok,…

  7. Piloting a Cooperative Extension Service Nutrition Education Program on First-Grade Children's Willingness to Try Foods Containing Legumes

    ERIC Educational Resources Information Center

    Edwards, Cassandra S.; Hermann, Janice R.


    Many nutrition education campaigns targeting children in the United States focus on increasing fruit and vegetable consumption, but most don't specifically promote legumes. The project described here sought to pilot the effect of an Extension nutrition education program on first grade children's willingness to try foods containing legumes. A…

  8. What Lies beyond the Bubble? Trying out One of the Stanford History Education Group's New History Assessments

    ERIC Educational Resources Information Center

    Gerwin, David


    Trying out a "Beyond the Bubble" assessment in a social studies methods classroom revealed that the assessment worked much better than any multiple choice item while retaining great ease in marking. However, as discussion of the item showed, the rubrics for the item apply the "sourcing" heuristic so literally that it loses some…


    EPA Science Inventory

    The developmental toxicity of tri-ortho-cresyl phosphate (TOCP) was evaluated in Long-Evans rats. Pregnant rats were treated with 87.5, 175, and 350 mg/kg/day TOCP throughout organogenesis from gestation day 6 through 18 (day of sperm = day 0). The highest dose tested (350 mg/kg)...

  10. Synthesis and Ligand-Exchange Reactions of a Tri-Tungsten Cluster with Applications in Biomedical Imaging

    ERIC Educational Resources Information Center

    Noey, Elizabeth; Curtis, Jeff C.; Tam, Sylvia; Pham, David M.; Jones, Ella F.


    In this experiment students are exposed to concepts in inorganic synthesis and various spectroscopies as applied to a tri-tungsten cluster with applications in biomedical imaging. The tungsten-acetate cluster, Na[W[superscript 3](mu-O)[subscript 2](CH[superscript 3]COO)[superscript 9

  11. 77 FR 10475 - Tri-State Generation and Transmission Association, Inc., Notice of Intent To Hold Public Scoping...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Rural Utilities Service Tri-State Generation and Transmission Association, Inc., Notice of Intent To Hold Public Scoping Meetings and Prepare an Environmental Assessment AGENCY: Rural Utilities Service.... SUMMARY: The Rural Utilities Service (RUS), an agency of the United States Department of...

  12. Assessing head and trunk symmetry during sleep using tri-axial accelerometers.


    Sato, Haruhiko; Ikura, Daiki; Tsunoda, Masahiro


    Using two types of small, lightweight tri-axial accelerometers, we obtained evidence for the effectiveness of an approach for assessing head-trunk symmetrical or asymmetrical positions during sleep. First, we assessed the accuracy of our monitoring system in five healthy young adults (age range, 22-24 years). The participants wore acceleration monitors on the sternum and forehead; then spent 5 min in six different positions. Once accuracy was confirmed, we assessed head-trunk symmetry during night-time sleep in 10 healthy children (age range, 3-13 years) and 10 young adults (age range, 21-26 years) in their home environments. All participants wore the monitors during one night's sleep in their homes. After computing head-trunk positions using the orientation data obtained by the accelerometers, head and trunk symmetry were evaluated. The head and trunk positions were correctly detected: the positional data from the trunk had 99% agreement, and the data from the head had 96% agreement. Both the young adults and children were observed to spend time with the head-trunk in asymmetric positions; however, the subjects changed position frequently so the asymmetrical postures were mobile. We concluded that the proposed monitoring system is a reliable and valid approach for assessing head-trunk symmetry during sleep at home. Implications for Rehabilitation We propose a head and trunk symmetry monitoring system using accelerometers. The proposed system could accurately identify head and trunk position. Asymmetrical positioning was seen in healthy participants but it was not immobile. PMID:24274623

  13. Tri-axial Shape Coexistence and a New Aligned Band in 178Os

    NASA Astrophysics Data System (ADS)

    Govil, I. M.


    The Os nuclei lie in the beginning of the transitional region between the well deformed rare earth and spherical lead isotopes. The nuclei in this region are believed to be soft to changes in gamma deformation due to the softness of nuclear potential which may result in the shape coexistence. The neutron Fermi levels in Os nuclei from A = 170 to A = 186 lie in the middle of i13/2 orbital so that their shape in the ground state tends to take an appreciable prolate deformation. Hence collective bands with the well defined moment of inertia occur and the effect of different proton orbitals is observed as a modulation of the prolate structure. The anomalies in the yrast sequence, an effect attributed to change in moment of inertia of the ground state rotational band and the band crossing phenomena, are very important and vary strongly with neutron number in case of Os nuclei. The nuclear structure of 178Os nucleus has been studied using the reaction 165Ho (20Ne, p6n) 178Os. Indian National Gamma Array (INGA) consisting of six Clover detectors with anti Compton shields was used for the detection of resulting gamma rays. The Direction Correlation of γ-rays de-exciting Oriented states (DCO) ratio and polarization of gamma rays were measured to assign spin, parity and multipolarity of transitions. Twenty one new transitions belonging to the 178Os nucleus have been identified. The sudden and rather strong gain in aligned angular momentum is observed in the yrast band of 178Os. A new aligned rotational band similar to 180Os is also discovered in this nucleus. This band exhibits a very complex decay pattern with a single linking transition of 1778 keV to the ground state band. The tri-axial shape co-existence is also observed in this nucleus at higher excitation. The experimental results are compared with the Microscopic Hartree-Fock model calculations.

  14. Transport of chromium(VI) through a supported liquid membrane containing tri-n-octylphosphine oxide

    SciTech Connect

    Huang, T.C.; Huang, C.C.; Chen, D.H.


    In this study the transport of chromium(VI) from aqueous solutions of pH 2--4 through a supported liquid membrane (SLM) with tri-n-octylphosphine oxide (TOPO) dissolved in kerosene as a mobile carrier was investigated. The transport flux of Cr(VI) increased with an increase in the concentrations of Cr(VI) in the feed phase and of TOPO in the membrane phase, but with a decrease in pH of the feed phase. Considering the equilibria of various Cr(VI) species in the aqueous phase and of the Cr(VI)-TOPO complexes formed in the membrane phase, a permeation model including the aqueous film diffusion of HCrO{sub 4}{sup {minus}} and Cr{sub 2}O{sub 7}{sup 2{minus}} toward the membrane, the interfacial chemical reaction between them and TOPO, and the membrane diffusion of the Cr(VI)-TOPO complexes ({ovr H{sub 2}CrO{sub 4}{center_dot}(TOPO)} and {ovr H{sub 2}Cr{sub 2}O{sub 7}{center_dot}(TOPO){sub 3}}) was proposed to describe the transport of Cr(VI) through the SLM. By best fitting the transport flux equations of Cr(VI) with the experimental data using the Rosenbrock method, the apparent mass-transfer coefficients of HCrO{sub 4}{sup {minus}} and Cr{sub 2}O{sub 7}{sup 2{minus}} across the aqueous film, and those of {ovr H{sub 2}CrO{sub 4}{center_dot}(TOPO)} and {ovr H{sub 2}Cr{sub 2}O{sub 7}{center_dot}(TOPO){sub 3}} across the membrane phase, were obtained. This work helps to clarify the transport mechanism of Cr(VI) through an SLM.

  15. Tri-trophic insecticidal effects of African plants against cabbage pests.


    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C


    -available Ghanaian plants give beneficial, tri-trophic benefits and merit further research as an inexpensive plant protection strategy for smallholder farmers in West Africa. PMID:24205287

  16. Toxic Release Inventory (TRI), 1987-1994 (on cd-rom). Data file

    SciTech Connect


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a national inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the states of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The following information is required on Form R: the name, location and type of business; off-site locations to which the facility transfers toxic chemicals in waste; whether the chemical is manufactured (including importation), processed, or otherwise used and the general categories of use of the chemical; an estimate (in ranges) of the maximum amounts of the toxic chemical present at the facility at any time during the preceding year; quantity of the chemical entering each medium - air, land, and water - annually; waste treatment/disposal methods and efficiency of methods for each waste stream; optional information on waste minimization; and a certification by a senior facility official that the report is complete and accurate. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience.

  17. Growth and characterization of an organometallic tri-allylthiourea complex nonlinear optical crystals

    NASA Astrophysics Data System (ADS)

    Perumal, R.; Moorthy Babu, S.


    A novel family of allylthiourea metal complexes was identified for photonic applications with allylthiourea serving as a double ligand, and II (B) group metals were chosen as a co-ordination metal. This family belongs to an island-type organometallic category. A series of optically negative nonlinear optical (NLO) crystals (ATCC, ATCB, ATMC and ATMB) have been prepared. Their SHG efficiency was an order of magnitude higher than that of the well-known organic crystal, urea. The properties of allylthiourea complex with central atom Cd were compared with the crystals with another central atom Hg. The latter has longer transparency cut-off wavelength, higher thermal stability and SHG efficiencies. These organometallic tri-allylthiourea complex crystals were grown from the aqueous solution by temperature-lowering technique. Comprehensive studies of synthesis, solubility, crystal growth and the general properties including structural, spectral, optical and thermal properties were analyzed by conducting various characterization techniques. They were synthesized in the de-ionized water and the solubilities of each material were determined by employing thermogravimetric analysis. The growth conditions were analyzed in terms of the pH value of the mother solution because it plays a vital role during the growth. Their structural properties were examined by recording the powder X-ray diffraction pattern. The crystal formation and the metal co-ordination were confirmed by the spectral analysis. The transmission spectrum of these crystals shows a wide transparent UV-vis-NIR band. The thermal behavior of these complexes was studied from the thermal studies. Their NLO efficiencies were analyzed through the Kurt'z technique.

  18. Fabrication and analysis of a micro-machined tri-axis gyroscope

    NASA Astrophysics Data System (ADS)

    Tsai, Nan-Chyuan; Sue, Chung-Yang


    This paper presents an innovative micro-gyroscope design. Solely by SOI (silicon on insulator) fabrication technology and wet etching, the proposed micro-gyroscope can be produced in batch and is capable of detecting three-axis angular rates. The induced motions of all individual seismic mass modules are designed to respond in the directions orthogonal to each other in order to decouple the obtained measurements. In our work, three pairs of high-resolution differential capacitors with signal processing circuits are employed to measure the angular velocity components in three axes. On the other hand, the drive electrode comb is used to constantly vibrate the outer-ring in the tangential direction by a sinusoidal voltage. The signal bandwidth is increased by distributed translational proof masses (DTPM), placed 90° apart orderly. Each individual proof mass of DTPM is designed with natural frequency discrepancy and constrained to move in the radial direction so that the superior mode matching can be easily, to some extent, achieved. The suspension flexures are particularly designed to resist planar displacements in the drive mode but increase the stroke of tilting angular displacement in the sense mode. By considering the complicated geometry of the suspension flexures, FEM (finite element method) is employed to examine the potential maximum induced mechanical stress. The dynamic equations of the proposed gyroscope are established so that the embedded gyroscopic effects are explicitly unveiled. More importantly, the efficacy of the drive and sense circuit modules are verified by commercial softwares Hspice and Multisim. By intensive computer simulations and preliminary experimental studies, the resolution, bandwidth and decoupling capability of the tri-axis gyroscope are expected to be fairly enhanced if a certain degree of trade-off is preset.Corrections were made to figure 5 in this article on 3 October 2008. The corrected electronic version is identical to the

  19. Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests

    PubMed Central

    Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.


