Science.gov

Sample records for chuyn giao tri

  1. Gauge invariance, current conservation, and GIAO's

    NASA Technical Reports Server (NTRS)

    Epstein, S. T.

    1972-01-01

    The well known relationship between gauge invariance and current conservation is exhibited within the usual quantum mechanical formalism. It is then shown that the use of gauge-invariant atomic orbitals (GIAO) does not necessarily lead to the expected current conservation. The reason is found to lie in the constrained nature of the gauge invariance which is provided by the use of GIAO's. It is concluded that this invariance is, of itself, no argument in favor of their use.

  2. Determination of a new chromone from Aurantii Fructus Immaturus by DFT/GIAO method.

    PubMed

    Jiang, Zhe; Liu, Fang; Zhong, Aijiao; Dugu, Jiaxiu; Li, Xuezheng

    2016-01-01

    Investigation of EtOAc fraction from the 95% ethanol extract of Aurantii Fructus Immaturus led to the isolation of one new chromone (1) and seven known flavonoids (2-8). Their structures were elucidated mainly by NMR and HR-ESI-MS, as well as on comparison with the reported NMR data. The final substituent pattern of 1 was defined by comparison of (13)C NMR data calculated by DFT/GIAO with those of experimental NMR data.

  3. Conformational analysis of capsaicin using 13C, 15N MAS NMR, GIAO DFT and GA calculations

    NASA Astrophysics Data System (ADS)

    Siudem, Paweł; Paradowska, Katarzyna; Bukowicki, Jarosław

    2017-10-01

    Capsaicin produced by plants from genus Capsicum exerts multiple pharmacological effects and has found applications in food and pharmaceutical industry. The alkaloid was studied by a combined approach: solid-state NMR, GA conformational search and GIAO DFT methods. The 13C CPMAS NMR spectra were recorded using variable contact time and dipolar dephasing experiments. The results of cross-polarization (CP) kinetics, such as TCP values and long T1ρH (100-200 ms), indicated that the capsaicin molecule is fairly mobile, especially at the end of the aliphatic chain. The15N MAS NMR spectrum showed one narrow signal at -255 ppm. Genetic algorithm (GA) search with multi modal optimization was used to find low-energy conformations of capsaicin. Theoretical GIAO DFT calculations were performed using different basis sets to characterize five selected conformations. 13C CPMAS NMR was used as a validation method and the experimental chemical shifts were compared with those calculated for selected stable conformers. Conformational analysis suggests that the side chain can be bent or extended. A comparison of the experimental and the calculated chemical shifts indicates that solid capsaicin does not have the same structure as those established by PWXRD.

  4. GIAO/DFT studies on 1,2,4-triazole-5-thiones and their propargyl derivatives.

    PubMed

    Phalgune, Usha D; Vanka, Kumar; Rajamohanan, P R

    2013-12-01

    Density functional theory (DFT)/Becke-Lee-Yang-Parr (B3LYP) and gauge-including atomic orbital (GIAO) calculations were performed on a number of 1,2,4-triazole derivatives, and the optimized structural parameters were employed to ascertain the nature of their predominant tautomers. (13)C and (15)N NMR chemical shifts of 3-substituted 1,2,4-triazole-5-thiones and their propargylated derivatives were calculated via GIAO/DFT approach at the B3LYP level of theory with geometry optimization using a 6-311++G** basis set. A good agreement between theoretical and experimental (13)C and (15)N NMR chemical shifts could be found for the systems investigated. The data generated were useful in predicting (15)N chemical shifts of all the nitrogen atoms of the triazole ring, some of which could not be obtained in solution state (15)N HMBC/HSQC NMR measurements. The energy profile computed for the dipropargylated derivatives was found to follow the product distribution profile of regioisomers formed during propargylation of 1,2,4-triazole thiones. Copyright © 2013 John Wiley & Sons, Ltd.

  5. Effects of structural differences on the NMR chemical shifts in cinnamic acid derivatives: Comparison of GIAO and GIPAW calculations

    NASA Astrophysics Data System (ADS)

    Szeleszczuk, Łukasz; Pisklak, Dariusz Maciej; Zielińska-Pisklak, Monika; Wawer, Iwona

    2016-06-01

    In this article we report the results of combined theoretical and experimental structural studies on cinnamic acid derivatives (CADs), one of the main groups of secondary metabolites present in various medicinal plant species and food products of plant origin. The effects of structural differences in CADs on their spectroscopic properties were studied in detail by both: solid-state NMR and GIAO/GIPAW calculations. Theoretical computations were used in order to perform signal assignment in 13C CP/MAS NMR spectra of the cinnamic, o-coumaric, m-coumaric, p-coumaric, caffeic, ferulic, sinapic and 3,4-dimethoxycinnamic acids, and to evaluate the accuracy of GIPAW and GIAO methodology.

  6. (13)C, (15)N CPMAS NMR and GIAO DFT calculations of stereoisomeric oxindole alkaloids from Cat's Claw (Uncaria tomentosa).

    PubMed

    Paradowska, Katarzyna; Wolniak, Michał; Pisklak, Maciej; Gliński, Jan A; Davey, Matthew H; Wawer, Iwona

    2008-11-01

    Oxindole alkaloids, isolated from the bark of Uncaria tomentosa [Willd. ex Schult.] Rubiaceae, are considered to be responsible for the biological activity of this herb. Five pentacyclic and two tetracyclic alkaloids were studied by solid-state NMR and theoretical GIAO DFT methods. The (13)C and (15)N CPMAS NMR spectra were recorded for mitraphylline, isomitraphylline, pteropodine (uncarine C), isopteropodine (uncarine E), speciophylline (uncarine D), rhynchophylline and isorhynchophylline. Theoretical GIAO DFT calculations of shielding constants provide arguments for identification of asymmetric centers and proper assignment of NMR spectra. These alkaloids are 7R/7S and 20R/20S stereoisomeric pairs. Based on the (13)C CP MAS chemical shifts the 7S alkaloids (delta C3 70-71ppm) can be easily and conveniently distinguished from 7R (deltaC3 74.5-74.9ppm), also 20R (deltaC20 41.3-41.7ppm) from the 20S (deltaC20 36.3-38.3ppm). The epiallo-type isomer (3R, 20S) of speciophylline is characterized by a larger (15)N MAS chemical shift of N4 (64.6ppm) than the allo-type (3S, 20S) of isopteropodine (deltaN4 53.3ppm). (15)N MAS chemical shifts of N1-H in pentacyclic alkaloids are within 131.9-140.4ppm.

  7. 2016 TRI Preliminary Dataset

    EPA Pesticide Factsheets

    The TRI preliminary dataset includes the most current TRI data available and reflects toxic chemical releases and pollution prevention activities that occurred at TRI facilities during the 2016 calendar year.

  8. Molecular structure of actein: 13C CPMAS NMR, IR, X-ray diffraction studies and theoretical DFT-GIAO calculations

    NASA Astrophysics Data System (ADS)

    Jamróz, Marta K.; Bąk, Joanna; Gliński, Jan A.; Koczorowska, Agnieszka; Wawer, Iwona

    2009-09-01

    Actein is a prominent triterpene glycoside occurring in Actaea racemosa. The triterpene glycosides are believed to be responsible for the estrogenic activity of an extract prepared from this herb. We determined in the crystal structure of actein by X-ray crystallography to be monoclinic P2(1) chiral space group. Refining the disorder, we determined 70% and 30% of contributions of ( S)- and ( R)-actein, respectively. The IR and Raman spectra suggest that actein forms at least four different types of hydrogen bonds. The 13C NMR spectra of actein were recorded both in solution and solid state. The 13C CPMAS spectrum of actein displays multiplet signals, in agreement with the crystallographic data. The NMR shielding constants were calculated for actein using GIAO approach and a variety of basis sets: 6-31G**, 6-311G**, 6-31+G**, cc-pVDZ, cc-pVDZ-su1 and 6-31G**-su1, as well as IGLO approach combined with the IGLO II basis set. The best results (RMSD of 1.6 ppm and maximum error of 3.4 ppm) were obtained with the 6-31G**-su1 basis set. The calculations of the shielding constants are helpful in the interpretation of the 13C CPMAS NMR spectra of actein and actein's analogues.

  9. Effect of 1,10-phenanthroline aromaticity in carboxylic acids:1H NMR spectroscopy, GIAO calculations and thermodynamic properties

    NASA Astrophysics Data System (ADS)

    Machado, Camila M. B.; Santos, Vanessa F. C.; Belarmino, Marcia K. D. L.; França, José A. A.; Moura, Gustavo L. C.; Lima, Nathalia B. D.

    2016-08-01

    Hydrogen bonding represents a class of chemical interactions, which are directly responsible for several physical properties, such as: energetic stabilities, boiling points, vibrational modes, bond lengths, etc. In this article, we examine from the point of view of 1H NMR spectroscopy and GIAO calculations, the effects associated with the process of formation of the hydrogen bonds as they appear in the chemical shifts of the acidic hydrogens in the complexes between nitrogenated compounds, PHEN, BIPY and DIBIPY, and carboxylic acids, HOOCH, HOOCCH3 and HOOCC6H5. All computational simulations were performed using the quantum chemical methods B3LYP/6-31++G(d,p) and ωB97X-D/def2-TZVP. The 1H NMR spectroscopy results showed that, in both cases, the hydrogen nucleus of the OH group is the most affected in the process of hydrogen bond formation. For the complexes involving PHEN we observed that the hydrogen nucleus is more strongly shielded when compared with this signal in the corresponding complexes involving BIPY and DIBIPY.

  10. TRI Fotonovela Slideshow - English

    EPA Pesticide Factsheets

    Presentation designed to introduce the basic concepts of the Toxics Release Inventory, including why TRI is an important resource for commmunities and which tool provides the easiest access to basic TRI data.

  11. 2017 TRI University Challenge

    EPA Pesticide Factsheets

    Details about the 2017 TRI University Challenge, in which EPA is looking to academic institutions to help build a diverse portfolio of practical and replicable projects that benefit communities, the environment, academic institutions, and the TRI Program.

  12. TRI Fotonovela Slideshow - Spanish

    EPA Pesticide Factsheets

    Presentation designed to introduce the basic concepts of the Toxics Release Inventory, including why TRI is an important resource for commmunities and which tool provides the easiest access to basic TRI data.

  13. ADHD: Tips to Try

    MedlinePlus

    ... Right Sport for You Healthy School Lunch Planner ADHD: Tips to Try KidsHealth > For Teens > ADHD: Tips to Try Print A A A en español TDAH: Consejos que puedes probar ADHD , or attention deficit hyperactivity disorder, is a medical ...

  14. TRI National Analysis

    EPA Pesticide Factsheets

    Interpretation of annual TRI data reported by industrial facilities. Interactive maps and other tools give a close look at how industries, parent companies, and individual facilities manage toxic chemical waste and how they prevent and reduce pollution.

  15. Trying something new.

    PubMed

    Condon, Barbara Backer

    2013-01-01

    Trying something new is a universal living experience of health. Although trying something new frequently occurs in healthcare, its meaning has never explicitly been studied. Parse's humanbecoming school of thought is the theoretical perspective for this study. The research question for this study is: What is the structure of the living experience of trying something new? The purpose of this study was to advance nursing science. Parse's qualitative phenomenological-hermeneutic research method was used to guide this study. Participants were 8 men and 2 women, ages 29 to 65 who utilize an outpatient mental health facility in the Midwest. Data were collected with dialogical engagement. The major finding of the study is the structure: Trying something new is engaging in capricious exploitations with vacillating sentiments, as wistful contemplation surfaces with disparate affiliations.

  16. TRI Pollution Prevention Reporting Tipsheet

    EPA Pesticide Factsheets

    TRI Pollution Prevention Reporting Tipsheet is provided to encourage and assist TRI facilities with reporting optional P2 information on their TRI reporting forms, and to facilitate information sharing within and across organizations.

  17. Theoretical gas to liquid shift of (15)N isotropic nuclear magnetic shielding in nitromethane using ab initio molecular dynamics and GIAO/GIPAW calculations.

    PubMed

    Gerber, Iann C; Jolibois, Franck

    2015-05-14

    Chemical shift requires the knowledge of both the sample and a reference magnetic shielding. In few cases as nitrogen (15N), the standard experimental reference corresponds to its liquid phase. Theoretical estimate of NMR magnetic shielding parameters of compounds in their liquid phase is then mandatory but usually replaced by an easily-get gas phase value, forbidding direct comparisons with experiments. We propose here to combine ab initio molecular dynamic simulations with the calculations of magnetic shielding using GIAO approach on extracted cluster's structures from MD. Using several computational strategies, we manage to accurately calculate 15N magnetic shielding of nitromethane in its liquid phase. Theoretical comparison between liquid and gas phase allows us to extrapolate an experimental value for the 15N magnetic shielding of nitromethane in gas phase between -121.8 and -120.8 ppm.

  18. TRI Fotonovela (Latino/Hispanic novella style introduction to TRI)

    EPA Pesticide Factsheets

    Presentation designed to introduce the basic concepts of the Toxics Release Inventory, including why TRI is an important resource for commmunities and which tool provides the easiest access to basic TRI data.

  19. Tri-M: Try it; You'll Like it!

    ERIC Educational Resources Information Center

    Beelendorf, Pierre

    2002-01-01

    Describes the Tri-M Music Honor Society that is for middle/junior high and senior high school students. Discusses what having a Tri-M Society can do for a music department and the benefits of having a Tri-M Society. Includes information on starting the society, a history, and Web sites. (CMK)

  20. Tri-M: Try it; You'll Like it!

    ERIC Educational Resources Information Center

    Beelendorf, Pierre

    2002-01-01

    Describes the Tri-M Music Honor Society that is for middle/junior high and senior high school students. Discusses what having a Tri-M Society can do for a music department and the benefits of having a Tri-M Society. Includes information on starting the society, a history, and Web sites. (CMK)

  1. Introduction to TRI for Communities

    EPA Pesticide Factsheets

    Presentation designed to introduce the basic concepts of the Toxics Release Inventory, including why TRI is an important resource for commmunities and which tool provides the easiest access to basic TRI data.

  2. Tanks Emissions for TRI Reporting

    EPA Pesticide Factsheets

    A presentation on overcoming the challenges of TRI reporting for and monitoring the hazardous air emissions from storage tanks, including a discussion on the most accurate and feasible methods of correctly reporting tank emissions to the TRI Program.

  3. Successful combination of computationally inexpensive GIAO 13C NMR calculations and artificial neural network pattern recognition: a new strategy for simple and rapid detection of structural misassignments.

    PubMed

    Sarotti, Ariel M

    2013-08-07

    GIAO NMR chemical shift calculations coupled with trained artificial neural networks (ANNs) have been shown to provide a powerful strategy for simple, rapid and reliable identification of structural misassignments of organic compounds using only one set of both computational and experimental data. The geometry optimization, usually the most time-consuming step in the overall procedure, was carried out using computationally inexpensive methods (MM+, AM1 or HF/3-21G) and the NMR shielding constants at the affordable mPW1PW91/6-31G(d) level of theory. As low quality NMR prediction is typically obtained with such protocols, the decision making was foreseen as a problem of pattern recognition. Thus, given a set of statistical parameters computed after correlation between experimental and calculated chemical shifts the classification was done using the knowledge derived from trained ANNs. The training process was carried out with a set of 200 molecules chosen to provide a wide array of chemical functionalities and molecular complexity, and the results were validated with a set of 26 natural products that had been incorrectly assigned along with their 26 revised structures. The high prediction effectiveness observed makes this method a suitable test for rapid identification of structural misassignments, preventing not only the publication of wrong structures but also avoiding the consequences of such a mistake.

  4. Preparation, GIAO NMR Calculations and Acidic Properties of Some Novel 4,5-dihydro-1H-1,2,4-triazol-5-one Derivatives with Their Antioxidant Activities

    PubMed Central

    Yüksek, Haydar; Alkan, Muzaffer; Cakmak, Ismail; Ocak, Zafer; Bahçeci, Şule; Calapoğlu, Mustafa; Elmastaş, Mahfuz; Kolomuç, Ali; Aksu, Havva

    2008-01-01

    Six novel 3-alkyl(aryl)-4-(p-nitrobenzoylamino)-4,5-dihydro-1H-1,2,4-triazol-5- ones (2a-f) were synthesized by the reactions of 3-alkyl(aryl)-4-amino-4,5-dihydro-1H- 1,2,4-triazol-5-ones (1a-f) with p-nitrobenzoyl chloride and characterized by elemental analyses and IR, 1H-NMR, 13C-NMR and UV spectral data. The newly synthesized compounds 2 were titrated potentiometrically with tetrabutylammonium hydroxide in four non-aqueous solvents such as acetone, isopropyl alcohol, tert-butyl alcohol and N,N-dimethylformamide, and the half-neutralization potential values and the corresponding pKa values were determined for all cases. Thus, the effects of solvents and molecular structure upon acidity were investigated. In addition, isotropic 1H and 13C nuclear magnetic shielding constants of compounds 2 were obtained by the gauge-including-atomic-orbital (GIAO) method at the B3LYP density functional level. The geometry of each compound has been optimized using the 6-311G basis set. Theoretical values were compared to the experimental data. Furthermore, these new compounds and five recently reported 3-alkyl-4-(2-furoylamino)-4,5-dihydro-1H-1,2,4-triazol-5-ones (3a–c,e,f) were screened for their antioxidant activities. PMID:19325716

  5. Try Another Way. Training Manual.

    ERIC Educational Resources Information Center

    Gold, Marc

    Intended for use in training conferences, the manual describes the philosophy and procedures of Try Another Way, an approach for teaching moderately, severely and profoundly mentally retarded persons and developmentally disabled persons difficult to train. An alternative definition of retardation is proposed which stresses level of functioning…

  6. Try This: Collaborative Mind Mapping

    ERIC Educational Resources Information Center

    Mendelson, Melissa

    2016-01-01

    In this "Try This" article, students learn about collaborative mind mapping. A mind map is a type of graphic organizer that allows for short ideas to be written and linked to related ideas on a "map." A central idea is placed in the middle of the paper with related ideas connected to the central idea as well as to other ideas.…

  7. Try Another Way. Training Manual.

    ERIC Educational Resources Information Center

    Gold, Marc

    Intended for use in training conferences, the manual describes the philosophy and procedures of Try Another Way, an approach for teaching moderately, severely and profoundly mentally retarded persons and developmentally disabled persons difficult to train. An alternative definition of retardation is proposed which stresses level of functioning…

  8. Analysis of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rate within the scope of econophysics

    NASA Astrophysics Data System (ADS)

    Deviren, Bayram; Kocakaplan, Yusuf; Keskin, Mustafa; Balcılar, Mehmet; Özdemir, Zeynel Abidin; Ersoy, Ersan

    2014-09-01

    In this study, we analyze the Turkish Lira/US Dollar (TRY/USD), Turkish Lira/Euro (TRY/EUR), Turkish Lira/Japanese Yen (TRY/JPY) and Turkish Lira/Swiss Franc (TRY/CHF) exchange rates in the global financial crisis period to detect the bubbles and crashes in the TRY by using a mathematical methodology developed by Watanabe et al. (2007). The methodology defines the bubbles and crashes in financial market price fluctuations by considering an exponential fitting of the associated data. This methodology is applied to detect the bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rates from January, 1, 2005 to December, 20, 2013. In this mathematical methodology, the whole period of bubbles and crashes can be determined purely from past data, and the start of bubbles and crashes can be identified even before its bursts. In this way, the periods of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF are determined, and the beginning and end points of these periods are detected. The results show that the crashes in the TRY/CHF exchange rate are commonly finished earlier than in the other exchange rates; hence it is probable that the crashes in the other exchange rates would be finished soon when the crashes in the TRY/CHF exchange rate ended. We also find that the periods of crashes in the TRY/EUR exchange rate take longer time than in the other exchange rates. This information can be used in risk management and/or speculative gain. The crashes' periods in the TRY/EUR and TRY/USD exchange rates are observed to be relatively longer than in the other exchange rates.

  9. Tri-state logic circuit

    NASA Technical Reports Server (NTRS)

    Pryor, Richard Lee (Inventor)

    1977-01-01

    A line driver including a pair of complementary transistors having their conduction paths serially connected between an operating and a reference potential and their bases connected through a first switch to a signal input terminal. A second switch is connected between the common base connection and the common connection of the conduction paths. With the second switch open and the first closed, an output voltage, responsive to the input signal, corresponding to first or second binary values is obtained. When the second switch is closed and the first opened, the transistor pair is turned off, disconnecting the line driver from its load, thereby providing tri-state logic operation.

  10. TRI-MEweb Enhancements for RY 2016

    EPA Pesticide Factsheets

    An overview of the new and enhanced features in the modernized version of TRI-MEweb, the CDX-based software that industrial facilities use to prepare and submit annual Toxics Release Inventory (TRI) data to EPA.

  11. TRI.NET Tutorial with Examples

    EPA Pesticide Factsheets

    This tutorial walks users through some sample TRI.NET searches to illustrate some of the ways this application can be used to access TRI data and answer basic questions about toxic chemical releases in a specific geographic area.

  12. Meeting TRI Data User’s Needs

    EPA Pesticide Factsheets

    A presentation focused on identifying near-term changes in EPA’s information resources, changes in the information technology available to TRI users, and changes in current and potential TRI customers.

  13. Ab initio/GIAO-CCSD(T) (13)C NMR study of the rearrangement and dynamic aspects of rapidly equilibrating tertiary carbocations, C6H13(+) and C7H15(+).

    PubMed

    Olah, George A; Prakash, G K Surya; Rasul, Golam

    2016-01-05

    The rearrangement pathways of the equilibrating tertiary carbocations, 2,3-dimethyl-2-butyl cation (C6H13(+), 1), 2,3,3-trimethyl-2-butyl cation (C7H15(+), 5) and 2,3-dimethyl-2-pentyl cation (C7H15(+), 8 and 9) were investigated using the ab initio/GIAO-CCSD(T) (13)C NMR method. Comparing the calculated and experimental (13)C NMR chemical shifts of a series of carbocations indicates that excellent prediction of δ(13)C could be achieved through scaling. In the case of symmetrical equilibrating cations (1 and 5) the Wagner-Meerwein 1,2-hydride and 1,2-methide shifts, respectively, produce the same structure. This indicates that the overall (13)C NMR chemical shifts are conserved and independent of temperature. However, in the case of unsymmetrical equilibrating cations (8 and 9) the Wagner-Meerwein shift produces different tertiary structures, which have slightly different thermodynamic stabilities and, thus, different spectra. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level structure 8 is only 90 calories/mol more stable than structure 9. Based on computed (13)C NMR chemical shift calculations, mole fractions of these isomers were determined by assuming the observed chemical shifts are due to the weighted average of the chemical shifts of the static ions.

  14. Pyridazine-based Schiff base ligands with N 4O xS 2 ( x = 2, 4) donor set atoms: Synthesis, characterization, spectral studies and 13C chemical shifts computed by the GIAO-DFT and CSGT-DFT methodologies

    NASA Astrophysics Data System (ADS)

    Khanmohammadi, Hamid; Erfantalab, Malihe

    2010-01-01

    Six pyridazine-based Schiff base ligands, H 2L n ( n = 1-5) and H 4L, with N 4O 2S 2 and N 4O 4S 2 donor set atoms, respectively, were prepared by condensation reaction of 3,6-bis-((2-aminoethyl)thio)pyridazine with various salicyladehyde derivatives in ethanol and under solvent-free polyphosphate ester catalyzed conditions. The acid-base properties of H 2L 2 and H 2L 3 in DMSO/water (1:1) solution have been studied by spectrophotometric method at 25 °C. Optimized geometries of all compounds were also obtained at the B3LYP level of theory. Additionally, the 13C chemical shielding of gas phase H 2L 1 and H 2L 2 were studied by the gauge independent atomic orbital (GIAO) and continuous set of gauge transformations (CSGT) methods at the level of density functional theory (DFT). The 6-311++G* basis set was utilized for all of the atoms.

  15. Pyridazine-based Schiff base ligands with N4OxS2 (x=2, 4) donor set atoms: synthesis, characterization, spectral studies and 13C chemical shifts computed by the GIAO-DFT and CSGT-DFT methodologies.

    PubMed

    Khanmohammadi, Hamid; Erfantalab, Malihe

    2010-01-01

    Six pyridazine-based Schiff base ligands, H(2)L(n) (n=1-5) and H(4)L, with N(4)O(2)S(2) and N(4)O(4)S(2) donor set atoms, respectively, were prepared by condensation reaction of 3,6-bis-((2-aminoethyl)thio)pyridazine with various salicyladehyde derivatives in ethanol and under solvent-free polyphosphate ester catalyzed conditions. The acid-base properties of H(2)L(2) and H(2)L(3) in DMSO/water (1:1) solution have been studied by spectrophotometric method at 25 degrees C. Optimized geometries of all compounds were also obtained at the B3LYP level of theory. Additionally, the (13)C chemical shielding of gas phase H(2)L(1) and H(2)L(2) were studied by the gauge independent atomic orbital (GIAO) and continuous set of gauge transformations (CSGT) methods at the level of density functional theory (DFT). The 6-311++G* basis set was utilized for all of the atoms.

  16. Synthesis, determination of p Ka values and GIAO NMR calculations of some new 3-alkyl-4-( p-methoxybenzoylamino)-4,5-dihydro-1 H-1,2,4-triazol-5-ones

    NASA Astrophysics Data System (ADS)

    Yüksek, Haydar; Alkan, Muzaffer; Bahçeci, Şule; Cakmak, Ismail; Ocak, Zafer; Baykara, Haci; Aktaş, Ozlem; Ağyel, Elif

    2008-02-01

    3-Alkyl-4-amino-4,5-dihydro-1 H-1,2,4-triazol-5-ones ( 2) reacted with p-methoxybenzoyl chloride to afford the corresponding 3-alkyl-4-( p-methoxybenzoylamino)-4,5-dihydro-1 H-1,2,4-triazol-5-ones ( 3). Five newly synthesized compounds have been characterized by elemental analyses, IR, 1H NMR, 13C NMR and UV spectral data. The newly synthesized compounds 3 were titrated potentiometrically with tetrabutylammonium hydroxide in four non-aqueous solvents such as acetonitrile, isopropyl alcohol, tert-butyl alcohol and N, N-dimethylformamide, and the half-neutralization potential values and the corresponding p Ka values were determined for all cases. Thus, the effects of solvents and molecular structure upon acidity were investigated. In addition, isotropic 1H and 13C nuclear magnetic shielding constants of compounds 3 were obtained by the gauge-including-atomic-orbital (GIAO) method at the B3LYP density functional level. The geometry of each compound has been optimized using the 6-311G basis set. Theoretical values were compared to the experimental data.

  17. Study of stereospecificity of 1H, 13C, 15N and 77Se shielding constants in the configurational isomers of the selenophene-2-carbaldehyde azine by NMR spectroscopy and MP2-GIAO calculations.

    PubMed

    Afonin, Andrei V; Pavlov, Dmitry V; Albanov, Alexander I; Levanova, Ekaterina P; Levkovskaya, Galina G

    2011-11-01

    In the (1)H and (13)C NMR spectra of selenophene-2-carbaldehyde azine, the (1)H-5, (13)C-3 and (13)C-5 signals of the selenophene ring are shifted to higher frequencies, whereas those of the (1)H-1, (13)C-1, (13)C-2 and (13)C-4 are shifted to lower frequencies on going from the EE to ZZ isomer or from the E moiety to the Z moiety of EZ isomer. The (15)N chemical shift is significantly larger in the EE isomer relative to the ZZ isomer and in the E moiety relative to the Z moiety of EZ isomer. A very pronounced difference (60-65 mg/g) between the (77)Se resonance positions is revealed in the studied azine isomers, the (77)Se peak being shifted to higher frequencies in the ZZ isomer and in the Z moiety of EZ isomer. The trends in the changes of the measured chemical shifts are reasonably reproduced by the GIAO calculations at the MP2 level of the (1)H, (13)C, (15)N and (77)Se shielding constants in the energy-favorable conformation with the syn orientation of both selenophene rings relative to the C = N groups. The NBO analysis suggests that such an arrangement of the selenophene rings may take place because of a higher energy of some intramolecular interactions. Copyright © 2011 John Wiley & Sons, Ltd.

  18. 2016 TRI National Training Conference: Detailed Agenda

    EPA Pesticide Factsheets

    Agenda listing events, speakers, topics, biographies, and presentations for the 2016 National Training Conference on the Toxics Release Inventory (TRI) and Environmental Conditions in Communities. October 19-21, 2016

  19. Post-Menopausal? Give Exercise a Try

    MedlinePlus

    ... gov/news/fullstory_163625.html Post-Menopausal? Give Exercise a Try Study participants were fitter, felt better -- ... Feb. 16, 2017 (HealthDay News) -- After menopause, moderate exercise can help women manage hot flashes, become more ...

  20. Can't sleep? Try these tips

    MedlinePlus

    ... this page: //medlineplus.gov/ency/patientinstructions/000853.htm Can't sleep? Try these tips To use the ... you get the rest you need. What you can do Some people have trouble falling asleep. Others ...

  1. TriKota v 1.0

    SciTech Connect

    SALINGER, ANDREW; BARTLETT, ROSCOE; ELDRED, MICHAEL; & ADAMS, BRIAN

    2009-12-04

    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantification algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.

  2. EPA Facility Registry Service (FRS): TRI

    EPA Pesticide Factsheets

    This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link to the Toxic Release Inventory (TRI) System. TRI is a publicly available EPA database reported annually by certain covered industry groups, as well as federal facilities. It contains information about more than 650 toxic chemicals that are being used, manufactured, treated, transported, or released into the environment, and includes information about waste management and pollution prevention activities. FRS identifies and geospatially locates facilities, sites or places subject to environmental regulations or of environmental interest. Using vigorous verification and data management procedures, FRS integrates facility data from EPA's national program systems, other federal agencies, and State and tribal master facility records and provides EPA with a centrally managed, single source of comprehensive and authoritative information on facilities. This data set contains the subset of FRS integrated facilities that link to TRI facilities once the TRI data has been integrated into the FRS database. Additional information on FRS is available at the EPA website https://www.epa.gov/enviro/facility-registry-service-frs.

  3. Tri-Service Science and Technology Reliance.

    DTIC Science & Technology

    1992-12-01

    through the Cronus distributed computing environment. It utilizes the Cronus Distributed Computing Environment and is investigating distributed Tri...RL, CECOM, and NCCOSC with the access, update and interoperability prided through the Cronus distributed computing environment. The activities pursued...under this joint program have contributed to the successful transition of the Cronus technology to operational Navy use. B-22 COMPUTER SCIENCES PANEL

  4. Try This: Umbrella--Materials Testing

    ERIC Educational Resources Information Center

    Preston, Christine

    2016-01-01

    This article is the second in "Teaching Science's" "Try This" series. These hands-on activities are designed especially for early childhood students to encourage their natural curiosity and promote development of scientific thinking. In this activity, the problem-based learning approach means that the children are engaged in a…

  5. Try This: Umbrella--Materials Testing

    ERIC Educational Resources Information Center

    Preston, Christine

    2016-01-01

    This article is the second in "Teaching Science's" "Try This" series. These hands-on activities are designed especially for early childhood students to encourage their natural curiosity and promote development of scientific thinking. In this activity, the problem-based learning approach means that the children are engaged in a…

  6. Ham Tries Out His Life Support System

    NASA Technical Reports Server (NTRS)

    1961-01-01

    Ham tries out his combination couch and life support system in preparation for his flight in Mercury Redstone-2 (MR-2). The couch is plugged into the circuit that normally would supply the astronaut's full pressure suit. The MR-2 flight was one in a series of flights that led to the manned orbital flights of NASA's Project Mercury program.

  7. Tri-axial tactile sensing element

    NASA Astrophysics Data System (ADS)

    Castellanos-Ramos, Julián.; Navas-González, Rafael; Vidal-Verdú, F.