    -available Ghanaian plants give beneficial, tri-trophic benefits and merit further research as an inexpensive plant protection strategy for smallholder farmers in West Africa. PMID:24205287

  20. Reliability and validity of measures of impulsive choice and impulsive action in smokers trying to quit.


    McCarthy, Danielle E; Bold, Krysten W; Minami, Haruka; Yeh, Vivian M; Rutten, Emily; Nadkarni, Shruti G; Chapman, Gretchen B


    Cross-sectional research suggests that smokers are more impulsive than are nonsmokers, but few studies have examined relations between impulsiveness and later success in quitting smoking. The purpose of this study was to investigate the reliability and predictive validity of facets of impulsiveness in adult smokers trying to quit. Baseline behavioral measures of impulsive choice (assessed with a delay discounting task) and impulsive action (assessed with a measure of behavioral disinhibition) were used as predictors of smoking cessation success over 12 weeks. The sample included 116 adult (18 years old or older) daily smokers from central New Jersey. Impulsive choice, impulsive action, and self-reported impulsiveness were not significantly related to one another at baseline. Impulsive choice had high test-retest reliability from pre- to postquit, whereas impulsive action was less stable. Test-retest reliability from prequit to 3 weeks' postquit was moderated by achievement of 7-day abstinence. Baseline impulsive action was significantly negatively related to quitting for at least 1 day in the first 2 weeks of a quit attempt and of prolonged abstinence (no relapse over the next 10 weeks). Baseline impulsive choice was robustly associated with biochemically verified 7-day point-prevalence abstinence 12 weeks' postquit, such that those with lower delay discounting were more likely to achieve abstinence. Facets of impulsiveness appear to function largely independently in adult smokers, as indicated by their lack of intercorrelation, differential stability, and differential relations with abstinence. Impulsive action may impede initial quitting, whereas impulsive choice may be an obstacle to maintaining lasting abstinence. (PsycINFO Database Record PMID:26751623

  1. Tris(bis(trimethylsilyl)amido)uranium: Compounds with tri-, tetra-, and penta-valent uranium

    SciTech Connect

    Stewart, J.L.


    This trivalent uranium compound, serves as a precursor to new tri-, tetra-, and penta-valent uranium species. The geometry about the U atom is pyramidal. Lewis-base coordination compounds of U(N(SiMe/sub 3/)/sub 2/)/sub 3/ with a one-to-one- ratio of Lewis base to uranium were isolated with pyridine, 4-dimethylamino-pyridine, 2,6-Me/sub 2/-C/sub 6/H/sub 3/NC, and TPO. Two-to-one coordination compounds were obtained with t-butylnitrile and t-butylisocyanide. Compounds with more sterically demanding bases could not be isolated. The expected decrease in U-N(SiMe/sub 3/)/sub 2/ bond length with increase in oxidation state is not observed. Reaction of ClU(N(SiMe/sub 3/)/sub 2/)/sub 3/and Li(NH(p-tolyl)) yields the uranium (IV) dimer, U/sub 2/(N(SiMe/sub 3/)/sub 2/)/sub 4/( 2/. Reaction with 2,4,6-triemethylaniline produces a dimer. Analogous substitution products could not be obtained with aniline or p-toluidine. t-Bu/sub 3/CO/sup /minus//, t-Bu/sub 2/CHO/sup /minus//, and t-Bu/sub 3/SiO/sup /minus// are used to synthesize new tetravalent, mononuclear uranium compounds. Reaction of ClU(tritox)/sub 3/ with alkyllithium reagents leads to isolation of RU(tritox)/sub 3/. The reaction of U(ditox)/sub 4/ with MeLi affords the addition product U(ditox)/sub 4/(Me)Li, whose crystal structure is described. Preparation of uranium silox compounds is reported. 97 refs., 26 figs., 39 tabs.

  2. Effects of metal surface grinding at the porcelain try-in stage of fixed dental prostheses

    PubMed Central

    Kesim, Bülent; Gümüş, Hasan Önder; Dinçel, Mehmet; Erkaya, Selçuk


    PURPOSE This study was to evaluate the effect of grinding of the inner metal surface during the porcelain try-in stage on metal-porcelain bonding considering the maximum temperature and the vibration of samples. MATERIALS AND METHODS Ninety-one square prism-shaped (1 × 1 × 1.5 mm) nickel-chrome cast frameworks 0.3 mm thick were prepared. Porcelain was applied on two opposite outer axial surfaces of the frameworks. The grinding was performed from the opposite axial sides of the inner metal surfaces with a low-speed handpiece with two types of burs (diamond, tungsten-carbide) under three grinding forces (3.5 N, 7 N, 14 N) and at two durations (5 seconds, 10 seconds). The shear bond strength (SBS) test was performed with universal testing machine. Statistical analyzes were performed at 5% significance level. RESULTS The samples subjected to grinding under 3.5 N showed higher SBS values than those exposed to grinding under 7 N and 14 N (P<.05). SBS values of none of the groups differed from those of the control group (P>.05). The types of bur (P=.965) and the duration (P=.679) did not affect the SBS values. On the other hand, type of bur, force applied, and duration of the grinding affected the maximum temperatures of the samples, whereas the maximum vibration was affected only by the type of bur (P<.05). CONCLUSION Grinding the inner metal surface did not affect the metal-porcelain bond strength. Although the grinding affected the maximum temperature and the vibration values of the samples, these did not influence the bonding strength. PMID:25177476

  3. Distinguishing the causes of falls in humans using an array of wearable tri-axial accelerometers.


    Aziz, Omar; Park, Edward J; Mori, Greg; Robinovitch, Stephen N


    Falls are the number one cause of injury in older adults. Lack of objective evidence on the cause and circumstances of falls is often a barrier to effective prevention strategies. Previous studies have established the ability of wearable miniature inertial sensors (accelerometers and gyroscopes) to automatically detect falls, for the purpose of delivering medical assistance. In the current study, we extend the applications of this technology, by developing and evaluating the accuracy of wearable sensor systems for determining the cause of falls. Twelve young adults participated in experimental trials involving falls due to seven causes: slips, trips, fainting, and incorrect shifting/transfer of body weight while sitting down, standing up from sitting, reaching and turning. Features (means and variances) of acceleration data acquired from four tri-axial accelerometers during the falling trials were input to a linear discriminant analysis technique. Data from an array of three sensors (left ankle+right ankle+sternum) provided at least 83% sensitivity and 89% specificity in classifying falls due to slips, trips, and incorrect shift of body weight during sitting, reaching and turning. Classification of falls due to fainting and incorrect shift during rising was less successful across all sensor combinations. Furthermore, similar classification accuracy was observed with data from wearable sensors and a video-based motion analysis system. These results establish a basis for the development of sensor-based fall monitoring systems that provide information on the cause and circumstances of falls, to direct fall prevention strategies at a patient or population level. PMID:24148648

  4. Reliability and Validity of Measures of Impulsive Choice and Impulsive Action in Smokers Trying to Quit

    PubMed Central

    McCarthy, Danielle E.; Bold, Krysten W.; Minami, Haruka; Yeh, Vivian M.; Rutten, Emily; Nadkarni, Shruti G.; Chapman, Gretchen B.


    Cross-sectional research suggests that smokers are more impulsive than are non-smokers, but few studies have examined relations between impulsiveness and later success in quitting smoking. The purpose of this study was to investigate the reliability and predictive validity of facets of impulsiveness in adult smokers trying to quit. Baseline behavioral measures of impulsive choice (assessed with a delay discounting task) and impulsive action (assessed with a measure of behavioral disinhibition) were used as predictors of smoking cessation success over 12 weeks. The sample included 116 adult (18 years old or older) daily smokers from central New Jersey. Impulsive choice, impulsive action, and self-reported impulsiveness were not significantly related to one another at baseline. Impulsive choice had high test-retest reliability from pre- to post-quit, whereas impulsive action was less stable. Test-retest reliability from pre-quit to three weeks post-quit was moderated by achievement of seven-day abstinence. Baseline impulsive action was significantly negatively related to quitting for at least one day in the first two weeks of a quit attempt and of prolonged abstinence (no relapse over the next 10 weeks). Baseline impulsive choice was robustly associated with biochemically verified seven-day point-prevalence abstinence 12 weeks post-quit, such that those with lower delay discounting were more likely to achieve abstinence. Facets of impulsiveness appear to function largely independently in adult smokers, as indicated by their lack of inter-correlation, differential stability, and differential relations with abstinence. Impulsive action may impede initial quitting, whereas impulsive choice may be an obstacle to maintaining lasting abstinence. PMID:26751623

  5. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry

    NASA Astrophysics Data System (ADS)

    Whiddon, R.; Zhou, B.; Borggren, J.; Aldén, M.; Li, Z. S.


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 62S1/2 → 52P1/2 and 62S1/2 → 52P3/2 transitions as a function of the calculated TMI seeding concentration over a range of 2-45 ppm. The response was found to be linear over the range 3-22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence.

  6. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry.


    Whiddon, R; Zhou, B; Borggren, J; Aldén, M; Li, Z S


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 6(2)S1/2 → 5(2)P1/2 and 6(2)S1/2 → 5(2)P3/2 transitions as a function of the calculated TMI seeding concentration over a range of 2-45 ppm. The response was found to be linear over the range 3-22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence. PMID:26429429

  7. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry

    SciTech Connect

    Whiddon, R.; Zhou, B.; Borggren, J.; Aldén, M.; Li, Z. S.


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 6{sup 2}S{sub 1/2} → 5{sup 2}P{sub 1/2} and 6{sup 2}S{sub 1/2} → 5{sup 2}P{sub 3/2} transitions as a function of the calculated TMI seeding concentration over a range of 2–45 ppm. The response was found to be linear over the range 3–22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence.

  8. In-shoe plantar tri-axial stress profiles during maximum-effort cutting maneuvers.


    Cong, Yan; Lam, Wing Kai; Cheung, Jason Tak-Man; Zhang, Ming


    Soft tissue injuries, such as anterior cruciate ligament rupture, ankle sprain and foot skin problems, frequently occur during cutting maneuvers. These injuries are often regarded as associated with abnormal joint torque and interfacial friction caused by excessive external and in-shoe shear forces. This study simultaneously investigated the dynamic in-shoe localized plantar pressure and shear stress during lateral shuffling and 45° sidestep cutting maneuvers. Tri-axial force transducers were affixed at the first and second metatarsal heads, lateral forefoot, and heel regions in the midsole of a basketball shoe. Seventeen basketball players executed both cutting maneuvers with maximum efforts. Lateral shuffling cutting had a larger mediolateral braking force than 45° sidestep cutting. This large braking force was concentrated at the first metatarsal head, as indicated by its maximum medial shear stress (312.2 ± 157.0 kPa). During propulsion phase, peak shear stress occurred at the second metatarsal head (271.3 ± 124.3 kPa). Compared with lateral shuffling cutting, 45° sidestep cutting produced larger peak propulsion shear stress (463.0 ± 272.6 kPa) but smaller peak braking shear stress (184.8 ± 181.7 kPa), of which both were found at the first metatarsal head. During both cutting maneuvers, maximum medial and posterior shear stress occurred at the first metatarsal head, whereas maximum pressure occurred at the second metatarsal head. The first and second metatarsal heads sustained relatively high pressure and shear stress and were expected to be susceptible to plantar tissue discomfort or injury. Due to different stress distribution, distinct pressure and shear cushioning mechanisms in basketball footwear might be considered over different foot regions. PMID:25468303

  9. Effects of urbanization on direct and indirect interactions in a tri-trophic system.


    Tabea, Turrini; Dirk, Sanders; Eva, Knop


    While effects of urbanization on species assemblages are receiving increasing attention, effects on ecological interactions remain largely unexplored. We investigated how urbanization influences the strength of direct and indirect trophic interactions in a tri- trophic system. In a field experiment including five cities and nearby farmed areas, we used potted Vicia faba plants and manipulated the presence of Megoura viciae aphids and that of naturally occurring aphid predators. When predators could access aphids, they reduced their abundance less in the urban than in the agricultural ecosystem. Compared to aphid abundance on plants without predator access, abundance on plants with predator access was 2.58 times lower in urban and 5.27 times lower in agricultural areas. This indicates that urbanization limited top-down control of aphids by predators. In both ecosystems, plant biomass was negatively affected by herbivores and positively affected by predators, but the positive indirect predator effect was weaker in cities. Compared to aphid-infested plants without predator access, plants with predator access were 1.89 times heavier in urban and 2.12 times heavier in agricultural areas. Surprisingly, differences between ecosystems regarding the indirect predator effect on plants were not explained by the differentially strong herbivore suppression. Instead, the urban environment limited plant biomass per se, thereby mitigating the scope of a positive predator effect. Our results show that urbanization can influence direct and indirect trophic interactions through effects on biotic top-down forces and on plant growth. In order to understand how urbanization affects biodiversity and ecosystem functioning, it is fundamental to not only consider species assemblages, but also species interactions. PMID:27411241

  10. Design of a prototype tri-electrode ion-chamber for megavoltage X-ray imaging

    NASA Astrophysics Data System (ADS)

    Samant, Sanjiv S.; Gopal, Arun; Jain, Jinesh; Xia, Junyi; DiBianca, Frank A.


    High-energy (megavoltage) X-ray imaging is widely used in industry (e.g., aerospace, construction, material sciences) as well as in health care (radiation therapy). One of the fundamental problems with megavoltage imaging is poor contrast and spatial resolution in the detected images due to the dominance of Compton scattering at megavoltage X-ray energies. Therefore, although megavoltage X-rays can be used to image highly attenuating objects that cannot be imaged at kilovoltage energies, the former does not provide the high image quality that is associated with the latter. A high contrast and spatial resolution detector for high-energy X-ray fields called the kinestatic charge detector (KCD) is presented here. The KCD is a tri-electrode ion-chamber based on highly pressurized noble gas. The KCD operates in conjunction with a strip-collimated X-ray beam (for high scatter rejection) to scan across the imaging field. Its thick detector design and unique operating principle provides enhanced charge signal integration for high quality imaging (quantum efficiency ˜50%) despite the unfavorable implications of high-energy X-ray interactions on image quality. The proposed design for a large-field prototype KCD includes a cylindrical pressure chamber along with 576 signal-collecting electrodes capable of resolving at 2 mm -1. The collecting electrodes are routed out of the chamber through the flat end-cap, thereby optimizing the mechanical strength of the chamber. This article highlights the simplified design of the chamber using minimal components for simple assembly. In addition, fundamental imaging measurements and estimates of ion recombination that were performed on a proof-of-principle test chamber are presented. The imaging performance of the prototype KCD was found to be an order-of-magnitude greater than commercial phosphor screen based flat-panel systems, demonstrating the potential for high-quality megavoltage imaging for a variety of industrial applications.

  11. Bis(2,4,6-tri-amino-pyrimidin-1-ium) sulfate penta-hydrate.


    Nimthong, Ruthairat; Chamchong, Siva; Pakawatchai, Chaveng; Mokhagul, Jedsada; Wattanakanjana, Yupa


    The asymmetric unit of the title salt, 2C4H8N5 (+)·SO4 (2-)·5H2O, contains four 2,4,6-tri-amino-pyrimidinium (TAPH(+)) cations, two sulfate anions and ten lattice water mol-ecules. Each two of the four TAPH(+) cations form dimers via N-H⋯N hydrogen bonds between the amino groups and the unprotonated pyrimidine N atoms [graph-set motif R 2 (2)(8)]. The (TAPH(+))2 dimers, in turn, form slightly offset infinite π-π stacks parallel to [010], with centroid-centroid distances between pyrimidine rings of 3.5128 (15) and 3.6288 (16) Å. Other amino H atoms, as well as the pyrimidinium N-H groups, are hydrogen-bonded to sulfate and lattice water O atoms. The SO4 (2-) anions and water mol-ecules are inter-connected with each other via O-H⋯O hydrogen bonds. The combination of hydrogen-bonding inter-actions and π-π stacking leads to the formation of a three-dimensional network with alternating columns of TAPH(+) cations and channels filled with sulfate anions and water mol-ecules. One of the sulfate anions shows a minor disorder by a ca 37° rotation around one of the S-O bonds [occupancy ratio of the two sets of sites 0.927 (3):0.073 (3)]. One water mol-ecule is disordered over two mutually exclusive positions with an occupancy ratio of 0.64 (7):0.36 (7). PMID:24109349

  12. A Tri-Oceanic Perspective: DNA Barcoding Reveals Geographic Structure and Cryptic Diversity in Canadian Polychaetes

    PubMed Central

    Carr, Christina M.; Hardy, Sarah M.; Brown, Tanya M.; Macdonald, Tara A.; Hebert, Paul D. N.


    Background Although polychaetes are one of the dominant taxa in marine communities, their distributions and taxonomic diversity are poorly understood. Recent studies have shown that many species thought to have broad distributions are actually a complex of allied species. In Canada, 12% of polychaete species are thought to occur in Atlantic, Arctic, and Pacific Oceans, but the extent of gene flow among their populations has not been tested. Methodology/Principal Findings Sequence variation in a segment of the mitochondrial cytochrome c oxidase I (COI) gene was employed to compare morphological versus molecular diversity estimates, to examine gene flow among populations of widespread species, and to explore connectivity patterns among Canada's three oceans. Analysis of 1876 specimens, representing 333 provisional species, revealed 40 times more sequence divergence between than within species (16.5% versus 0.38%). Genetic data suggest that one quarter of previously recognized species actually include two or more divergent lineages, indicating that richness in this region is currently underestimated. Few species with a tri-oceanic distribution showed genetic cohesion. Instead, large genetic breaks occur between Pacific and Atlantic-Arctic lineages, suggesting their long-term separation. High connectivity among Arctic and Atlantic regions and low connectivity with the Pacific further supports the conclusion that Canadian polychaetes are partitioned into two distinct faunas. Conclusions/Significance Results of this study confirm that COI sequences are an effective tool for species identification in polychaetes, and suggest that DNA barcoding will aid the recognition of species overlooked by the current taxonomic system. The consistent geographic structuring within presumed widespread species suggests that historical range fragmentation during the Pleistocene ultimately increased Canadian polychaete diversity and that the coastal British Columbia fauna played a minor

  13. Renal replacement therapy in support of Operation Iraqi Freedom: a tri-service perspective.


    Perkins, Robert; Simon, James; Jayakumar, Arun; Neff, Robert; Cohen, Irving; Bohen, Erin; Oliver, James; Kumke, Kevin; Older, Steven; Perkins, Jeremy; Grathwohl, Kurt; Yuan, Christina; Abbott, Kevin


    Experience with delivery of renal replacement therapy (RRT) in support of combat operations by the U.S. military has not been reported since the 1970s. We describe the tri-service military medical experience with RRT in support of Operation Iraqi Freedom. Through December 31, 2006, RRT was provided to 12 individuals inside the theater of operations. Navy medical personnel provided RRT to three patients (two U.S. active duty service members and one host nation individual) aboard the USNS Comfort, a mobile level 4 hospital. Dialysis was performed using conventional single-pass hemodialysis machines equipped with portable reverse osmosis systems. Army and Air Force medical personnel provided RRT to nine patients in theater (eight host nation patients and one U.S. active duty service member), using peritoneal dialysis and continuous renal replacement therapy (CRRT), not requiring trained renal nurses or technicians. Originally, U.S. military personnel with acute kidney injury (AKI) who were evacuated from theater to Landstuhl Regional Medical Center (LRMC), or those who developed AKI at LRMC were transferred to the German civilian medical system, if RRT was required. After creation of a rapid-response dialysis team and, later, positioning of a full-time active duty reserve nephrologist at LRMC, 16 patients received RRT at LRMC. None had required RRT in theater. Renal failure requiring RRT during combat operations remains an unusual but serious event, calling for flexibility in the provision of care. Notably, the Operation Iraqi Freedom experience has highlighted the needs of injured host nation patients with AKI and future military medical planning will need to account for their intratheater renal care. PMID:19055188

  14. Home ovulation tests and stress in women trying to conceive: a randomized controlled trial

    PubMed Central

    Tiplady, S.; Jones, G.; Campbell, M.; Johnson, S.; Ledger, W.


    STUDY QUESTION Does the use of a digital home ovulation test have any effect on the level of stress in women seeking to conceive? SUMMARY ANSWER No difference was found in levels of stress between women using digital ovulation tests to time intercourse compared with women who were trying to conceive without any additional aids: in addition, their use did not negatively impact time to conception in users but may provide additional benefits, including an increased understanding of the menstrual cycle, reassurance and confidence in focusing conception attempts to the correct time in the cycle. WHAT IS KNOWN ALREADY It has been suggested that timing of intercourse in such a way that it coincides with ovulation by using ovulation tests can lead to emotional distress; however, no study has been conducted to investigate this hypothesis specifically, until now. STUDY DESIGN, SIZE AND DURATION The study was performed over two complete menstrual cycles as a prospective, randomized, controlled trial including quantitative and qualitative methods. The intervention (test) group were given digital ovulation tests to time intercourse to the most fertile time of the cycle and the control group were provided with the current National Institute for Health and Clinical Excellence guidelines for increasing the chances of conception (intercourse every 2–3 days) and asked not to use any additional methods to time when ovulation occurs. PARTICIPANTS/MATERIALS, SETTING AND METHODS A total of 210 women who were seeking to conceive were recruited from the general UK population. A total of 115 women were randomized to the test group and 95 to the control group through block randomization. The positive and negative affect schedule (PANAS) and the Perceived Stress Scale (PSS) were used to measure subjective stress levels, the Short-Form 12 health survey was used as a measure of general health and well-being and urine samples were measured for biochemical markers of stress including urinary

  15. Tri (2-chloroisopropyl) phosphate--an unexpected organochlorine contaminant in some charcoal air-sampling sorbent tubes

    SciTech Connect

    van Netten, C.; Brands, R.; Park, J.; Deverall, R. )


    Air sampling in a government building was necessary in response to reports of a cancer cluster. SKC (Eighty Four, Pa.) charcoal coconut shell-based sorbent tubes (226-01 lot 120) were recommended for this procedure. A recently purchased supply was present at the University of British Columbia and consequently was used for this particular study. Analysis of the front charcoal section showed the presence of a flame retardant, tri (2-chloroisopropyl) phosphate, which was confirmed by gas liquid chromatography (GLC) and mass spectrometry analysis. In an effort to identify the source of this fire retardant in the building, it became apparent from the analysis done on unknown field blanks that tri (2-chloroisopropyl) phosphate was a contaminant of the sorbent tubes used. Analysis of additional blank tubes identified the foam separators as the most likely source of contamination. Levels of tri (2-chloroisopropyl) phosphate in the front charcoal section ranged from 1.3 to 5.9 micrograms. The foam separator contained between 11.4 and 16.5 micrograms, and the backup charcoal section contained between 14.5 and 24.0 micrograms of tri (2-chloroisopropyl) phosphate. In addition, another flame retardant, tri (1,3 dichloro-2-propyl) phosphate was also found. Because these contaminants have long column retention times in GLC, it may not be apparent that these contaminants are present and consequently are likely to have modified the sorbent characteristics of the activated charcoal. Another batch of sorbent tubes bearing the same catalog number and lot number was purchased from the supplier; no flame retardants were found in this batch.