    2013-05-01

    A 13 x 13 square millimetre tri-axial taxel is presented which is suitable for some medical applications, for instance in assistive robotics that involves contact with humans or in prosthetics. Finite Element Analysis is carried out to determine what structure is the best to obtain a uniform distribution of pressure on the sensing areas underneath the structure. This structure has been fabricated in plastic with a 3D printer and a commercial tactile sensor has been used to implement the sensing areas. A three axis linear motorized translation stage with a tri-axial precision force sensor is used to find the parameters of the linear regression model and characterize the proposed taxel. The results are analysed to see to what extent the goal has been reached in this specific implementation.

  8. EPRI tries to integrate utility information systems

    SciTech Connect

    Hansen, T.

    1995-04-01

    Utilities spent $5 billion on information technology in 1994, according to market research firm Newton Evans Research Co. The Electric Power Research Institute (EPRI) estimates half was spent trying to integrate systems not designed to operate together. To solve this problem, EPRI has developed what it calls the Utility Communications Architecture (UCA). It was developed under the guidance of industry experts and utilities to provide a set of standards to integrate communications between utilities and systems.

  9. JDL Tri-Service Distributed Technology Experiment

    DTIC Science & Technology

    1992-03-01

    ment. The system used to support the Tri-Service Distributed Technology Experiment is the Cronus distributed computing environment. Cronus , developed by...applications. It is designed specifically for a command and control (C2) environment. Cronus operates on a variety of different hardware bases and...operating systems. It runs at user level, above the host’s native operating system. A JDL Cronus testbed was established at each site, using existing

  10. A Tri-Modal Directional Modem Transducer

    DTIC Science & Technology

    2003-09-01

    Spherical sensors with patterned electrodes [2] as well as dual mode flextensional transducers [3] have also been used to achieve directionality... Flextensional Transducer and Line Array” J. Acoust. Soc. Am. 102, 308-314 (1997). [4] J. E. Cole, III, “Acoustic Particle Velocity Sensors,” M. J. Berliner...A Tri-Modal Directional Modem Transducer A. L. Butler and J. L. Butler, Image Acoustics, Inc., Cohasset, MA 02025 jbutler@imageacoustics.com

  11. The SMX DNA Repair Tri-nuclease.

    PubMed

    Wyatt, Haley D M; Laister, Rob C; Martin, Stephen R; Arrowsmith, Cheryl H; West, Stephen C

    2017-03-02

    The efficient removal of replication and recombination intermediates is essential for the maintenance of genome stability. Resolution of these potentially toxic structures requires the MUS81-EME1 endonuclease, which is activated at prometaphase by formation of the SMX tri-nuclease containing three DNA repair structure-selective endonucleases: SLX1-SLX4, MUS81-EME1, and XPF-ERCC1. Here we show that SMX tri-nuclease is more active than the three individual nucleases, efficiently cleaving replication forks and recombination intermediates. Within SMX, SLX4 co-ordinates the SLX1 and MUS81-EME1 nucleases for Holliday junction resolution, in a reaction stimulated by XPF-ERCC1. SMX formation activates MUS81-EME1 for replication fork and flap structure cleavage by relaxing substrate specificity. Activation involves MUS81's conserved N-terminal HhH domain, which mediates incision site selection and SLX4 binding. Cell cycle-dependent formation and activation of this tri-nuclease complex provides a unique mechanism by which cells ensure chromosome segregation and preserve genome integrity.

  12. miniTri Mantevo miniapp v. 1.0

    SciTech Connect

    Berry, Johathan; Stark, Dylan; Wolf, Michael

    2016-02-02

    miniTri is a miniapplication developed as part of the Mantevo project. Given a graph, miniTri enumerates all triangles in this graph and computes a metric for each triangle based on the triangle edge and vertex degree. The output of miniTri is a summary of this metric. miniTri mimics the computational requirements of an important set of data science applications. Several approaches to this problem are included in the miniTri software.

  13. A Transgenic Tri-Modality Reporter Mouse

    PubMed Central

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.

    2013-01-01

    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This “Tri-Modality Reporter Mouse” system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R2=0.89 for TdTomato vs Fluc, R2=0.94 for Fluc vs TTK, R2=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R2=0.99 for bioluminescence imaging (BLI)). Both BLI (R2=0.93) and micro-PET (R2=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R2=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell research

  14. Tri-bimaximal Mixing from Cascades

    SciTech Connect

    Takahashi, Ryo

    2008-11-23

    We investigate fermion mass matrices of the cascade form which lead to the tri-bimaximal mixing in the lepton sector. The cascade neutrino matrix predicts a parameter-independent relation among the observables, which are the neutrino mixing angles and mass squared differences. The relation predicts that the atmospheric neutrino mixing angle is close to maximal. We also study phenomenological aspect of the cascade form in supersymmetric theory, which are lepton flavor violation and thermal leptogenesis. A dynamical realivation of the cascade mass matrix are also presented in U(1) flavor theory.

  15. A transgenic tri-modality reporter mouse.

    PubMed

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C; Gambhir, Sanjiv S

    2013-01-01

    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This "Tri-Modality Reporter Mouse" system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R(2)=0.89 for TdTomato vs Fluc, R(2)=0.94 for Fluc vs TTK, R(2)=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R(2)=0.99 for bioluminescence imaging (BLI)). Both BLI (R(2)=0.93) and micro-PET (R(2)=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R(2)=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4(th) week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell

  16. Toxic Release Inventory Training Course (TRI) (2015 EIC)

    EPA Pesticide Factsheets

    Focusing on air releases, explore tried and true access points along with new ways to access the data including the new P2 tool (currently available) and the TRI Analyzer tool (schedule to go public summer 2015)

  17. Try-in Pastes Versus Resin Cements: A Color Comparison.

    PubMed

    Vaz, Edenize Cristina; Vaz, Maysa Magalhães; Rodrigues Gonçalves de Oliveira, Maria Beatriz; Takano, Alfa Emília; de Carvalho Cardoso, Paula; de Torres, Érica Miranda; Gonzaga Lopes, Lawrence

    2016-05-01

    This study aimed to compare the color of ceramic veneer restorations using different shades of try-in pastes and resin cement. Researchers found no differences between try-in pastes and resin cements after cementation.

  18. New Ways to Showcase Sustainability in Your 2012 TRI Report

    EPA Pesticide Factsheets

    Slides to accompany a presentation for TRI facilities about improvements to the TRI-MEweb reporting application that make it easier to submit pollution prevention information, and why this is beneficial to facilities.

  19. 75 FR 54297 - Tri-County Advisory Committee Meeting

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-09-07

    ... Forest Service Tri-County Advisory Committee Meeting AGENCY: Forest Service, USDA. ACTION: Notice of... Beaverhead-Deerlodge National Forest's Tri-County Resource Advisory Committee will meet on Thursday September... INFORMATION CONTACT: Patty Bates, Tri County Resource Advisory Committee Coordinator, Beaverhead-Deerlodge...

  20. Recording Activity in Older Women with TriTrac.

    ERIC Educational Resources Information Center

    Conn, Vicki S.; Minor, Marian A.; Mehr, David R.

    2000-01-01

    Examined the association of TriTrac-recorded activity among older women with commonly-used measures of activity and associated constructs. A moderate correlation was found between TriTrac and the main criterion measure, the Physical Activity Index. Respondents wore the TriTrac units only 78 percent of the requested days and underreported time not…

  1. How to try this: detecting delirium.

    PubMed

    Waszynski, Christine M

    2007-12-01

    For patients and their loved ones, delirium can be a frightening experience. A fluctuating mental status is important to identify because it often signals a need for additional treatment. The Confusion Assessment Method (CAM) diagnostic algorithm enables nurses to assess for delirium by identifying the four features of the disorder that distinguish it from other forms of cognitive impairment. It can be completed in five minutes and is easily incorporated into ongoing assessments of hospitalized patients. (This screening tool is included in the series Try This: Best Practices in Nursing Care to Older Adults, from the Hartford Institute for Geriatric Nursing at New York University's College of Nursing.) For a free online video demonstrating the use of this tool, go to http://links.lww.com/A209.

  2. Characterization of Tri-lab Tantalum Plate.

    SciTech Connect

    Buchheit, Thomas E.; Cerreta, Ellen K.; Deibler, Lisa Anne; Chen, Shu-Rong; Michael, Joseph R.

    2014-09-01

    This report provides a detailed characterization Tri-lab Tantalum (Ta) plate jointly purchased from HCStark Inc. by Sandia, Los Alamos and Lawrence Livermore National Laboratories. Data in this report was compiled from series of material and properties characterization experiments carried out at Sandia (SNL) and Los Alamos (LANL) Laboratories through a leveraged effort funded by the C2 campaign. Results include microstructure characterization detailing the crystallographic texture of the material and an increase in grain size near the end of the rolled plate. Mechanical properties evaluations include, compression cylinder, sub-scale tension specimen, micohardness and instrumented indentation testing. The plate was found to have vastly superior uniformity when compare with previously characterized wrought Ta material. Small but measurable variations in microstructure and properties were noted at the end, and at the top and bottom edges of the plate.

  3. Tri-Center Analysis: Determining Measures of Trichotomous Central Tendency for the Parametric Analysis of Tri-Squared Test Results

    ERIC Educational Resources Information Center

    Osler, James Edward

    2014-01-01

    This monograph provides an epistemological rational for the design of a novel post hoc statistical measure called "Tri-Center Analysis". This new statistic is designed to analyze the post hoc outcomes of the Tri-Squared Test. In Tri-Center Analysis trichotomous parametric inferential parametric statistical measures are calculated from…

  4. Development and evaluation of WillTry: An instrument for measuring children’s willingness to try fruits and vegetables

    USDA-ARS?s Scientific Manuscript database

    This paper describes the development and evaluation of the WillTry instrument, a psychometric tool, designed to measure children’s willingness to try fruits and vegetables. WillTry surveys were interviewer-administered to 284 children in an elementary school, and in summer day camps located in rura...

  5. Spectroscopic Study of the Polar BS Tri

    NASA Astrophysics Data System (ADS)

    Borisov, N. V.; Gabdeev, M. M.; Shimansky, V. V.; Katysheva, N. A.; Shugarov, S. Yu.

    2015-11-01

    We have analyzed the spectra of the cataclysmic variable BS Tri taken in September 2011 and August 2012 with the 6-m BTA SAO RAS telescope. The object's spectra exhibit a flat continuum with superimposed strong hydrogen Balmer, neutral and ionized helium emission lines. Our analysis of the line profiles has shown that they consist of several components that are formed in the accretion structure and on the irradiated red dwarf surface. The measured radial velocities of one of the components of the line forming in a spot on the red dwarf surface have allowed the parameters of the system to be estimated: M 1 = 0.75 ± 0.02 M ⊙, M 2 = 0.16 ± 0.01 M ⊙, q = 0.21 ± 0.02, and R L2 = 0.18 ± 0.02 R ⊙. The Doppler maps constructed from the emission lines show no disk accretion, defining the system as a polar.

  6. PyTRiP - a toolbox and GUI for the proton/ion therapy planning system TRiP

    NASA Astrophysics Data System (ADS)

    Toftegaard, J.; Petersen, J. B.; Bassler, N.

    2014-03-01

    Purpose: Only very few treatment planning systems (TPS) are capable of handling heavy ions. Commercial heavy ion TPS are costly and normally restrict the possibility to implement new functionalities. PyTRiP provides Python bindings and a platform-independent graphical user interface (GUI) for the heavy ion treatment program TRiP, and adds seamless support of DICOM files. We aim to provide a front-end for TRiP which does not require any special computer skills. Methods: PyTRiP is written in Python combined with C for fast computing. Routines for DICOM file import/export to TRiPs native file format are implemented. The GUI comes as an executable with all its dependencies including PyTRiP making it easy to install on Windows, Mac and Linux. Results: PyTRiP is a comprehensive toolbox for handling TRiP. Treatment plans are handled using an object oriented structure. Bindings to TRiP (which only runs on Linux, either locally or on a remote server) are performed through a single function call. GUI users can intuitively create treatment plans without much knowledge about the TRiP user interface. Advanced users still have full access to all TRiP functionality. The user interface comes with a comprehensive plotting tool, which can visualize 2D contours, volume histograms, as well as dose- and linear energy transfer (LET) distributions. Conclusion: We developed a powerful toolbox for ion therapy research using TRiP as backend. The corresponding GUI allows to easily and intuitively create, calculate and visualize treatment plans. TRiP is thereby more accessible and simpler to use.

  7. Preparation of tri- and difluoromethylsilanes via an unusual magnesium metal-mediated reductive tri- and difluoromethylation of chlorosilanes using tri- and difluoromethyl sulfides, sulfoxides, and sulfones.

    PubMed

    Prakash, G K Surya; Hu, Jinbo; Olah, George A

    2003-05-30

    A new and efficient method for the preparation of tri- and difluoromethylsilanes using magnesium metal-mediated reductive tri- and difluoromethylation of chlorosilanes is reported using tri- and difluoromethyl sulfides, sulfoxides, and sulfones. The byproduct of the process is diphenyl disulfide. Since phenyl trifluoromethyl sulfone, sulfoxide, and sulfide are readily prepared from trifluoromethane (CF(3)H) and diphenyl disulfide, the method can be considered to be catalytic in diphenyl disulfide for the preparation of (trifluoromethyl)trimethylsilane (TMS-CF(3)) from non-ozone-depleting trifluoromethane.

  8. Tri-Cities Index of Innovation and Technology

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.; Butner, Ryan S.

    2011-01-17

    In 2001 and 2004, the Economic Development Office of Pacific Northwest National Laboratory published companion reports to the Washington Technology Center Index studies that provided additional information on the Tri-Cities (Kennewick-Richland-Pasco) area of the state, its technology businesses, and important advantages that the Tri-Cities have as places to live and do business. These reports also compared the Tri-Cities area to other technology-based metropolitan areas in the Pacific Northwest and nation along critical dimensions known to be important to technology firms. This report updates the material in these earlier reports, and highlights a growing Tri-Cities metropolitan area.

  9. An improved tri-tube cryogenic gravel sampler.

    Treesearch

    Fred H. Everest; Carl E. McLemore; John F. Ward

    1980-01-01

    The tri-tube cryogenic gravel sampler has been improved, and accessories have been developed that increase its reliability and safety of operation, reduce core extraction time, and allow accurate partitioning of cores into subsamples. The improved tri-tube sampler is one of the most versatile and efficient substrate sampling tools yet developed.

  10. Multidrug encapsulation by coaxial tri-capillary electrospray.

    PubMed

    Lee, Yi-Hsuan; Bai, Meng-Yi; Chen, Da-Ren

    2011-01-01

    This study describes how a coaxial tri-capillary electrospray (ES) system can synthesize monodisperse PLGA-coated particles containing multiple drugs in one step. The coaxial arrangement of three separate capillaries in an ES nozzle enables production of composite particles with tri-layered structures without the complicated steps involved in emulsion processes. Various materials can be encapsulated in separate layers of individual composite particles without regard for the hydroscopic property of drugs. At the proper spray setting, nearly 100% drug encapsulation efficiency can be achieved. By varying the feed flowrate of spray solutions, the overall particle sizes, ranging from submicrometer to micrometer, and the thickness of the layers in produced particles can also be controlled. Size and tri-layered structure of the composite particles were characterized by SEM and laser scanning confocal microscopy (LSCM). We further explored the spray technique in the production of tri-layered composite particles having a controlled multidrug-release profile, and compared the release profiles of both core-shell structured particles (produced by coaxial dual-capillary ES) and tri-layered ones (produced by coaxial tri-capillary ES). The comparison showed that composite particles with the tri-layered structure can release multiple drugs in distinct kinetic phases. We further demonstrated that the release profile of tri-layered composite particles can be effectively controlled by varying the thickness and chemical composition of their individual layers. Copyright © 2010 Elsevier B.V. All rights reserved.

  11. Financial Statement Audit Report of Tri-County Community College.

    ERIC Educational Resources Information Center

    Campbell, Ralph

    This report presents the results of the Tri-County Community College financial statement audit for the fiscal year ending on June 30, 1998. Tri-County Community College is a component of the State of North Carolina, thus the authority to audit is granted by Article 5A of G.S. 147. The accounts and operations of the institution were subject to…

  12. TriBITS (Tribal Build, Integrate, and Test System)

    SciTech Connect

    2013-05-16

    TriBITS is a configuration, build, test, and reporting system that uses the Kitware open-source CMake/CTest/CDash system. TriBITS contains a number of custom CMake/CTest scripts and python scripts that extend the functionality of the out-of-the-box CMake/CTest/CDash system.

  13. Building for the Future through Tri-M.

    ERIC Educational Resources Information Center

    Thoms, Paul E.

    1984-01-01

    Few teaching techniques encourage excellence in music education more effectively than recognition through membership in the Tri-M International Music Honor Society. Examined are how Tri-M promotes excellence, rewards achievement, and benefits both school and student. Membership requirements are also discussed. (RM)

  14. 1H, 13C NMR spectral and single crystal structural studies of toxaphene congeners. Quantum chemical calculations for preferred conformers of 2,5- endo,6- exo,8,9,9,10,10-octachloro-2-bornene and their DFT/GIAO 13C chemical shifts

    NASA Astrophysics Data System (ADS)

    Laihia, K.; Valkonen, A.; Kolehmainen, E.; Suontamo, R.; Nissinen, M.; Nikiforov, V.; Selivanov, S.

    2005-11-01

    The 1H and 13C NMR chemical shifts for six toxaphene congeners: 2- exo,3- endo,6- exo,8,9,10-hexachloro- ( 1), 2- exo,3- endo,5- exo,9,9,10,10-heptachloro- ( 2), 2- exo,3- endo,6- exo,8,9,10,10-heptachloro- ( 3), 2- exo,3- endo,5- exo,6- endo,8,9,10-heptachloro- ( 4), 2- exo,3- endo,5- exo,6- endo,8,9,9,10-octachlorobornane ( 5) and 2,5- endo,6- exo,8,9,9,10,10-octachloro-2-bornene ( 6) are reported. Their chemical shift assignments have been obtained by means of Pulsed Field Gradient (PFG) Double Quantum Filtered (DQF) 1H, 1H correlation spectroscopy (COSY), PFG 1H, 13C Heteronuclear Multiple Quantum Coherence (HMQC) and PFG 1H, 13C Heteronuclear Multiple Bond Correlation (HMBC) experiments. A single crystal X-ray structural analysis was made for compounds 1, 3, 4 and 6. The prevalences of two octachlorobornene rotamers ( 6 a, 6 b) were elucidated by ab initio MO method and single point DFT/GIAO calculations for 13C chemical shifts. Theoretical calculations proved that the single crystal structure of 6 corresponds its most stable conformer in solution.

  15. Development and evaluation of WillTry. An instrument for measuring children's willingness to try fruits and vegetables.

    PubMed

    Thomson, Jessica L; McCabe-Sellers, Beverly J; Strickland, Earline; Lovera, Dalia; Nuss, Henry J; Yadrick, Kathleen; Duke, Sara; Bogle, Margaret L

    2010-06-01

    This paper describes the development and evaluation of the WillTry instrument, a psychometric tool designed to measure children's willingness to try fruits and vegetables. WillTry surveys were interviewer-administered to 284 children in an elementary school and summer day camps located in rural Mississippi and Arkansas (United States) communities. Factor analysis was used to determine construct dimensionality. Additional evaluation included internal consistency, test-retest reliability, and predictive validity. Factor analysis suggested a single dimension for the food items. The WillTry food scale had substantial reliability (intraclass correlation coefficients between 0.61 and 0.80) and sufficient internal consistency (Cronbach's alpha > or = 0.70). Results of the regression analysis for percent consumption of foods offered on WillTry response confirmed the predictive validity of the instrument. The results of these analyses provide psychometric evidence for the use of the WillTry instrument as a measure of willingness to try fruits and vegetables in rural, southern US children 5-14 years of age.

  16. Factors that contribute to the willingness to try "street hypnosis".

    PubMed

    Davis, Orin C; Gao, Xuan

    2014-01-01

    This study takes a context-specific approach to examine people's willingness to try hypnosis under various conditions and the factors that contribute to their willingness. It examined 378 participants, who completed a web-based hypnosis survey. The results showed that people's willingness to try hypnosis varies by context. Specifically, people are more willing to try hypnosis when it is framed as "peak focus" rather than "hypnosis" and when they perceive the environment as being safer. Moreover, factors including participants' demographics, hypnotists' demographics (relative to the subjects'), participants' control bias, and knowledge of hypnosis affect people's degrees of willingness to try hypnosis, depending on the specific context. The results suggest further analysis of hypnosis occurring in public contexts and the effects it may have on attitudes and therapeutic outcomes.

  17. Biofeedback: It's Time to Try Hardware in the Classroom

    ERIC Educational Resources Information Center

    Mulholland, Thomas B.

    1973-01-01

    A pioneer in the field tries to close the communications gap between biofeedback and education by showing how the technology can help students stay alert, feel better and explore inner space. (Editor)

  18. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    NASA Technical Reports Server (NTRS)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.

    2012-01-01

    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  19. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    NASA Technical Reports Server (NTRS)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.

    2012-01-01

    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  20. Analgesic and antipyretic activity of Tri-sa-maw recipe.

    PubMed

    Nanna, Urarat; Jaijoy, Kanjana; Soonthornchareonnon, Noppamas; Sireeratawong, Seewaboon

    2015-03-01

    Tri-sa-maw recipe is composed of equal proportions of the three fruits including Terminalia chebula Retz., Terminalia sp. and Terminalia bellirica Roxb. In Southeast Asia, these fruits are used as both food and medicine. In Thai traditional medicine, Tri-sa-maw recipe is well known for treating fever, expectorant, periodic maintenance, and tight stomach relief To study anti-inflammatory, analgesic and antipyretic activities of Tri-sa-maw recipe in experimental animals. The anti-inflammatory study was conducted by two experimental models; ethyl phenylpropiolate- induced ear edema and carrageenin-induced paw edema. For analgesic activity, the pain was induced by acetic acid or heat. In addition, yeast-induced hyperthermia was performedfor the study of antipyretic activity. The results showed that Tri-sa-maw recipe extract reduced ear edema ofrat induced by EPP but did not inhibit acute inflammation in the carrageenin-inducedpaw edema. However the extract at the doses of 300-1,200 mg/kg was able to inhibit the acetic acid-induced writhing response, but not the heat-induced pain. This result suggests the peripheral effect of its analgesic activity, which inhibits the biosynthesis, and/or release of some pain mediators. Finally, oral administration ofthe extract at the dose of 1,200 mg/kg body weight effectively reduced the hyperthermia, which possibly is due to the inhibition of prostaglandins. The present study has clearly demonstrated both analgesic and antipyretic activities of Tri-sa-maw recipe.

  1. Complete Tri-Axis Magnetometer Calibration with a Gyro Auxiliary

    PubMed Central

    Yang, Deng; You, Zheng; Li, Bin; Duan, Wenrui; Yuan, Binwen

    2017-01-01

    Magnetometers combined with inertial sensors are widely used for orientation estimation, and calibrations are necessary to achieve high accuracy. This paper presents a complete tri-axis magnetometer calibration algorithm with a gyro auxiliary. The magnetic distortions and sensor errors, including the misalignment error between the magnetometer and assembled platform, are compensated after calibration. With the gyro auxiliary, the magnetometer linear interpolation outputs are calculated, and the error parameters are evaluated under linear operations of magnetometer interpolation outputs. The simulation and experiment are performed to illustrate the efficiency of the algorithm. After calibration, the heading errors calculated by magnetometers are reduced to 0.5° (1σ). This calibration algorithm can also be applied to tri-axis accelerometers whose error model is similar to tri-axis magnetometers. PMID:28587115

  2. Complete Tri-Axis Magnetometer Calibration with a Gyro Auxiliary.

    PubMed

    Yang, Deng; You, Zheng; Li, Bin; Duan, Wenrui; Yuan, Binwen

    2017-05-26

    Magnetometers combined with inertial sensors are widely used for orientation estimation, and calibrations are necessary to achieve high accuracy. This paper presents a complete tri-axis magnetometer calibration algorithm with a gyro auxiliary. The magnetic distortions and sensor errors, including the misalignment error between the magnetometer and assembled platform, are compensated after calibration. With the gyro auxiliary, the magnetometer linear interpolation outputs are calculated, and the error parameters are evaluated under linear operations of magnetometer interpolation outputs. The simulation and experiment are performed to illustrate the efficiency of the algorithm. After calibration, the heading errors calculated by magnetometers are reduced to 0.5° (1σ). This calibration algorithm can also be applied to tri-axis accelerometers whose error model is similar to tri-axis magnetometers.

  3. Tri-Cities research may help biofuels take flight

    SciTech Connect

    Madison, Alison L.

    2011-12-04

    Monthly economic diversity column for the Tri-City Herald. Excerpt: If you stop and think about it, some pretty interesting stuff has roots in the Tri-Cities, but reaches far beyond. Many Tri-Citians have gone on to be professional athletes, entertainers, scientists and engineers, doctors, lawyers, and humanitarians to name just a few. And a lot of groundbreaking discoveries - many born of strategic collaborations resulting from purposeful economic development efforts - have emerged from work at our local national laboratory. Just recently, Pacific Northwest National Laboratory entered into a $2M collaboration with Seattle biofuel producer Imperium Renewables and other partners to develop a new method to make renewable jet fuels. Successful development of the catalytic process, which converts biomass-based alcohols into renewable drop-in jet fuels, could lead to additional renewable jet fuel production facilities being built and operated in the Pacific Northwest.

  4. New TRI data shows chemical industry remains top toxic polluter

    SciTech Connect

    Begley, R.; Rotman, D.

    1993-06-02

    Despite continued declines in emissions, the latest Toxics Release Inventory (TRI) data from the Environmental Protection Agency show the chemical industry was by far the largest emitter of toxic pollutants in 1991. DuPont headed the list of polluting companies, releasing a whopping 243 million lbs of toxic chemical-almost 100 million lbs more than number two Freeport-McMoRan. Releasing 1.55 billion lbs of toxics in 1991, chemical producers are trailed distantly by primary metals at 433 million lbs and paper manufacturing at 242 million lbs. total TRI air releases for all industries declined 13% because of reductions in industrial solvent, chlorine, and ammonia. Water releases rose 24%, primarily because of runoff from four fertilizer plants in Louisiana; and land releases dropped 9% because of decreases in phosphoric acid and metal compounds. The top three states for TRI releases are Lousiana, with 459 million lbs; Texas, with 411 million lbs; and Tennessee, with 215 million lbs.

  5. Evaluation of TRI-726 as a drug delivery matrix.

    PubMed

    Mondal, Pravakar; Alur, Hemant H; Johnston, Thomas P

    2011-08-01

    The TRI-726 polymeric drug delivery matrix is a newly-developed biocompatible hydrogel exhibiting in situ reverse-thermal gelling, mucoadhesivity, and sustained-erosion properties. Using two model drugs, clindamycin hydrochloride and acetaminophen, we determined the gelling temperatures, in vitro release profiles, kinetics of matrix erosion, rheological properties, mucoadhesive strength, microbiological activity of released clindamycin, and biocompatibility when in contact with cells. It was demonstrated that none of the excipients contained in the TRI-726 polymer matrix caused any loss in clindamycin?s antimicrobial activity following incorporation into the polymer matrix. Thus, the new patent pending TRI-726 drug delivery matrix was both inert and non-reactive toward the incorporated clindamycin in terms of chemical degradation (< 10% degradation under accelerated conditions over 6 months) and antimicrobial activity. This new drug delivery matrix is capable of releasing a wide variety of water-soluble drug compounds over an approximate 10-day period, due primarily to protracted dissolution/erosion of the three-dimensional polymer matrix in an aqueous-based biophase. Additionally, TRI-726 exhibits excellent mucoadhesive properties that would allow a candidate drug/TRI-726 formulation to adhere and remain at a potential application site for an extended period of time. Lastly, the biocompatibility tests affirmed the non-toxic and biocompatible nature of TRI-726 when in contact with cells, which suggests its suitability and versatility as a drug delivery matrix for the targeted administration of a wide range of pharmaceutical compounds where in situ gelation, protracted release of the active, and mucoadhesion of the formulation are desired.

  6. Tri-Service Thermal Flash Test Facility. Summary Report.

    DTIC Science & Technology

    1980-01-15

    8217WrAA080 360 DAYTON UNIV OHIO F/6 14/2 TRI-SERVICE THERMAL FLASH TEST FACILITY. SUMMARY REPORT. (U) jAN 80 8 H WILT, R A SERVAIS, N J1 OLSON DNAOO-79...C-0106 ’JqCASSIIED DR- R -8003 OA-517F L VI •1 1 IIII M R1.8 .1111II MIRCP EOUINTS LEVEV-4 3 v V96 9 OLEVE1. ’--DNA 5197F TRI-SERVICE THERMAL FLASH...PAGE READ INSTRUCTIONS BEFORE COMPLETING FORM 1. REPT T NUMBER...... ... . GOVT ACCESSION No. 3.RCPETSCATALOG NUMBER . ,.TITLr-t, a--?.t ...- r % R

  7. Tri-Cities an ideal environment for biofuels research

    SciTech Connect

    Madison, Alison L.

    2010-09-05

    These days, you don’t have to go far to hear a little something about renewable power. And in the Tri-Cities, you needn’t look beyond your own backyard. At the Bioproducts, Sciences, and Engineering Laboratory--BSEL--on Washington State University’s Richland campus, scientists are doing some cutting edge research on the conversion of biomass to fuels and value-added products that are traditionally derived from petroleum. The facility, built by the State of Washington, houses scientists from both Pacific Northwest National Laboratory and WSU Tri-Cities.

  8. Intratubular disinfection with tri-antibiotic and calcium hydroxide pastes.

    PubMed

    Pereira, Thais Cristina; Vasconcelos, Layla Reginna Silva Munhoz De; Graeff, Marcia Sirlene Zardin; Duarte, Marco Antonio Hungaro; Bramante, Clóvis Monteiro; Andrade, Flaviana Bombarda De

    2017-03-01

    The aim of this study was to compare the in vitro intradentinal antimicrobial ability of the calcium hydroxide and tri-antibiotic pastes. Standard bovine dentin tubes were sterilized and then infected with Enterococcus faecalis by a new contamination protocol of great depths of dentin. The specimens were filled with the medications, divided into two test-groups: calcium hydroxide (Group 1) and tri-antibiotic (Group 2) pastes. After 15 days, the teeth were evaluated by microbiological culture and confocal laser scanning microscopy (CLSM) with viability dye assay LIVE/DEAD inside dentinal tubules. In experiment of culture, the bacterial collection of the dentin fragments was done for counting the colony-forming units. The tri-antibiotic paste had a slightly greater antimicrobial effect; however, there was no statistical difference between the groups. It was concluded that the tri-antibiotic paste and the calcium hydroxide paste exercise the same effect on intra-tubular decontamination against E. faecalis. So, due the multiples advantages, the calcium hydroxide paste can be the choice for dentinal decontamination in regenerative procedures.

  9. EPA Facility Registry Service (FRS): ER_TRI

    EPA Pesticide Factsheets

    This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link to the Toxic Release Inventory (TRI) System. TRI is a publicly available EPA database reported annually by certain covered industry groups, as well as federal facilities. It contains information about more than 650 toxic chemicals that are being used, manufactured, treated, transported, or released into the environment, and includes information about waste management and pollution prevention activities. FRS identifies and geospatially locates facilities, sites or places subject to environmental regulations or of environmental interest. Using vigorous verification and data management procedures, FRS integrates facility data from EPA's national program systems, other federal agencies, and State and tribal master facility records and provides EPA with a centrally managed, single source of comprehensive and authoritative information on facilities. This data set contains the subset of FRS integrated facilities that link to TRI facilities once the TRI data has been integrated into the FRS database. Additional information on FRS is available at the EPA website https://www.epa.gov/enviro/facility-registry-service-frs.