  16. Overexpression of the Trichoderma brevicompactum tri5 Gene: Effect on the Expression of the Trichodermin Biosynthetic Genes and on Tomato Seedlings

    PubMed Central

    Tijerino, Anamariela; Hermosa, Rosa; Cardoza, Rosa E.; Moraga, Javier; Malmierca, Monica G.; Aleu, Josefina; Collado, Isidro G.; Monte, Enrique; Gutierrez, Santiago


    Trichoderma brevicompactum IBT 40841 produces trichodermin, a trichothecene-type toxin that shares most of the steps of its biosynthesis with harzianum A, another trichothecene produced by several Trichoderma species. The first specific step in the trichothecene biosynthesis is carried out by a terpene cylcase, trichodiene synthase, that catalyzes the conversion of farnesyl pyrophosphate to trichodiene and that is encoded by the tri5 gene. Overexpression of tri5 resulted in increased levels of trichodermin production, but also in an increase in tyrosol and hydroxytyrosol production, two antioxidant compounds that may play a regulatory role in trichothecene biosynthesis, and also in a higher expression of three trichothecene genes, tri4, tri6 and tri10, and of the erg1 gene, which participates in the synthesis of triterpenes. The effect of tri5 overexpression on tomato seedling disease response was also studied. PMID:22069764

  17. Tri-axial Shape Coexistence and a New Aligned Band in {sup 178}Os

    SciTech Connect

    Govil, I. M.


    The Os nuclei lie in the beginning of the transitional region between the well deformed rare earth and spherical lead isotopes. The nuclei in this region are believed to be soft to changes in gamma deformation due to the softness of nuclear potential which may result in the shape coexistence. The neutron Fermi levels in Os nuclei from A = 170 to A = 186 lie in the middle of i{sub 13/2} orbital so that their shape in the ground state tends to take an appreciable prolate deformation. Hence collective bands with the well defined moment of inertia occur and the effect of different proton orbitals is observed as a modulation of the prolate structure. The anomalies in the yrast sequence, an effect attributed to change in moment of inertia of the ground state rotational band and the band crossing phenomena, are very important and vary strongly with neutron number in case of Os nuclei. The nuclear structure of {sup 178}Os nucleus has been studied using the reaction {sup 165}Ho({sup 20}Ne, p6n){sup 178}Os. Indian National Gamma Array (INGA) consisting of six Clover detectors with anti Compton shields was used for the detection of resulting gamma rays. The Direction Correlation of {gamma}-rays de-exciting Oriented states (DCO) ratio and polarization of gamma rays were measured to assign spin, parity and multipolarity of transitions. Twenty one new transitions belonging to the {sup 178}Os nucleus have been identified. The sudden and rather strong gain in aligned angular momentum is observed in the yrast band of {sup 178}Os. A new aligned rotational band similar to {sup 180}Os is also discovered in this nucleus. This band exhibits a very complex decay pattern with a single linking transition of 1778 keV to the ground state band. The tri-axial shape co-existence is also observed in this nucleus at higher excitation. The experimental results are compared with the Microscopic Hartree-Fock model calculations.

  18. Tri-stereo Pleiades images-derived digital surface models for tectonic geomorphology studies

    NASA Astrophysics Data System (ADS)

    Ferry, Matthieu; Le Roux-Mallouf, Romain; Ritz, Jean-François; Berthet, Théo; Peyret, Michel; Vernant, Philippe; Maréchal, Anaïs; Cattin, Rodolphe; Mazzotti, Stéphane; Poujol, Antoine


    Very high resolution digital elevation models are a key component of modern quantitative geomorphology. In parallel to high-precision but time-consuming kinematic GPS and/or total station surveys and dense coverage but expensive LiDAR campaigns, we explore the usability of affordable, flexible, wide coverage digital surface models (DSMs) derived from Pleiades tri-stereo optical images. We present two different approaches to extract DSM from a triplet of images. The first relies on the photogrammetric extraction of 3 DSMs from the 3 possible stereo couples and subsequent merge based on the best correlation score. The second takes advantage of simultaneous correlation over the 3 images to derive a point cloud. We further extract DSM from panchromatic 0.5 m resolution images and multispectral 2 m resolution images to test for correlation and noise and determine optimal correlation window size and achievable resolution. Georeferencing is also assessed by comparing raw coordinates derived from Pleiades Rational Polynomial Coefficients to ground control points. Primary images appear to be referenced within ~15 m over flat areas where parallax is minimal while derived DSMs and associated orthorectified images show a much improved referencing within ~5 m of GCPs. In order to assess the adequacy of Pleiades DSMs for tectonic geomorphology, we present examples from case studies along the Trougout normal fault (Morocco), the Hovd strike-slip fault (Mongolia), the Denali strike-slip fault (USA and Canada) and the Main Frontal Thrust (Bhutan). In addition to proposing a variety of tectonic contexts, these examples cover a wide range of climatic conditions (semi-arid, arctic and tropical), vegetation covers (bare earth, sparse Mediterranean, homogeneous arctic pine, varied tropical forest), lithological natures and related erosion rates. The capacity of derived DSMs is demonstrated to characterize geomorphic markers of active deformation such as marine and alluvial terraces

  19. Two tri-spin complexes based on gadolinium and nitronyl nitroxide radicals: Structure and ferromagnetic interactions

    SciTech Connect

    Zhou Na; Ma Yue; Wang Chao; Xu Gongfeng; Tang Jinkui; Yan Shiping; Liao Daizheng


    Three Radical-Ln(III)-Radical complexes based on nitronyl nitroxide radicals have been synthesized, structurally and magnetically characterized: [Gd(hfac){sub 3}(NITPhOEt){sub 2}] (1) (hfac=hexafluoroacetylacetonate, and NITPhOEt=4'-ethoxy-phenyl-4,4,5,5-tetramethylimidazoline-1-oxyl-3-oxide), [Gd(hfac){sub 3}(NITPhOCH{sub 2}Ph){sub 2}] (2) (NITPhOCH{sub 2}Ph=4'-benzyloxy-phenyl-4,4,5, 5-tetramethylimidazoline-1-oxyl-3-oxide) and [Lu(hfac){sub 3}(NITPhOCH{sub 2}Ph){sub 2}] (3). The X-ray crystal structure analyses show that the structures of the three compounds are similar and all consist of the isolated molecules, in which central ions Gd{sup III} or Lu{sup III} are coordinated by six oxygen atoms from three hfac and two oxygen atoms from nitronyl radicals. The magnetic studies show that in both of the two Gd{sup III} complexes, there are ferromagnetic Gd{sup III}-Rad interactions and antiferro-magnetic Rad-Rad interactions in the molecules (with J{sub Rad-Gd}=0.27 cm{sup -1}, j{sub Rad-Rad}=-2.97 cm{sup -1} for 1: and J{sub Rad-Gd}=0.62 cm{sup -1}, j{sub Rad-Rad}=-7.01 cm{sup -1} for 2). An analogous complex of [Lu(hfac){sub 3} (NITPhOCH{sub 2}Ph){sub 2}] (3) containing diamagnetic Lu{sup III} ions has also been introduced for further demonstrating the nature of magnetic coupling between radicals. - Graphical abstract: Two tri-spin complexes based on gadolinium-radical have been synthesized and characterized, the magnetic studies show that in the two complexes the Gd-radical interaction is ferromagnetic and the radical-radical interaction is antiferromagnetic. An analogous complex containing the diamagnetic Lu{sup III} ions has also been synthesized to further demonstrate the nature of the magnetic coupling between radicals.

  20. A Tri-band Cryogenic Receiver for the RAEGE Project Antennas

    NASA Astrophysics Data System (ADS)

    López-Pérez, J. A.; Tercero, F.; Serna, J. M.; López-Fernández, J. A.


    The Spanish Centro de Desarrollos Tecnológicos (CDT) is developing a tri-band cryogenic receiver for the first light observations of the first RAEGE project antenna in Centro Astronómico de Yebes observatory in the framework of the VLBI2010 project. The RAEGE project plans to install three new ring-focus 13.2 meter antennas in compliance with the VLBI2010 specifications. These antennas are under construction. The first light receiver envisaged for these antennas will operate in the S (2.2 — 2.7 GHz), X (7.5 — 9 GHz), and Ka (28 — 33 GHz) bands, simultaneously, in order to be backward compatible with non-VLBI2010 stations and forward compatible with new ones. The receiver feed designed to illuminate the ring-focus antenna is made of a coaxial waveguide, for the S and X bands, and a circular waveguide for the Ka band. Four outputs from their corresponding field probes at S and X bands must be combined with 180 ° and 90 ° hybrid circuits to get simultaneous dual-circular polarization. In the Ka band case, the two circular polarizations are split by means of a classical septum polarizer. The feed, hybrids, and polarizer will operate at cryogenic temperature in order to minimize their contribution to system noise. The estimated equivalent noise temperature for this receiver is lower than 15 Kelvin for S-band, 20 Kelvin for X-band, and 25 Kelvin for Ka-band. The output signals from the cryostat will be sent to their corresponding room temperature downconverters for later amplification, filtering, and mixing. The final IF signal will range from 500 to 1000 MHz, as in a classical geodetic VLBI receiver, to be backward compatible with non-VLBI2010 stations. An advantage of having the Ka band receiver is that it will allow the radiometric characterization (pointing, tracking, and efficiency) of these antennas during commissioning. In addition, simultaneous X/Ka operation would be possible. The first receiver of this type is planned to be finished by September, 2012

  1. Evidence of Latitudinal Migration in Tri-colored Bats, Perimyotis subflavus

    PubMed Central

    Fraser, Erin E.; McGuire, Liam P.; Eger, Judith L.; Longstaffe, Fred J.; Fenton, M. Brock


    Background Annual movements of tri-colored bats (Perimyotis subflavus) are poorly understood. While this species has been considered a regional migrant, some evidence suggests that it may undertake annual latitudinal migrations, similar to other long distance North American migratory bat species. Methodology/Principal Findings We investigated migration in P. subflavus by conducting stable hydrogen isotope analyses of 184 museum specimen fur samples and comparing these results (δDfur) to published interpolated δD values of collection site growing season precipitation (δDprecip). Results suggest that the male molt period occurred between June 23 and October 16 and 33% of males collected during the presumed non-molt period were south of their location of fur growth. For the same time period, 16% of females were south of their location of fur growth and in general, had not travelled as far as migratory males. There were strong correlations between δDfur from the presumed molt period and both growing season δDprecip (males – r2 = 0.86; p<0.01; females – r2 = 0.75; p<0.01), and latitude of collection (males – r2 = 0.85; p<0.01; females – r2 = 0.73; p<0.01). Most migrants were collected at the northern (>40°N; males and females) and southern (<35°N; males only) extents of the species' range. Conclusions/Significance These results indicate a different pattern of migration for this species than previously documented, suggesting that some P. subflavus engage in annual latitudinal migrations and that migratory tendency varies with latitude and between sexes. We suggest that this species' hibernation ecology makes it particularly susceptible to long winters, making migration from the northern extent of the species' range to more southern hibernacula preferable for some individuals. Fur δD values for some of the northern individuals may indicate an increase in the currently accepted northern range of this species. Sex-biased differences in

  2. TriTel 3 dimensional space dosimetric telescope in the European Student Earth Orbiter project of ESA

    NASA Astrophysics Data System (ADS)

    Zábori, Balázs; Hirn, Attila


    The development of the European Student Earth Orbiter (ESEO) was announced in the year of 2008 by the European Space Agency for students interested in the space exploration. The Budapest University of Technology and Economics joined this international cooperation with three student groups among other participating European universities. One of them is the ESEO-TriTel team. The development of the TriTel 3D silicon detector telescope began in the KFKI Atomic Energy Research Institute several years ago in order to determine the average radiation quality factor of the space radiation field for dosimetric purposes. In the year 2011—before the start of the ESEO mission—it will be operated on board the European Columbus module of the International Space Station (ISS) and will be installed in the Russian segment of the ISS as well. The ESEO version of TriTel will fly higher than the ISS version, at an altitude of 520 km. At this altitude the Earth's geomagnetic field is much lower and the spectrum of the radiation field is also different. In the ESEO-TriTel experiment the anisotropies in the radiation field, the effects of the Earth shadow and the South Atlantic Anomaly (SAA) will be analysed and the results will be compared with the fluxes calculated with the standard AP-8 and AE-8 trapped proton and electron models. In the near future the frequency of manned space flights will probably increase, we can think of the continuous human presence in the near-Earth region (low Earth orbits) or the proposed human Mars expedition. That is why the cosmic radiation field is interesting not only in the near-Earth region but at higher altitudes or in the interplanetary field as well. The present paper addresses the optimal shielding of the dosimetric telescopes of TriTel in order to avoid the saturation of the electronics. The amount of optimal shielding is equivalent to the effective thickness of astronaut's space suit, which means that the same dose will be measured as what the

  3. Stress-optic modulator in TriPleX platform using a ezoelectric lead zirconate titanate (PZT) thin film.


    Hosseini, Naser; Dekker, Ronald; Hoekman, Marcel; Dekkers, Matthijn; Bos, Jan; Leinse, Arne; Heideman, Rene


    We will demonstrate a stress-optic phase modulator in the passive SiN-based TriPleX platform using a layer of piezoelectric material. Regarding the stress-optic effect, the piezoelectric layer deposited on top of an optical waveguide is employed to control the phase of propagating light in the structure by applying an electrical field across the layer. In this work, it is demonstrated that the stress-optic effect lowers the power consumption by a factor of one million for quasi-DC operation and increases the modulation speed by three orders of magnitude, compared to currently used thermo-optic modulation in the TriPleX platform. PMID:26072771

  4. Nickel-Catalyzed Regioselective Cleavage of Csp(2)-S Bonds: Method for the Synthesis of Tri- and Tetrasubstituted Alkenes.


    Chen, Jinyang; Chen, Sihai; Xu, Xinhua; Tang, Zhi; Au, Chak-Tong; Qiu, Renhua


    We describe here an efficient route for the synthesis of (Z)-vinylic sulfides 3 via the highly regio- and stereoselective coupling of (Z)-1,2-bis(aryl(alkyl)thio)alkenes and Grignard reagents over a Ni catalyst under mild conditions. (Z)-Vinylic sulfides 3 are important intermediates in the synthesis of tri- and tetrasubstituted alkenes that are important construction blocks for drugs and natural products. The directing organosulfur groups (SR) can be converted to diaryl(alkyl) disulfides (RSSR) using H2O2 as oxidant, hence avoiding the waste of sulfur resources. The protocol provides a general method that is highly regio- and stereoselective for the synthesis of a diversity of tri- and tetrasubstituted alkenes. PMID:26999304

  5. Modulating the Nucleated Self-Assembly of Tri-β(3) -Peptides Using Cucurbit[n]urils.


    Satav, Tushar; Korevaar, Peter; de Greef, Tom F A; Huskens, Jurriaan; Jonkheijm, Pascal


    The modulation of the hierarchical nucleated self-assembly of tri-β(3) -peptides has been studied. β(3) -Tyrosine provided a handle to control the assembly process through host-guest interactions with CB[7] and CB[8]. By varying the cavity size from CB[7] to CB[8] distinct phases of assembling tri-β(3) -peptides were arrested. Given the limited size of the CB[7] cavity, only one aromatic β(3) -tyrosine can be simultaneously hosted and, hence, CB[7] was primarily acting as an inhibitor of self-assembly. In strong contrast, the larger CB[8] can form a ternary complex with two aromatic amino acids and hence CB[8] was acting primarily as cross-linker of multiple fibers and promoting the formation of larger aggregates. General insights on modulating supramolecular assembly can lead to new ways to introduce functionality in supramolecular polymers. PMID:27434777

  6. Quenching of triplet benzophenone by 2,4,6-tri-tert-butylphenol and formation of its phenoxy radical

    SciTech Connect

    Kajii, Y.; Fujita, M.; Hiratsuka, H.; Obi, K.; Mori, Y.; Tanaka, I.


    Quenching of triplet benzophenone in benzene by 2,4,6-tri-tert-butylphenol is studied by the nanosecond laser flash photolysis. The quenching rate constant of triplet benzophenone has been determined to be 6.2 x 10/sup 8/ M/sup -1/ s/sup -1/, which is slightly smaller than the diffusion-controlled limit. The quenching reaction produces benzophenone ketyl and 2,4,6-tri-tert-butylphenoxy radicals simultaneously. The transient spectrum of the latter radical shows characteristic structured bands around 400 nm and a broad absorption between 600 and 700 nm. The extinction coefficient at the peak lambda/sub max/ = 670 nm of red absorption has been estimated to be 1200 M/sup -1/ cm/sup -1/.

  7. Tri-reforming and combined reforming of methane for producing syngas with desired hydrogen/carbon monoxide ratios

    NASA Astrophysics Data System (ADS)

    Pan, Wei

    This dissertation is an exploratory study of a new process concept for direct production of synthesis gas (CO + H2) with desired H 2/CO ratios (1.5--2.0) for methanol synthesis and F-T synthesis, using CO2 together with steam and unconverted O2 in flue gas from fossil fuel-fired electric power plants to react with methane or natural gas. This new process is called tri-reforming, referring to simultaneous CO2-steam-O2 reforming of methane or natural gas. This study included (1) The investigation of carbon formation in the tri-reforming process. For comparison, carbon formation in the combined reforming and CO2 reforming reaction was studied as well. (2) The effect of reaction conditions and feed compositions on equilibrium composition (e.g. H2/CO ratio) and equilibrium conversions in the tri-reforming process. (3) The role of catalysts in the tri-reforming process, especially the effect of catalysts on CO2 conversion in the presence of H 2O and O2. It was clearly evidenced from this study that CO in the product stream is probably the major source of carbon over Ni/Al2O3 in the equimolar CO2-CH4 reforming at 650°C and 1 atm. Addition of either O2 or H2O into the CO 2 reforming reaction system can suppress carbon formation. It was demonstrated that carbon-free operation can be achieved in the tri-reforming process. A thermodynamic comparison of tri-reforming with feed compositions of (H2O+CO2+0.5O2)/CH4 (mol ratio) = 1 showed that O2 improves equilibrium CH4 conversion, yet greatly decreases equilibrium CO2 conversion. H2O in tri-reforming has a significant effect on the H2/CO ratio in the products, while O2 has a minor effect. A kinetic study and catalytic performance tests indicated that the support in a supported catalyst has a significant role in enhancing CO2 conversion to CO in the presence of H2O and O2 in tri-reforming. The Ni/MgO catalyst showed superior performance with close to equilibrium CH4 and CO2 conversions at 850°C, 1 atm, and 32,000 ml

  8. Effect of inositol and tri-iodothyronine on the hormonal responsiveness of hepatocytes obtained from partially hepatectomized rats.

    PubMed Central

    Huerta-Bahena, J; García-Sáinz, J A


    Hepatocytes obtained from animals partially hepatectomized (72 h before the experiment) have a diminished responsiveness to alpha 1-adrenergic amines, vasopressin, angiotensin and glucagon and an increased responsiveness to beta-adrenergic amines. Administration of inositol or tri-iodothyronine to the hepatectomized animals induced a recovery in the hepatocyte responsiveness to the Ca2+-dependent hormones and abolished that to beta-adrenergic amines; the response to glucagon was not improved. PMID:6508748

  9. Design and synthesis of a novel, orally active, brain penetrant, tri-substituted thiophene based JNK inhibitor

    SciTech Connect

    Bowers, Simeon; Truong, Anh P.; Neitz, R. Jeffrey; Neitzel, Martin; Probst, Gary D.; Hom, Roy K.; Peterson, Brian; Galemmo, Jr., Robert A.; Konradi, Andrei W.; Sham, Hing L.; Tóth, Gergley; Pan, Hu; Yao, Nanhua; Artis, Dean R.; Brigham, Elizabeth F.; Quinn, Kevin P.; Sauer, John-Michael; Powell, Kyle; Ruslim, Lany; Ren, Zhao; Bard, Frédérique; Yednock, Ted A.; Griswold-Prenner, Irene


    The SAR of a series of tri-substituted thiophene JNK3 inhibitors is described. By optimizing both the N-aryl acetamide region of the inhibitor and the 4-position of the thiophene we obtained single digit nanomolar compounds, such as 47, which demonstrated an in vivo effect on JNK activity when dosed orally in our kainic acid mouse model as measured by phospho-c-jun reduction.

  10. Efficient production of di- and tri-acylated mannosylerythritol lipids as glycolipid biosurfactants by Pseudozyma parantarctica JCM 11752(T).


    Morita, Tomotake; Konishi, Masaaki; Fukuoka, Tokuma; Imura, Tomohiro; Sakai, Hideki; Kitamoto, Dai


    Mannosylerythritol lipids (MELs) are one of the most promising biosurfactants known, because of their multifunctionality and biocompatibility. In order to attain an efficient production of MELs, Pseudozyma parantarctica JCM 11752(T), which is a newly identified strain of the genus, was examined for the productivity of MELs at different culture conditions. The yeast strain showed significant cell growth and production of di-acylated MELs even at 36 degrees C. In contrast, on conventional high-level MEL producers including P. rugulosa, the MEL yield considerably decreased with an increase of the cultivation temperature at over 30 degrees C. On P. parantarctica, soybean oil and sodium nitrate were the best carbon and nitrogen sources, respectively. Under the optimal conditions on a shake-flask culture at 34 degrees C, the amount of di-acylated MELs reached over 100 g/L by intermittent feeding of only soybean oil. Interestingly, the yeast strain produced tri-acylated MELs as well as di-acylated ones when grown on the medium containing higher soybean oil concentrations than 8% (vol/vol). The production of tri-acylated MELs was significantly accelerated at between 34 and 36 degrees C. With 20 % (vol/vol) of soybean oil at 34 degrees C, the yield of tri-acylated MELs reached 22.7 g/L. The extracellular lipase activity considerably depended on the culture temperature, and became the maximum at 34 degrees C; this would bring the accelerated production of tri-acylated MELs. Accordingly, the present strain of P. parantarctica provided high efficiency in MEL production at elevated temperatures compared to conventional MEL producers, and would thus be highly advantageous for the commercial production of the promising biosurfactants. PMID:18781056

  11. Genetic and Environmental Interactions in Determining the Early Lexicon: Evidence from a Set of Tri-Zygotic Quadruplets

    ERIC Educational Resources Information Center

    McGregor, Karla K.; Capone, Nina C.


    A set of tri-zygotic quadruplets, three girls and one boy, participated in weekly observations from 1;2 to 1;10 (years;months), a period of transition from prelinguistic gesture to 50 words. In the study, one girl served as a genetic mate to her identical twin and a biological risk mate to her fraternal sister. The biological risk mates achieved…

  12. Toxic polyneuropathy due to gingili oil contaminated with tri-cresyl phosphate affecting adolescent girls in Sri Lanka.


    Senanayake, N; Jeyaratnam, J


    An outbreak of acute polyneuropathy affected over 20 young females in Sri Lanka during 1977-78. The illness was restricted to girls attaining menarche and to women after childbirth. The cause of the neuropathy could be traced to tri-cresyl phosphate found as a contaminant in gingili oil. Contamination probably occurred during transport of the oil in containers previously used for storing mineral oils. PMID:6109132

  13. Psychometric Functions for Shortened Administrations of a Speech Recognition Approach Using Tri-Word Presentations and Phonemic Scoring

    ERIC Educational Resources Information Center

    Gelfand, Stanley A.; Gelfand, Jessica T.


    Method: Complete psychometric functions for phoneme and word recognition scores at 8 signal-to-noise ratios from -15 dB to 20 dB were generated for the first 10, 20, and 25, as well as all 50, three-word presentations of the Tri-Word or Computer Assisted Speech Recognition Assessment (CASRA) Test (Gelfand, 1998) based on the results of 12…

  14. Tri-allelic pattern of short tandem repeats identifies the murderer among identical twins and suggests an embryonic mutational origin.