  10. Tried And True Integrating Active And Reserve Components

    DTIC Science & Technology

    2016-02-16

    State Governor President Who Performs Duty The Militia The Federally - recognized militia (i.e. National Guard) Active Component, Reserve ...Accordance with State Law Federal Pay & Allowances Federal Pay & Allowances 6 Active and Reserve Components maintain separate ADCON...AIR WAR COLLEGE AIR UNIVERSITY TRIED AND TRUE? INTEGRATING ACTIVE AND RESERVE COMPONENTS by Joe Delgado, Lt Col, USAF A Research

  11. Low Back Pain? Relax, Breathe and Try Yoga

    MedlinePlus

    ... page: https://medlineplus.gov/news/fullstory_163537.html Low Back Pain? Relax, Breathe and Try Yoga Review of 12 ... Feb. 10, 2017 (HealthDay News) -- For people experiencing low back pain, the thought of exercise often seems daunting. But ...

  12. The Food Friends: Encouraging Preschoolers to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura; Anderson, Jennifer

    2006-01-01

    In response to concerns about children's eating behaviors, the Colorado Nutrition Network developed and tested Food Friends--Making New Foods Fun for Kids. The program was designed as a 12-week social marketing campaign aimed at encouraging preschool-age children to try new foods, such as Ugli Fruit, couscous, and daikon radish. Tasting novel…

  13. TRiC’s tricks inhibit huntingtin aggregation

    PubMed Central

    Shahmoradian, Sarah H; Galaz-Montoya, Jesus G; Schmid, Michael F; Cong, Yao; Ma, Boxue; Spiess, Christoph; Frydman, Judith; Ludtke, Steven J; Chiu, Wah

    2013-01-01

    In Huntington’s disease, a mutated version of the huntingtin protein leads to cell death. Mutant huntingtin is known to aggregate, a process that can be inhibited by the eukaryotic chaperonin TRiC (TCP1-ring complex) in vitro and in vivo. A structural understanding of the genesis of aggregates and their modulation by cellular chaperones could facilitate the development of therapies but has been hindered by the heterogeneity of amyloid aggregates. Using cryo-electron microscopy (cryoEM) and single particle cryo-electron tomography (SPT) we characterize the growth of fibrillar aggregates of mutant huntingtin exon 1 containing an expanded polyglutamine tract with 51 residues (mhttQ51), and resolve 3-D structures of the chaperonin TRiC interacting with mhttQ51. We find that TRiC caps mhttQ51 fibril tips via the apical domains of its subunits, and also encapsulates smaller mhtt oligomers within its chamber. These two complementary mechanisms provide a structural description for TRiC’s inhibition of mhttQ51 aggregation in vitro. DOI: http://dx.doi.org/10.7554/eLife.00710.001 PMID:23853712

  14. Queens Tri-School Confederation, 1991-92 Evaluation Report.

    ERIC Educational Resources Information Center

    Hannah, Susan; Dworkowitz, Barbara

    An evaluation was done of the Queens Tri-School Confederation, three high schools in the New York City Public Schools funded by a federal grant from the Magnet Schools Assistance Program. The grant provided Hillcrest, Jamaica, and Thomas A. Edison High Schools with funds to develop or expand emergency technician programs at Hillcrest; a law…

  15. As Students Scatter Online, Colleges Try to Keep Up

    ERIC Educational Resources Information Center

    Mangan, Katherine

    2012-01-01

    While e-mail remains the official method of communication on most campuses, colleges are expanding their presence in the virtual world, trying to reach students where they hang out. But without careful planning, that can lead to a scattershot approach as new platforms keep popping up and students' attention becomes increasingly dispersed. The…

  16. The Food Friends: Encouraging Preschoolers to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura; Anderson, Jennifer

    2006-01-01

    In response to concerns about children's eating behaviors, the Colorado Nutrition Network developed and tested Food Friends--Making New Foods Fun for Kids. The program was designed as a 12-week social marketing campaign aimed at encouraging preschool-age children to try new foods, such as Ugli Fruit, couscous, and daikon radish. Tasting novel…

  17. THE RECOGNITION OF TRI-DIMENSIONAL VISUAL STIMULI,

    DTIC Science & Technology

    dimensions: form , color , and crosshatching. There were in all 10 different forms, 10 different colors, and 4 different crosshatchings. A tri...test stimuli. For each of the 80 test stimuli Ss had to judge whether its form , color , and crosshatching was or was not the same as the form , color , and

  18. TriSWACH Material Trade-off Analysis

    DTIC Science & Technology

    2011-08-01

    Small Waterplane Area Twin Hull SWBS Ship Work Breakdown Structure TriSWACH Trimaran Small Waterplane Area Center Hull Center for...Analysis 6 2.1 Weight DPSS outputs a general hull structure Ship Work Breakdown Structure ( SWBS ) weight estimate based on the volume of

  19. Migration of Di- and Tri-Interstitials in Silicon

    SciTech Connect

    Posselt, Matthias; Gao, Fei; Zwicker, D

    2005-01-01

    A comprehensive study on the migration of di- and tri-interstitials in silicon is performed using classical molecular dynamics simulations with the Stillinger-Weber potential. The initial di- and tri-interstitial configurations with the lowest formation energies are determined, and then, the defect migration is investigated for temperatures between 800 and 1600 K. The defect diffusivity and the self-diffusion coefficient per defect are calculated. Compared to the mono-interstitial, the di-interstitial migrates faster, whereas the tri-interstitial diffuses slower. The migration mechanism of the di-interstitial shows a pronounced dependence on the temperature. Like in the case of the mono-interstitial, the mobility of the di-interstitial is higher than the mobility of the lattice atoms during the defect diffusion. On the other hand, the tri-interstitial mobility is lower than the corresponding atomic mobility. The results are compared with data from the literature and the implications of the present results for the analysis of experimental data on defect evolution and migration are discussed.

  20. DECS tries out instructional materials on AIDS prevention education.

    PubMed

    1994-01-01

    A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level. full text

  1. A Theoretical Analysis of the English "Try and V" Construction

    ERIC Educational Resources Information Center

    Tsuchida, Takehiro

    2011-01-01

    Examining grammatically idiosyncratic English expressions often helps reveal not only to ESL (English as a second language) teachers and learners but also to experts on English how intricately language is composed. This paper aims to expound one such idiomatic expression of the "try and V" construction by exploring the phenomenon from diverse…

  2. Mobile magic: try it, you'll like it.

    PubMed

    Berend, Michael E

    2006-09-01

    Mobility affords conformity that results in less polyethylene stress and perhaps less load on the underlying bone. Wear has been documented to be less. There are excellent long-term data on large numbers of patients, and I would submit that if you try it, both you and your patients will love it.

  3. Cholesterol complexes with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in chlorinated hydrocarbon solvents.

    PubMed

    Senegacnik, Marjan; Klofutar, Cveto

    2007-04-01

    The hydrogen bonding interactions of moderately associated cholesterol with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in dilute solutions of tetrachloromethane, 1,2-dichloroethane and trichloromethane were studied by conventional IR spectroscopy. Information on the stoichiometry of the complexes formed was derived from least squares plots of the linearized expressions of Bjerrum's degree of system formation. The formation constants of the complexes were also determined in this way. The spectra recorded in the OH region from 3100 to 3700 cm-1 were resolved in to the bands of the cholesterol species and the complexes formed. The complexes responsible for the observed bands were recognized from the dependence of their intensity on cholesterol monomer and free base concentration and from their frequency locations. The presence of the complexes B...HO(R) and B...HO(R)...HO(R) with tri-n-butylphosphate and tri-n-octylamine was established in all of the solutions and also for the system cholesterol+cyclohexanone in 1,2-dichloroethane. On the other hand, for cholesterol bonding to cyclohexanone in tetrachloromethane, the model considering complexes with 3:1 and 1:1 stoichiometry seemed the most appropriate.

  4. Identification of animal movement patterns using tri-axial magnetometry.

    PubMed

    Williams, Hannah J; Holton, Mark D; Shepard, Emily L C; Largey, Nicola; Norman, Brad; Ryan, Peter G; Duriez, Olivier; Scantlebury, Michael; Quintana, Flavio; Magowan, Elizabeth A; Marks, Nikki J; Alagaili, Abdulaziz N; Bennett, Nigel C; Wilson, Rory P

    2017-01-01

    Accelerometers are powerful sensors in many bio-logging devices, and are increasingly allowing researchers to investigate the performance, behaviour, energy expenditure and even state, of free-living animals. Another sensor commonly used in animal-attached loggers is the magnetometer, which has been primarily used in dead-reckoning or inertial measurement tags, but little outside that. We examine the potential of magnetometers for helping elucidate the behaviour of animals in a manner analogous to, but very different from, accelerometers. The particular responses of magnetometers to movement means that there are instances when they can resolve behaviours that are not easily perceived using accelerometers. We calibrated the tri-axial magnetometer to rotations in each axis of movement and constructed 3-dimensional plots to inspect these stylised movements. Using the tri-axial data of Daily Diary tags, attached to individuals of number of animal species as they perform different behaviours, we used these 3-d plots to develop a framework with which tri-axial magnetometry data can be examined and introduce metrics that should help quantify movement and behaviour.. Tri-axial magnetometry data reveal patterns in movement at various scales of rotation that are not always evident in acceleration data. Some of these patterns may be obscure until visualised in 3D space as tri-axial spherical plots (m-spheres). A tag-fitted animal that rotates in heading while adopting a constant body attitude produces a ring of data around the pole of the m-sphere that we define as its Normal Operational Plane (NOP). Data that do not lie on this ring are created by postural rotations of the animal as it pitches and/or rolls. Consequently, stereotyped behaviours appear as specific trajectories on the sphere (m-prints), reflecting conserved sequences of postural changes (and/or angular velocities), which result from the precise relationship between body attitude and heading. This novel

  5. 78 FR 43971 - Amendment of Class E Airspace; Tri-Cities, TN

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-07-23

    ... Federal Aviation Administration 14 CFR Part 71 Amendment of Class E Airspace; Tri-Cities, TN AGENCY... airspace for the Tri-Cities, TN area, by correcting the regulatory text of the Class E surface airspace at Tri-Cities Regional Airport, Tri-Cities, TN. Exclusionary language was omitted in the final rule...

  6. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Glyceryl tri-(12-acetoxy-stearate). 178.3505... SANITIZERS Certain Adjuvants and Production Aids § 178.3505 Glyceryl tri-(12-acetoxy-stearate). Glyceryl tri... calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in contact...

  7. 78 FR 7993 - Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-02-05

    ... Administration 14 CFR Part 71 Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends Class D and Class E airspace and removes Class E airspace in the Tri-Cities, TN, area, to...

  8. 77 FR 59573 - Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-09-28

    ... Federal Aviation Administration 14 CFR Part 71 Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN AGENCY: Federal Aviation Administration (FAA), DOT... Tri-Cities Regional Airport, and establish Class E airspace extending upward from 700 feet above the...

  9. Sustainability of remission of pediatric primary nocturnal enuresis--comparison of remission using Try for Dry vs. non-Try for Dry treatment plans.

    PubMed

    Saldano, Dawn Diaz; Chaviano, Antonio H; Maizels, Max

    2008-08-01

    This study examined the sustainability of remission of primary nocturnal enuresis (PNE) using an algorithm-based multimodal treatment plan, Try for Dry. Remission of PNE using the Try for Dry treatment method was retained longer and more often than using a non-Try for Dry plan.

  10. Crystal structures of fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) monohydrate and fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) methanol hemisolvate: rhodium structures that are isotypic with their iridium analogs.

    PubMed

    Merola, Joseph S; Franks, Marion A

    2015-02-01

    The crystal structures of two solvates of fac-tri-chlorido-tris-(tri-methyl-phosphane-κP)rhodium(III) are reported, i.e. one with water in the crystal lattice, fac-[RhCl3(Me3P)3]·H2O, and one with methanol in the crystal lattice, fac-[RhCl3(Me3P)3]·0.5CH3OH. These rhodium compounds exhibit distorted octahedral coordination spheres at the metal and are isotypic with the analogous iridium compounds previously reported by us [Merola et al. (2013 ▶). Polyhedron, 54, 67-73]. Comparison is made between the rhodium and iridium compounds, highlighting their isostructural relationships.

  11. Development of the Tri-ATHLETE Lunar Vehicle Prototype

    NASA Technical Reports Server (NTRS)

    Heverly, Matt; Matthews, Jaret; Frost, Matt; Quin, Chris

    2010-01-01

    The Tri-ATHLETE (All Terrain Hex Limed Extra Terrestrial Explorer) vehicle is the second generation of a wheel-on-limb vehicle being developed to support the return of humans to the lunar surface. This paper describes the design, assembly, and test of the Tri-ATHLETE robotic system with a specific emphasis on the limb joint actuators. The design and implementation of the structural components is discussed, and a novel and low cost approach to approximating flight-like cabling is also presented. The paper concludes with a discussion of the "second system effect" and other lessons learned as well as results from a three week long field trial of the vehicle in the Arizona desert.

  12. Why Do Faculty Try Research Based Instructional Strategies?

    NASA Astrophysics Data System (ADS)

    Dancy, Melissa H.; Turpen, Chandra; Henderson, Charles

    2010-10-01

    As part of a larger ongoing study of physics faculty, we report on analysis of 15 interviews with Peer Instruction (PI) users. The analyses presented here address the following two research questions 1) How did PI users come to know about PI? and 2) What reasons do PI users give for first trying PI? In this paper we describe how faculty were first exposed to PI, and the avenues faculty used to subsequently learn more about PI such as workshops, informal discussions with colleagues, reading journal articles, etc. We also describe reasons that faculty give for initially trying PI such as dissatisfaction with lecture methods, easy trialability of PI, or their intuitive sense that PI was a better way to teach. Following a summary of our findings, we discuss implications for dissemination.

  13. Virtual Try-On Through Image-based Rendering.

    PubMed

    Hauswiesner, Stefan; Straka, Matthias; Reitmayr, Gerhard

    2013-03-22

    Virtual try-on applications have become popular because they allow users to watch themselves wearing different clothes without the effort of changing them physically. This helps users to make quick buying decisions and thus improves the sales efficiency of retailers. Previous solutions usually involve motion capture, 3D reconstruction or modeling, which are time consuming and not robust for all body poses. Our method avoids these steps by combining image-based renderings of the user and previously recorded garments. It transfers the appearance of a garment recorded from one user to another by matching input and recorded frames, image-based visual hull rendering and online registration methods. Using images of real garments allows for a realistic rendering quality with high performance. It is suitable for a wide range of clothes and complex appearances, allows arbitrary viewing angles and requires only little manual input. Our system is particularly useful for virtual try-on applications as well as interactive games.

  14. Virtual try-on through image-based rendering.

    PubMed

    Hauswiesner, Stefan; Straka, Matthias; Reitmayr, Gerhard

    2013-09-01

    Virtual try-on applications have become popular because they allow users to watch themselves wearing different clothes without the effort of changing them physically. This helps users to make quick buying decisions and, thus, improves the sales efficiency of retailers. Previous solutions usually involve motion capture, 3D reconstruction or modeling, which are time consuming and not robust for all body poses. Our method avoids these steps by combining image-based renderings of the user and previously recorded garments. It transfers the appearance of a garment recorded from one user to another by matching input and recorded frames, image-based visual hull rendering, and online registration methods. Using images of real garments allows for a realistic rendering quality with high performance. It is suitable for a wide range of clothes and complex appearances, allows arbitrary viewing angles, and requires only little manual input. Our system is particularly useful for virtual try-on applications as well as interactive games.

  15. Results of the multilateral study of Tri-Regol tablet.

    PubMed

    Seregély, G

    1991-01-01

    The author processed in the form of a literary analysis the results of the clinical studies performed with Tri-Regol tablet so far. Within this scope he discusses the contraceptive effect, the tolerance of the women, the therapeutical use, the possibility of managing intolerance to other tablets, and some other matters of detail. He reviews the basic principles and the mechanism of action of triphasic treatment. He demonstrates the importance of contraception by demographical data too.

  16. Tri-Cultural Sensitivity In-Service Training Program Report.

    ERIC Educational Resources Information Center

    Bernalillo Public Schools, NM.

    The Tri-Cultural Sensitivity In-Service Training Program, funded by the Federal government under the provisions of Title IV, Public Law 88-352 (Civil Rights Act) of 1964, was developed in response to the results of a system-wide survey of the staff in 1967. Eighty-five percent of the teachers granted that a deficiency in knowledge, understanding,…

  17. 108. Doughton Park Recreation Area Comfort Station. Instead of trying ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    108. Doughton Park Recreation Area Comfort Station. Instead of trying to hide this building, it was decided to let it be seen. A salt box design reflecting a mountain building was chosen, it had a sloping split shingle roof matching the hill side with a front porch placed on the lower side. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  18. Designs for the ATDRSS tri-band reflector antenna

    NASA Technical Reports Server (NTRS)

    Lee, Shung-Wu; Zimmerman, Martin L.; Fujikawa, Gene; Sharp, G. Richard

    1991-01-01

    Two approaches to design a tri-band reflector antenna for the Advanced TDRSS are examined. Two reflector antenna configurations utilizing frequency selective surfaces for operation in three frequency bands, S, Ku, and Ka, are proposed. Far-field patterns and the antenna feed losses were computed for each configuration. An offset-fed single reflector antenna configuration was adapted for conceptual spacecraft design. CADAM drawings were completed and a 1/13th scale model of the spacecraft was constructed.

  19. Cellular interactions regulate stem cell differentiation in tri-culture.

    PubMed

    Wang, I-Ning E; Bogdanowicz, Danielle R; Mitroo, Siddarth; Shan, Jing; Kala, Sonam; Lu, Helen H

    2016-11-01

    Currently, the mechanism governing the regeneration of the soft tissue-to-bone interface, such as the transition between the anterior cruciate ligament (ACL) and bone, is not known. Focusing on the ACL-to-bone insertion, this study tests the novel hypothesis that interactions between cells from the ligament (fibroblasts) and bone (osteoblasts) initiate interface regeneration. Specifically, these heterotypic cell interactions direct the fibrochondrogenic differentiation of interface-relevant cell populations, defined here as ligament fibroblasts and bone marrow stromal cells (BMSC). The objective of this study is to examine the effects of heterotypic cellular interactions on BMSC or fibroblast growth and biosynthesis, as well as expression of fibrocartilage-relevant markers in tri-culture. The effects of cell-cell physical contact and paracrine interactions between fibroblasts and osteoblasts were also determined. It was found that, in tri-culture with fibroblasts and osteoblasts, BMSC exhibited greater fibrochondrogenic potential than ligament fibroblasts. The growth of BMSC decreased while proteoglycan production and TGF-β3 expression increased. Moreover, tri-culture regulated BMSC response via paracrine factors, and interestingly, fibroblast-osteoblast contact further promoted proteoglycan and TGF-β1 synthesis as well as induced SOX9 expression in BMSC. Collectively, the findings of this study suggest that fibroblast-osteoblast interactions play an important role in regulating the stem cell niche for fibrocartilage regeneration, and the mechanisms of these interactions are directed by paracrine factors and augmented with direct cell-cell contact.

  20. Tri-layered elastomeric scaffolds for engineering heart valve leaflets

    PubMed Central

    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L.; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B.; Mayer, John E.; Khademhosseini, Ali

    2014-01-01

    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(-caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) growth within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  1. ASPEN modeling of the Tri-State indirect liquefaction process

    SciTech Connect

    Begovich, J.M.; Clinton, J.H.; Johnson, P.J.; Barker, R.E.

    1983-01-01

    The ASPEN process simulator has been used to model an indirect liquefaction flowsheet patterned after that of the Tri-State project. This flowsheet uses Lurgi moving-bed gasification with synthesis gas conversion to methanol followed by further processing to gasoline using the Mobil MTG process. Models developed in this study include the following: Lurgi gasifier, Texaco gasifier, synthesis gas cooling, Rectisol, methanol synthesis, methanol-to-gasoline, CO-shift, methanation, and naphtha hydrotreating. These models have been successfully developed in modular form so that they can be used to simulate a number of different flowsheets or process alternatives. Simulations of the Tri-State flowsheet have been made using two different coal feed rates and two types of feed coal. The overall simulation model was adjusted to match the Tri-State flowsheet values for methanol, LPG, isobutane, and gasoline. As a result of this adjustment, the MTG reactor yield structure necessary to match the flowsheet product rates was determined. The models were exercised at different flow rates and were unaffected by such changes, demonstrating their range of operability. The use of Illinois No. 6 coal, with its lower ash content, resulted in slightly higher production rates for each of the products as compared to use of the Kentucky coal.

  2. Bayer bilateral denoising on TriMedia3270

    NASA Astrophysics Data System (ADS)

    Phelippeau, H.; Akil, M.; Dias Rodrigues, B.; Talbot, H.; Bara, S.

    2009-02-01

    Digital cameras are now commonly included in several digital devices such as mobile phones. They are present everywhere and have become the principal image capturing tool. Inherent to light and semiconductors properties, sensor noise [10] continues to be an important factor of image quality [12], especially in low light conditions. Removing the noise with mathematical solutions appears thus unavoidable to obtain an acceptable image quality. However, embedded devices are limited by processing capabilities and power consumption and thus cannot make use of the full range of complex mathematical noise removing solutions. The bilateral filter [6] appears to be an interesting compromise between implementation complexity and noise removing performances. Especially, the Bayer [5] bilateral filter proposed in [11] is well adapted for single sensor devices. In this paper, we simulate and optimize the Bayer bilateral filter execution on a common media-processor: the TM3270 [4] from the NXP Semiconductors TriMedia family. To do so we use the TriMedia Compilation System (TCS). We applied common optimization techniques (such as LUT, loop unrolling, convenient data type representation) as well as custom TriMedia operations. We finally propose a new Bayer bilateral filter formulation dedicated to the TM3270 architecture that yields an execution improvement of 99.6% compared to the naÃve version. This improvement results in real-time video processing at VGA resolution at the 350MHz clock rate.

  3. Dental hygienists' work environment: motivating, facilitating, but also trying.

    PubMed

    Candell, A; Engström, M

    2010-08-01

    The aim of the present study was to describe dental hygienists' experiences of their physical and psychosocial work environment. The study was descriptive in design and used a qualitative approach. Eleven dental hygienists participated in the study and data were collected during spring 2008 using semi-structured interviews. The material was analysed using qualitative content analysis. The results showed that the dental hygienists experienced their work environment as motivating and facilitating, but at the same time as trying. The three categories revealed a theme: Being controlled in a modern environment characterized by good relationships. Motivating factors were the good relationship with co-workers, managers and patients, seeing the results of your work, having your own responsibility and making your own decisions. The new, pleasant and modern clinics, good cooperation between co-workers and varying duties were described as facilitating factors. The trying factors, as described by the dental hygienists, were above all being controlled by time limits or by some elements of the work, such as teamwork. The dental hygienists also felt stress because appointments were too-short. To conclude, the participants described their work environment as trying in several ways, despite the modern clinics and good relationships.

  4. Experimental demonstration of tri-aperture Differential Synthetic Aperture Ladar

    NASA Astrophysics Data System (ADS)

    Zhao, Zhilong; Huang, Jianyu; Wu, Shudong; Wang, Kunpeng; Bai, Tao; Dai, Ze; Kong, Xinyi; Wu, Jin

    2017-04-01

    A tri-aperture Differential Synthetic Aperture Ladar (DSAL) is demonstrated in laboratory, which is configured by using one common aperture to transmit the illuminating laser and another two along-track receiving apertures to collect back-scattered laser signal for optical heterodyne detection. The image formation theory on this tri-aperture DSAL shows that there are two possible methods to reconstruct the azimuth Phase History Data (PHD) for aperture synthesis by following standard DSAL principle, either method resulting in a different matched filter as well as an azimuth image resolution. The experimental setup of the tri-aperture DSAL adopts a frequency chirped laser of about 40 mW in 1550 nm wavelength range as the illuminating source and an optical isolator composed of a polarizing beam-splitter and a quarter wave plate to virtually line the three apertures in the along-track direction. Various DSAL images up to target distance of 12.9 m are demonstrated using both PHD reconstructing methods.

  5. Apolar distal pocket mutants of yeast cytochrome c peroxidase: hydrogen peroxide reactivity and cyanide binding of the TriAla, TriVal, and TriLeu variants.

    PubMed

    Bidwai, Anil K; Meyen, Cassandra; Kilheeney, Heather; Wroblewski, Damian; Vitello, Lidia B; Erman, James E

    2013-01-01

    Three yeast cytochrome c peroxidase (CcP) variants with apolar distal heme pockets have been constructed. The CcP variants have Arg48, Trp51, and His52 mutated to either all alanines, CcP(triAla), all valines, CcP(triVal), or all leucines, CcP(triLeu). The triple mutants have detectable enzymatic activity at pH 6 but the activity is less than 0.02% that of wild-type CcP. The activity loss is primarily due to the decreased rate of reaction between the triple mutants and H(2)O(2) compared to wild-type CcP. Spectroscopic properties and cyanide binding characteristics of the triple mutants have been investigated over the pH stability region of CcP, pH 4 to 8. The absorption spectra indicate that the CcP triple mutants have hemes that are predominantly five-coordinate, high-spin at pH 5 and six-coordinate, low-spin at pH 8. Cyanide binding to the triple mutants is biphasic indicating that the triple mutants have two slowly-exchanging conformational states with different cyanide affinities. The binding affinity for cyanide is reduced at least two orders of magnitude in the triple mutants compared to wild-type CcP and the rate of cyanide binding is reduced by four to five orders of magnitude. Correlation of the reaction rates of CcP and 12 distal pocket mutants with H(2)O(2) and HCN suggests that both reactions require ionization of the reactants within the distal heme pocket allowing the anion to bind the heme iron. Distal pocket features that promote substrate ionization (basic residues involved in base-catalyzed substrate ionization or polar residues that can stabilize substrate anions) increase the overall rate of reaction with H(2)O(2) and HCN while features that inhibit substrate ionization slow the reactions.

  6. Apolar Distal Pocket Mutants of Yeast Cytochrome c Peroxidase: Hydrogen Peroxide Reactivity and Cyanide Binding of the TriAla, TriVal, and TriLeu Variants

    PubMed Central

    Bidwai, Anil K.; Meyen, Cassandra; Kilheeney, Heather; Wroblewski, Damian; Vitello, Lidia B.; Erman, James E.

    2012-01-01

    Three yeast cytochrome c peroxidase (CcP) variants with apolar distal heme pockets have been constructed. The CcP variants have Arg48, Trp51, and His52 mutated to either all alanines, CcP(triAla), all valines, CcP(triVal), or all leucines, CcP(triLeu). The triple mutants have detectable enzymatic activity at pH 6 but the activity is less than 0.02% that of wild-type CcP. The activity loss is primarily due to the decreased rate of reaction between the triple mutants and H2O2 compared to wild-type CcP. Spectroscopic properties and cyanide binding characteristics of the triple mutants have been investigated over the pH stability region of CcP, pH 4 to 8. The absorption spectra indicate that the CcP triple mutants have hemes that are predominantly five-coordinate, high-spin at pH 5 and six-coordinate, low-spin at pH 8. Cyanide binding to the triple mutants is biphasic indicating that the triple mutants have two slowly-exchanging conformational states with different cyanide affinities. The binding affinity for cyanide is reduced at least two orders of magnitude in the triple mutants compared to wild-type CcP and the rate of cyanide binding is reduced by four to five orders of magnitude. Correlation of the reaction rates of CcP and 12 distal pocket mutants with H2O2 and HCN suggests that both reactions require ionization of the reactants within the distal heme pocket allowing the anion to bind the heme iron. Distal pocket features that promote substrate ionization (basic residues involved in base-catalyzed substrate ionization or polar residues that can stabilize substrate anions) increase the overall rate of reaction with H2O2 and HCN while features that inhibit substrate ionization slow the reactions. PMID:23022490

  7. The reactants equation of state for the tri-amino-tri-nitro-benzene (TATB) based explosive PBX 9502

    NASA Astrophysics Data System (ADS)

    Aslam, Tariq D.

    2017-07-01

    The response of high explosives (HEs), due to mechanical and/or thermal insults, is of great importance for both safety and performance. A major component of how an HE responds to these stimuli stems from its reactant equation of state (EOS). Here, the tri-amino-tri-nitro-benzene based explosive PBX 9502 is investigated by examining recent experiments. Furthermore, a complete thermal EOS is calibrated based on the functional form devised by Wescott, Stewart, and Davis [J. Appl. Phys. 98, 053514 (2005)]. It is found, by comparing to earlier calibrations, that a variety of thermodynamic data are needed to sufficiently constrain the EOS response over a wide range of thermodynamic state space. Included in the calibration presented here is the specific heat as a function of temperature, isobaric thermal expansion, and shock Hugoniot response. As validation of the resulting model, isothermal compression and isentropic compression are compared with recent experiments.

  8. Tri-functional cannula for retinal endovascular surgery

    DOEpatents

    Weiss, Jonathan D.

    2010-07-27

    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  9. Tri-bimaximal mixing from twisted Friedberg-Lee symmetry

    NASA Astrophysics Data System (ADS)

    Araki, Takeshi; Takahashi, Ryo

    2009-10-01

    We investigate the Friedberg-Lee (FL) symmetry and its promotion to include the μ- τ symmetry, and call this the twisted FL symmetry. Based on the twisted FL symmetry, two possible schemes are presented toward the realistic neutrino mass spectrum and the tri-bimaximal mixing. In the first scheme, we suggest the semi-uniform translation of the FL symmetry. The second one is based on the S 3 permutation family symmetry. The breaking terms, which are twisted FL symmetric, are introduced. Some viable models in each scheme are also presented.

  10. Molecular diagnostics: Molecular Med Tri-Con 2013.

    PubMed

    Klein, Roger D

    2013-07-01

    The 20th annual Molecular Med Tri-Con conference, sponsored by Cambridge Health Institute (MA, USA), consisted of over 250 presentations within five parallel 'channels': 'Diagnostics, Therapeutics, Clinical, Informatics and Cancer', along with five preliminary symposia, 15 short courses, a plenary keynote session entitled 'Personalized Oncology - Fulfilling the Promise for Today's Patients' and a keynote panel entitled, 'Emerging Technologies and Industry Perspectives'. Over 3000 individuals from academia, clinical laboratories and industry were in attendance. This article will focus on the Keynote Session of 'Molecular Diagnostics' track within the Diagnostics Channel.

  11. Parametric design of tri-axial nested Helmholtz coils.

    PubMed

    Abbott, Jake J

    2015-05-01

    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  12. A Tri-band Cryogenic Receiver for VGOS Radio Telescopes

    NASA Astrophysics Data System (ADS)

    López-Pérez, José Antonio; López-Fernández, José Antonio; Tercero, Félix; Vaquero, Beatriz; Serna, José Manuel

    2014-12-01

    The Yebes Observatory has developed a world class tri-band (S/X/Ka) cryogenic receiver for VGOS radio telescopes. The main advantages of this receiver are the simultaneous S/X/Ka operation with dual-circular polarization, the backward compatibility with the legacy VLBI stations, X/Ka VLBI measurements, the reduced feed size for cooling down to 15 Kelvin, and the easy cal signal injection in front of the LNAs. It also allows the characterization of radio telescope pointing, tracking, and gain at high frequencies (32 GHz).

  13. Parametric design of tri-axial nested Helmholtz coils

    SciTech Connect

    Abbott, Jake J.

    2015-05-15

    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  14. An innovative tri-directional broadband piezoelectric energy harvester

    SciTech Connect

    Su, Wei-Jiun Zu, Jean

    2013-11-11

    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  15. Government action on diabetes prevention: time to try something new.