    Wang, Li-Feng; Yang, Ying; Zhang, Xiao-Nan; Quan, Xiao-Liang; Wu, Yuan-Ming


    Monozygotic twins can be co-identified by genotyping of short tandem repeats (STRs); however, for distinguishing them, STR genotyping is ineffective, especially in the case of murder. Here, a rarely occurring tri-allelic pattern in the vWA locus (16, 18, 19) was identified only in the DNA of one identical twin, which could help to exonerate the innocent twin in a murder charge. This mutation was defined as primary through genotyping of the family and could be detected in blood, buccal and semen samples from the individual; however, two alternative allele-balanced di-allelic patterns (16, 18 or 16, 19) were detected in hair root sheath cells. Such a kind of segregation indicates a one-step mutation occurs in cell mitosis, which is after embryonic zygote formation and during the early development of the individual after the division of the blastocyte. Sequencing revealed the insertion between the allele 18 and 19 is a repeat unit of TAGA/TCTA (plus/minus strand), which belongs to "AGAT/ATCT"-based core repeats identified from all tri-allelic pattern reports recorded in the STR base and a detailed model was proposed for STR repeat length variation caused by false priming during DNA synthesis. Our model illustrates the possible origination of allele-balanced and unbalanced tri-allelic pattern, clarifies that the genotypes of parent-child mismatches, aberrant di-allelic patterns, and type 1 or 2 tri-allelic patterns should be considered as independent, but interconnected forms of STR mutation. PMID:25732248

  15. Using Tri-Axial Accelerometers to Assess the Dynamic Control of Head Posture During Gait

    NASA Technical Reports Server (NTRS)

    Lawrence, John H., III


    Long duration spaceflight is known to cause a variety of biomedical stressors to the astronaut. One of the more functionally destabilizing effects of spaceflight involves microgravity-induced changes in vestibular or balance control. Balance control requires the integration of the vestibular, visual, and proprioceptive systems. In the microgravity environment, the normal gravity vector present on Earth no longer serves as a reference for the balance control system. Therefore, adaptive changes occur to the vestibular system to affect control of body orientation with altered, or non-present, gravity and/or proprioceptive inputs. Upon return to a gravity environment, the vestibular system must re-incorporate the gravity vector and gravity-induced proprioceptive inputs into the balance control regime. The result is often a period of postural instability, which may also be associated with space motion sickness (oscillopsia, nausea, and vertigo). Previous studies by the JSC Neuroscience group have found that returning astronauts often employ alterations in gait mechanics to maintain postural control during gait. It is believed that these gait alterations are meant to decrease the transfer of heel strike shock energy to the head, thus limiting the contradictory head and eye movements that lead to gait instability and motion sickness symptoms. We analyzed pre- and post-spaceflight tri-axial accelerometer data from the NASA/MIR long duration spaceflight missions to assess the heel to head transfer of heel strike shock energy during locomotion. Up to seven gait sessions (three preflight, four postflight) of head and shank (lower leg) accelerometer data was previously collected from six astronauts who engaged in space flights of four to six months duration. In our analysis, the heel to head transmission of shock energy was compared using peak vertical acceleration (a), peak jerk (j) ratio, and relative kinetic energy (a). A host of generalized movement variables was produced

  16. Growth and characterization of bismuth tri-iodide single crystals by modified vertical Bridgman method

    NASA Astrophysics Data System (ADS)

    Qui, Wei

    Bismuth tri-iodide (Bil3) is a wide band gap semiconductor material with potential for room temperature gamma-ray detection applications. The inability to produce high quality, pure, and large single crystals is one of the major challenges for this material preventing its use in gamma-ray detection. This work presents the growth and characterization of Bil3 single crystals by a modified vertical Bridgman (MVB) method. The growth parameters to produce Bil3 single crystals were explored by adjusting growth rate and temperature gradient at the solid-liquid interface. Single crystals of Bil3 have been successfully grown in Pyrex glass ampoule at different growth conditions. Through etch pit density (EPD) and X-ray rocking curve measurement, the crystal with the best quality was determined to be obtained at 0.5 mm/h growth rate and 10oC/cm temperature gradient. Single crystal (001) oriented slabs up to 18 x 13 x 5 mm 3 (the largest Bil3 single crystal ever reported) were obtained under this condition. Impurity characterization on the starting Bil 3 powder and the grown crystals indicated a relatively high total impurity concentration up to 1017 cm-3, and the crystal growth using Pyrex glass does not introduce additional impurities to the crystal. The energy band gap is an important parameter for materials used as a room temperature gamma-ray detector, as it determines the energy to produce an electron-hole pair which is the source of the signal for the detector. Remarkably, very different band gap characteristics and values of Bil 3 have been reported in literature. This study characterized the band gap of Bil3 through Ultraviolet-visible spectroscopy (UV-Vis), which yielded an indirect band gap of 1.68 +/- 0.09 eV at room temperature. Impurity and temperature effects, as commonly observed in many semiconductors, have been investigated as the major extrinsic factors that influence the band gap value of Bil3. Three different metals, Au, Pd, and Pt were sputtered on the

  17. Synthetic and reactivity studies of hetero-tri-anionic sodium zincates.


    Francos, Javier; Kennedy, Alan R; O'Hara, Charles T


    The synthesis and characterisation of several sodium zincate complexes are reported. The all-alkyl monomeric sodium zincate, (PMEDTA)·Na(μ-CH2SiMe3)Zn(t)Bu22, is prepared by combining equimolar quantities of (t)Bu2Zn, (n)BuNa and PMDETA (N,N,N',N'',N''-pentamethyldiethylenetriamine)]. A similar approach was used to prepare and isolate the unusual dimeric zincate [(PMEDTA)·Na(μ-(n)Bu)Zn(t)Bu2]23. When an equimolar mixture of (n)BuNa, (t)Bu2Zn and TMP(H) (2,2,6,6-tetramethylpiperidine) is combined in hexane, the hetero-tri-leptic TMP(H)-solvated zincate (TMPH)Na(μ-TMP)(μ-(n)Bu)Zn(t)Bu 4 results. Complex 4 can also be prepared using a rational approach [i.e., utilising two molar equivalents of TMP(H)]. When TMEDA is reacted with an equimolar mixture of (n)BuNa, (t)Bu2Zn and TMP(H), the monomeric sodium zincate (TMEDA)Na(μ-TMP)(μ-(n)Bu)Zn(t)Bu 5 was obtained - this complex is structurally similar to the synthetically useful relation (TMEDA)·Na(μ-TMP)(μ-(t)Bu)Zn((t)Bu) 1. By changing the sodium reagent used in the synthesis of 5, it was possible to prepare (TMEDA)Na(μ-TMP)(μ-Me3SiCH2)Zn(t)Bu 6. By reacting 5 with cis-DMP(H) (cis-2,6-dimethylpiperidine), the zincate could thermodynamically function as an amide base, to give the transamination product (TMEDA)Na(μ-cis-DMP)(μ-(n)Bu)Zn(t)Bu 7, although no crystals could be grown. However, when HMDS(H) (1,1,1,3,3,3-hexamethyldisilazane) or PEA(H) [(+)-bis[(R)-1-phenylethyl]amine] is reacted with 5, crystalline (TMEDA)Na(μ-HMDS)(μ-(n)Bu)Zn(t)Bu 8 or (TMEDA)Na(μ-PEA)(μ-(n)Bu)Zn(t)Bu 9 is isolated respectively. With PNA(H) (N-phenylnaphthalen-1-amine) the reaction took a different course and resulted in the formation of the dimeric sodium amide complex [(TMEDA)Na(PNA)]210. When reacted with benzene, it appears that a TMEDA-free variant of 5 functions thermodynamically as an (n)Bu base to yield the previously reported (TMEDA)Na(μ-TMP)((t)Bu)Zn(μ-C6H4)Zn((t)Bu)(μ-TMP)Na(TMEDA) 11. Finally when reacted with

  18. Silicon nanowire-based ring-shaped tri-axial force sensor for smart integration on guidewire

    NASA Astrophysics Data System (ADS)

    Han, Beibei; Yoon, Yong-Jin; Hamidullah, Muhammad; Tsu-Hui Lin, Angel; Park, Woo-Tae


    A ring-shaped tri-axial force sensor with a 200 µm × 200 µm sensor area using silicon nanowires (SiNWs) as piezoresistive sensing elements is developed and characterized. The sensor comprises a suspended ring structure located at the center of four suspended beams that can be integrated on the distal tip of a guidewire by passing through the hollow core of the sensor. SiNWs with a length of 6 µm and a cross section of 90 nm × 90 nm are embedded at the anchor of each silicon bridge along <1 1 0> direction as the piezoresistive sensing element. Finite element analysis has been used to determine the location of maximum stress and the simulation results are verified with the experimental measurements. Taking advantage of the high sensitivity of SiNWs, the fabricated ring-shaped sensor is capable of detecting small displacement in nanometer ranges with a sensitivity of 13.4 × 10-3 µm-1 in the z-direction. This tri-axial force sensor also shows high linearity (>99.9%) to the applied load and no obvious hysteresis is observed. The developed SiNW-based tri-axial force sensor provides new opportunities to implement sensing capability on medical instruments such as guidewires and robotic surgical grippers, where ultra-miniaturization and high sensitivity are essential.

  19. Topological relations embodied in a generalized tri-prism (GTP) model for a 3D geoscience modeling system

    NASA Astrophysics Data System (ADS)

    Wu, Lixin


    3D geoscience modeling system (3D GMS) embodied with topological relations is of extreme importance for Geosciences. This paper presents a universal 3D model, generalized tri-prism (GTP) for 3D GMS and real-3D GIS, which is a modification and improvement of former presented analogous tri-prism (ATP) model and is the common model of pyramid model, tetrahedron model and tri-prism (TP) model. The GTP model takes the divergent drill holes, rather than triangulation network after interpolation or vertical parallel drill holes after projection transformation, as its direct data source. Hence, the reliability and quality of the 3D model is maximatily ensured. The GTP component is comprised of six primitives as node, TIN-edge, side-edge, TIN-face, side-face and GTP. Besides, three intermediary diagonal lines in each GTP component are temporary applied for spatial operations. Six groups of topological relations between the six primitives are carefully designed for geo-spatial inquiry and geo-spatial analysis. The mechanisms of chipping, dynamic updating and local refining operations of so constructed 3D geological model are introduced. A real-3D software platform, GeoMo 3D@, developed with VC ++, OPGL and SQL server, demonstrates most of the 3D geo-spatial operations including clipping, separating, uncovering and geo-fence diagram generating based on an actual 3D geological model of a coal mine, Tangshan, P.R. China.