    PubMed

    Kaldor, Jenny C; Magnusson, Roger S; Colagiuri, Stephen

    2015-06-15

    Type 2 diabetes mellitus, driven by overweight and obesity linked to unhealthy diets, is the fastest-growing non-communicable disease in Australia. Halting the rise of diabetes will require a paradigm shift from personal to shared responsibility, with greater accountability from Australian governments and the food industry. It will also require governments to try something different to the prevailing approaches emphasising education and the provision of information. We propose four priority areas where government regulation could strengthen Australia's response. Those areas relate to mandatory front-of-pack food labelling, regulating junk food advertising, better oversight of food reformulation and taxing sugar-sweetened beverages.

  16. Fluorescein Tri-Aldehyde Promotes the Selective Detection of Homocysteine.

    PubMed

    Barve, Aabha; Lowry, Mark; Escobedo, Jorge O; Thainashmuthu, Josephrajan; Strongin, Robert M

    2016-03-01

    Elevated homocysteine levels are a well-known independent risk factor for cardiovascular disease. To date, relatively few selective fluorescent probes for homocysteine detection have been reported. The lack of sensing reagents and remaining challenges largely derive from issues of sensitivity and/or selectivity. For example, homocysteine is a structural homologue of the more abundant (ca, 20-25 fold) aminothiol cysteine, differing only by an additional methylene group side chain. Fluorescein tri-aldehyde, described herein, has been designed and synthesized as a sensitive and selective fluorophore for the detection of homocysteine in human plasma samples. It responds to analytes selectively via a photoinduced electron transfer (PET) inhibition process that is modulated by predictable analyte-dye product hybridization and ionization states. Mulliken population analysis of fluorescein tri-aldehyde and its reaction products reveals that the characteristic formation of multiple cationic of homocysteine-derived heterocycles leads to enhanced relative negative charge build up on the proximal phenolate oxygen of the fluorophore as a contributing factor to selective emission enhancement.

  17. Design and analysis of miniature tri-axial fluxgate magnetometer

    NASA Astrophysics Data System (ADS)

    Zhi, Menghui; Tang, Liang; Qiao, Donghai

    2017-02-01

    The detection technology of weak magnetic field is widely used in Earth resource survey and geomagnetic navigation. Useful magnetic field information can be obtained by processing and analyzing the measurement data from magnetic sensors. A miniature tri-axial fluxgate magnetometer is proposed in this paper. This miniature tri-axial fluxgate magnetometer with ring-core structure has a dynamic range of the Earth’s field ±65,000 nT, resolution of several nT. It has three independent parts placed in three perpendicular planes for measuring three orthogonal magnetic field components, respectively. A field-programmable gate array (FPGA) is used to generate stimulation signal, analog-to-digital (A/D) convertor control signal, and feedback digital-to-analog (D/A) control signal. Design and analysis details are given to improve the dynamic range, sensitivity, resolution, and linearity. Our prototype was measured and compared with a commercial standard Magson fluxgate magnetometer as a reference. The results show that our miniature fluxgate magnetometer can follow the Magson’s change trend well. When used as a magnetic compass, our prototype only has ± 0.3∘ deviation compared with standard magnetic compass.

  18. Research on Design of Tri-color Shift Device

    NASA Astrophysics Data System (ADS)

    Xu, Ping; Yuan, Xia; Huang, Haixuan; Yang, Tuo; Huang, Yanyan; Zhu, Tengfei; Tang, Shaotuo; Peng, Wenda

    2016-11-01

    An azimuth-tuned tri-color shift device based on an embedded subwavelength one-dimensional rectangular structure with single period is proposed. High reflection efficiencies for both TE and TM polarizations can be achieved simultaneously. Under an oblique incidence of 60°, the reflection efficiencies can reach up to 85, 86, and 100 % in blue (azimuth of 24°), green (azimuth of 63°), and red (azimuth of 90°) waveband, respectively. Furthermore, the laws of influence of device period, groove depth, coating thickness, and incident angle on reflection characteristics are investigated and exposed, and feasibility of the device is demonstrated. The proposed device realizes tri-color shift for natural light using a simple structure. It exhibits high efficiency as well as good security. Such a device can be fabricated by the existing embossing and coating technique. All these break through the limit of bi-color shift anti-counterfeiting technology and have great applications in the field of optically variable image security.

  19. Multimatrix models and tri-Sasaki Einstein spaces

    SciTech Connect

    Herzog, Christopher P.; Pufu, Silviu S.; Tesileanu, Tiberiu; Klebanov, Igor R.

    2011-02-15

    Localization methods reduce the path integrals in N{>=}2 supersymmetric Chern-Simons gauge theories on S{sup 3} to multimatrix integrals. A recent evaluation of such a two-matrix integral for the N=6 superconformal U(N)xU(N) Aharony-Bergman-Jafferis-Maldacena theory produced detailed agreement with the AdS/CFT correspondence, explaining, in particular, the N{sup 3/2} scaling of the free energy. We study a class of p-matrix integrals describing N=3 superconformal U(N){sup p} Chern-Simons gauge theories. We present a simple method that allows us to evaluate the eigenvalue densities and the free energies in the large N limit keeping the Chern-Simons levels k{sub i} fixed. The dual M-theory backgrounds are AdS{sub 4}xY, where Y are seven-dimensional tri-Sasaki Einstein spaces specified by the k{sub i}. The gravitational free energy scales inversely with the square root of the volume of Y. We find a general formula for the p-matrix free energies that agrees with the available results for volumes of the tri-Sasaki Einstein spaces Y, thus providing a thorough test of the corresponding AdS{sub 4}/CFT{sub 3} dualities. This formula is consistent with the Seiberg duality conjectured for Chern-Simons gauge theories.

  20. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.

    PubMed

    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K

    2016-12-15

    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment.

  1. Hanford and the Tri-Cities economy 1997

    SciTech Connect

    Scott, M.J.

    1998-04-09

    The missions of the US Department of Energy`s Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). While the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the local Tri-Cities economy for purposes of this study. In the Federal fiscal year (FY) 1997 (October 1, 1996 through September 30, 1997), the total impact of DOE`s local $1.7 billion budget was felt through payrolls and local purchases of goods and services that totaled about $774 million. Directly or indirectly, the DOE/RL budget sustained an estimated 36% of all local employment (30,300 out of 84,800 jobs) and up to 67% of local wage income.

  2. Experimental Investigation and Modeling of Integrated Tri-generation Systems

    NASA Astrophysics Data System (ADS)

    Cetinkaya, Eda

    Energy demand in the world is increasing with population growth and higher living standards. Today, the need for energy requires a focus on renewable sources without abandoning fossil fuels. Efficient use of energy is one of the most important tasks in modern energy systems to achieve. In addition to the energy need, growing environmental concerns are linked with energy is emerged. Multi-purpose energy generation allows a higher efficiency by generating more outputs with the same input in the same system. Tri-generation systems are expected to provide at least three commodities, such as heating, cooling, desalination, storable fuel production and some other useful outputs, in addition to power generation. In this study, an experimental investigation of gasification is presented and two integrated tri-generation systems are proposed. The first integrated tri-generation system (System 1) utilizes solar energy as input and the outputs are power, fresh water and hot water. It consists of four sub-systems, namely solar power tower system, desalination system, Rankine cycle and organic Rankine cycle (ORC). The second integrated tri-generation system (System 2) utilizes coal and biomass as input and the outputs are power, fuel and hot water. It consists of five sub-systems: gasification plant, Brayton cycle, Rankine cycle, Fischer-Tropsch synthesis plant and an organic Rankine cycle (ORC). Experimental investigation includes coal and biomass gasification, where the experimental results of synthesis gas compositions are utilized in the analysis of the second systems. To maximize efficiency, heat losses from the system should be minimized through a recovery system to make the heat a useful commodity for other systems, such as ORCs which can utilize the low-grade heat. In this respect, ORCs are first analyzed for three different configurations in terms of energy and exergy efficiencies altering working fluids to increase the power output. Among two types of coal and one type

  3. Experimental Validation of the Piezoelectric Triple Hybrid Actuation System (TriHYBAS)

    NASA Technical Reports Server (NTRS)

    Xu, Tian-Bing; Jiang, Xiaoning; Su, Ji

    2008-01-01

    A piezoelectric triple hybrid actuation system (TriHYBAS) has been developed. In this brief presentation of the validation process the displacement profile of TriHYBAS and findings regarding displacement versus applied voltage are highlighted.

  4. Toxics Release Inventory Chemical Hazard Information Profiles (TRI-CHIP) Dataset

    EPA Pesticide Factsheets

    The Toxics Release Inventory (TRI) Chemical Hazard Information Profiles (TRI-CHIP) dataset contains hazard information about the chemicals reported in TRI. Users can use this XML-format dataset to create their own databases and hazard analyses of TRI chemicals. The hazard information is compiled from a series of authoritative sources including the Integrated Risk Information System (IRIS). The dataset is provided as a downloadable .zip file that when extracted provides XML files and schemas for the hazard information tables.

  5. 77 FR 25080 - Safety Zones; TriMet Bridge Project, Willamette River, Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-04-27

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zones; TriMet Bridge Project, Willamette River... of the TriMet Bridge on the Willamette River, in Portland, OR. This action is necessary to ensure the... established for the TriMet Bridge construction site and are more focused in nature than the previous safety...

  6. 76 FR 53054 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-08-25

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriMet Bridge Project, Willamette River... safety zone during the construction of the TriMet Bridge on the Willamette River, in Portland, OR. This... proposed rulemaking (NPRM) entitled Safety Zone: TriMet Bridge Project, Willamette River; Portland, OR in...

  7. An empirical study of the effect of granting multiple tries for online homework

    NASA Astrophysics Data System (ADS)

    Kortemeyer, Gerd

    2015-07-01

    When deploying online homework in physics courses, an important consideration is how many tries learners should be allowed to solve numerical free-response problems. While on the one hand, this number should be large enough to allow learners mastery of concepts and avoid copying, on the other hand, granting too many allowed tries encourages counter-productive behavior. We investigate data from an introductory calculus-based physics course that allowed different numbers of tries in different semesters. It turns out that the probabilities for successfully completing or abandoning problems during a particular try are independent of the number of tries already made, which indicates that students do not learn from their earlier tries. We also find that the probability for successfully completing a problem during a particular try decreases with the number of allowed tries, likely due to increased carelessness or guessing, while the probability to give up on a problem after a particular try is largely independent of the number of allowed tries. These findings lead to a mathematical model for learner usage of multiple tries, which predicts an optimum number of five allowed tries.

  8. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-09-06

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Competitor Group is sponsoring the TriRock Triathlon, consisting of 2000 swimmers swimming a predetermined...: Sec. 165.T11-516 Safety Zone; TriRock Triathlon; San Diego Bay, San Diego, CA. (a) Location. The...

  9. Osteomimicry: how tumor cells try to deceive the bone.

    PubMed

    Rucci, Nadia; Teti, Anna

    2010-06-01

    Bone metastases are complications of multiple myeloma and solid tumors, including breast and prostate carcinomas. Several reports have demonstrated that the preference to metastasize to bone by tumor cells is not a casual but an addressed event, which relies on specific interactions among tumor cells, bone marrow microenvironment and bone cells. One of the features that gives tumor cells more chances to survive and proliferate into the bone tissue is osteomimicry, that is the ability to acquire a bone cell phenotype, especially osteoblast-like. As clearly demonstrated, prostate and breast cancer cells try to resemble osteoblasts by expressing bone matrix proteins, the specific marker alkaline phosphatase, and molecules regulating the osteoblast/osteoclast cross-talk. Based on this evidence it is crucial to dissect in more detail the molecular mechanisms underlying the osteomimetic properties of cancer cells and identify new therapeutic targets eventually leading to a better and prolonged life expectation for patients with bone.

  10. Experiment M405: Tri-axis flux gate magnetometer

    NASA Technical Reports Server (NTRS)

    Womack, W. D.

    1971-01-01

    A tri-axis flux-gate magnetometer was used on four Gemini spacecraft for determination of the magnitude and direction of the local geomagnetic field with respect to the spacecraft. Conclusions derived from the data are not only important to the proton-electron spectrometer experiment, but also are of significance to any directional charged particle experiments that may be conducted. Even though the Gemini spacecraft was not clean magnetically, the data could be reduced to a form that supplied directional information on the magnetic field in relation to the spacecraft. Stray fields were the result of spacecraft structure, not the result of current flows that were produced within the spacecraft electrical systems. Efforts were made to reduce spacecraft stray fields and to facilitate the acquisition of more accurate data.

  11. Tri-band small monopole antenna based on SRR units

    NASA Astrophysics Data System (ADS)

    Shehata, Gehan; Mohanna, Mahmoud; Rabeh, Mohammed Lotfy

    2015-12-01

    In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5) and WLAN (5.2) bands. In our proposal, a coplanar waveguide (CPW) fed circular-disk monopole antenna is coupled with three split ring resonator (SRR) units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA) at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  12. Juveniles tried as adults: the age of the juvenile matters.

    PubMed

    Semple, Jaclyn K; Woody, William Douglas

    2011-08-01

    Serious juvenile crimes require evaluation of a child as a criminal defendant in adult court. In such cases, it is crucial to understand jurors' attitudes, biases, and ability to follow legal instructions and maintain fairness. 308 undergraduate psychology students served as mock jurors, were randomly separated into four groups, and each group read the same realistic summary of a trial with the defendant's age presented as 13, 15, 17, or 21 years. Participants were asked to render guilty or not guilty verdicts and, if guilty, to suggest sentences. Chi-squared analysis indicated 13- and 15-year-old defendants were convicted less often than 17- and 21-year-old defendants, showing that jurors distinguished between juvenile defendants of different ages, but not minors and adults as defined by law. Additional analysis showed that age did not affect sentencing recommendations. Decision processes jurors use for juveniles tried as adults are discussed.

  13. PLA branching with anhydrides and tri-functional aziridine

    NASA Astrophysics Data System (ADS)

    Gu, Liangliang; Xu, Yuewen; Naredla, Rajasekhar; Hoye, Thomas; Macosko, Christopher

    Branched PLA was prepared by melt blending with tri-functional aziridine (T-Az) and pyromellitic dianhydride (PMDA). 1HNMR, gel permeation chromatography (GPC) and rheology were used to characterize the topological structures of branched PLA. Fast reaction between PLA carboxyl end group and T-Az resulted in 3-arm stars and increased the molecular weight. However, the 3-arm stars did not show strain hardening behavior under extensional flow. After modifying PLA hydroxyl end group with PMDA, PLA can react with T-Az on both chain ends and form long chain branched structure, which showed strain hardening in extension. It was found that that only 10% of the PLA hydroxyl end groups reacted with PMDA. This work is supported by Center for Sustainable Polymers.

  14. Ringing and double frequency response of a tri-pod

    SciTech Connect

    Nedergaard, H.; Lyngesen, S.; Tychsen, J.

    1996-12-31

    The dynamic behavior of a tri-pod steel jacket installed in 65 m water depth in the North Sea has been investigated. The analysis method is a time-domain simulation of the platform exposed to irregular sea. Similar to monotower platforms the so-called ringing phenomenon caused by higher order harmonics in the wave loading is detected. Further, the analysis discovered another dynamic feature, double frequency response, caused by the interaction between the spatial distribution of the waveload and the shape of first vibrational mode. The dynamic response showed that the top of the platform vibrates notably more in first mode than found by a quasi static analysis with incorporation of standard dynamic amplification factors, however, the resulting extreme stress level and accumulated fatigue damage is found quite similar and the consequences to human comfort small. The basis for this finding is the fact that first mode only contributes very little to the stress level in critical points.

  15. Charge transport in tri-p-tolylamine doped trinaphthalylbenzene glass

    NASA Astrophysics Data System (ADS)

    Lin, Liang-Bih; O'Reilly, James M.; Magin, Edward H.; Weiss, David S.; Jenekhe, Samson A.

    2000-09-01

    The charge transport properties of tri-p-tolylamine (TTA) doped trinaphthalylbenzene have been measured as a function of electric field and temperature. The charge mobilities of the composite are comparable to but somewhat lower than that of TTA doped polystyrene, a nonpolar polymeric host, at similar weight fractions. We suggest that the difference is due to inhomogeneity between the host and the dopant. The results suggest that, similar to polymer hosts in molecularly doped polymers, the molecular host only functions as an inert diluter and does not directly participate in the charge transport manifold. The results also substantiate the importance of molecular packing to charge hopping in disordered organic materials. The charge mobility data are analyzed with a disorder model due to Bässler and coworkers and a recently modified expression due to Novikov and coworkers [Phys. Rev. Lett. 81, 4472 (1998)]. Both models provide adequate descriptions of charge transport in organic amorphous materials.

  16. Tri-modal microscope for head and neck tissue identification.

    PubMed

    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline

    2016-03-01

    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features.

  17. TriPleX: a versatile dielectric photonic platform

    NASA Astrophysics Data System (ADS)

    Wörhoff, Kerstin; Heideman, René G.; Leinse, Arne; Hoekman, Marcel

    2015-04-01

    Photonic applications based on planar waveguide technology impose stringent requirements on properties such as optical propagation losses, light coupling to optical fibers, integration density, as well as on reliability and reproducibility. The latter is correlated to a high level of control of the refractive index and waveguide geometry. In this paper, we review a versatile dielectric waveguide platform, called TriPleX, which is based on alternating silicon nitride and silicon dioxide films. Fabrication with CMOS-compatible equipment based on low-pressure chemical vapor deposition enables the realization of stable material compositions being a prerequisite to the control of waveguide properties and modal shape. The transparency window of both materials allows for the realization of low-loss waveguides over a wide wavelength range (400 nm-2.35 μm). Propagation losses as low as 5×10-4 dB/cm are reported. Three basic geometries (box shell, double stripe, and filled box) can be distinguished. A specific tapering technology is developed for on-chip, low-loss (<0.1 dB) spotsize convertors, allowing for combining efficient fiber to chip coupling with high-contrast waveguides required for increased functional complexity as well as for hybrid integration with other photonic platforms such as InP and SOI. The functionality of the TriPleX platform is captured by verified basic building blocks. The corresponding library and associated design kit is available for multi-project wafer (MPW) runs. Several applications of this platform technology in communications, biomedicine, sensing, as well as a few special fields of photonics are treated in more detail.

  18. Total homocysteine and cognition in a tri-ethnic cohort

    PubMed Central

    Wright, C.B.; Lee, H.-S.; Paik, M.C.; Stabler, S.P.; Allen, R.H.; Sacco, R.L.

    2005-01-01

    Objective: Several studies implicate elevated homocysteine as a risk factor for dementia and cognitive decline, but most studies have involved subjects older than 55 years from homogeneous populations. The authors examined homocysteine and cognition in a tri-ethnic community sample 40 years and older. Method: The Northern Manhattan Study includes 3,298 stroke-free subjects. Of these 2,871 had baseline fasting total homocysteine (tHcy) levels and Mini-Mental State Examination (MMSE) scores available. The authors used multiple linear regression to examine the cross-sectional association between baseline tHcy levels and mean MMSE scores adjusting for sociodemographic and vascular risk factors. Results: Homocysteine levels were related to age, renal function, and B12 deficiency. Those with B12 deficiency had tHcy levels five points higher (9.4 vs 14.4 nmol/L). Mean MMSE scores differed by age, sex, and race-ethnic group. Those with hypertension, diabetes, cardiac disease, and B12 deficiency had lower MMSE scores. In multivariate analyses, elevated tHcy was associated with lower mean MMSE scores for those older than 65 but not for those 40 to 64. Adjusting for B12 deficiency and sociodemographic factors the mean MMSE was 2.2 points lower for each unit increase in the log tHcy level (95% CI −3.6, −0.9). Adding vascular risk factors to the model did not attenuate this effect (mean MMSE −2.2 points; 95% CI −3.5, −0.9). Conclusions: Elevated homocysteine was independently associated with decreased cognition in subjects older than 65 in this tri-ethnic cohort, adjusting for sociodemographic and vascular risk factors. PMID:15277617

  19. Do subfertile women adjust their habits when trying to conceive?

    PubMed Central

    Joelsson, Lana Salih; Berglund, Anna; Wånggren, Kjell; Lood, Mikael; Rosenblad, Andreas; Tydén, Tanja

    2016-01-01

    Aim The aim of this study was to investigate lifestyle habits and lifestyle adjustments among subfertile women trying to conceive. Materials and methods Women (n = 747) were recruited consecutively at their first visit to fertility clinics in mid-Sweden. Participants completed a questionnaire. Data were analyzed using logistic regression, t tests, and chi-square tests. Results The response rate was 62% (n = 466). Mean duration of infertility was 1.9 years. During this time 13.2% used tobacco daily, 13.6% drank more than three cups of coffee per day, and 11.6% consumed more than two glasses of alcohol weekly. In this sample, 23.9% of the women were overweight (body mass index, BMI 25–29.9 kg/m2), and 12.5% were obese (BMI ≥30 kg/m2). Obese women exercised more and changed to healthy diets more frequently than normal-weight women (odds ratio 7.43; 95% confidence interval 3.7–14.9). Six out of ten women (n = 266) took folic acid when they started trying to conceive, but 11% stopped taking folic acid after some time. Taking folic acid was associated with a higher level of education (p < 0.001). Conclusions Among subfertile women, one-third were overweight or obese, and some had other lifestyle factors with known adverse effects on fertility such as use of tobacco. Overweight and obese women adjusted their habits but did not reduce their body mass index. Women of fertile age would benefit from preconception counseling, and the treatment of infertility should routinely offer interventions for lifestyle changes. PMID:27216564

  20. A Novel Regulatory Gene, Tri10, Controls Trichothecene Toxin Production and Gene Expression

    PubMed Central

    Tag, Andrew G.; Garifullina, Gulnara F.; Peplow, Andrew W.; Ake, Charles; Phillips, T. D.; Hohn, Thomas M.; Beremand, Marian N.

    2001-01-01

    We report here the characterization of Tri10, a novel regulatory gene within the trichothecene gene cluster. Comparison of Tri10 genomic and mRNA sequences revealed that removal of a single 77-bp intron provided a 1,260-bp open reading frame, encoding a 420-amino-acid protein. Disruption of Tri10 in Fusarium sporotrichioides abolished T-2 toxin production and dramatically decreased the transcript accumulation for four trichothecene genes (Tri4, Tri5, Tri6, and Tri101) and an apparent farnesyl pyrophosphate synthetase (Fpps) gene. Conversely, homologous integration of a disruption vector by a single upstream crossover event significantly increased T-2 toxin production and elevated the transcript accumulation of the trichothecene genes and Fpps. Further analysis revealed that disruption of Tri10, and to a greater extent the disruption of Tri6, increased sensitivity to T-2 toxin under certain growth conditions. Although Tri10 is conserved in Fusarium graminearum and Fusarium sambucinum and clearly plays a central role in regulating trichothecene gene expression, it does not show any significant matches to proteins of known or predicted function or to motifs except a single transmembrane domain. We suggest a model in which Tri10 acts upstream of the cluster-encoded transcription factor TRI6 and is necessary for full expression of both the other trichothecene genes and the genes for the primary metabolic pathway that precedes the trichothecene biosynthetic pathway, as well as for wild-type levels of trichothecene self-protection. We further suggest the presence of a regulatory loop where Tri6 is not required for the transcription of Tri10 but is required to limit the expression of Tri10. PMID:11679358

  1. Pregnancy intentions among women who do not try: focusing on women who are okay either way.

    PubMed

    McQuillan, Julia; Greil, Arthur L; Shreffler, Karina M

    2011-02-01

    Are women who are intentional about pregnancy (trying to or trying not to get pregnant) systematically different from women who are "okay either way" about getting pregnant? We use a currently sexually active subsample (n = 3,771) of the National Survey of Fertility Barriers, a random digit dialing telephone survey of reproductive-aged women (ages 25-45) in the United States. We compare women who are trying to, trying not to, or okay either way about getting pregnant on attitudes, social pressures, life course and status characteristics using bivariate analyses (chi-square tests for categorical and ANOVA tests for continuous variables). Multivariate multinomial logistic regression provides adjusted associations. Most women say that they are trying not to get pregnant (71%) or are okay either way (23%); few are trying to get pregnant. Among women with no prior pregnancies (n = 831), more say that they are trying to get pregnant (14%) but a similar percentage are okay either way (26%). Several characteristics distinguish those trying to from those okay: fertility intentions, importance of motherhood, age, parity, race/ethnicity and self identifying a fertility problem. Additional characteristics are associated with trying not to get pregnant compared to being okay: ideal number of children, wanting a baby, trusting conception, relationship satisfaction, race ethnicity, economic hardship, and attitudes about career success. Women who are "okay either way" about pregnancy should be assessed separately from women who are intentional (trying to, trying not to) about pregnancy.

  2. Hanford Diversification and the Tri-Cities Economy FY 1999

    SciTech Connect

    SCOTT, M.J.

    2000-06-05

    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study. In the federal fiscal year (FY) 1999 (October 1, 1998 through September 30, 1999), the total impact of DOE'S local $1.59 billion budget was felt through payrolls of $542 million and local purchases of goods and services of $226 million. The total local spending of $768 million was up slightly from the FY 1998 total of $765 million. Taking into account the multiplier effects of this spending, the DOE/RL budget sustained an estimated 32% of all local employment (28,250 out of 88,100 jobs) and about 35% of local earned income (almost $1.08 billion out of $3.08 billion). The decrease in these percentages from last year's report reflects an update of the model's economic structure based on the 1997 economic census year, a correction of a programming error in the model found during the update, and a broader definition of earnings that includes proprietor income, not just wages (see the Appendix for revisions to the previous forecasts). DOE budget increases in FY 2000 are expected to result in no change to the number of local DOE contractor jobs and about a $29 million increase in direct local spending.

  3. PMSE Observations With the Tri-Static EISCAT VHF Radars

    NASA Astrophysics Data System (ADS)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  4. Anatomical Directional Dissimilarities in Tri-axial Swallowing Accelerometry Signals.

    PubMed

    Movahedi, Faezeh; Kurosu, Atsuko; Coyle, James L; Perera, Subashan; Sejdic, Ervin

    2017-05-01

    Swallowing accelerometry is a noninvasive approach currently under consideration as an instrumental screening test for swallowing difficulties, with most current studies focusing on the swallowing vibrations in the anterior-posterior (A-P) and superior-inferior (S-I) directions. However, the displacement of the hyolaryngeal structure during the act of swallowing in patients with dysphagia involves declination of the medial-lateral (M-L), which suggests that the swallowing vibrations in the M-L direction have the ability to reveal additional details about the swallowing function. With this motivation, we performed a broad comparison of the swallowing vibrations in all three anatomical directions. Tri-axial swallowing accelerometry signals were concurrently collected from 72 dysphagic patients undergoing videofluoroscopic evaluation of swallowing (mean age: 63.94 ± 12.58 years period). Participants swallowed one or more thickened liquids with different consistencies including thin-thick liquids, nectar-thick liquids, and pudding-thick liquids with either a comfortable self-selected volume from a cup or a controlled volume by the examiner from a 5-ml spoon. Swallows were grouped based on the viscosity of swallows and the participant's stroke history. Then, a comprehensive set of features was extracted in multiple signal domains from 881 swallows. The results highlighted inter-axis dissimilarities among tri-axial swallowing vibrations including the extent of variability in the amplitude of signals, the degree of predictability of signals, and the extent of disordered behavior of signals in time-frequency domain. First, the upward movement of the hyolaryngeal structure, representing the S-I signals, were actually more variable in amplitude and showed less predictable behavior than the sideways and forward movements, representing the A-P and M-L signals, during swallowing. Second, the S-I signals, which represent the upward movement of the hyolaryngeal structure

  5. Hanford, diversification, and the Tri-Cities Economy FY 1998

    SciTech Connect

    SCOTT, M.J.

    1999-04-14

    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study (see Figure 1). In the federal fiscal year (IV) 1998 (October 1, 1997 through September 30, 1998), the total impact of DOEs local $1.6 billion budget was felt through payrolls of $519 million and local purchases of goods and services of $246 million. The total local spending of $765 million was down slightly from the FY 1997 total of $774 million. Taking into account the slightly greater multiplier effects of this spending due to changes in its mix, the DOE/RL budget sustained an estimated 36% of all local employment (31,200 out of 86,000 jobs) and up to 64% of local wage income ($1.55 billion out of $2.40 billion). This was up slightly from the year before (29,500 jobs, $1.49 billion income). DOE budget increases in FY 1999 are expected to result in a net increase of about 200 local DOE contractor jobs over the September 30, 1998 level, or about equal to the FY 1998 average. In addition, economic diversification more than offset the impact of the local DOE losses in FY 1998 and, together with an initial economic boost from privatization of Hanford's tank waste cleanup, is expected to play a significant expansive role in FY 1999

  6. Synthesis and coordination chemistry of tri-substituted benzamidrazones.

    PubMed

    Crimmin, Mark R; Colby, Denise A; Ellman, Jonathan A; Bergman, Robert G

    2011-01-14

    A series of N(1),N(1),N(3)-tri-substituted benzamidrazones of the general formula [PhC(NHR)=NNMe(2)] (R = Me, n-Pr, i-Pr, n-Bu, Bn, Ph; 1a-f) was synthesized via condensation of 1,1-dimethylhydrazine with the corresponding imidoyl chloride, [PhC(Cl)=NR]. Multinuclear NMR data, and zero-point energy DFT calculations conducted with the B3LYP functional and 6-31G+(d,p) basis set, suggest that these compounds exist as a single tautomer in solution; possessing a weak intramolecular hydrogen bond and a structure dominated by the localised resonance structure ArC(NHR)=N-NMe(2). An X-ray crystallographic study upon PhC(NHPh)=NNMe(2) (1f) demonstrated that this compound adopts an identical tautomer in the solid state. Reactions of [PhC(NHMe)=NNMe(2)] (1a) with [LMCl(2)](2) (M = Ru, L = cymene; M = Rh, Ir, L = Cp*) results in the stoichiometric formation of products of the formula [LM{PhC(=NMe)NHNMe(2)}Cl](+)Cl(-) (2a-c) in which the amidrazone chelates the metal in a κ(2)-N(1),N(3)-coordination mode. Formation of this five-membered chelate occurs with a concomitant tautomerisation of the amidrazone ligand to an alternative tautomer, i.e. [PhC(=NMe)NHNMe(2)], the latter tautomer is expected to be readily energetically accessible based upon the aforementioned DFT calculations. This series of salts may be deprotonated with lithium hexamethyldisilazide to form the corresponding charge neutral complexes [LM{PhC(NMe)=NNMe(2)}] (3a-c). In contrast, the reaction of N(1),N(1),N(3)-tri-substituted benzamidrazones with [(cymene)RuCl(2)](2) in the presence of NaOAc yielded a mixture of cyclometallation (C-H activation) and amidrazone chelation/deprotonation (N-H activation) products. Reaction of 1a yielded an inseparable mixture of products, whilst the reaction of 1c resulted in formation of the cyclometallated product [LM{C(6)H(5)C(=N(i)Pr)NHNMe(2)}] (L = cymene, M = Ru; 4a) in a modest 62% yield. This latter complex could be isolated as a crystalline orange solid, full

  7. Synthesis and coordination chemistry of tri-substituted benzamidrazones

    PubMed Central

    Crimmin, Mark R.; Colby, Denise A.

    2011-01-01

    A series of N1,N1,N3-tri-substituted benzamidrazones of the general formulae [PhC(NHR)=NNMe2] (R = Me, n-Pr, i-Pr, n-Bu, Bn, Ph; 1a–f) was synthesized via condensation of 1,1-dimethylhydrazine with the corresponding imidoyl chloride, [PhC(Cl)=NR]. Multinuclear NMR data, and zero-point energy DFT calculations conducted with the B3LYP functional and 6-31G+(d,p) basis set, suggest that these compounds exist as a single tautomer in solution; possessing a weak intramolecular hydrogen bond and a structure dominated by the localised resonance structure ArC(NHR)=N-NMe2. An X-ray crystallographic study upon PhC(NHPh)=NNMe2 (1f) demonstrated that this compound adopts an identical tautomer in the solid state. Reactions of [PhC(NHMe)=NNMe2] (1a) with [LMCl2]2 (M = Ru, L = cymene; M = Rh, Ir, L = Cp*) results in the stoichiometric formation of products of the formula [LM{PhC(=NMe)NHNMe2}Cl]+Cl− (2a–c) in which the amidrazone chelates the metal in a κ2-N1,N3-coordination mode. Formation of this five-membered chelate occurs with a concomitant tautomerisation of the amidrazone ligand to an alternative tautomer, i.e. [PhC(=NMe)NHNMe2], the latter tautomer is expected to be readily energetically accessible based upon the aforementioned DFT calculations. This series of salts may be deprotonated with lithium hexamethyldisilazide to form the corresponding charge neutral complexes [LM{PhC(NMe)=NNMe2}] (3a–c). In contrast, the reaction of N1,N1,N3-tri-substituted benzamidrazones with [(cymene)RuCl2]2 in the presence of NaOAc yielded a mixture of cyclometallation (C-H activation) and amidrazone chelation/deprotonation (N-H activation) products. Reaction of 1a yielded an inseparable mixture of products, whilst the reaction of 1c resulted in formation of the cyclometallated product [LM{C6H5C(=NiPr)NHNMe2}] (L = cymene, M = Ru; 4a) in a modest 62% yield. This latter complex could be isolated as a crystalline orange solid, full characterisation including single crystal X

  8. Monitoring of odor nuisance in the tri-city agglomeration

    NASA Astrophysics Data System (ADS)

    Gebicki, Jacek; Dymerski, Tomasz; Namieśnik, Jacek

    2016-11-01

    The paper describes a principle of operation of odor nuisance monitoring network, which is being designed in the tri-city agglomeration. Moreover, it presents the preliminary results of an investigation on ambient air quality with respect to odour nuisance in a vicinity of the municipal landfill. The investigation was performed during spring-winter season using a prototype of electronic nose and the Nasal Ranger field olfactometers. The prototype was equipped with a set of six semiconductor sensors by FIGARO Co. and one PID-type sensor. The field olfactometers were used to determine mean concentration of odorants, which amounted from 2.2 to 30.2 ou/m3 depending on the place of measurement. In case of the investigation with the electronic nose prototype a classification of the ambient air samples with respect to the place of sampling was performed utilizing kNN algorithm supported with a cross-validation method. Correct classification of the ambient air samples was at the level of 66.7%. Performed investigation revealed that discrimination of the ambient air samples differing in concentration of odorants and place of origin was possible.

  9. A regularized tri-linear approach for optical interferometric imaging

    NASA Astrophysics Data System (ADS)

    Birdi, Jasleen; Repetti, Audrey; Wiaux, Yves

    2017-06-01

    In the context of optical interferometry, only undersampled power spectrum and bispectrum data are accessible. It poses an ill-posed inverse problem for image recovery. Recently, a tri-linear model was proposed for monochromatic imaging, leading to an alternated minimization problem. In that work, only a positivity constraint was considered, and the problem was solved by an approximated Gauss-Seidel method. In this paper, we propose to improve the approach on three fundamental aspects. First, we define the estimated image as a solution of a regularized minimization problem, promoting sparsity in a fixed dictionary using either an ℓ1 or a (re)weighted-ℓ1 regularization term. Secondly, we solve the resultant non-convex minimization problem using a block-coordinate forward-backward algorithm. This algorithm is able to deal both with smooth and non-smooth functions, and benefits from convergence guarantees even in a non-convex context. Finally, we generalize our model and algorithm to the hyperspectral case, promoting a joint sparsity prior through an ℓ2,1 regularization term. We present simulation results, both for monochromatic and hyperspectral cases, to validate the proposed approach.

  10. Overview of the Tri Alpha Energy Plasma Diagnostics Program

    NASA Astrophysics Data System (ADS)

    Thompson, Matthew; Gota, Hiroshi; Putvinski, Sergei; Tuszewski, Michel; Binderbauer, Michl; the TAE Team

    2016-10-01

    Tri Alpha Energy (TAE) seeks to study the evolution of advanced beam-driven field-reversed configuration (FRC) plasmas sustained and heated by neutral beam (NB) injection. Heating of FRCs is the focus of the upcoming C-2W program. Data on the FRC plasma performance is provided by a comprehensive suite of diagnostics including magnetic sensors, interferometry, Thomson scattering, spectroscopy, bolometry, reflectometry, and NB-related fast-ion/neutral diagnostics. While many of these diagnostic systems were first implemented for the earlier C-2 and C-2U experiments, virtually all of them benefit from continuous improvement and upgrades. TAE maintains a large plasma diagnostics development program working on a variety of new systems for future devices including: far-infrared polarimetry, visible and infrared fast imaging cameras, proton detector arrays, end loss analyzers, impurity and majority ion CHERS, and 100-channel bolometer units with proprietary compact local data acquisition. In addition, extensive ongoing work focuses on developing advanced methods of measuring the internal magnetic fields of the FRC plasma.

  11. Leadership development for clinicians: what are we trying to achieve?

    PubMed

    McKimm, Judy; Swanwick, Tim

    2011-09-01

    The role of all health practitioners is changing as a result of social, technological and demographic shifts, and clinicians are increasingly required to participate in leadership activities. Worldwide, there are emerging examples of policy agendas, professional standards and competency frameworks and approaches to leadership development for clinicians. This article looks at what leadership development programmes for clinicians are trying to achieve, the rationale behind them and the outcomes that are deemed to be important. It offers a critical description of competency frameworks and their use in practice. The UK, along with other Western countries, has embedded leadership and management learning outcomes into professional frameworks for students and qualified clinicians. There is increasing recognition that leadership development is best rooted in work-based activities, reflecting the realities of clinical life, with an emphasis on learning across the education and training continuum. If leadership is deemed to be relevant 'at all levels', then 'leadership development' must be addressed throughout the education and training undertaken by health professionals. Leadership as a topic is gathering momentum as a key curriculum area. But effective clinical leaders and managers need to be nurtured and supported by the organisations and health systems within which they work and learn. Although a wide range of leadership development activities exist for individuals, without system-wide change these initiatives may not produce the most effective 'leadership', nor the health improvements to which they aspire. © Blackwell Publishing Ltd 2011.

  12. Tri-layered chitosan scaffold as a potential skin substitute.

    PubMed

    Lin, Hsin-Yi; Chen, Shin-Hung; Chang, Shih-Hsin; Huang, Sheng-Tung

    2015-01-01

    A tri-layered chitosan-based scaffold was successfully made to replicate the striation of a full-thickness skin more accurately than a single- or bi-layered scaffold, which needed weeks of co-culturing of fibroblasts and keratinocytes to achieve similar striation. Chitosan solution was freeze-dried and made into porous disks. Chitosan or chitosan-pectin in acetic acid solution was electrospun onto the chitosan disk to form a nanofibrous layer and a thin film. Examinations based on scanning electron spectroscopy showed that the scaffold was composed of a porous layer (2 mm) to simulate the dermis, a thin film (25-45 μm) to mimic the basement membrane, and a layer of nanofibers (100-200 μm) to serve as the protective epidermis. The tensile strength and modulus of the composite scaffold were significantly higher than those of the chitosan disk (p < 0.01). The composite was able to quickly absorb water and stayed intact throughout the course of the 14-day cell culture tests. The fibroblast cells seeded on both sides of the scaffolds were able to proliferate and stayed separated by the thin film.

  13. Competition in di- and tri-trophic food web modules.

    PubMed

    Křivan, Vlastimil

    2014-02-21

    Competition in di- and tri-trophic food web modules with many competing species is studied. The food web modules considered are apparent competition between n species sharing a single predator and a diamond-like food web with a single resource, a single top predator and many competing middle species. The predators have either fixed preferences for their prey, or they switch between available prey in a way that maximizes their fitness. Dependence of these food web dynamics on environmental carrying capacity and food web connectance is studied. The results predict that optimal flexible foraging strongly weakens apparent competition and promotes species coexistence. Food web robustness (defined here as the proportion of surviving species) does not decrease with increased connectance in these food-webs. Moreover, it is shown that flexible prey switching leads to the same population equilibria as in corresponding food webs with highly specialized predators. The results show that flexible foraging behavior by predators can have very strong impact on species richness, as well as the response of communities to changes in resource enrichment and food-web connectance when compared to the same food-web topology with inflexible top predators. Several results on global stability using Lyapunov functions are provided. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. "Try not to judge": mothers of substance exposed infants.

    PubMed

    Cleveland, Lisa M; Gill, Sara L

    2013-01-01

    To describe the hospital experiences of mothers who give birth to substance-exposed infants. Secondary analysis of data from a larger study that was focused on the experiences of Mexican-American mothers in the neonatal intensive care unit (NICU) was conducted. Semistructured interviews with five women who were recovering addicts on methadone were analyzed. Each of their infants spent time in an NICU following birth. The transcribed interviews were analyzed using qualitative content analysis. Four themes were identified: (a) "try not to judge," (b) "scoring" the baby, (c) "share with me," and (d) "I'm the mother here!" The quality of the relationship between the mothers and the nurses in the NICU was a crucial aspect of the mothers' experiences and may have an effect on long-term outcomes. Women with addictions often have other significant risk factors that may further jeopardize their ability to mother; therefore, it is essential to develop a strong support network. Nurses can be instrumental in organizing resources for this population of women. Judging behaviors may have a detrimental effect on women with addictions. Maternal adaptation to the mothering role can be enhanced by making reasonable efforts to include the mother in the care of the infant.

  15. Defects in the tri-critical Ising model

    NASA Astrophysics Data System (ADS)

    Makabe, Isao; Watts, Gérard M. T.

    2017-09-01

    We consider two different conformal field theories with central charge c = 7 /10. One is the diagonal invariant minimal model in which all fields have integer spins; the other is the local fermionic theory with superconformal symmetry in which fields can have half-integer spin. We construct new conformal (but not topological or factorised) defects in the minimal model. We do this by first constructing defects in the fermionic model as boundary conditions in a fermionic theory of central charge c = 7 /5, using the folding trick as first proposed by Gang and Yamaguchi [1]. We then act on these with interface defects to find the new conformal defects. As part of the construction, we find the topological defects in the fermionic theory and the interfaces between the fermionic theory and the minimal model. We also consider the simpler case of defects in the theory of a single free fermion and interface defects between the Ising model and a single fermion as a prelude to calculations in the tri-critical Ising model.

  16. Characterizing the effective bandwidth of tri-stable energy harvesters

    NASA Astrophysics Data System (ADS)

    Panyam, Meghashyam; Daqaq, Mohammed F.

    2017-01-01

    Recently, it has been shown that nonlinear vibratory energy harvesters possessing a tri-stable potential function are capable of harvesting energy efficiently over a wider range of frequencies in comparison to harvesters with a double-well potential function. However, the effect of the design parameters of the harvester on the dynamic response and the effective bandwidth of such devices remains uninvestigated. To fill this void, this paper establishes an analytical approach to characterize the effective frequency bandwidth of harvesters that possess a hexic potential energy function. To achieve this goal, the method of multiple scales is utilized to construct analytical solutions describing the amplitude and stability of the intra- and inter-well dynamics of the harvester. Using these solutions, critical bifurcations in the parameter's space are identified and used to define an effective frequency bandwidth of the harvester. The influence of the electric parameters, namely, the time constant ratio (ratio between the period of the mechanical system and the time constant of the harvesting circuit) and the electromechanical coupling, on the effective frequency bandwidth is analyzed. Experimental studies performed on the harvester are presented to validate some of the theoretical findings.

  17. STS-103 MS Clervoy tries on oxygen mask

    NASA Technical Reports Server (NTRS)

    1999-01-01

    In the bunker at Launch Pad 39B, STS-103 Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency (ESA), tries on an oxygen mask during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), plus Claude Nicollier of Switzerland, who is also with ESA. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  18. STS-99 crew try on oxygen masks during TCDT

    NASA Technical Reports Server (NTRS)

    2000-01-01

    In the bunker at Launch Pad 39A, the STS-99 crew try on oxygen masks. From left are Pilot Dominic Gorie, Mission Specialist Janice Voss (Ph.D.), Commander Kevin Kregel, and Mission Specialists Mamoru Mohri, Janet Lynn Kavandi (Ph.D.) and Gerhard Thiele. Mohri is with the National Space Development Agency (NASDA) of Japan and Thiele is with the European Space Agency. The crew are taking part in Terminal Countdown Demonstration Test activities, which provide them with simulated countdown exercises, emergency egress training, and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-99 is the Shuttle Radar Topography Mission, which will chart a new course, using two antennae and a 200-foot-long section of space station-derived mast protruding from the payload bay to produce unrivaled 3-D images of the Earth's surface. The result of the Shuttle Radar Topography Mission could be close to 1 trillion measurements of the Earth's topography. Besides contributing to the production of better maps, these measurements could lead to improved water drainage modeling, more realistic flight simulators, better locations for cell phone towers, and enhanced navigation safety. Launch of Endeavour on the 11-day mission is scheduled for Jan. 31 at 12:47 p.m. EST.

  19. Proving tri-linear couplings at the LHC

    SciTech Connect

    Womersley, J.

    1995-11-01

    Prospects for measuring the tri-linear couplings of gauge bosons at the LHC are reviewed. Studies carried out by the ATLAS collaboration, and for the 1994 DPF Long Range Planning Workshop, are described. It will be possible to probe {ital WWV} anomalous couplings with a precision of order 10{sup -1}-10{sup -3} if the form factor scale {lambda}{sub {ital FF}}{approx_gt}2 TeV. This just reaches the interesting region where one may hope to see deviations from the standard model given present limits on the scale of new physics. The {ital Z}{gamma}{ital V} limits are much more sensitive to {lambda}{sub {ital FF}}; for {lambda}{sub {ital FF}}{approx_gt}1.5 TeV, {ital h}{sub 3}{sup {ital Z}}{much_gt}O(10{sup -3}) and {ital h}{sup {ital Z}}{sub 4}{much_gt}O(10{sup -5}). It will be possible to see the amplitude zero in {ital W}{gamma} and {ital WZ} production at the LHC but this physics is probably better explored at the Tevatron. {copyright} 1995 {ital American Institute of Physics.}

  20. Diagnosing Invisible Cancer with Tri-Modal Spectroscopy

    NASA Astrophysics Data System (ADS)

    Müller, Markus G.; Georgakoudi, Irene; Feld, Michael S.

    2002-06-01

    Dysplasia, which is often invisible, is the precursor to cancer. This study evaluated the use of three spectroscopic techniques: intrinsic fluorescence, diffuse reflectance and light scattering spectroscopy (LSS), to detect precancerous lesions. We evaluated low and high-grade dysplasia in Barrett's esophagus, and squamous intraepithelial lesions in the cervix. Fluorescence spectra at 11 excitation wavelengths and a white light diffuse reflectance spectrum were obtained in less than one second from a tissue site prior to biopsy, using an optical fiber probe. The intrinsic fluorescence was extracted by combining the measured fluorescence spectra with the diffuse reflectance spectrum at the same site, from which biochemical information was obtained. Analysis of the diffuse reflectance provided morphological information about tissue structure and biochemical information about tissue absorbers. LSS was used to obtain information about epithelial cell nuclear enlargement and crowding. The combination of the three techniques, tri-modal spectroscopy (TMS), gave more accurate results than any one technique alone. The excellent results indicate the potential of using TMS for diagnosis without tissue removal.

  1. STS-103 MS Clervoy tries on oxygen mask

    NASA Technical Reports Server (NTRS)

    1999-01-01

    In the bunker at Launch Pad 39B, STS-103 Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency (ESA), tries on an oxygen mask during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), plus Claude Nicollier of Switzerland, who is also with ESA. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  2. STS-99 crew try on oxygen masks during TCDT

    NASA Technical Reports Server (NTRS)

    2000-01-01

    In the bunker at Launch Pad 39A, the STS-99 crew try on oxygen masks. From left are Pilot Dominic Gorie, Mission Specialist Janice Voss (Ph.D.), Commander Kevin Kregel, and Mission Specialists Mamoru Mohri, Janet Lynn Kavandi (Ph.D.) and Gerhard Thiele. Mohri is with the National Space Development Agency (NASDA) of Japan and Thiele is with the European Space Agency. The crew are taking part in Terminal Countdown Demonstration Test activities, which provide them with simulated countdown exercises, emergency egress training, and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-99 is the Shuttle Radar Topography Mission, which will chart a new course, using two antennae and a 200-foot-long section of space station-derived mast protruding from the payload bay to produce unrivaled 3-D images of the Earth's surface. The result of the Shuttle Radar Topography Mission could be close to 1 trillion measurements of the Earth's topography. Besides contributing to the production of better maps, these measurements could lead to improved water drainage modeling, more realistic flight simulators, better locations for cell phone towers, and enhanced navigation safety. Launch of Endeavour on the 11-day mission is scheduled for Jan. 31 at 12:47 p.m. EST.

  3. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.

    1999-02-01

    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  4. AIDS and journalism. Trying to tell too clear a story.

    PubMed

    Cohen, J

    1994-12-01

    Much in science is complex. Scientists, by definition, work within the realm of complex hypothesis, empirical evidence, and proof. Questions, answers, details, complexities; that is the domain of the scientist. Journalists, on the other hand, are paid to develop and present stories which are clearly read and interpreted by the general public. The mechanics and dynamics of HIV and AIDS are among the most complex scientific challenges in the history of humankind. Journalists calling upon scientists to obtain and report clear, concise, information about the agent and its resulting pandemic are therefore surely not always going to receive simple, readily reportable responses. HIV is a moving target upon which research continues. While there are some definitively affirmative and some definitively negative factors about HIV, the gray areas and speculation remain vast. The author gives a few examples of AIDS stories which the media mishandled because they were trying to tell too clear a story. He then discusses stories flawed because scientists managed to present clear information about which journalists were overly skeptical. In one case, the public was informed that AIDS vaccines were not working, with headlines which insinuated that the vaccines themselves were causing infections. None of the vaccines, however, contained infectious materials. As a result, people became overly fearful of participating in HIV vaccine trials. Coverage of the potential identification of HIV-3 was premature and only scared people, while Rolling Stone magazine's article hypothesizing the origin of HIV via trials of a contaminated polio vaccine in the Belgium Congo in the late 1950s should not have been published. Clear answers about HIV/AIDS are few and far between, but interesting and significant stories can still be found; they are just hard to tell.

  5. TRY – a global database of plant traits

    PubMed Central

    Kattge, J; Díaz, S; Lavorel, S; Prentice, I C; Leadley, P; Bönisch, G; Garnier, E; Westoby, M; Reich, P B; Wright, I J; Cornelissen, J H C; Violle, C; Harrison, S P; Van Bodegom, P M; Reichstein, M; Enquist, B J; Soudzilovskaia, N A; Ackerly, D D; Anand, M; Atkin, O; Bahn, M; Baker, T R; Baldocchi, D; Bekker, R; Blanco, C C; Blonder, B; Bond, W J; Bradstock, R; Bunker, D E; Casanoves, F; Cavender-Bares, J; Chambers, J Q; Chapin, F S; Chave, J; Coomes, D; Cornwell, W K; Craine, J M; Dobrin, B H; Duarte, L; Durka, W; Elser, J; Esser, G; Estiarte, M; Fagan, W F; Fang, J; Fernández-Méndez, F; Fidelis, A; Finegan, B; Flores, O; Ford, H; Frank, D; Freschet, G T; Fyllas, N M; Gallagher, R V; Green, W A; Gutierrez, A G; Hickler, T; Higgins, S I; Hodgson, J G; Jalili, A; Jansen, S; Joly, C A; Kerkhoff, A J; Kirkup, D; Kitajima, K; Kleyer, M; Klotz, S; Knops, J M H; Kramer, K; Kühn, I; Kurokawa, H; Laughlin, D; Lee, T D; Leishman, M; Lens, F; Lenz, T; Lewis, S L; Lloyd, J; Llusià, J; Louault, F; Ma, S; Mahecha, M D; Manning, P; Massad, T; Medlyn, B E; Messier, J; Moles, A T; Müller, S C; Nadrowski, K; Naeem, S; Niinemets, Ü; Nöllert, S; Nüske, A; Ogaya, R; Oleksyn, J; Onipchenko, V G; Onoda, Y; Ordoñez, J; Overbeck, G; Ozinga, W A; Patiño, S; Paula, S; Pausas, J G; Peñuelas, J; Phillips, O L; Pillar, V; Poorter, H; Poorter, L; Poschlod, P; Prinzing, A; Proulx, R; Rammig, A; Reinsch, S; Reu, B; Sack, L; Salgado-Negret, B; Sardans, J; Shiodera, S; Shipley, B; Siefert, A; Sosinski, E; Soussana, J-F; Swaine, E; Swenson, N; Thompson, K; Thornton, P; Waldram, M; Weiher, E; White, M; White, S; Wright, S J; Yguel, B; Zaehle, S; Zanne, A E; Wirth, C

    2011-01-01

    Plant traits – the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs – determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world's 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation – but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial

  6. Try-A Global Database of Plant Traits

    SciTech Connect

    Thornton, Peter E

    2011-01-01

    Plant traits the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world s 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial vegetation in

  7. Magnetic field uniformity of the practical tri-axial Helmholtz coils systems.

    PubMed

    Beiranvand, R

    2014-05-01

    In this paper, effects of the assembly misalignments and the manufacturing mismatches on the magnetic field uniformity of a practical tri-axial Helmholtz coils system have been modeled mathematically. These undesired effects regularly occur in any practical tri-axial Helmholtz coils system. To confirm the mathematical calculations, a tri-axial Helmholtz coils system has been constructed and the uniformity of its magnetic field has been measured under different conditions. The experimental results are in good agreement with the mathematical analyses.

  8. Network of nano-droplets by a tri-block polymer

    NASA Astrophysics Data System (ADS)

    Sharifi, Soheil; Doodman, Esmaeil

    2014-11-01

    Mixtures of oil in water nano-droplets with two molecular weights of a tri-block polymer was studied by quasi elastic light scattering and small angle X-ray scattering. The results showed that the size and interaction of droplets didn't change with increase of the tri-block polymer length but the order parameters increased. The increase of length of the tri-block biopolymer changed the dynamics of the droplets. A network formation is resulted with increase of the amount of tri-block polymer in the microemulsions.

  9. Synthesis of di-, tri-, and tetrasulfides through multifold carbon-sulfur cross-coupling reactions with indium tri(organothiolates) in a one-pot procedure.

    PubMed

    Lee, Phil Ho; Park, Youngchul; Park, Sangkyun; Lee, Euijae; Kim, Sunggak

    2011-02-04

    Pd-catalyzed multifold (2-, 3-, and 4-fold) carbon-sulfur cross-coupling reaction of indium tri(organothiolates) with polybromonated aromatic and heteroaromatic compounds was developed in a one-pot procedure. Both 2,5-dibromopyridine and 2,6-dibromopyridine reacted with indium tri(organothiolates) (0.68 equiv) in the presence of 4 mol % of Pd(OAc)(2), 4.2 mol % of Xantphos, and 1 equiv of diisopropylethylamine (DIPEA), producing disulfides in good to excellent yields. These results indicate that indium tri(organothiolates) transfer all three alkyl- or arylthio groups attached to indium metal to electrophilic coupling partners. Indium tri(organothiolates) derived from alkyl thiol having a low boiling point, such as n-propyl, isopropyl, and tert-butyl thiol, acted as good nucleophilic coupling partners. In addition, indium tri(arylthiolates) derived from aryl thiols possessing an electron-withdrawing or -donating group on the aromatic ring participated well in the Pd-catalyzed multifold carbon-sulfur cross-coupling reaction. 4,4'-Dibromo-1,1'-biphenyl, 9,10-dibromoanthracene, 2,4-dibromoanisole, 2,7-dibromo-9,9-dimethylfluorene, 3,4-dibromothiophene, 2,3-dibromothiophene, 2,2'-bithiophene, 1,3,5-tribromobenzene, and 1,2,4,5-tetrabromobenzene were converted smoothly to the corresponding di-, tri-, and tetrasulfides.

  10. Tri-Laboratory Linux Capacity Cluster 2007 SOW

    SciTech Connect

    Seager, M

    2007-03-22

    well, the budget demands are extreme and new, more cost effective ways of fielding these systems must be developed. This Tri-Laboratory Linux Capacity Cluster (TLCC) procurement represents the ASC first investment vehicle in these capacity systems. It also represents a new strategy for quickly building, fielding and integrating many Linux clusters of various sizes into classified and unclassified production service through a concept of Scalable Units (SU). The programmatic objective is to dramatically reduce the overall Total Cost of Ownership (TCO) of these 'capacity' systems relative to the best practices in Linux Cluster deployments today. This objective only makes sense in the context of these systems quickly becoming very robust and useful production clusters under the crushing load that will be inflicted on them by the ASC and SSP scientific simulation capacity workload.

  11. Novel Pentacyano Complexes of Tri- and Tetravalent Platinum.

    PubMed

    Maliarik, Mikhail; Glaser, Julius; Tóth, Imre

    1998-10-19

    New pentacyano complexes of tri- and tetravalent platinum were obtained in aqueous solution and characterized by multinuclear NMR ((195)Pt, (13)C) supported by Raman spectroscopy. The complexes form as products of redox decomposition of metal-metal bonded platinum-thallium compounds. The trimetallic [(NC)(5)Pt-Tl-Pt(CN)(5)](3)(-) yields a new dimeric compound of Pt(III), [(NC)(5)Pt-Pt(CN)(5)](4)(-). The latter is a rare representative of unbridged dimeric complexes of trivalent platinum; it was obtained through an oxidation of monomeric square-planar platinum(II) species by a metal complex. From the bimetallic compounds [(NC)(5)Pt-Tl(CN)(n)()](n)()(-) (n = 0-2) tetravalent platinum complexes are formed. Depending on the Pt-Tl species, electron transfer is initiated either by heat or by exposition to light; it results in [Pt(CN)(6)](2)(-) or in the hitherto unknown complexes [Pt(CN)(5)(OH)](2)(-) and [Pt(CN)(5)(H(2)O)](-), with the (195)Pt NMR chemical shift values 1638.7 (+/-0.6) and 1766.7 (+/-0.6), respectively. Proton dissociation constant of [Pt(CN)(5)(H(2)O)](-) has been determined, pK(a) = 2.51 (+/-0.01). In both Pt(III) and Pt(IV) pentacyano complexes platinum is hexacoordinated forming a pseudo-octahedron with two types of cyano ligands: four equivalent equatorial cyanides and one apical. Related platinum(IV) species, [Pt(CN)(5)X](2)(-) (X = Cl, Br, I), have also been studied. In all the pentacyano complexes a pronounced trans influence is reflected in a substantial difference between the (195)Pt-(13)C spin-spin coupling constant for the apical (trans) and the equatorial (cis) carbon sites. In this respect, the studied X ligands can be ordered in a series of decreasing (195)Pt-(13)C(trans) coupling constant: H(2)O > Cl(-) > Br(-) > I(-) > OH(-) > CN(-).

  12. 75 FR 12731 - Foreign-Trade Zone 204-Tri-Cities Area, Tennessee/Virginia; Application for Expansion

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-03-17

    ... Foreign-Trade Zones Board Foreign-Trade Zone 204--Tri-Cities Area, Tennessee/Virginia; Application for Expansion An application has been submitted to the Foreign-Trade Zones (FTZ) Board (the Board) by the Tri... in Bristol, Tennessee in the Tri-Cities Area, Tennessee/Virginia, adjacent to the Tri-Cities Customs...

  13. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new uses...

  14. 77 FR 65545 - Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-10-29

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Western Electric... (2011), Tri-State Generation and Transmission Association, Inc. (Complainants) filed a complaint and...

  15. Outcome-Oriented Operations (Tri-O[superscript 3]): Thriving in a Highly Competitive Environment

    ERIC Educational Resources Information Center

    Sigler, Wayne

    2003-01-01

    This article describes Outcome-Oriented Operations (Tri-O[superscript 3]), a system developed at the University of Minnesota-Twin Cities, which enables an office to identify and achieve specific, measurable outcomes. Tri-O[superscript 3] was implemented in the University's Office of Undergraduate Admissions with significant success. (Contains 3…

  16. Leucine metabolism regulates TRI6 expression and affects deoxynivalenol production and virulence in Fusarium graminearum.

    PubMed

    Subramaniam, Rajagopal; Narayanan, Swara; Walkowiak, Sean; Wang, Li; Joshi, Manisha; Rocheleau, Hélène; Ouellet, Thérèse; Harris, Linda J

    2015-11-01

    TRI6 is a positive regulator of the trichothecene gene cluster and the production of trichothecene mycotoxins [deoxynivalenol (DON)] and acetylated forms such as 15-Acetyl-DON) in the cereal pathogen Fusarium graminearum. As a global transcriptional regulator, TRI6 expression is modulated by nitrogen-limiting conditions, sources of nitrogen and carbon, pH and light. However, the mechanism by which these diverse environmental factors affect TRI6 expression remains underexplored. In our effort to understand how nutrients affect TRI6 regulation, comparative digital expression profiling was performed with a wild-type F. graminearum and a Δtri6 mutant strain, grown in nutrient-rich conditions. Analysis showed that TRI6 negatively regulates genes of the branched-chain amino acid (BCAA) metabolic pathway. Feeding studies with deletion mutants of MCC, encoding methylcrotonyl-CoA-carboxylase, one of the key enzymes of leucine metabolism, showed that addition of leucine specifically down-regulated TRI6 expression and reduced 15-ADON accumulation. Constitutive expression of TRI6 in the Δmcc mutant strain restored 15-ADON production. A combination of cellophane breach assays and pathogenicity experiments on wheat demonstrated that disrupting the leucine metabolic pathway significantly reduced disease. These findings suggest a complex interaction between one of the primary metabolic pathways with a global regulator of mycotoxin biosynthesis and virulence in F. graminearum.

  17. 76 FR 25278 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-05-04

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriMet Bridge Project, Willamette River... is proposing the establishment of a safety zone during the construction of the TriMet Bridge on the..., will be starting construction of the new Portland-Milwaukie Light Rail Bridge on July 1, 2011 (with in...

  18. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    ERIC Educational Resources Information Center

    Goff, John Eric; Lipscombe, Trevor Davis

    2015-01-01

    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  19. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  20. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  1. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  2. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  3. Developmental differences in sensory decision making involved in deciding to try a novel fruit.

    PubMed

    Dovey, Terence M; Aldridge, Victoria K; Dignan, Wendy; Staples, Paul A; Gibson, E Leigh; Halford, Jason C G

    2012-05-01

    This research compared sensory processing and personality traits involved in deciding to try a novel fruit (guava) in adults and children. The research employed an age, sex, and food neophobia matched between-participant design to examine sensory decision making in choosing to eat a novel fruit. Forty-four adults (Study 1) and 68 children (Study 2) took part. In each study, participants were separated into two groups to investigate whether prior assessment of a familiar and liked fruit (apple) that shares similar visual characteristics to the target novel fruit (guava) increased the likelihood that an individual would decide to try it. All participants completed appetitive and familiarity ratings by sensory stages: vision, smell, and touch, prior to trying (tasting) the fruit. Participants (or their parents) also completed the general and food neophobia scales and adults also completed the sensation-seeking scale. Twenty-eight adults (64%) tried the guava and 16 did not (36%). In the second study, 22 children decided not to try the novel fruit (32%). Significant predictors of whether the adult tried the target fruit were Thrill and Adventure Seeking, Experience Seeking, General Neophobia, and 'appealing to touch'. In children, Food Neophobia, concurrent presentation of a familiar fruit alongside the target and visual assessment of the target predicted decision to try the novel fruit. This study suggests that touch is pertinent to adults' decision to try a novel fruit, whereas visual cues appear to be more important for children. ©2011 The British Psychological Society.