  20. Production of Molecular Iodine and Tri-iodide in the Frozen Solution of Iodide: Implication for Polar Atmosphere.


    Kim, Kitae; Yabushita, Akihiro; Okumura, Masanori; Saiz-Lopez, Alfonso; Cuevas, Carlos A; Blaszczak-Boxe, Christopher S; Min, Dae Wi; Yoon, Ho-Il; Choi, Wonyong


    The chemistry of reactive halogens in the polar atmosphere plays important roles in ozone and mercury depletion events, oxidizing capacity, and dimethylsulfide oxidation to form cloud-condensation nuclei. Among halogen species, the sources and emission mechanisms of inorganic iodine compounds in the polar boundary layer remain unknown. Here, we demonstrate that the production of tri-iodide (I3(-)) via iodide oxidation, which is negligible in aqueous solution, is significantly accelerated in frozen solution, both in the presence and the absence of solar irradiation. Field experiments carried out in the Antarctic region (King George Island, 62°13'S, 58°47'W) also showed that the generation of tri-iodide via solar photo-oxidation was enhanced when iodide was added to various ice media. The emission of gaseous I2 from the irradiated frozen solution of iodide to the gas phase was detected by using cavity ring-down spectroscopy, which was observed both in the frozen state at 253 K and after thawing the ice at 298 K. The accelerated (photo-)oxidation of iodide and the subsequent formation of tri-iodide and I2 in ice appear to be related with the freeze concentration of iodide and dissolved O2 trapped in the ice crystal grain boundaries. We propose that an accelerated abiotic transformation of iodide to gaseous I2 in ice media provides a previously unrecognized formation pathway of active iodine species in the polar atmosphere. PMID:26745029

  1. Tri-State Synfuels Project Review: Volume 12. Fluor project status. [Proposed Henderson, Kentucky coal to gasoline plant; engineering

    SciTech Connect

    Not Available


    The purpose of this report is to document and summarize activities associated with Fluor's efforts on the Tri-State Synfuels Project. The proposed facility was to be coal-to-transport fuels facility located in Henderson, Kentucky. Tri-State Synfuels Company was participating in the project as a partner of the US Department of Energy per terms of a Cooperative Agreement resulting from DOE's synfuel's program solicitation. Fluor's initial work plan called for preliminary engineering and procurement services to the point of commitment for construction for a Sasol Fischer-Tropsch plant. Work proceeded as planned until October 1981 when results of alternative coal-to-methanol studies revealed the economic disadvantage of the Synthol design for US markets. A number of alternative process studies followed to determine the best process configuration. In January 1982 Tri-State officially announced a change from Synthol to a Methanol to Gasoline (MTG) design basis. Further evaluation and cost estimates for the MTG facility eventually led to the conclusion that, given the depressed economic outlook for alternative fuels development, the project should be terminated. Official announcement of cancellation was made on April 13, 1982. At the time of project cancellation, Fluor had completed significant portions of the preliminary engineering effort. Included in this report are descriptions and summaries of Fluor's work during this project. In addition location of key project data and materials is identified and status reports for each operation are presented.

  2. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2014 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  3. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2011 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  4. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2012 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  5. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2013 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  6. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2010 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  7. Analysis of the small interfering RNA profiles of randomly inserted pTRM-TRI6 Fusarium graminearum mutants and their DON related phenotypes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Deoxynivalenol (DON) production by Fusarium graminearum requires activation of the trichothecene pathway in which TRI5 catalyzes the first step of trichothecene synthesis and TRI6 is a transcription factor activates the pathway. RNA interference (RNAi) has emerged as a useful fungal genetics tool f...

  8. Octa-μ3-selenido-penta­kis­(tri­ethyl­phos­phane-κP)(tri­methyl­aceto­nitrile-κN)-octa­hedro-hexa­rhenium(III) bis­(hexa­fluorido­anti­monate) tri­methyl­aceto­nitrile monosolvate

    PubMed Central

    Ren, YiXin; Bruck, Andrea M.; Szczepura, Lisa F.


    The crystal structure of the title compound, [Re6Se8{NCC(CH3)3}(Et3P)5](SbF6)2·NCC(CH3)3, contains a face-capped octa­hedral [Re6(μ3-Se)8]2+ cluster core. The pseudo-centrosymmetric [Re6Se8]2+ cluster core is bonded through the Re atoms to five tri­ethyl­phosphane ligands and one tri­methyl­aceto­nitrile ligand. No significant interactions are observed between the cationic cluster, the SbF6 − anions and the trimethylacetonitrile solvent molecule. PMID:25161513

  9. Permeability Changes of Coal Cores and Briquettes under Tri-Axial Stress Conditions

    NASA Astrophysics Data System (ADS)

    Wierzbicki, Mirosław; Konečný, Pavel; Kožušníková, Alena


    The paper is dealing with the permeability of coal in triaxial state of stress. The permeability of coal, besides coal's methane capacity, is the main parameter determining the quantity of methane inflow into underground excavations. The stress in a coal seam is one of the most important factors influencing coal permeability therefore the permeability measurements were performed in tri-axial state of stress. The hydrostatic three-axial state of stress was gradually increased from 5 MPa with steps of 5 MPa up to a maximum of 30 MPa. Nitrogen was applied as a gas medium in all experiments. The results of the permeability measurements of coal cores from the "Zofiówka" mine, Poland, and three mines from the Czech Republic are presented in this paper. As a "reference", permeability measurements were also taken for coal briquettes prepared from coal dust with defined porosity. It was confirmed that the decreasing porosity of coal briquettes affects the decreasing permeability. The advantage of experimentation on coal briquettes is its good repeatability. From the experimental results, an empirical relation between gas permeability and confining pressure has also been identified. The empirical relation for coal briquettes is in good correspondence with published results. However, for coal cores, the character of change differs. The influence of confining pressure has a different character and the decrease in permeability is stronger due to the increasing confining pressure Przepuszczalność węgla, oprócz pojemności sorpcyjnej względem metanu jest głównym parametrem określającym dopływ metanu do podziemnych wyrobiskach górniczych. W warunkach naturalnych wartość przepuszczalności jest ściśle związana ze stanem naprężenia w pokładzie węgla. W pracy przedstawiono wyniki pomiarów przepuszczalności wykonanych w trójosiowym stanie naprężenia. Hydrostatyczny trójosiowy stan naprężenia stopniowo zwiększano od 5 MPa do maksymalnie 30 MPa z krokiem

  10. Crystal structure of bis-(ethyl-enedi-thio)-tetra-thia-fulvalenium μ2-acetato-bis-[tri-bromido-rhenate(III)] 1,1,2-tri-chloro-ethane hemisolvate.


    Golichenko, Alexander A; Kravchenko, Andrey V; Omelchenko, Irina V; Chudak, Denis M; Starodub, Vladimir A; Barszcz, Boleslaw; Shtemenko, Alexander V


    The asymmetric unit of the title salt, (C10H8S8)[Re2Br6(CH3COO)]·0.5C2H3Cl3, contains one bis-(ethyl-enedi-thio)-tetra-thia-fulvalene (ET) radical cation, one μ2-acetato-bis-[tri-bromido-rhenate(III)] anion and a 1,1,2-tri-chloro-ethane mol-ecule with half-occupancy disordered about a twofold rotation axis. The tetra-thia-fulvalene fragment adopts an almost planar configuration typical of the ET radical cation. The C atoms of both ethyl-enedi-thio fragments in the cation are disordered over two orientations with occupancy factors 0.65:0.35 and 0.77:0.23. In the anion, six Br atoms and a μ2-acetate ligand form a strongly distorted cubic O2Br6 coordination polyhedron around the Re2 dinuclear centre. In the crystal, centrosymmetrically related ET cations and Re2O2Br6 anions are linked into dimers by π-π stacking inter-actions [centroid-to-centroid distance = 3.826 (8) Å] and by pairs of additional Re⋯Br contacts [3.131 (3) Å], respectively. The dimers are further packed into a three-dimensional network by non-directional inter-ionic electrostatic forces and by C-H⋯Br and C-H⋯S hydrogen bonds. The disordered 1,1,2-tri-chloro-ethane mol-ecules occupy solvent-accessible channels along the b axis. PMID:27308025

  11. Crystal structure of bis­(ethyl­enedi­thio)­tetra­thia­fulvalenium μ2-acetato-bis­[tri­bromido­rhenate(III)] 1,1,2-tri­chloro­ethane hemisolvate

    PubMed Central

    Golichenko, Alexander A.; Kravchenko, Andrey V.; Omelchenko, Irina V.; Chudak, Denis M.; Starodub, Vladimir A.; Barszcz, Boleslaw; Shtemenko, Alexander V.


    The asymmetric unit of the title salt, (C10H8S8)[Re2Br6(CH3COO)]·0.5C2H3Cl3, contains one bis­(ethyl­enedi­thio)­tetra­thia­fulvalene (ET) radical cation, one μ2-acetato-bis­[tri­bromido­rhenate(III)] anion and a 1,1,2-tri­chloro­ethane mol­ecule with half-occupancy disordered about a twofold rotation axis. The tetra­thia­fulvalene fragment adopts an almost planar configuration typical of the ET radical cation. The C atoms of both ethyl­enedi­thio fragments in the cation are disordered over two orientations with occupancy factors 0.65:0.35 and 0.77:0.23. In the anion, six Br atoms and a μ2-acetate ligand form a strongly distorted cubic O2Br6 coordination polyhedron around the Re2 dinuclear centre. In the crystal, centrosymmetrically related ET cations and Re2O2Br6 anions are linked into dimers by π–π stacking inter­actions [centroid-to-centroid distance = 3.826 (8) Å] and by pairs of additional Re⋯Br contacts [3.131 (3) Å], respectively. The dimers are further packed into a three-dimensional network by non-directional inter­ionic electrostatic forces and by C—H⋯Br and C—H⋯S hydrogen bonds. The disordered 1,1,2-tri­chloro­ethane mol­ecules occupy solvent-accessible channels along the b axis. PMID:27308025

  12. Vaccinia-Related Kinase 2 Controls the Stability of the Eukaryotic Chaperonin TRiC/CCT by Inhibiting the Deubiquitinating Enzyme USP25

    PubMed Central

    Kim, Sangjune; Lee, Dohyun; Lee, Juhyun; Song, Haengjin; Kim, Hyo-Jin


    Molecular chaperones monitor the proper folding of misfolded proteins and function as the first line of defense against mutant protein aggregation in neurodegenerative diseases. The eukaryotic chaperonin TRiC is a potent suppressor of mutant protein aggregation and toxicity in early stages of disease progression. Elucidation of TRiC functional regulation will enable us to better understand the pathological mechanisms of neurodegeneration. We have previously shown that vaccinia-related kinase 2 (VRK2) downregulates TRiC protein levels through the ubiquitin-proteasome system by recruiting the E3 ligase COP1. However, although VRK2 activity was necessary in TRiC downregulation, the phosphorylated substrate was not determined. Here, we report that USP25 is a novel TRiC interacting protein that is also phosphorylated by VRK2. USP25 catalyzed deubiquitination of the TRiC protein and stabilized the chaperonin, thereby reducing accumulation of misfolded polyglutamine protein aggregates. Notably, USP25 deubiquitinating activity was suppressed when VRK2 phosphorylated the Thr680, Thr727, and Ser745 residues. Impaired USP25 deubiquitinating activity after VRK2-mediated phosphorylation may be a critical pathway in TRiC protein destabilization. PMID:25755282

  13. Effects of advertisements on smokers’ interest in trying e-cigarettes: the roles of product comparison and visual cues

    PubMed Central

    Pepper, Jessica K; Emery, Sherry L; Ribisl, Kurt M; Southwell, Brian G; Brewer, Noel T


    Introduction Electronic cigarettes (e-cigarettes) are battery-powered nicotine delivery devices that have become popular among smokers. We conducted an experiment to understand adult smokers’ responses to e-cigarette advertisements and investigate the impact of ads’ arguments and imagery. Methods A US national sample of smokers who had never tried e-cigarettes (n=3253) participated in a between-subjects experiment. Smokers viewed an online advertisement promoting e-cigarettes using one of three comparison types (emphasising similarity to regular cigarettes, differences or neither) with one of three images, for nine conditions total. Smokers then indicated their interest in trying e-cigarettes. Results Ads that emphasised differences between e-cigarettes and regular cigarettes elicited more interest than ads without comparisons (p<0.01), primarily due to claims about e-cigarettes’ lower cost, greater healthfulness and utility for smoking cessation. However, ads that emphasised the similarities of the products did not differ from ads without comparisons. Ads showing a person using an e-cigarette created more interest than ads showing a person without an e-cigarette (p<0.01). Conclusions Interest in trying e-cigarettes was highest after viewing ads with messages about differences between regular and electronic cigarettes and ads showing product use. If e-cigarettes prove to be harmful or ineffective cessation devices, regulators might restrict images of e-cigarette use in advertising, and public health messages should not emphasise differences between regular and electronic cigarettes. To inform additional regulations, future research should seek to identify what advertising messages and features appeal to youth. PMID:24935896

  14. Three-Dimensional Microfluidic Tri-Culture Model of the Bone Marrow Microenvironment for Study of Acute Lymphoblastic Leukemia

    PubMed Central

    Bruce, Allison; Evans, Rebecca; Mezan, Ryan; Shi, Lin; Moses, Blake S.; Martin, Karen H.; Gibson, Laura F.; Yang, Yong


    Acute lymphoblastic leukemia (ALL) initiates and progresses in the bone marrow, and as such, the marrow microenvironment is a critical regulatory component in development of this cancer. However, ALL studies were conducted mainly on flat plastic substrates, which do not recapitulate the characteristics of marrow microenvironments. To study ALL in a model of in vivo relevance, we have engineered a 3-D microfluidic cell culture platform. Biologically relevant populations of primary human bone marrow stromal cells, osteoblasts and human leukemic cells representative of an aggressive phenotype were encapsulated in 3-D collagen matrix as the minimal constituents and cultured in a microfluidic platform. The matrix stiffness and fluidic shear stress were controlled in a physiological range. The 3-D microfluidic as well as 3-D static models demonstrated coordinated cell-cell interactions between these cell types compared to the compaction of the 2-D static model. Tumor cell viability in response to an antimetabolite chemotherapeutic agent, cytarabine in tumor cells alone and tri-culture models for 2-D static, 3-D static and 3-D microfluidic models were compared. The present study showed decreased chemotherapeutic drug sensitivity of leukemic cells in 3-D tri-culture models from the 2-D models. The results indicate that the bone marrow microenvironment plays a protective role in tumor cell survival during drug treatment. The engineered 3-D microfluidic tri-culture model enables systematic investigation of effects of cell-cell and cell-matrix interactions on cancer progression and therapeutic intervention in a controllable manner, thus improving our limited comprehension of the role of microenvironmental signals in cancer biology. PMID:26488876

  15. Updated and Expanded Study of Polycythemia Vera and Other Myeloproliferative Neoplasms in the Tri-County Area

    PubMed Central

    Buchanich, J. M.; Mertz, K. J.; Washington, T. L.; Logue, J. N.; Marchetto, D.; Roda, P. I.; Irvin-Barnwell, E.


    Introduction The results of a 2001–2005 polycythemia vera (PV) investigation in Eastern Pennsylvania revealed a disease cluster plus underreporting and false reporting to the Pennsylvania Cancer Registry (PCR). Purpose The objectives of this study were 1) to assess PV reporting to the PCR in 2006–2009, 2) to determine whether a cancer cluster persisted, and 3) to determine whether other myeloproliferative neoplasms (MPNs), including essential thrombocytopenia (ET), were subject to similar reporting problems. Methods Cases were identified from: 1) PCR records from the Tri-County, 2) reviewing billing records at Tri-County hematologist/oncologist offices, and 3) self-identification. An expert panel of physicians reviewed medical records and determined “true,” “false,” or “indeterminate” cases reported to the PCR. The analyses were conducted to determine sensitivity and positive predictive value (PPV) of case reporting to the PCR, estimate cancer incidence rates, and evaluate the presence of cancer clusters. Results Of 290 cases identified, 90% were from the original PCR, 9% from billing records, and 1% from self-report. Fifty-five cases consented to participate, and medical records were obtained for 44. The expert panel determined that 45% were true cases, 32% were false cases, and 23% were indeterminate. PV had 100% (95% CI, 59–100) sensitivity, but only 47% PPV (95% CI, 20–70): ET had 78% (95% CI, 47–99) sensitivity and 100% PPV (95% CI, 59–100). Low participation and chart review rates led to rates with wide confidence intervals. We did not identify any PV cancer clusters, but we did identify a cluster of 9 ET cases in the Wilkes-Barre, Pennsylvania area. Conclusion The current study was limited by the low response rate (22%) from MPN patients in the Tri-County area. This study identified 47% PPV for PV reporting and 100% PPV for ET. PMID:25803630

  16. Rare-earth tri-halides methanol-adduct single-crystal scintillators for gamma ray and neutron detection

    NASA Astrophysics Data System (ADS)

    Boatner, L. A.; Wisniewski, D. J.; Neal, J. S.; Bell, Z. W.; Ramey, J. O.; Kolopus, J. A.; Chakoumakos, B. C.; Custelcean, R.; Wisniewska, M.; Pena, K. E.


    Cerium activated rare-earth tri- halides represent a well-known family of high performance inorganic rare-earth scintillators - including the high-light-yield, high-energy-resolution scintillator, cerium-doped lanthanum tribromide. These hygroscopic inorganic rare-earth halides are currently grown as single crystals from the melt - either by the Bridgman or Czochralski techniques - slow and expensive processes that are frequently characterized by severe cracking of the material due to anisotropic thermal stresses and cleavage effects. We have recently discovered a new family of cerium-activated rare-earth metal organic scintillators consisting of tri-halide methanol adducts of cerium and lanthanum - namely CeCl3(CH3OH)4 and LaBr3(CH3OH)4:Ce. These methanol-adduct scintillator materials can be grown near room temperature from a methanol solution, and their high solubility is consistent with the application of the rapid solution growth methods that are currently used to grow very large single crystals of potassium dihydrogen phosphate. The structures of these new rare-earth metal-organic scintillating compounds were determined by single crystal x-ray refinements, and their scintillation response to both gamma rays and neutrons, as presented here, was characterized using different excitation sources. Tri-halide methanol-adduct crystals activated with trivalent cerium apparently represent the initial example of a solution-grown rare-earth metal-organic molecular scintillator that is applicable to gamma ray, x-ray, and fast neutron detection.

  17. Genomic DNA extraction from medicinal plants available in Malaysia using a TriOmic(TM) improved extraction kit.


    Mohd-Hairul, A R; Sade, A B; Yiap, B C; Raha, A R


    DNA extraction was carried out on 32 medicinal plant samples available in Malaysia using the TriOmic(TM) extraction kit. Amounts of 0.1 g flowers or young leaves were ground with liquid nitrogen, lysed at 65°C in RY1(plus) buffer and followed by RNAse treatment. Then, RY2 buffer was added to the samples and mixed completely by vortexing before removal of cell debris by centrifugation. Supernatants were transferred to fresh microcentrifuge tubes and 0.1 volume RY3 buffer was added to each of the transferred supernatant. The mixtures were applied to spin columns followed by a centrifugation step to remove buffers and other residues. Washing step was carried out twice by applying 70% ethanol to the spin columns. Genomic DNA of the samples was recovered by applying 50 μL TE buffer to the membrane of each spin column, followed by a centrifugation step at room temperature. A modification of the TriOmic(TM) extraction procedure was carried out by adding chloroform:isoamyl alcohol (24:1) steps in the extraction procedure. The genomic DNA extracted from most of the 32 samples showed an increase of total yield when chloroform:isoamyl alcohol (24:1) steps were applied in the TriOmicTM extraction procedure. This preliminary study is very important for molecular studies of medicinal plants available in Malaysia since the DNA extraction can be completed in a shorter period of time (within 1 h) compared to manual extraction, which entails applying phenol, chloroform and ethanol precipitation, and requires 1-2 days to complete. PMID:22095601

  18. Tri-peptide reference structures for the calculation of relative solvent accessible surface area in protein amino acid residues.


    Topham, Christopher M; Smith, Jeremy C


    Relative amino acid residue solvent accessibility values allow the quantitative comparison of atomic solvent-accessible surface areas in different residue types and physical environments in proteins and in protein structural alignments. Geometry-optimised tri-peptide structures in extended solvent-exposed reference conformations have been obtained for 43 amino acid residue types at a high level of quantum chemical theory. Significant increases in side-chain solvent accessibility, offset by reductions in main-chain atom solvent exposure, were observed for standard residue types in partially geometry-optimised structures when compared to non-minimised models built from identical sets of proper dihedral angles abstracted from the literature. Optimisation of proper dihedral angles led most notably to marked increases of up to 54% in proline main-chain atom solvent accessibility compared to literature values. Similar effects were observed for fully-optimised tri-peptides in implicit solvent. The relief of internal strain energy was associated with systematic variation in N, C(α) and C(β) atom solvent accessibility across all standard residue types. The results underline the importance of optimisation of 'hard' degrees of freedom (bond lengths and valence bond angles) and improper dihedral angle values from force field or other context-independent reference values, and impact on the use of standardised fixed internal co-ordinate geometry in sampling approaches to the determination of absolute values of protein amino acid residue solvent accessibility. Quantum chemical methods provide a useful and accurate alternative to molecular mechanics methods to perform energy minimisation of peptides containing non-standard (chemically modified) amino acid residues frequently present in experimental protein structure data sets, for which force field parameters may not be available. Reference tri-peptide atomic co-ordinate sets including hydrogen atoms are made freely available

  19. Wireless Tri-Axial Trunk Accelerometry Detects Deviations in Dynamic Center of Mass Motion Due to Running-Induced Fatigue

    PubMed Central


    Small wireless trunk accelerometers have become a popular approach to unobtrusively quantify human locomotion and provide insights into both gait rehabilitation and sports performance. However, limited evidence exists as to which trunk accelerometry measures are suitable for the purpose of detecting movement compensations while running, and specifically in response to fatigue. The aim of this study was therefore to detect deviations in the dynamic center of mass (CoM) motion due to running-induced fatigue using tri-axial trunk accelerometry. Twenty runners aged 18–25 years completed an indoor treadmill running protocol to volitional exhaustion at speeds equivalent to their 3.2 km time trial performance. The following dependent measures were extracted from tri-axial trunk accelerations of 20 running steps before and after the treadmill fatigue protocol: the tri-axial ratio of acceleration root mean square (RMS) to the resultant vector RMS, step and stride regularity (autocorrelation procedure), and sample entropy. Running-induced fatigue increased mediolateral and anteroposterior ratios of acceleration RMS (p < .05), decreased the anteroposterior step regularity (p < .05), and increased the anteroposterior sample entropy (p < .05) of trunk accelerometry patterns. Our findings indicate that treadmill running-induced fatigue might reveal itself in a greater contribution of variability in horizontal plane trunk accelerations, with anteroposterior trunk accelerations that are less regular from step-to-step and are less predictable. It appears that trunk accelerometry parameters can be used to detect deviations in dynamic CoM motion induced by treadmill running fatigue, yet it is unknown how robust or generalizable these parameters are to outdoor running environments. PMID:26517261

  20. Transitions from mono- to co- to tri-culture uniquely affect gene expression in breast cancer, stromal, and immune compartments.


    Regier, Mary C; Maccoux, Lindsey J; Weinberger, Emma M; Regehr, Keil J; Berry, Scott M; Beebe, David J; Alarid, Elaine T


    Heterotypic interactions in cancer microenvironments play important roles in disease initiation, progression, and spread. Co-culture is the predominant approach used in dissecting paracrine interactions between tumor and stromal cells, but functional results from simple co-cultures frequently fail to correlate to in vivo conditions. Though complex heterotypic in vitro models have improved functional relevance, there is little systematic knowledge of how multi-culture parameters influence this recapitulation. We therefore have employed a more iterative approach to investigate the influence of increasing model complexity; increased heterotypic complexity specifically. Here we describe how the compartmentalized and microscale elements of our multi-culture device allowed us to obtain gene expression data from one cell type at a time in a heterotypic culture where cells communicated through paracrine interactions. With our device we generated a large dataset comprised of cell type specific gene-expression patterns for cultures of increasing complexity (three cell types in mono-, co-, or tri-culture) not readily accessible in other systems. Principal component analysis indicated that gene expression was changed in co-culture but was often more strongly altered in tri-culture as compared to mono-culture. Our analysis revealed that cell type identity and the complexity around it (mono-, co-, or tri-culture) influence gene regulation. We also observed evidence of complementary regulation between cell types in the same heterotypic culture. Here we demonstrate the utility of our platform in providing insight into how tumor and stromal cells respond to microenvironments of varying complexities highlighting the expanding importance of heterotypic cultures that go beyond conventional co-culture. PMID:27432323