  4. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    ERIC Educational Resources Information Center

    Goff, John Eric; Lipscombe, Trevor Davis

    2015-01-01

    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  5. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-08-29

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA. (a) Location. The limits of the safety zone...

  6. Compression response of tri-axially braided textile composites

    NASA Astrophysics Data System (ADS)

    Song, Shunjun

    2007-12-01

    This thesis is concerned with characterizing the compression stiffness and compression strength of 2D tri-axially braided textile composites (2DTBC). Two types of 2DTBC are considered differing only on the resin type, while the textile fiber architecture is kept the same with bias tows at 45 degrees to the axial tows. Experimental, analytical and computational methods are described based on the results generated in this study. Since these composites are manufactured using resin transfer molding, the intended and as manufactured composite samples differ in their microstructure due to consolidation and thermal history effects in the manufacturing cycle. These imperfections are measured and the effect of these imperfections on the compression stiffness and strength are characterized. Since the matrix is a polymer material, the nonuniform thermal history undergone by the polymer at manufacturing (within the composite and in the presence of fibers) renders its properties to be non-homogenous. The effects of these non-homogeneities are captured through the definition of an equivalent in-situ matrix material. A method to characterize the mechanical properties of the in-situ matrix is also described. Fiber tow buckling, fiber tow kinking and matrix microcracking are all observed in the experiments. These failure mechanisms are captured through a computational model that uses the finite element (FE) technique to discretize the structure. The FE equations are solved using the commercial software ABAQUS version 6.5. The fiber tows are modeled as transversely isotropic elastic-plastic solids and the matrix is modeled as an isotropic elastic-plastic solid with and without microcracking damage. Because the 2DTBC is periodic, the question of how many repeat units are necessary to model the compression stiffness and strength are examined. Based on the computational results, the correct representative unit cell for this class of materials is identified. The computational models and

  7. Technology transfer and commercialization initiatives at TRI/Austin: Resources and examples

    SciTech Connect

    Matzkanin, G.A.; Dingus, M.L.

    1995-12-31

    Located at TRI/Austin, and operated under a Department of Defense contract, is the Nondestructive Testing Information Analysis Center (NTIAC). This is a full service Information Analysis Center sponsored by the Defense Technical Information Center (DTIC), although services of NTIAC are available to other government agencies, government contractors, industry and academia. The principal objective of NTIAC is to help increase the productivity of the nation`s scientists, engineers, and technical managers involved in, or requiring, nondestructive testing by providing broad information analysis services of technical excellence. TRI/Austin is actively pursuing commercialization of several products based on results from outside funded R and D programs. As a small business, TRI/Austin has limited capabilities for large scale fabrication, production, marketing or distribution. Thus, part of a successful commercialization process involves making appropriate collaboration arrangements with other organizations to augment TRI/Austin`s capabilities. Brief descriptions are given here of two recent commercialization efforts at TRI/Austin.

  8. R2 TRI facilities with 1999-2011 risk related estimates throughout the census blockgroup

    EPA Pesticide Factsheets

    This dataset delineates the distribution of estimate risk from the TRI facilities for 1999 - 2011 throughout the census blockgroup of the region using Office of Pollution, Prevention & Toxics (OPPT)'s Risk-Screening Environmental Indicators model (RSEI). The model uses the reported quantities of TRI releases of chemicals to estimate the impacts associated with each type of air release or transfer by every TRI facility.The RSEI was run to generate the estimate risk for each TRI facility in the region. The result from the model is joined to the TRI spatial data. Estimate risk values for each census block group were calculated based on the inverse distance of all the facilities which are within a 50 km radius of the census block group centroid. The estimate risk value for each census block group thus is an aggregated value that takes into account the estimate potential risk of all the facilities within the searching radius (50km).

  9. Mechanism of lid closure in the eukaryotic chaperonin TRiC/CCT.

    PubMed

    Booth, Christopher R; Meyer, Anne S; Cong, Yao; Topf, Maya; Sali, Andrej; Ludtke, Steven J; Chiu, Wah; Frydman, Judith

    2008-07-01

    All chaperonins mediate ATP-dependent polypeptide folding by confining substrates within a central chamber. Intriguingly, the eukaryotic chaperonin TRiC (also called CCT) uses a built-in lid to close the chamber, whereas prokaryotic chaperonins use a detachable lid. Here we determine the mechanism of lid closure in TRiC using single-particle cryo-EM and comparative protein modeling. Comparison of TRiC in its open, nucleotide-free, and closed, nucleotide-induced states reveals that the interdomain motions leading to lid closure in TRiC are radically different from those of prokaryotic chaperonins, despite their overall structural similarity. We propose that domain movements in TRiC are coordinated through unique interdomain contacts within each subunit and, further, these contacts are absent in prokaryotic chaperonins. Our findings show how different mechanical switches can evolve from a common structural framework through modification of allosteric networks.

  10. Crystal structure of nitridobis(tri-methyl-silanolato)[1,1,1-trimethyl-N-(tri-methyl-sil-yl)silanaminato]molybdenum(VI).

    PubMed

    Geng, Caiwei; Hao, Xiang; Jiao, Peng

    2015-12-01

    In the title compound, [Mo(C6H18NSi2)(C3H9OSi)2N], the Mo(VI) cation is located on a mirror plane and is coordinated by a nitride anion, a 1,1,1-trimethyl-N-(tri-methyl-sil-yl)silanaminate anion and two tri-methyl-silanolate anions in a distorted tetra-hedral geometry; the N atom and two Si atoms of the 1,1,1-trimethyl-N-(tri-methyl-sil-yl)silanaminato anionic ligand are also located on the mirror plane. The Mo N bond length of 1.633 (6) Å is much shorter than the Mo-N single-bond length of 1.934 (7) Å. No hydrogen bonding is observed in the crystal structure.

  11. Bronchial Challenge With Tri a 14 as an Alternative Diagnostic Test for Baker's Asthma.

    PubMed

    Armentia, A; Garrido-Arandia, M; Cubells-Baeza, N; Gómez-Casado, C; Díaz-Perales, A

    2015-01-01

    Baker's asthma (BA) is the most prevalent occupational respiratory disease in developed countries. It is caused by inhalation of wheat dust in the working environment and affects 1%-10% of workers in the baking industry. Diagnosis of BA is based on bronchial challenge with wheat, a technique that carries a high risk for patients. The wheat lipid transfer protein Tri a 14 is a major allergen in BA. The aim of our study was to characterize Tri a 14 as a marker of BA in order to prevent patients from having to undergo bronchial challenge with wheat. The study population comprised 55 patients selected at the Rio Hortega Hospital, Valladolid, Spain. Patients with BA were diagnosed using a skin prick test (SPT) with wheat and Tri a 14 and bronchial challenge test (BCT) with wheat. Patients with food allergy had a clear clinical history of allergy to peach confirmed by positive SPT to peach extract and Pru p 3. All patients in the BA group had a positive SPT result with wheat (100%), and most had positive results with Tri a 14 (95%). A positive BCT result with Tri a 14 was also observed in 22 of 27 of the patients with BA (82%). The response to Tri a 14 was specifically associated with BA. Tri a 14 is a good marker of BA and can be used in SPT and BCT as an alternative diagnostic method, thus avoiding bronchial challenge with wheat and reducing the risk associated with this technique.

  12. TriLoNet: Piecing Together Small Networks to Reconstruct Reticulate Evolutionary Histories.

    PubMed

    Oldman, James; Wu, Taoyang; van Iersel, Leo; Moulton, Vincent

    2016-08-01

    Phylogenetic networks are a generalization of evolutionary trees that can be used to represent reticulate processes such as hybridization and recombination. Here, we introduce a new approach called TriLoNet (Trinet Level- one Network algorithm) to construct such networks directly from sequence alignments which works by piecing together smaller phylogenetic networks. More specifically, using a bottom up approach similar to Neighbor-Joining, TriLoNet constructs level-1 networks (networks that are somewhat more general than trees) from smaller level-1 networks on three taxa. In simulations, we show that TriLoNet compares well with Lev1athan, a method for reconstructing level-1 networks from three-leaved trees. In particular, in simulations we find that Lev1athan tends to generate networks that overestimate the number of reticulate events as compared with those generated by TriLoNet. We also illustrate TriLoNet's applicability using simulated and real sequence data involving recombination, demonstrating that it has the potential to reconstruct informative reticulate evolutionary histories. TriLoNet has been implemented in JAVA and is freely available at https://www.uea.ac.uk/computing/TriLoNet. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. First-year college students' interest in trying dissolvable tobacco products.

    PubMed

    Wolfson, Mark; Pockey, Jessica R; Reboussin, Beth A; Sutfin, Erin L; Egan, Kathleen L; Wagoner, Kimberly G; Spangler, John G

    2014-01-01

    Dissolvable tobacco products (DTPs) have been introduced into test markets in the U.S. We sought to gauge the level of interest in trying these products and correlates of interest among potential consumers. A web-based survey of freshman at 11 universities in North Carolina and Virginia was conducted in fall 2010. Multivariable logistic regression analyses were used to identify correlates of students' likelihood to try DTPs if offered a free sample. Weighted prevalence of likelihood to try DTPs was 3.7%. Significant correlates of likelihood to try included male gender, current cigarette smoking, current snus use, sensation seeking, lifetime illicit drug use, and perceived health risk of using DTPs. Among current smokers, current snus use, current use of chewing tobacco, and considering quitting smoking were associated with likelihood to try DTPs. While overall interest in trying these products was low, current users of cigarettes and snus were much more likely than others in trying a free sample. Some current smokers may consider DTPs to be an aid to smoking cessation, although the population-level impact of introducing these products is unknown. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  14. Tri-allelic pattern at the TPOX locus: a familial study.

    PubMed

    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; Paskulin, Giorgio Adriano; Alvarez, Luís; Amorim, António; Batista Dos Santos, Sidney Emanuel; Alho, Clarice Sampaio

    2014-02-10

    Alleles at the TPOX STR locus have 6-14 different numbers of a four-nucleotide (AATG) repeat motif arranged in tandem. Although tri-allelic genotypes are generally rare, the TPOX tri-allelic pattern has a higher frequency, varying widely among populations. Despite this, there are few accurate reports to disclose the nature of the TPOX third allele. In this work we present data obtained from 45 individuals belonging to the same pedigree, in which there are cases of tri-allelic TPOX genotypes. The subjects were apparently healthy with a normal biological development. We noticed six tri-allelic cases in this family, and all of them were women. Karyotype analysis showed no occurrence of partial 2p trisomy. All the tri-allelic cases had the genotype 8-10-11, probably due to three copies of the TPOX STR sequence in all cells (Type 2 tri-allelic pattern). Based on previous data we assumed the allele 10 as the TPOX third allele. The pedigree analyses show evidences that the TPOX extra-allele was the allele10, it is placed far from the main TPOX locus, and that there is a potential linkage of the TPOX extra-allele-10 with Xq. This was the first study that included a large pedigree analysis in order to understand the nature TPOX tri-allelic pattern. © 2013.

  15. Color agreement between nanofluorapatite ceramic discs associated with try-in pastes and with resin cements.

    PubMed

    Rigoni, Paulo; Amaral, Flávia Lucisano Botelho do; França, Fabiana Mantovani Gomes; Basting, Roberta Tarkany

    2012-01-01

    The aim of this study was to evaluate the in vitro color agreement between nanofluorapatite ceramic discs (e.max Ceram / Ivoclar Vivadent / A2) associated with try-in pastes and those bonded with resin cements (Vitique / DMG/ try-in shade A2½ and cement shade A2½, Variolink II / Ivoclar Vivadent / try-in shade A1 and cement shade A1, and Choice 2 / Bisco / try-in shade A2 and cement shade A2), and to evaluate the shade stability of the discs bonded with resin cements. The shades of composite resin discs (Lliss / FGM / A2) and nanofluorapatite ceramic discs with try-in pastes or cements were evaluated according to the Vita Classical shade guide by a digital spectrophotometer (Micro EspectroShade, MHT) immediately after placing the try-in pastes or resin cements between composite resin discs and ceramic discs. Other evaluations were performed at 2, 5, and 6 day intervals after cementation with the resin cements. All ceramic discs that received try-in pastes presented an A2 shade. There was no statistical difference in the shade of the ceramic specimens fixed with different cements at the different intervals, as evaluated by the Friedman test (p > 0.05). Two try-in pastes presented shade compatibility with those recommended by the manufacturers. There was no similarity of shades between the ceramic discs with try-in pastes and those with the respective resin cements. Shade stability was observed in ceramic discs with resin cements within the intervals evaluated.

  16. Various notions of positivity for bi-linear maps and applications to tri-partite entanglement

    SciTech Connect

    Han, Kyung Hoon; Kye, Seung-Hyeok

    2016-01-15

    We consider bi-linear analogues of s-positivity for linear maps. The dual objects of these notions can be described in terms of Schmidt ranks for tri-tensor products and Schmidt numbers for tri-partite quantum states. These tri-partite versions of Schmidt numbers cover various kinds of bi-separability, and so we may interpret witnesses for those in terms of bi-linear maps. We give concrete examples of witnesses for various kinds of three qubit entanglement.

  17. The effects of advice and "try more" instructions on improving realism of confidence.

    PubMed

    Buratti, Sandra; Allwood, Carl Martin

    2013-09-01

    This study investigated whether participants can improve the accuracy of their confidence judgments by making second-order judgments, and whether advice (attend both to correct and incorrect items and consider the remember/know quality of the item), and "try more" instructions can help increase participants' accuracy. The participants (n=220) made confidence judgments of their answers to 50 recall questions on a video clip. Next, all the participants were asked to try to increase the accuracy of their confidence judgments by modifying those they believed showed poor realism. Although the participants did increase the accuracy of their confidence judgments, neither the advice nor the "try more" instructions improved their accuracy.

  18. Apolar distal pocket mutants of yeast cytochrome c peroxidase: Binding of imidazole, 1-methylimidazole and 4-nitroimidazole to the triAla, triVal, and triLeu variants.

    PubMed

    Bidwai, Anil; Ayala, Caitlan; Vitello, Lidia B; Erman, James E

    2015-08-01

    Imidazole binding to three apolar distal heme pocket mutants of yeast cytochrome c peroxidase (CcP) has been investigated between pH4 and 8. The three CcP variants have Arg-48, Trp-51, and His-52 mutated to either all alanine, CcP(triAla), all valine, CcP(triVal), or all leucine residues, CcP(triLeu). The imidazole binding curves for all three mutants are biphasic indicating that each of the mutants exists in at least two conformational states with different affinities for imidazole. At pH7, the high-affinity conformations of the three CcP mutants bind imidazole between 3.8 and 4.7 orders of magnitude stronger than that of wild-type CcP while the low-affinity conformations have binding affinities about 2.5 orders of magnitude larger than wild-type CcP. Imidazole binding to the three CcP mutants is pH dependent with the strongest binding observed at high pH. Apparent pK(a) values for the transition in binding vary between 5.6 and 7.5 for the high-affinity conformations and between 6.2 and 6.8 for the low-affinity conformations of the CcP triple mutants. The kinetics of imidazole binding are also biphasic. The fast phase of imidazole binding to CcP(triAla) and CcP(triLeu) is linearly dependent on the imidazole concentration while the slow phase is independent of imidazole concentration. Both phases of imidazole binding to CcP(triVal) have a hyperbolic dependence on the imidazole concentration. The apparent association rate constants vary between 30 and 170 M(-1)s(-1) while the apparent dissociation rate constants vary between 0.05 and 0.43 s(-1). The CcP triple mutants have higher binding affinities for 1-methylimidazole and 4-nitroimidazole than does wild-type CcP.

  19. Lithium cell technology and safety report of the Tri-Service Lithium Safety Committee

    NASA Technical Reports Server (NTRS)

    Reiss, E.

    1980-01-01

    The organization of the Tri-Service Lithium Safety Committee is described. The following areas concerning lithium batteries are discussed: transportation--DOT Exemption 7052, FAA; disposal; storage; individual testing/test results; and battery design and usage.

  20. The Effects of Bis(tri-n-butyltin) Oxide on Three Species of Marine Phytoplankton.

    DTIC Science & Technology

    1985-05-01

    Dunaliella sp. (Division Chlorophyta ), and Phaeodac- tylum tricornutum (Division Bacillariophyta) - were exposed to each of three concentrations of TBTO...used in this study were Gymnodinium splendens (Division Pyrrophyta), Dunaliella sp. (Division Chlorophyta ), and Phaeodactylum tri- cornutum (Division

  1. TRI as a Tool to Measure Green Chemistry Progress: A Pharmaceutical Case Study

    EPA Pesticide Factsheets

    Presentation of research using TRI data to investigate whether the pharmaceutical industry's implementation of green chemistry practices in manufacturing processes have significantly reduced the quantities of toxic chemicals it uses and releases.

  2. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... provisions of this section. (a) The additive is applied to the surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate...

  3. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in contact...

  4. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in contact...

  5. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in contact...

  6. Spin and valley resolved Landau level crossing in tri-layer ABA stacked graphene

    NASA Astrophysics Data System (ADS)

    Datta, Biswajit; Gupta, Vishakha; Borah, Abhinandan; Watanabe, Kenji; Taniguchi, Takashi; Deshmukh, Mandar

    We present quantum Hall measurements on a high quality encapsulated tri-layer graphene device. Low temperature field effect mobility of this device is around 500,000 cm2/Vs and we see SdH oscillations at a magnetic field as low as 0.3 T. Quantum Hall measurements confirm that the chosen tri layer graphene is Bernal (ABA) stacked. Due to the presence of both mass-less monolayer like Dirac fermions and massive bi-layer like Dirac fermions in Bernal stacked tri-layer graphene, there are Landau level crossings between monolayer and bi-layer bands in quantum Hall regime. Although most of the Landau Level crossings are predominantly present on the electron sides, we also observe signatures of the crossings on the hole side. This behaviour is consistent with the asymmetry of electron and hole in ABA tri-layer graphene. We observe a series of crossings of the spin and valley resolved Landau Levels.

  7. Fabrication of Tri-axially Oriented RE-Ba-Cu-O Ceramics by Magnetic Alignment

    NASA Astrophysics Data System (ADS)

    Yamaki, M.; Furuta, M.; Doi, T.; Shimoyama, J.; Horii, S.

    Magnetic alignment is a new crystal alignment process which enables tri-axial orientation without epitaxial growth at room temperature. In order to investigate the effectiveness of this magnetic tri-axial alignment process, we attempted to fabricate tri-axially oriented ErBa2Cu4O8 (Er124) ceramics by a slip-casting technique under two different modulated rotation magnetic fields (MRFs); uni-directional rotation type and oscillation type. For improvement of the degrees of tri-axial orientation in the Er124 green compacts slip-casted under MRFs, appropriate choice of sample-rotation method, magnetic field condition, control of mean diameter of source powders, and viscosity of slurry was found to be important in the case of MRFs induced by the sample-rotation. At the current stage, the degree of inplane orientation with ∼10̊ in Er124 was achieved.

  8. VizieR Online Data Catalog: Differential light curves of TV Tri (Yang+, 2009)

    NASA Astrophysics Data System (ADS)

    Yang, Y.-G.; Wei, J.-Y.

    2011-09-01

    CCD observations of RV Tri were carried out in 2007 November 28-30, using the 85 cm telescope at the Xinglong Station of National Astronomical Observatories of the Chinese Academy of Sciences. (3 data files).

  9. TRI Analysis of Community-Scale Pollution Prevention Activities: North Birmingham, Alabama (PDF)

    EPA Pesticide Factsheets

    This analysis compared TRI data about pollution prevention and waste management activities from facilities located in North Birmingham with facilities in the same industry sectors that are located elsewhere in the country.

  10. TRI Community Engagement: Four New EPA Pilot Projects Challenge Us to Communicate More Effectively with Communities

    EPA Pesticide Factsheets

    Overview of pilot projects conducted to test new approaches for raising awareness about TRI at the community level, including discussion of the results, lessons learned, and responses from communities

  11. Using the TRI Pollution Prevention Tool to Compare Facilities and Identify Sustainable Practices

    EPA Pesticide Factsheets

    Discussion and demonstration of how TRI tools can be used to identify reported pollution prevention (P2) achievements, and highlights of the P2 stories from companies that have led the way in implementing and reporting P2.

  12. Workshop: Community-Based Research on TRI Exposure Risks using Online Environmental Geographic Information Systems (GIS)

    EPA Pesticide Factsheets

    Presentation to introduce community stakeholders to GIS mapping-supported environmental websites and tutorials designed to help users access geospatial, TRI, and other community exposure risk data from each site.

  13. The quantity and quality of physical activity among those trying to lose weight.

    PubMed

    Gordon, P M; Heath, G W; Holmes, A; Christy, D

    2000-01-01

    Regular exercise to elicit caloric expenditure is an important component for achieving weight loss. The Healthy People 2000 objectives recommend regular sustained physical activity lasting 30 minutes, five days per week (Objective 1.3) particularly for weight loss. Moreover, this recommendation has been restated for weight loss and overall health benefits in the Centers for Disease Control and Prevention / American College of Sports Medicine (CDC/ACSM) statement and Surgeon General's Report (SGR) on Physical ActivitY and Health. Thus, we sought to identify the relative quality, and quantity of physical activity among people trying to lose weight. Cross-sectional self-reported data from the West Virginia Behavioral Risk Factor Surveillance System (BRFSS) were used. The BRFSS is a state-based telephone survey of adults that uses a multistage cluster design based on the Waksberg method of random-digit dialing. Data froM 2769 men and 4490 women were obtained from the 1992, 1994, and 1996 surveys. Half (49.6%) of individuals trying to lose weight did not engage in any physical activity. Further, only 15% of respondents trying to lose weight reported exercising regularly. Nevertheless, those trying to lose weight were more likely (OR [odds ratio] = 1.3; 95% CI [confidence interval], 1.14, 1.51, p < 0.001) to exercise regularly than those not trying to lose weight. In particular, women trying to lose weight were significantly more likely (OR = 1.45; 95% CI, 1.22,1.74, p < 0.001) to exercise regularly than women not trying to lose weight. Conversely, men trying to lose weight were no more likely to exercise regularly (p = .23) than men not trying to lose weight. Among respondents who were using exercise for weight loss, only 14.7% were expending > or =1000 kcal/week and 18.2% were expending > or =500 kcal/week. Weekly expenditure rates of > or =1000 kcal/week were more likely to occur among men (17%) than women (13.8%), in younger age groups, and among those with higher

  14. Dynamic Self-Assembly Encodes A Tri-stable Au-TiO2 Photocatalyst.

    PubMed

    Zhang, Qi; Wang, Wen-Zhi; Yu, Jing-Jing; Qu, Da-Hui; Tian, He

    2017-02-01

    A tri-stable switchable catalyst is encoded by pH-controlled dynamic self-assembly of gold and TiO2 nanoparticles (NPs). Through precise adjustment of the integrated dynamic covalent and noncovalent self-assembly process of the two types of nanoparticles, the photocatalytic activity of the hybrid system is modulated by switching pH conditions between tri-stable "highly active", "active", and "inactive" states.

  15. Tri-Services Coordinated Care (TRICARE) A Study of Change Management.

    DTIC Science & Technology

    1993-12-01

    TITLE AND SUBTITLE TRI-SERVICES COORDINATED CARE 5. FUNDING NUMBERS (TRICARE): A STUDY OF CHANGE MANAGEMENT 6. AUTHOR(S) LT Man K. Dyson 7...unlimited. Tri-Services Coordinated Care (TRICARE) A Study of Change Management by Mari K. Dyson Lieutenant, United States Navy B.S.B.A., Robert Morris...command archives. This data was studied using qualitative methods of analysis as well as organizational change management models. C. BACKGROUND The cost

  16. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    SciTech Connect

    Garvey, Graeme S.; McCormick, Susan P.; Alexander, Nancy J.; Rayment, Ivan

    2009-08-14

    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the 'in vivo' characterization of Deltatri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified.

  17. TRiM: an organizational response to traumatic events in Cumbria Constabulary.

    PubMed

    Hunt, E; Jones, N; Hastings, V; Greenberg, N

    2013-12-01

    A major incident involving multiple fatalities occurred in Cumbria, England on 2 June 2010. The Cumbrian Constabulary deployed an organizational peer support response for personnel involved known as trauma risk management (TRiM). To examine data routinely gathered during the TRiM process to evaluate the relationship of the intervention to sickness absence. Using incident databases, details were gathered regarding exposure to the murders and type of TRiM intervention, including an assessment of the psychological risk to the individual of developing a trauma-related mental health problem. Sociodemographic information was collated by the occupational health department. Cumulative sickness absence data in the 2 months following the murders were used as a proxy for mental health status. A total of 717 police officers and civilian support staff were identified. High levels of traumatic exposure were associated with subsequent receipt of a TRiM intervention. The majority of psychological risk indices reduced between the initial and subsequent evaluation. Greater traumatic exposure was associated with longer sickness absence lengths. Engagement in the TRiM process was associated with a reduction in sickness absence especially in more junior ranks. In this study, we found that TRiM deployed within a police force responding to a major event offered a way of structuring a response for those involved. Our data suggest that TRiM may offer a way of assessing psychological risk so that officers can be offered early supportive interventions. Our data suggest that TRiM may help to ameliorate some of the negative effects of high trauma exposure.

  18. Tri-s-triazine-Based Crystalline Carbon Nitride Nanosheets for an Improved Hydrogen Evolution.

    PubMed

    Ou, Honghui; Lin, Lihua; Zheng, Yun; Yang, Pengju; Fang, Yuanxing; Wang, Xinchen

    2017-06-01

    Tri-s-triazine-based crystalline carbon nitride nanosheets (CCNNSs) have been successfully extracted via a conventional and cost-effective sonication-centrifugation process. These CCNNSs possess a highly defined and unambiguous structure with minimal thickness, large aspect ratios, homogeneous tri-s-triazine-based units, and high crystallinity. These tri-s-triazine-based CCNNSs show significantly enhanced photocatalytic hydrogen generation activity under visible light than g-C3 N4 , poly (triazine imide)/Li(+) Cl(-) , and bulk tri-s-triazine-based crystalline carbon nitrides. A highly apparent quantum efficiency of 8.57% at 420 nm for hydrogen production from aqueous methanol feedstock can be achieved from tri-s-triazine-based CCNNSs, exceeding most of the reported carbon nitride nanosheets. Benefiting from the inherent structure of 2D crystals, the ultrathin tri-s-triazine-based CCNNSs provide a broad range of application prospects in the fields of bioimaging, and energy storage and conversion. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Colour matching of composite resin cements with their corresponding try-in pastes.

    PubMed

    Kampouropoulos, D; Gaintantzopoulou, M; Papazoglou, E; Kakaboura, A

    2014-06-01

    Two shades of four resin cements (Calibra, Clearfil Esthetic, Insure, Variolink II), in light- and dual-curing modes, were tested for colour matching with their corresponding try-in pastes, immediately after photopolymerization and after 24-hour dry and dark storage. Colour measurements were performed for 0.8 mm-thick specimens through a 0.8mm-thick ceramic plate. For each resin cement, colour differences (deltaE) were calculated between the two curing modes, and between the corresponding try-in paste, at baseline and after 24h. deltaE>0 values were detected between all resin cements and their try-in pastes, which were brand/shade/curing mode depended. The try-in pastes of the Variolink II system demonstrated the best colour matching (deltaE<2). Try-in pastes of Calibra and Insure, at both curing modes, did not match at an acceptable value, the shade of their corresponding resin cements (deltaE>3.3). Calibra presented the highest colour differences. deltaE values of the Clearfil Esthetic system immediately after photo-activation ranged between 2 and 3 units. A ceramic restoration may fail aesthetically as a result of not acceptable colour match (deltaE>3.3) between the shade of certain resin cements and their relevant try-in pastes.

  20. Tri-Squared Mean Cross Comparative Analysis: An Advanced Post Hoc Qualitative and Quantitative Metric for a More In-Depth Examination of the Initial Research Outcomes of the Tri-Square Test

    ERIC Educational Resources Information Center

    Osler, James Edward

    2013-01-01

    This monograph provides an epistemological rational for the design of an advanced novel analysis metric. The metric is designed to analyze the outcomes of the Tri-Squared Test. This methodology is referred to as: "Tri-Squared Mean Cross Comparative Analysis" (given the acronym TSMCCA). Tri-Squared Mean Cross Comparative Analysis involves…

  1. Tri-Gas Pressurization System Testing and Modeling for Cryogenic Applications

    NASA Technical Reports Server (NTRS)

    Taylor, B.; Polsgrove, R.; Stephens, J.; Hedayat, A.

    2014-01-01

    The use of Tri-gas in rocket propulsion systems is somewhat of a new technology. This paper defines Tri-gas as a mixture of gases composed largely of helium with a small percentage of a stoichiometric mixture of hydrogen and oxygen. When exposed to a catalyst the hydrogen and oxygen in the mixture combusts, significantly raising the temperature of the mixture. The increase in enthalpy resulting from the combustion process significantly decreases the required quantity of gas needed to pressurize the ullage of the vehicle propellant tanks. The objective of this effort was to better understand the operating characteristics of Tri-gas in a pressurization system with low temperature applications. In conjunction with ongoing programs at NASA Marshall Space Flight Center, an effort has been undertaken to evaluate the operating characteristics of Tri-gas through modeling and bench testing. Through improved understanding of the operating characteristics, the risk of using this new technology in a launch vehicle propulsion system was reduced. Bench testing of Tri-gas was a multistep process that targeted gas characteristics and performance aspects that pose a risk to application in a pressurization system. Pressurization systems are vital to propulsion system performance. Keeping a target ullage pressure in propulsions tanks is necessary to supply propellant at the conditions and flow rates required to maintain desired engine functionality. The first component of testing consisted of sampling Tri-gas sources that had been stagnant for various lengths of time in order to determine the rate at which stratification takes place. Second, a bench test was set up in which Tri-gas was sent through a catalyst bed. This test was designed to evaluate the performance characteristics of Tri-gas, under low temperature inlet temperatures, in a flight-like catalyst bed reactor. The third, most complex, test examined the performance characteristics of Tri-gas at low temperature temperatures

  2. 78 FR 12716 - Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri-Cities, Tennessee...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-02-25

    ... Foreign-Trade Zones Board Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri... reorganization of general-purpose zones; Whereas, the Tri-Cities Airport Commission, grantee of Foreign- Trade... adjacent to the Tri-Cities Customs and Border Protection port of entry. FTZ 204's Sites 1 through 9 and 11...

  3. 77 FR 17408 - Foreign-Trade Zone 204-Tri-Cities Area, TN/VA; Application for Reorganization Under Alternative...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-03-26

    ... Foreign-Trade Zones Board Foreign-Trade Zone 204--Tri-Cities Area, TN/VA; Application for Reorganization...) Board (the Board) by the Tri-Cities Airport Commission, grantee of FTZ 204, requesting authority to.../30/15)--Tri-Cities Regional Airport complex, 2525 Highway 75, Blountville, Sullivan County, TN; Site...

  4. 75 FR 38979 - Expansion/Reorganization of Foreign-Trade Zone 204, Tri-Cities Area, TN/VA

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-07-07

    ... Foreign-Trade Zones Board Expansion/Reorganization of Foreign-Trade Zone 204, Tri-Cities Area, TN/VA...), the Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas, the Tri-Cities Airport... FTZ 204 to include a site in Bristol, Tennessee, adjacent to the Tri-Cities Customs and Border...

  5. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Federal Implementation Plan for Tri... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River Pima... the Tri-Cities landfill located on the Salt River Pima-Maricopa Indian Community near Phoenix, Arizona...

  6. 75 FR 65705 - Notice of Intent To Rule on Request To Release Airport Property at the Tri-Cities Regional...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-26

    ... Federal Aviation Administration Notice of Intent To Rule on Request To Release Airport Property at the Tri... the release of land at the Tri-Cities Regional Airport in the city of Blountville, Tennessee. This... 26, 2010. ADDRESSES: Documents are available for review at the Tri-Cities Regional Airport, 2525...

  7. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 33 Navigation and Navigable Waters 2 2012-07-01 2012-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR... directions, and within 140 feet, in all directions, of the TriMet bridge construction cranes. (b) Regulation...

  8. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 33 Navigation and Navigable Waters 2 2014-07-01 2014-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR... directions, and within 140 feet, in all directions, of the TriMet bridge construction cranes. (b) Regulation...

  9. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 33 Navigation and Navigable Waters 2 2013-07-01 2013-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR... directions, and within 140 feet, in all directions, of the TriMet bridge construction cranes. (b) Regulation...

  10. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 29 2013-07-01 2013-07-01 false Must I try to recover my costs from... Reimbursed § 310.14 Must I try to recover my costs from those potentially responsible for the emergency? Yes. Before applying for reimbursement from EPA, you must try to recover your costs from all known...

  11. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 29 2012-07-01 2012-07-01 false Must I try to recover my costs from... Reimbursed § 310.14 Must I try to recover my costs from those potentially responsible for the emergency? Yes. Before applying for reimbursement from EPA, you must try to recover your costs from all known...

  12. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Must I try to recover my costs from... Reimbursed § 310.14 Must I try to recover my costs from those potentially responsible for the emergency? Yes. Before applying for reimbursement from EPA, you must try to recover your costs from all known...

  13. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 28 2011-07-01 2011-07-01 false Must I try to recover my costs from... Reimbursed § 310.14 Must I try to recover my costs from those potentially responsible for the emergency? Yes. Before applying for reimbursement from EPA, you must try to recover your costs from all known...

  14. 40 CFR 310.14 - Must I try to recover my costs from those potentially responsible for the emergency?

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 28 2014-07-01 2014-07-01 false Must I try to recover my costs from... Reimbursed § 310.14 Must I try to recover my costs from those potentially responsible for the emergency? Yes. Before applying for reimbursement from EPA, you must try to recover your costs from all known...

  15. Dual-/tri-apodization techniques for high frequency ultrasound imaging: a simulation study.

    PubMed

    Sung, Jin Ho; Jeong, Jong Seob

    2014-10-11

    In the ultrasound B-mode (Brightness-mode) imaging, high side-lobe level reduces contrast to noise ratio (CNR). A linear apodization scheme by using the window function can suppress the side-lobe level while the main-lobe width is increased resulting in degraded lateral resolution. In order to reduce the side-lobe level without sacrificing the main-lobe width, a non-linear apodization method has been suggested. In this paper, we computationally evaluated the performance of the non-linear apodization method such as dual-/tri-apodization focusing on the high frequency ultrasound image. The rectangular, Dolph-Chebyshev, and Kaiser window functions were employed to implement dual-/tri-apodization algorithms. The point and cyst target simulations were conducted by using a dedicated ultrasound simulation tool called Field-II. The center frequency of the simulated linear array transducer was 40 MHz and the total number of elements was 128. The performance of dual-/tri-apodization was compared with that of the rectangular window function focusing on the side-lobe level and the main-lobe widths (at -6 dB and -35 dB). In the point target simulation, the main-lobe widths of the dual-/tri-apodization were very similar to that of the rectangular window, and the side-lobe levels of the dual-/tri-apodization were more suppressed by 9~10 dB. In the cyst target simulation, CNR values of the dual-/tri-apodization were improved by 41% and 51%, respectively. The performance of the non-linear apodization was numerically investigated. In comparison with the rectangular window function, the non-linear apodization method such as dual- and tri-apodization had low side-lobe level without sacrificing the main-lobe width. Thus, it can be a potential way to increase CNR maintaining the main-lobe width in the high frequency ultrasound imaging.

  16. Tri-party agreement databases, access mechanism and procedures. Revision 2

    SciTech Connect

    Brulotte, P.J.

    1996-01-01

    This document contains the information required for the Washington State Department of Ecology (Ecology) and the U.S. Environmental Protection Agency (EPA) to access databases related to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement). It identifies the procedure required to obtain access to the Hanford Site computer networks and the Tri-Party Agreement related databases. It addresses security requirements, access methods, database availability dates, database access procedures, and the minimum computer hardware and software configurations required to operate within the Hanford Site networks. This document supersedes any previous agreements including the Administrative Agreement to Provide Computer Access to U.S. Environmental Protection Agency (EPA) and the Administrative Agreement to Provide Computer Access to Washington State Department of Ecology (Ecology), agreements that were signed by the U.S. Department of Energy (DOE), Richland Operations Office (RL) in June 1990, Access approval to EPA and Ecology is extended by RL to include all Tri-Party Agreement relevant databases named in this document via the documented access method and date. Access to databases and systems not listed in this document will be granted as determined necessary and negotiated among Ecology, EPA, and RL through the Tri-Party Agreement Project Managers. The Tri-Party Agreement Project Managers are the primary points of contact for all activities to be carried out under the Tri-Party Agreement. Action Plan. Access to the Tri-Party Agreement related databases and systems does not provide or imply any ownership on behalf of Ecology or EPA whether public or private of either the database or the system. Access to identified systems and databases does not include access to network/system administrative control information, network maps, etc.

  17. TriAnnot: A Versatile and High Performance Pipeline for the Automated Annotation of Plant Genomes

    PubMed Central

    Leroy, Philippe; Guilhot, Nicolas; Sakai, Hiroaki; Bernard, Aurélien; Choulet, Frédéric; Theil, Sébastien; Reboux, Sébastien; Amano, Naoki; Flutre, Timothée; Pelegrin, Céline; Ohyanagi, Hajime; Seidel, Michael; Giacomoni, Franck; Reichstadt, Mathieu; Alaux, Michael; Gicquello, Emmanuelle; Legeai, Fabrice; Cerutti, Lorenzo; Numa, Hisataka; Tanaka, Tsuyoshi; Mayer, Klaus; Itoh, Takeshi; Quesneville, Hadi; Feuillet, Catherine

    2012-01-01

    In support of the international effort to obtain a reference sequence of the bread wheat genome and to provide plant communities dealing with large and complex genomes with a versatile, easy-to-use online automated tool for annotation, we have developed the TriAnnot pipeline. Its modular architecture allows for the annotation and masking of transposable elements, the structural, and functional annotation of protein-coding genes with an evidence-based quality indexing, and the identification of conserved non-coding sequences and molecular markers. The TriAnnot pipeline is parallelized on a 712 CPU computing cluster that can run a 1-Gb sequence annotation in less than 5 days. It is accessible through a web interface for small scale analyses or through a server for large scale annotations. The performance of TriAnnot was evaluated in terms of sensitivity, specificity, and general fitness using curated reference sequence sets from rice and wheat. In less than 8 h, TriAnnot was able to predict more than 83% of the 3,748 CDS from rice chromosome 1 with a fitness of 67.4%. On a set of 12 reference Mb-sized contigs from wheat chromosome 3B, TriAnnot predicted and annotated 93.3% of the genes among which 54% were perfectly identified in accordance with the reference annotation. It also allowed the curation of 12 genes based on new biological evidences, increasing the percentage of perfect gene prediction to 63%. TriAnnot systematically showed a higher fitness than other annotation pipelines that are not improved for wheat. As it is easily adaptable to the annotation of other plant genomes, TriAnnot should become a useful resource for the annotation of large and complex genomes in the future. PMID:22645565

  18. TRY-5 Is a Sperm-Activating Protease in Caenorhabditis elegans Seminal Fluid

    PubMed Central

    Smith, Joseph R.; Stanfield, Gillian M.

    2011-01-01

    Seminal fluid proteins have been shown to play important roles in male reproductive success, but the mechanisms for this regulation remain largely unknown. In Caenorhabditis elegans, sperm differentiate from immature spermatids into mature, motile spermatozoa during a process termed sperm activation. For C. elegans males, sperm activation occurs during insemination of the hermaphrodite and is thought to be mediated by seminal fluid, but the molecular nature of this activity has not been previously identified. Here we show that TRY-5 is a seminal fluid protease that is required in C. elegans for male-mediated sperm activation. We observed that TRY-5::GFP is expressed in the male somatic gonad and is transferred along with sperm to hermaphrodites during mating. In the absence of TRY-5, male seminal fluid loses its potency to transactivate hermaphrodite sperm. However, TRY-5 is not required for either hermaphrodite or male fertility, suggesting that hermaphrodite sperm are normally activated by a distinct hermaphrodite-specific activator to which male sperm are also competent to respond. Within males, TRY-5::GFP localization within the seminal vesicle is antagonized by the protease inhibitor SWM-1. Together, these data suggest that TRY-5 functions as an extracellular activator of C. elegans sperm. The presence of TRY-5 within the seminal fluid couples the timing of sperm activation to that of transfer of sperm into the hermaphrodite uterus, where motility must be rapidly acquired. Our results provide insight into how C. elegans has adopted sex-specific regulation of sperm motility to accommodate its male-hermaphrodite mode of reproduction. PMID:22125495

  19. TRY-5 is a sperm-activating protease in Caenorhabditis elegans seminal fluid.

    PubMed

    Smith, Joseph R; Stanfield, Gillian M

    2011-11-01

    Seminal fluid proteins have been shown to play important roles in male reproductive success, but the mechanisms for this regulation remain largely unknown. In Caenorhabditis elegans, sperm differentiate from immature spermatids into mature, motile spermatozoa during a process termed sperm activation. For C. elegans males, sperm activation occurs during insemination of the hermaphrodite and is thought to be mediated by seminal fluid, but the molecular nature of this activity has not been previously identified. Here we show that TRY-5 is a seminal fluid protease that is required in C. elegans for male-mediated sperm activation. We observed that TRY-5::GFP is expressed in the male somatic gonad and is transferred along with sperm to hermaphrodites during mating. In the absence of TRY-5, male seminal fluid loses its potency to transactivate hermaphrodite sperm. However, TRY-5 is not required for either hermaphrodite or male fertility, suggesting that hermaphrodite sperm are normally activated by a distinct hermaphrodite-specific activator to which male sperm are also competent to respond. Within males, TRY-5::GFP localization within the seminal vesicle is antagonized by the protease inhibitor SWM-1. Together, these data suggest that TRY-5 functions as an extracellular activator of C. elegans sperm. The presence of TRY-5 within the seminal fluid couples the timing of sperm activation to that of transfer of sperm into the hermaphrodite uterus, where motility must be rapidly acquired. Our results provide insight into how C. elegans has adopted sex-specific regulation of sperm motility to accommodate its male-hermaphrodite mode of reproduction.

  20. Intramolecular C-arylation of 2,3,5-tri-O-benzyl- and 2,3,5-tri-O-(3-methylbenzyl)-pentofuranose derivatives.

    PubMed

    Martin, O R

    1987-12-31

    Upon treatment with tin(IV) chloride, 1-O-acetyl-2,3,5-tri-O-benzyl- and 1-O-acetyl-2,3,5-tri-O-(3-methylbenzyl)pentofuranose (D-ribo, L-arabino) undergo intramolecular Friedel-Crafts alkylation of the aromatic substituent at O-2 to give unusual internal C-glycosyl compounds (isochroman derivatives) in high yield. The final products are also partially debenzylated at O-3 or O-5 (up to 25%) under these conditions. By contrast, the corresponding methyl glycosides are poor substrates for the intramolecular C-arylation reaction, as methyl 2,3,5-tri-O-(3-methylbenzyl)-beta-D-ribofuranoside was found to give preponderantly methyl 3,5-di-O-(3-methylbenzyl)-alpha-D-ribofuranoside (11) (49%), and the C-arylation product in 30% yield only in the presence of the same Lewis acid. The competitive formation of 11 is thought to be due to the anomerization of the substrate leading to a tin(IV) complex coordinated with O-1 and O-2, which promoted the cleavage of the benzyl group at O-2. These reactions provide a novel and efficient C-arylation method and suggest a new approach to selectively protected D-ribofuranose derivatives. Evidence for the uncommon C-arylated structure of the new products was gained from their 1H- and 13C(APT)-n.m.r. spectra.

  1. Radiation measurement platform for balloon flights based on the TriTel silicon detector telescope

    NASA Astrophysics Data System (ADS)

    Zabori, Balazs; Hirn, Attila; Pazmandi, Tamas; Apathy, Istvan; Szanto, Peter; Deme, Sandor

    Several measurements have been performed on the cosmic radiation field from the surface of the Earth up to the maximum altitudes of research airplanes. However the cosmic radiation field is not well known between 15 km and 30 km. Our experiment idea based on to study the radiation environment in the stratosphere. The main technical goals of our experiment were to test at first time the TriTel 3D silicon detector telescope system for future ISS missons and to develop a balloon technology platform for advanced cosmic radiation and dosimetric measurements. The main scientific goals were to give an assessment of the cosmic radiation field at the altitude of the BEXUS balloons, to use the TriTel system to determine dosimetric and radiation quantities during the ballon flight and to intercompare the TriTel and Pille results to provide a correction factor definition method for the Pille ISS measurements. To fulfil the scientific and technological objectives several different dosimeter systems were included in the experiment: an advanced version of the TriTel silicon detector telescope, Geiger-Müller counters, Pille passive thermoluminescent dosimeters and Solid State Nuclear Track Detectors. The experiment was built by students from Hungarian universities and flew on board the BEXUS stratospheric balloon in Northern Sweden (from ESRANGE Space Center). The float altitude was approximately 28.6 km and the total flight time was about 4 hours. The active instruments measured in real time and the ground team received the collected data continuously during the mission. The main technical goals were received since the operation of the TriTel experienced no failures and the experiment worked as it expected. This paper presents the scientific goals and results. From the TriTel measurements the deposited energy spectra, the Linear Energy Transfer spectra, the average quality factor of the cosmic radiation as well as the absorbed dose and the dose equivalent were determined for the

  2. Acute and sub-chronic toxicity of Tri-sa-maw recipe in rats.

    PubMed

    Nanna, Urarat; Jaijoy, Kanjana; Lertprasertsuke, Nirush; Soonthornchareonnon, Noppamas; Sireeratawong, Seewaboon

    2015-03-01

    Tri-sa-maw recipe is a botanical preparation comprised of equal proportions ofthe three herbalfruits, namely Terminalia chebula Retz., Tenninalia sp. and Terminalia bellirica Roxb. This recipe is used for antipyretic, expectorant, periodic maintenance, and relieving stomach tight. To evaluate the acute and sub-chronic toxicities of Tri-sa-maw recipe extract in rats. In the present study of acute toxicity, a single oral dose 5,000 mg/kg of Tri-sa-maw recipe extract was administered to rats. Sub-chronic toxicity was studied by the daily oral administration ofthe extract at the doses of 600, 1,200 and 2,400 mg/kg body weight for consecutive 90 days. Tri-sa-maw recipe extract at the dose of 5,000 mg/kg showed no signs of differences as compared to the control rat. No abnormalities were found in the sub-chronic toxicity study; none of the parametersfor body and organ weights, hematol- ogy, blood chemistry, necropsy, and histopathology showed any differences between the control and all treatment groups. Tri-sa-maw recipe extract did not significantly cause acute toxicity or sub-chronic toxicity in rats.

  3. Effect of Tri-sa-maw recipe on gastrointestinal regulation and motility. .

    PubMed

    Wannasiri, Supaporn; Jaijoy, Kanjana; Chiranthanut, Natthakarn; Soonthornchareonnon, Noppamas; Sireeratawong, Seewaboon

    2015-03-01

    Tri-sa-maw recipe is comprised ofequal proportions of three herbal fruits, including Terminalia chebula Retz., Terminalia sp. and Terminalia bellirica Roxb. The traditional use of this recipe has been reported as a medication for fever; expectorant, relief of tightness in the stomach, laxative and antidiarrheal agent. To study the effects of Tri-sa-maw recipe extract on gastrointestinal tract in both in vitro and in vivo. Gastrointestinal effect of Tri-sa-maw recipe was studied by using two in vivo models (gastric emptying, gastrointestinal transit) and in vitro isolated guinea pig ileum experiment. Tri-sa-maw recipe showed both stimulatory and inhibitory effects on the stomach function. Not only did the extract at the dose of 1,000 mg/kg inhibit the gastric emptying time, but also stimulate the movement of the digestive tract by increasing the mobility of charcoal. In the isolated guinea pig ileum experiment, the extract at low concentration (0.1 ng/mL) induced the contraction of isolated guinea pig ileum. However the stimulation effect on contractions of isolated guineapig ileum was very much decreased at the high concentration (0.2-1 ng/mL) of the extract. The findings of this study support to traditional uses of Tri-sa-maw recipe as a laxative and antidiarrheal agent.

  4. Molecular architecture of the human U4/U6.U5 tri-snRNP.

    PubMed

    Agafonov, Dmitry E; Kastner, Berthold; Dybkov, Olexandr; Hofele, Romina V; Liu, Wen-Ti; Urlaub, Henning; Lührmann, Reinhard; Stark, Holger

    2016-03-25

    The U4/U6.U5 triple small nuclear ribonucleoprotein (tri-snRNP) is a major spliceosome building block. We obtained a three-dimensional structure of the 1.8-megadalton human tri-snRNP at a resolution of 7 angstroms using single-particle cryo-electron microscopy (cryo-EM). We fit all known high-resolution structures of tri-snRNP components into the EM density map and validated them by protein cross-linking. Our model reveals how the spatial organization of Brr2 RNA helicase prevents premature U4/U6 RNA unwinding in isolated human tri-snRNPs and how the ubiquitin C-terminal hydrolase-like protein Sad1 likely tethers the helicase Brr2 to its preactivation position. Comparison of our model with cryo-EM three-dimensional structures of the Saccharomyces cerevisiae tri-snRNP and Schizosaccharomyces pombe spliceosome indicates that Brr2 undergoes a marked conformational change during spliceosome activation, and that the scaffolding protein Prp8 is also rearranged to accommodate the spliceosome's catalytic RNA network. Copyright © 2016, American Association for the Advancement of Science.

  5. The Impact of Trying Electronic Cigarettes on Cigarette Smoking by College Students: A Prospective Analysis

    PubMed Central

    Reboussin, Beth A; Debinski, Beata; Wagoner, Kimberly G.; Spangler, John; Wolfson, Mark

    2015-01-01

    Objectives. We assessed the impact of trying electronic cigarettes (e-cigarettes) on future cigarette smoking in a sample of smokers enrolled in college. Methods. In this longitudinal study, first-semester college students at 7 colleges in North Carolina and 4 in Virginia completed a baseline survey and 5 follow-up surveys between fall 2010 and fall 2013. Current cigarette smoking at wave 6 was the primary outcome. Participants (n = 271) reported current cigarette smoking at baseline and no history of e-cigarette use. We measured trying e-cigarettes at each wave, defined as use in the past 6 months. Results. By wave 5, 43.5% had tried e-cigarettes. Even after controlling for other variables associated with cigarette smoking, trying e-cigarettes was a significant predictor of cigarette smoking at wave 6 (adjusted odds ratio [AOR] = 2.48; 95% confidence interval [CI] = 1.32, 4.66), as were friends’ cigarette smoking (AOR = 4.20; 95% CI = 2.22, 7.96) and lifetime use of other tobacco products (AOR = 1.63; 95% CI = 1.22, 2.17). Conclusions. Trying e-cigarettes during college did not deter cigarette smoking and may have contributed to continued smoking. PMID:26066954

  6. TriKEs and BiKEs join CARs on the cancer immunotherapy highway.

    PubMed

    Tay, Szun Szun; Carol, Hernan; Biro, Maté

    2016-11-01

    Unprecedented clinical success has recently been achieved in cancer immunotherapy using cytotoxic T cells armed with activating tumor-specific Chimeric Antigen Receptors (CARs). Natural killer (NK) cells, potent cytotoxic effectors, also hold potential to be effectively harnessed for immunotherapy. The anti-tumor efficacy of NK cell therapies has been limited by a lack of antigen specificity and the poor persistence of NK cells in vivo. To address these limitations, Vallera and colleagues developed novel Trispecific Killer cell Engagers (TriKEs), reported in the Feb. 2016 issue of Clinical Cancer Research. (1) The novel TriKE immunomodulator evolved from the Bispecific Killer cell Engager (BiKE), a precursor developed by the same team. BiKEs comprise 2 antibody fragments, a first recognizing a tumor antigen and a second directed against CD16 on NK cells, which together trigger antibody-dependent cell-mediated cytotoxicity. IL-15 was further integrated to create TriKEs in order to drive NK cell expansion. Compared to BiKEs, TriKEs elicit far superior NK cytotoxicity and NK cell persistence in a xenograft tumor model in vivo, and are proposed to be effective adjuncts to existing NK transfer protocols. Importantly, TriKEs provide a versatile and cost-effective platform onto which novel targeting ligands can be incorporated and hold the potential to stimulate endogenous NK cells in order to circumvent the need for cell transfers altogether, heralding a new generation of immunotherapeutics.

  7. Photoelectric properties of ZnS/Au/ZnS transparent conductive tri-layer films

    NASA Astrophysics Data System (ADS)

    Wang, Caifeng; Hu, Bo

    2017-09-01

    ZnS/Au/ZnS tri-layer films are deposited on quartz glass by pulsed laser deposition (PLD) at room temperature, and have been annealed in air at different temperatures. The effect of annealing temperature on the optical and electrical properties of ZnS/Au/ZnS tri-layer films is investigated. X-ray diffraction (XRD) patterns show that the increase in annealing temperature improves the crystallinity of the structures. Scanning electron microscope (SEM) images of the samples show that the particle size becomes larger as the annealing temperature increases. Moreover, with the increase of annealing temperature, sheet resistance of the tri-layer films decreases initially, and increases further by increasing the annealing temperature to 300 °C. High quality ZnS/Au/ZnS tri-layer films with the sheet resistance of 27 Ω/sq and the maximum optical transmittance of 86.2% in the visible light region (400-800 nm) are obtained when the sample is annealed at 200 °C. The figure of merit is calculated to evaluate the performance of ZnS/Au/ZnS tri-layer films.

  8. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1

    PubMed Central

    Freund, Adam; Zhong, Franklin L.; Venteicher, Andrew S.; Meng, Zhaojing; Veenstra, Timothy D.; Frydman, Judith; Artandi, Steven E.

    2015-01-01

    SUMMARY Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking, using a high content genome-wide siRNA screen in human cells for factors required for Cajal body-localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance and human disease. PMID:25467444

  9. Square lattice honeycomb tri-carbide fuels for 50 to 250 KN variable thrust NTP design

    NASA Astrophysics Data System (ADS)

    Anghaie, Samim; Knight, Travis; Gouw, Reza; Furman, Eric

    2001-02-01

    Ultrahigh temperature solid solution of tri-carbide fuels are used to design an ultracompact nuclear thermal rocket generating 950 seconds of specific impulse with scalable thrust level in range of 50 to 250 kilo Newtons. Solid solutions of tri-carbide nuclear fuels such as uranium-zirconium-niobium carbide. UZrNbC, are processed to contain certain mixing ratio between uranium carbide and two stabilizing carbides. Zirconium or niobium in the tri-carbide could be replaced by tantalum or hafnium to provide higher chemical stability in hot hydrogen environment or to provide different nuclear design characteristics. Recent studies have demonstrated the chemical compatibility of tri-carbide fuels with hydrogen propellant for a few to tens of hours of operation at temperatures ranging from 2800 K to 3300 K, respectively. Fuel elements are fabricated from thin tri-carbide wafers that are grooved and locked into a square-lattice honeycomb (SLHC) shape. The hockey puck shaped SLHC fuel elements are stacked up in a grooved graphite tube to form a SLHC fuel assembly. A total of 18 fuel assemblies are arranged circumferentially to form two concentric rings of fuel assemblies with zirconium hydride filling the space between assemblies. For 50 to 250 kilo Newtons thrust operations, the reactor diameter and length including reflectors are 57 cm and 60 cm, respectively. Results of the nuclear design and thermal fluid analyses of the SLHC nuclear thermal propulsion system are presented. .

  10. TriAnd and its siblings: satellites of satellites in the Milky Way halo

    NASA Astrophysics Data System (ADS)

    Deason, A. J.; Belokurov, V.; Hamren, K. M.; Koposov, S. E.; Gilbert, K. M.; Beaton, R. L.; Dorman, C. E.; Guhathakurta, P.; Majewski, S. R.; Cunningham, E. C.

    2014-11-01

    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main-sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered Pan-Andromeda Archaeological Survey (PAndAS) stream share a common heliocentric distance (D ˜ 20 kpc), position on the sky, and line-of-sight velocity (VGSR ˜ 50 km s-1). Similarly, A-type, giant, and main-sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 satellite show that TriAnd is prevalent in these fields, with a velocity and distance similar to Segue 2. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall on to the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are `satellites of satellites', and the large, metal-rich TriAnd overdensity is the remains of the group central.

  11. Shade evaluation of ceramic laminates according to different try-in materials.

    PubMed

    Lopes, Lawrence Gonzaga; Vaz, Maysa Magalhaes; de Magalhaes, Ana Paula Rodrigues; Cardoso, Paula Carvalho; de Souza, Joao Batista; de Torres, Erica Miranda

    2014-01-01

    The porcelain laminate replaces the visible portion of enamel with a ceramic, which is attached to the dental surface. To enhance cosmetic results, a preliminary color matching procedure is performed prior to cementing the veneers. This procedure can be performed using water, water-soluble gel, or try-in paste. The different shades of cement and try-in pastes are intended to obtain better color and esthetics of the final restoration. This study sought to evaluate the shade of ceramic veneers produced by different try-in materials. Forty bovine teeth and 40 ceramic discs (0.6 mm thick) were prepared. The samples were divided into 4 groups (n = 10). For Group 1 samples, no material was used between the tooth and the ceramic, Group 2 interposed samples with water, Group 3 used a water-soluble gel, and Group 4 used try-in paste (value 0). The color was measured with a spectrophotometer, obtaining L*, a*, and b* values to calculate the color difference (ΔE*). The data were subjected to normality tests and 1-way ANOVA. No significant statistical differences were found among the groups, indicating that the different try-in materials had similar effects on the color of the ceramic laminates.

  12. Toxics Release Inventory Expansion Rule Phase 3 (TRI-P3)

    SciTech Connect

    Evans, R.A.; Saunders, A.D.; Worley, G.G.

    1998-09-01

    The ORR [East Tennessee Technology Park (ETTP), Y-12 Plant, and Oak Ridge National Laboratory (ORNL)] is considered a single facility for reporting by the DOE prime contractors. The processing, manufacturing, or "otherwise use" Section313 chemicals are combined to determine TRI reportability. Such is the case with lead metal, which is one of two chemicals for which reportin~ forms were prepared in this pilot study (Task 2;1. The lead shop at ORNL exceeded the reporting threshold, causing a lead activity at a Y-1 2 machine shop and lead in waste at ETTP to be reportable. TRI-P3 report preparation time for lead totaled 36.5 hours. The second chemical investigated and reported (chromium) also required nearly a man-week for report preparation and documentation by experienced TRI personnel. The ORR TRI report typically includes about six chemicals, so an estimate of the TRI-P3 incremental reporting burden for ORR would be six weeks for experienced personnel axI d two/three man-months for first-time ORR preparers.

  13. Second try: who returns for additional assisted reproductive technology treatment and the effect of a prior assisted reproductive technology birth.

    PubMed

    Luke, Barbara; Brown, Morton B; Wantman, Ethan; Baker, Valerie L; Grow, Daniel R; Stern, Judy E

    2013-12-01

    To evaluate the effect of a prior assisted reproductive technology (ART) live birth on subsequent live-birth rates. Historical cohort study. Clinic-based data. The study population included 297,635 women with 549,278 cycles from 2004 to 2010 from the Society for Assisted Reproductive Technology Clinic Outcome Reporting System. Try 1 refers to ART cycles up to and including the first live birth, try 2 to ART cycles after a first live birth. None. Live-birth rates by cycle number, try number, and oocyte source. Younger women at try 1 are more likely to return for try 2. Women returning for try 2 were more likely to have had an ART singleton versus multiple birth (33.2% after a try 1 singleton versus 8.1% after twins and 4.9% after triplets) and were less likely to have a diagnosis of diminished ovarian reserve or tubal factors. Live-birth rates were significantly higher for try 2 compared with try 1 for autologous fresh cycles, averaging 7.7 percentage points higher over five cycles. Live-birth rates were not significantly different for try 2 versus try 1 with thawed autologous cycles or either fresh or thawed donor cycles. These results indicate that when fresh autologous oocytes can be used, live-birth rates per cycle are significantly greater after a prior history of an ART live birth. Copyright © 2013 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.

  14. The Identification of Mono-, Di-, Tri-, and Tetragalactosyldiacylglycerols and their Natural Estolides in Oat Kernels†

    PubMed Central

    Moreau, Robert A.; Doehlert, Douglas C.; Welti, Ruth; Isaac, Giorgis; Roth, Mary; Tamura, Pamela; Nuñez, Alberto

    2014-01-01

    Oat kernels were extracted with methanol, and glycolipid-enriched fractions were prepared using silica solid phase extraction. Using direct infusion electrospray ionization (ESI) tandem mass spectrometry (MS), high performance liquid chromatography (HPLC)-ESI-MS, and HPLC-atmospheric pressure chemical ionization (APCI)-MS, we confirmed previous reports that digalactosyldiacylglycerol (DGDG) was the most abundant glycolipid in oat kernels and confirmed a previous report of the presence of a DGDG mono-estolide in oat kernels. In the current study we also identified several additional natural galactolipid estolides: two new DGDG estolides (di- and tri-estolides), two trigalactosyldiacylglycerol (TriGDG) estolides (mono- and di-estolides), and one tetragalactosyldiacylglycerol (TetraGDG) estolide (monoestolide). The levels of total galactolipid estolides in oat kernels were estimated to be about 29% of the total glycolipid fraction. To our knowledge, this report is the first evidence of natural diand tri-estolides of polar lipids. PMID:18481134

  15. A Tri-Factor Model for Integrating Ratings Across Multiple Informants

    PubMed Central

    Bauer, Daniel J.; Howard, Andrea L.; Baldasaro, Ruth E.; Curran, Patrick J.; Hussong, Andrea M.; Chassin, Laurie; Zucker, Robert A.

    2014-01-01

    Psychologists often obtain ratings for target individuals from multiple informants such as parents or peers. In this paper we propose a tri-factor model for multiple informant data that separates target-level variability from informant-level variability and item-level variability. By leveraging item-level data, the tri-factor model allows for examination of a single trait rated on a single target. In contrast to many psychometric models developed for multitrait-multimethod data, the tri-factor model is predominantly a measurement model. It is used to evaluate item quality in scale development, test hypotheses about sources of target variability (e.g., sources of trait differences) versus informant variability (e.g., sources of rater bias), and generate integrative scores that are purged of the subjective biases of single informants. PMID:24079932

  16. Tri-layer wrinkling as a mechanism for anchoring center initiation in the developing cerebellum.

    PubMed

    Lejeune, Emma; Javili, Ali; Weickenmeier, Johannes; Kuhl, Ellen; Linder, Christian

    2016-07-07

    During cerebellar development, anchoring centers form at the base of each fissure and remain fixed in place while the rest of the cerebellum grows outward. Cerebellar foliation has been extensively studied; yet, the mechanisms that control anchoring center initiation and position remain insufficiently understood. Here we show that a tri-layer model can predict surface wrinkling as a potential mechanism to explain anchoring center initiation and position. Motivated by the cerebellar microstructure, we model the developing cerebellum as a tri-layer system with an external molecular layer and an internal granular layer of similar stiffness and a significantly softer intermediate Purkinje cell layer. Including a weak intermediate layer proves key to predicting surface morphogenesis, even at low stiffness contrasts between the top and bottom layers. The proposed tri-layer model provides insight into the hierarchical formation of anchoring centers and establishes an essential missing link between gene expression and evolution of shape.

  17. A new miniaturized negative-index meta-atom for tri-band applications

    NASA Astrophysics Data System (ADS)

    Hossain, Mohammad Jakir; Faruque, Mohammad Rashed Iqbal; Abdullah, Sharifah Mastura Syed; Roslan, Muhamad Roszaini; Islam, Mohammad Tariqul

    2017-07-01

    In this paper, a miniature negative index meta-atom was designed; simulated, fabricated and measured based on parallel incidence of electromagnetic wave that can maintain a tri-band applications in microwave spectra. Compare to the other multi-band conventional metamaterial, the proposed meta-atom structure allows miniaturization factor and follows better effective medium ratio (EMR). Finite-integration technique (FIT) based computer simulation technology (CST) electromagnetic simulator was adopted to examine the design of the meta-atom. It exhibits tri-band response in conjunction with backward wave property over a certain frequency band in the microwave regime. Furthermore, the effective medium ratio is considerably improved compared to previously reported metamaterial. Moreover, few parametric analyses were done with the meta-atom. The size, scattering parameters and effective medium parameters of the proposed negative index miniaturized meta-atom is appropriate for tri-band applications.

  18. The TRY Plant Trait Database - a Tool to Characterize Plant Responses to Global Changes

    NASA Astrophysics Data System (ADS)

    Kattge, J.

    2015-12-01

    Plant traits are fundamental for understanding and predicting vegetation responses to global changes, and they provide a promising basis towards a more quantitative and predictive approach to ecology. Plant traits have therefore been collected for a long time, but mostly been stored in small, separated and private databases, not accessible to the research community. The TRY initiative, a network of vegetation scientists (https://www.try-db.org), provides a global archive of plant traits, curated to be applicable for the characterization of species-specific responses in the context of terrestrial biosphere models. This contribution will (1) introduce the TRY initiative and the current state of the plant trait database, (2) provide examples of trait-based approaches to improve terrestrial biosphere models, (3) highlight future perspectives and challenges for trait based approaches in ecology and vegetation modeling.

  19. Try-It-On: Experiential Learning of Holistic Stress Management in a Graduate Nursing Curriculum.

    PubMed

    Gregg, S Renee; Twibell, K Renee

    2016-09-01

    The aim of this article is to relate how nursing students in a graduate curriculum can learn, personally practice, and prepare to disseminate stress management strategies to patients. Advanced practice nurses often provide care for patients experiencing stress-related disorders while concurrently trying to manage their own high levels of stress. Through the innovative Try-It-On teaching-learning strategy, graduate students experimented with holistic stress management approaches, with the intention of sharing with patients what worked effectively. Student comments on course evaluations were positive regarding Try-It-On. In the pilot trial of a quantitative survey to expand the evaluation of the strategy, students who trialed holistic stress management techniques reported satisfaction, engagement, perceived relevance, and intention to trial techniques with patients in future clinical courses. Modeling role modeling theory and the Kirkpatrick evaluation model guided the project, which filled gaps in current knowledge about experiential learning in graduate nursing programs.

  20. Tri-focal tensor-based multiple video synchronization with subframe optimization.

    PubMed

    Lei, Cheng; Yang, Yee-Hong

    2006-09-01

    In this paper, we present a novel method for synchronizing multiple (more than two) uncalibrated video sequences recording the same event by free-moving full-perspective cameras. Unlike previous synchronization methods, our method takes advantage of tri-view geometry constraints instead of the commonly used two-view one for their better performance in measuring geometric alignment when video frames are synchronized. In particular, the tri-ocular geometric constraint of point/line features, which is evaluated by tri-focal transfer, is enforced when building the timeline maps for sequences to be synchronized. A hierarchical approach is used to reduce the computational complexity. To achieve subframe synchronization accuracy, the Levenberg-Marquardt method-based optimization is performed. The experimental results on several synthetic and real video datasets demonstrate the effectiveness and robustness of our method over previous methods in synchronizing full-perspective videos.

  1. The TriBeam system: Femtosecond laser ablation in situ SEM

    SciTech Connect

    Echlin, McLean P.; Straw, Marcus; Randolph, Steven; Filevich, Jorge; Pollock, Tresa M.

    2015-02-15

    Femtosecond laser ablation offers the unique ability to remove material at rates that are orders of magnitude faster than existing ion beam technologies with little or no associated damage. By combining ultrafast lasers with state-of-the-art electron microscopy equipment, we have developed a TriBeam system capable of targeted, in-situ tomography providing chemical, structural, and topographical information in three dimensions of near mm{sup 3} sized volumes. The origins, development, physics, current uses, and future potential for the TriBeam system are described in this tutorial review. - Graphical abstract: Display Omitted - Highlights: • An emerging tool, the TriBeam, for in situ femtosecond (fs) laser ablation is presented. • Fs laser ablation aided tomography at the mm{sup 3}-scale is demonstrated. • Fs laser induced deposition of Pt is demonstrated at sub-diffraction limit resolution. • Fs laser surface structuring is reviewed as well as micromachining applications.

  2. Analysis of weak signal detection based on tri-stable system under Levy noise

    NASA Astrophysics Data System (ADS)

    Li-Fang, He; Ying-Ying, Cui; Tian-Qi, Zhang; Gang, Zhang; Ying, Song

    2016-06-01

    Stochastic resonance system is an effective method to extract weak signal. However, system output is directly influenced by system parameters. Aiming at this, the Levy noise is combined with a tri-stable stochastic resonance system. The average signal-to-noise ratio gain is regarded as an index to measure the stochastic resonance phenomenon. The characteristics of tri-stable stochastic resonance under Levy noise is analyzed in depth. First, the method of generating Levy noise, the effect of tri-stable system parameters on the potential function and corresponding potential force are presented in detail. Then, the effects of tri-stable system parameters w, a, b, and Levy noise intensity amplification factor D on the resonant output can be explored with different Levy noises. Finally, the tri-stable stochastic resonance system is applied to the bearing fault detection. Simulation results show that the stochastic resonance phenomenon can be induced by tuning the system parameters w, a, and b under different distributions of Levy noise, then the weak signal can be detected. The parameter intervals which can induce stochastic resonances are approximately equal. Moreover, by adjusting the intensity amplification factor D of Levy noise, the stochastic resonances can happen similarly. In bearing fault detection, the detection effect of the tri-stable stochastic resonance system is superior to the bistable stochastic resonance system. Project supported by the National Natural Science Foundation of China (Grant No. 61371164), the Chongqing Municipal Distinguished Youth Foundation, China (Grant No. CSTC2011jjjq40002), and the Research Project of Chongqing Municipal Educational Commission, China (Grant No. KJ130524).

  3. A tri-modality image fusion method for target delineation of brain tumors in radiotherapy.

    PubMed

    Guo, Lu; Shen, Shuming; Harris, Eleanor; Wang, Zheng; Jiang, Wei; Guo, Yu; Feng, Yuanming

    2014-01-01

    To develop a tri-modality image fusion method for better target delineation in image-guided radiotherapy for patients with brain tumors. A new method of tri-modality image fusion was developed, which can fuse and display all image sets in one panel and one operation. And a feasibility study in gross tumor volume (GTV) delineation using data from three patients with brain tumors was conducted, which included images of simulation CT, MRI, and 18F-fluorodeoxyglucose positron emission tomography (18F-FDG PET) examinations before radiotherapy. Tri-modality image fusion was implemented after image registrations of CT+PET and CT+MRI, and the transparency weight of each modality could be adjusted and set by users. Three radiation oncologists delineated GTVs for all patients using dual-modality (MRI/CT) and tri-modality (MRI/CT/PET) image fusion respectively. Inter-observer variation was assessed by the coefficient of variation (COV), the average distance between surface and centroid (ADSC), and the local standard deviation (SDlocal). Analysis of COV was also performed to evaluate intra-observer volume variation. The inter-observer variation analysis showed that, the mean COV was 0.14(± 0.09) and 0.07(± 0.01) for dual-modality and tri-modality respectively; the standard deviation of ADSC was significantly reduced (p<0.05) with tri-modality; SDlocal averaged over median GTV surface was reduced in patient 2 (from 0.57 cm to 0.39 cm) and patient 3 (from 0.42 cm to 0.36 cm) with the new method. The intra-observer volume variation was also significantly reduced (p = 0.00) with the tri-modality method as compared with using the dual-modality method. With the new tri-modality image fusion method smaller inter- and intra-observer variation in GTV definition for the brain tumors can be achieved, which improves the consistency and accuracy for target delineation in individualized radiotherapy.

  4. A Multi-wavelength Study of the Close M-dwarf Eclipsing Binary System BX Tri

    NASA Astrophysics Data System (ADS)

    Perdelwitz, V.; Czesla, S.; Robrade, J.; Schmitt, J. H. M. M.

    2015-01-01

    We present the first detailed X-ray study of the close dMe binary system BX Tri, whose optical variation has been continously monitored in the frame of the DWARF project (Pribulla et al.(2012)). We observed BX Tri with XMM-Newton for two full orbital periods and confirm that the system is an ultra-active M-dwarf binary showing frequent flares and an X-ray luminosity close to the saturation limit. The strong magnetic activity could have influenced the angular momentum evolution of the system via magnetic braking.

  5. More than just great quotes: An introduction to the Canadian Tri-Council's qualitative requirements.

    PubMed

    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L

    2013-01-01

    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council's nine requirements.

  6. Bogdanov-Takens singularity in tri-neuron network with time delay.

    PubMed

    He, Xing; Li, Chuandong; Huang, Tingwen; Li, Chaojie

    2013-06-01

    This brief reports a retarded functional differential equation modeling tri-neuron network with time delay. The Bogdanov-Takens (B-T) bifurcation is investigated by using the center manifold reduction and the normal form method. We get the versal unfolding of the norm forms at the B-T singularity and show that the model can exhibit pitchfork, Hopf, homoclinic, and double-limit cycles bifurcations. Some numerical simulations are given to support the analytic results and explore chaotic dynamics. Finally, an algorithm is given to show that chaotic tri-neuron networks can be used for encrypting a color image.

  7. Development of new Si-contained hardmask for tri-layer process

    NASA Astrophysics Data System (ADS)

    Nakajima, Makoto; Kanno, Yuta; Shibayama, Wataru; Takeda, Satoshi; Kato, Masakazu; Matsumoto, Takashi

    2011-04-01

    In the advanced semiconductor lithography process, the tri-layer process have been used for the essential technique{photoresist/ silicon contained hard mask (Si-HM) / spin on carbon hard mask (SOC)}(Figure 1). Tri-layer process was introduced and applied to the L/S and C/H patterning in the ArF dry and ArF immersion lithography process. Therefore, Si-HM should have the wider compatibility with different photoresist. In this paper, we investigate the interface behavior between photoresist and Si-HM in detail and get the new Si-HM to have the wider compatibility with different photoresist.

  8. More than just great quotes: An introduction to the Canadian Tri-Council’s qualitative requirements

    PubMed Central

    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L

    2013-01-01

    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council’s nine requirements. PMID:24421811

  9. Hanford and the tri-cities economy: Review and outlook, March 1989

    SciTech Connect

    Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.

    1989-03-01

    The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

  10. Identification of a 35S U4/U6.U5 Tri-snRNP Complex Intermediate in Spliceosome Assembly.

    PubMed

    Chen, Zhe; Gui, Bin; Zhang, Yu; Xie, Guojia; Li, Wanjin; Liu, Shumeng; Xu, Bosen; Wu, Chongyang; He, Lin; Yang, Jianguo; Yi, Xia; Yang, Xiaohan; Sun, Luyang; Liang, Jing; Shang, Yongfeng

    2017-09-06

    The de novo assembly and post-splicing reassembly of the U4/U6.U5 tri-snRNP remain to be investigated. We report here that ZIP, a protein containing a CCCH type of zinc finger and a G-patch domain as we characterized previously, regulates pre-mRNA splicing in a RNA binding-independent manner. We found that ZIP is physically associated with the U4/U6.U5 tri-snRNP. Remarkably, ZIP-containing tri-snRNP has a sedimentation coefficient ~35S, a tri-snRNP that has not been described before. We showed that the 35S tri-snRNP contains hPrp24, indicative of a state when the U4/U6 di-snRNP is just integrating with the U5 snRNP. We found that the 35S tri-snRNP is enriched in the Cajal body, indicating that it is an assembly intermediate during 25S tri-snRNP maturation. We showed that the 35S tri-snRNP also contains hPrp43, whose ATPase/RNA helicase activities are stimulated by ZIP. Our study identified, for the first time, a tri-snRNP intermediate, shedding new light on the de novo assembly and recycling of the U4/U6.U5 tri-snRNP. Copyright © 2017, The American Society for Biochemistry and Molecular Biology.

  11. Tri-P-LETS: Changing the Face of High School Computer Science

    ERIC Educational Resources Information Center

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James

    2012-01-01

    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  12. Investment in hydrogen tri-generation for wastewater treatment plants under uncertainties

    NASA Astrophysics Data System (ADS)

    Gharieh, Kaveh; Jafari, Mohsen A.; Guo, Qizhong

    2015-11-01

    In this article, we present a compound real option model for investment in hydrogen tri-generation and onsite hydrogen dispensing systems for a wastewater treatment plant under price and market uncertainties. The ultimate objective is to determine optimal timing and investment thresholds to exercise initial and subsequent options such that the total savings are maximized. Initial option includes investment in a 1.4 (MW) Molten Carbonate Fuel Cell (MCFC) fed by mixture of waste biogas from anaerobic digestion and natural gas, along with auxiliary equipment. Produced hydrogen in MCFC via internal reforming, is recovered from the exhaust gas stream using Pressure Swing Adsorption (PSA) purification technology. Therefore the expansion option includes investment in hydrogen compression, storage and dispensing (CSD) systems which creates additional revenue by selling hydrogen onsite in retail price. This work extends current state of investment modeling within the context of hydrogen tri-generation by considering: (i) Modular investment plan for hydrogen tri-generation and dispensing systems, (ii) Multiple sources of uncertainties along with more realistic probability distributions, (iii) Optimal operation of hydrogen tri-generation is considered, which results in realistic saving estimation.

  13. Queens Tri-School Confederation 1992-93 Evaluation Report. OREA Report.

    ERIC Educational Resources Information Center

    Dworkowitz, Barbara

    This report presents the evaluation results of the Queens Tri-School Confederation magnet programs in New York City: programs designed to reduce minority-group isolation among high school students in three high schools and simultaneously improve the quality of their education through the sharing of resources and expertise. These programs, which…

  14. PROCEEDINGS OF THE DELMARVA COASTAL BAYS CONFERENCE III: TRI-STATE APPROACHES TO PRESERVING AQUATIC RESOURCES

    EPA Science Inventory

    On November 12-13, 1999, Approximately 300 people attended the Delmarva Coastal Bays Conference III: Tri-State Approaches to Preserving Aquatic Resources (CBCIII). The conference was organized by the Assateague Coastal Trust with planning and financial assistance from twenty-one ...

  15. Metallic conductance at the interface of tri-color titanate superlattices

    NASA Astrophysics Data System (ADS)

    Kareev, M.; Cao, Yanwei; Liu, Xiaoran; Middey, S.; Meyers, D.; Chakhalian, J.

    2013-12-01

    Ultra-thin tri-color (tri-layer) titanate superlattices ([3 u.c. LaTiO3/2 u.c. SrTiO3/3 u.c. YTiO3], u.c. = unit cells) were grown in a layer-by-layer way on single crystal TbScO3 (110) substrates by pulsed laser deposition. High sample quality and electronic structure were characterized by the combination of in-situ photoelectron and ex-situ structure and surface morphology probes. Temperature-dependent sheet resistance indicates the presence of metallic interfaces in both [3 u.c. LaTiO3/2 u.c. SrTiO3] bi-layers and all the tri-color structures, whereas a [3 u.c. YTiO3/2 u.c. SrTiO3] bi-layer shows insulating behavior. Considering that in the bulk YTiO3 is ferromagnetic below 30 K, the tri-color titanate superlattices provide an opportunity to induce tunable spin-polarization into the two-dimensional electron gas with Mott carriers.

  16. Making Mission Statements Operational: Perceptions of Principals from Tri-Association Schools

    ERIC Educational Resources Information Center

    Fayad, Juan David; Yoshida, Roland K.

    2014-01-01

    Researchers and theorists in the management and educational leadership fields have debated the importance of mission statements. This study investigated this issue within the context of American schools that are members of the Tri-Association (Mexico, Central America, Colombia, and the Caribbean). The results showed that about the same percentage…

  17. Development of education program for physical therapy assistant in Quang Tri province of Vietnam.

    PubMed

    Noh, Jin Won; Cho, Sang Hyun; Kim, Min Hee; Kim, Eun Joo

    2017-02-01

    [Purpose] The purpose of the present study was to develop an education program for physical therapy assistants in order to provide high quality physical therapy for the province of Quang Tri in Vietnam. [Subjects and Methods] Subjects consisted of 9 professors in Quang Tri medical college and 1 physical therapist in Quang Tri General hospital. The survey research to lecturer for education of physical therapy assistant in Quang Tri medical college was conducted as pre-analysis of demand for the physical therapy assistant curriculum development. The priority rank of expectation and consciousness were measured in curriculum subjects. [Results] Results of educational expectation of the curriculum total educational expectation were presented as minimum 4 to maximum 5. In the result of educational expectation according to background variable, the differences of educational expectation on scores according to the educational experience were significant. Among the consciousness priority of each curriculum subject, the priority rank of basic kinesiology and physical therapy for international medicine & surgery were 9, the highest first rank frequency. [Conclusion] The curriculum for physical therapy assistant was developed to 5 main subjects including a total of 420 hours (120 hours of theory and 300 hours of practice).

  18. A continuous tri-phase transition effect for HIFU-mediated intravenous drug delivery.

    PubMed

    Zhang, Kun; Chen, Hangrong; Li, Faqi; Wang, Qi; Zheng, Shuguang; Xu, Huixiong; Ma, Ming; Jia, Xiaoqing; Chen, Yu; Mou, Juan; Wang, Xia; Shi, Jianlin

    2014-07-01

    Aiming at substantially enhanced efficacy and biosafety of clinical HIFU therapy, a natural solid medium, L-menthol (LM), characteristic of mild and controllable "solid-liquid-gas" (SLG) tri-phase transition, was adopted, instead of those conventional explosive liquid-gas (LG) bi-phase transitional media, in constructing a multifunctional theranostic system. Owing to the continuous and controllable characteristics of SLG tri-phase transition, such a novel tri-phase transition-based theranostic system has been demonstrated of the repeatedly enhanced HIFU efficacy ex vivo and in vivo under once intravenous injection and the significantly improved treatment precision, controllability and biosafety when comparing to the traditional bi-phase transition medium, perfluorohexane (PFH), thus promising great application potential in clinical HIFU treatment. Moreover, this theranostic system has been demonstrated a long blood-circulation lifetime and continuous accumulation in tumor in 24 h, which is very beneficial for the enhanced tumor ablation in vivo along with SLG tri-phase transition. More importantly, after loading multiple model drugs and real drug, such a theranostic system presents a HIFU-mediated temperature-responsive drug release property, and depending on the versatile miscibility of LM, co-loadings with hydrophobic and hydrophilic drugs are also achieved, which provides the possibility of synergistic treatment combining HIFU therapy and chemotherapy. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    ERIC Educational Resources Information Center

    Grier-Reed, Tabitha; Ganuza, Zoila

    2012-01-01

    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  20. Exciton Binding Energy in Organic-Inorganic Tri-Halide Perovskites.

    PubMed

    Askar, Abdelrahman M; Shankar, Karthik

    2016-06-01

    The recent dramatic increase in the power conversion efficiencies of organic-inorganic tri-halide perovskite solar cells has triggered intense research worldwide and created a paradigm shift in the photovoltaics field. It is crucial to develop a solid understanding of the photophysical processes underlying solar cell operation in order to both further improve the photovoltaic performance of perovskite solar cells as well as to exploit the broader optoelectronic applications of the tri-halide perovskites. In this short review, we summarize the main research findings about the binding energy of excitons in tri-halide perovskite materials and find that a value in the range of 2-22 meV at room temperature would be a safe estimate. Spontaneous free carrier generation is the dominant process taking place directly after photoexcitation in organic-inorganic tri-halide perovskites at room temperature, which eliminates the exciton diffusion bottleneck present in organic solar cells and constitutes a major contributing factor to the high photovoltaic performance of this material.

  1. 76 FR 60781 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-09-30

    ... the TRI program, EPA is helping to increase awareness of toxic releases within Tribal communities... Indian country (18 U.S.C. 1151) with a toxic chemical(s) known by the owner or operator to be..., Coal Mining (except 1241)); or 212221, 212222, 212231, 212234, 212299 (correspond to SIC 10, Metal...

  2. Columbia Basin College Facts & Impacts: A Report to the Tri-Cities Community.

    ERIC Educational Resources Information Center

    Knutzen, Judi; LaGrange, Jill; Jones, Ty

    This fact book for Columbia Basin College (CBC) (Washington) covers seven subject areas: (1) mission statement; (2) access; (3) academics; (4) career and workforce development; (5) basic skills; (6) cultural enrichment; and (7) physical and emotional well-being. Report highlights include: (1) in 2001, CBC presented to the Tri-Cities community a…

  3. The TRIIC--Tri-I (Innovative, Integrative, Individualized) Curriculum for Mainstreaming.

    ERIC Educational Resources Information Center

    Jamieson, Bonnie; And Others

    The Tri-I (Innovative, Integrative, Individualized Curriculum)--TRIIC--contains a systematic method to train preschool teachers in using the curriculum for behaviorally handicapped and/or nonhandicapped children. The curriculum is designed to aid teachers in: developing individualized goals for handicapped and nonhandicapped children…

  4. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    ERIC Educational Resources Information Center

    Abdulwahed, Mahmoud; Nagy, Zoltan K.

    2011-01-01

    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  5. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    ERIC Educational Resources Information Center

    Abdulwahed, Mahmoud; Nagy, Zoltan K.

    2011-01-01

    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  6. Making the Link: Service-Learning and Community Education--A Tri-State Partnership.

    ERIC Educational Resources Information Center

    Potts, Stanley J.; Herrity, Joe; Bucher, Marlys; Fehsenfeld, Lizanne

    1998-01-01

    The Tri-State Initiative is a collaboration for service learning linking the Iowa Department of Education; Minnesota Department of Children, Families, and Learning; and the Wisconsin Department of Public Instruction. Six demonstration schools are restructuring using service learning methodology. (SK)

  7. Challenges and Mental Health Experiences of Lesbian and Bisexual Women Who Are Trying to Conceive

    ERIC Educational Resources Information Center

    Yager, Christina; Brennan, David; Steele, Leah S.; Epstein, Rachel; Ross, Lori E.

    2010-01-01

    To date, there is little evidence to inform social work practice with lesbian and bisexual women who are trying to conceive (TTC). The authors report a preliminary examination of the mental health experiences of lesbian and bisexual women who are TTC, through a comparison with lesbian and bisexual women in the postpartum period (PP). Thirty-three…

  8. Bioprospecting for TRI101 in Fusarium: Searching for a Better Enzyme to Detoxify Deoxynivalenol (DON)

    USDA-ARS?s Scientific Manuscript database

    The mycotoxin deoxynivalenol (DON) is a common contaminant of wheat and barley in the United States. New strategies to mitigate the threat of DON need to be developed and implemented. Previous research has shown the value of an enzyme (TRI101) to modify DON and reduce its toxicity. Recent work by...

  9. Tri-County Teachers' Guide to Community Resources: Speakers, Field Trips, Career Interviews.

    ERIC Educational Resources Information Center

    Tri-County Industry-Education-Labor Council, East Peoria, IL.

    The guide to local resources was compiled by the Tri-County Industry-Education-Labor Council for teachers and guidance counselors seeking specific career education information. The resources are classified according to the 15 occupational clusters, as identified by the U.S. Office of Education, plus economic education for integration with…

  10. Outlook: The Growing Asian Presence in the Tri-State Region.

    ERIC Educational Resources Information Center

    United Way of Tri-State, New York, NY.

    Data from the 1980 Census, post-Census supplements, and other sources are used to establish a base of information on the Asian American community in the tri-state (New York/New Jersey/Connecticut) metropolitan area, in order to assess the social service needs of this population. The Asian American presence and the growth and diversity of the…

  11. Wake structure of axial-flow hydrokinetic turbines in tri-frame arrangement

    NASA Astrophysics Data System (ADS)

    Chawdhary, Saurabh; Yang, Xiaolei; Hill, Craig; Khosronejad, Ali; Guala, Michele; Sotiropoulos, Fotis

    2015-11-01

    Marine and hydro-kinetic (MHK) energy hold promise for future of sustainable energy generation. Tri-frame of turbines, three turbines mounted on vertices of a triangle, are an effective way to build a power producing array of hydrokinetic turbines in marine environment. Large eddy simulation (LES) is used to simulate the flow past a tri-frame and characterize its wake. Full geometry of all three turbines in the tri-frame is resolved using the Curvilinear Immersed Boundary (CURVIB) method of Kang et al. (2011). High fidelity solution of flow field is obtained owing to the inclusion of detailed geometry of the turbines. Excellent agreement is obtained with the experiments conducted in a flume at Saint Anthony Falls Laboratory (SAFL). The wake evolution of the three turbines is compared to that of an isolated single turbine. The differences in wake dynamics are highlighted to elucidate the importance of turbine wake interaction in an array. The simulations indicate lower levels of TKE and lower levels of momentum deficit in the wake of the upstream turbine of tri-frame compared to the other turbines. Analysis of the far wake recovery is useful for the optimal MHK array design. This work was supported by NSF grant IIP-1318201. The simulations were carried out at the Minnesota Supercomputing Institute.

  12. The TRY Foundation: A Case Study in Private Community Development Organizations.

    ERIC Educational Resources Information Center

    McClure, Paul T.

    This is a case study of the TRY Foundation, a privately funded non-profit corporation devoting its resources to "community and human development in disadvantaged areas." Activities sponsored by its primate unit, the Willowbrook Chapter of Watts, Los Angeles, include: thrift shop, preventive dentistry clinic, Operation Vegetable…

  13. Monolithically integrated tri-axis shock accelerometers with MHz-level high resonant-frequency

    NASA Astrophysics Data System (ADS)

    Zou, Hongshuo; Wang, Jiachou; Chen, Fang; Bao, Haifei; Jiao, Ding; Zhang, Kun; Song, Zhaohui; Li, Xinxin

    2017-07-01

    This paper reports a novel monolithically integrated tri-axis high-shock accelerometer with high resonant-frequency for the detection of a broad frequency-band shock signal. For the first time, a resonant-frequency as high as about 1.4 MHz is designed for all the x-, y- and z-axis accelerometers of the integrated tri-axis sensor. In order to achieve a wide frequency-band detection performance, all the three sensing structures are designed into an axially compressed/stretched tiny-beam sensing scheme, where the p  +  -doped tiny-beams are connected into a Wheatstone bridge for piezoresistive output. By using ordinary (1 1 1) silicon wafer (i.e. non-SOI wafer), a single-wafer based fabrication technique is developed to monolithically integrate the three sensing structures for the tri-axis sensor. Testing results under high-shock acceleration show that each of the integrated three-axis accelerometers exhibit about 1.4 MHz resonant-frequency and 0.2-0.4 µV/V/g sensitivity. The achieved high frequencies for all the three sensing units make the tri-axis sensor promising in high fidelity 3D high-shock detection applications.

  14. "How To Succeed in Business Without Really Trying." Spotlight on Theater Notes.

    ERIC Educational Resources Information Center

    Carr, John C.

    This booklet presents a variety of materials concerning the current revival of the 1961 play "How to Succeed in Business Without Really Trying." After a brief introduction to the play, the booklet discusses the plot of the play, how it went from best seller to prize-winning musical, biographical information on the lead actor (Matthew…

  15. TriTrypDB: a functional genomic resource for the Trypanosomatidae

    PubMed Central

    Aslett, Martin; Aurrecoechea, Cristina; Berriman, Matthew; Brestelli, John; Brunk, Brian P.; Carrington, Mark; Depledge, Daniel P.; Fischer, Steve; Gajria, Bindu; Gao, Xin; Gardner, Malcolm J.; Gingle, Alan; Grant, Greg; Harb, Omar S.; Heiges, Mark; Hertz-Fowler, Christiane; Houston, Robin; Innamorato, Frank; Iodice, John; Kissinger, Jessica C.; Kraemer, Eileen; Li, Wei; Logan, Flora J.; Miller, John A.; Mitra, Siddhartha; Myler, Peter J.; Nayak, Vishal; Pennington, Cary; Phan, Isabelle; Pinney, Deborah F.; Ramasamy, Gowthaman; Rogers, Matthew B.; Roos, David S.; Ross, Chris; Sivam, Dhileep; Smith, Deborah F.; Srinivasamoorthy, Ganesh; Stoeckert, Christian J.; Subramanian, Sandhya; Thibodeau, Ryan; Tivey, Adrian; Treatman, Charles; Velarde, Giles; Wang, Haiming

    2010-01-01

    TriTrypDB (http://tritrypdb.org) is an integrated database providing access to genome-scale datasets for kinetoplastid parasites, and supporting a variety of complex queries driven by research and development needs. TriTrypDB is a collaborative project, utilizing the GUS/WDK computational infrastructure developed by the Eukaryotic Pathogen Bioinformatics Resource Center (EuPathDB.org) to integrate genome annotation and analyses from GeneDB and elsewhere with a wide variety of functional genomics datasets made available by members of the global research community, often pre-publication. Currently, TriTrypDB integrates datasets from Leishmania braziliensis, L. infantum, L. major, L. tarentolae, Trypanosoma brucei and T. cruzi. Users may examine individual genes or chromosomal spans in their genomic context, including syntenic alignments with other kinetoplastid organisms. Data within TriTrypDB can be interrogated utilizing a sophisticated search strategy system that enables a user to construct complex queries combining multiple data types. All search strategies are stored, allowing future access and integrated searches. ‘User Comments’ may be added to any gene page, enhancing available annotation; such comments become immediately searchable via the text search, and are forwarded to curators for incorporation into the reference annotation when appropriate. PMID:19843604

  16. PROCEEDINGS OF THE DELMARVA COASTAL BAYS CONFERENCE III: TRI-STATE APPROACHES TO PRESERVING AQUATIC RESOURCES

    EPA Science Inventory

    On November 12-13, 1999, Approximately 300 people attended the Delmarva Coastal Bays Conference III: Tri-State Approaches to Preserving Aquatic Resources (CBCIII). The conference was organized by the Assateague Coastal Trust with planning and financial assistance from twenty-one ...

  17. A Tri-Citation Analysis Exploring the Citation Image of Kurt Lewin.

    ERIC Educational Resources Information Center

    Marion, Linda S.

    2002-01-01

    Presents the initial phase of a comparison of cocitation and social network analysis methods for the study of scholarly communication, based on a case study of the intellectual contributions of Kurt Lewin, a social psychologist. Highlights include an author tri-citation analysis; cluster analysis; multidimensional scaling; and diffusion of ideas.…

  18. Cultural Competence in Infant/Toddler Caregivers: Application of a Tri-Dimensional Model

    ERIC Educational Resources Information Center

    Obegi, Amy Dale; Ritblatt, Shulamit Natan

    2005-01-01

    The early childhood literature has acknowledged the need for culturally competent child care professionals. Based on Sue's (1981) tri-dimensional model, the Infant and Toddler Caregiver Cultural Rating Scale (ITCCRS) was created to assess 109 child care providers' cultural competence and the demographic correlates of that competence. Scores fell…

  19. Making Mission Statements Operational: Perceptions of Principals from Tri-Association Schools

    ERIC Educational Resources Information Center

    Fayad, Juan David; Yoshida, Roland K.

    2014-01-01

    Researchers and theorists in the management and educational leadership fields have debated the importance of mission statements. This study investigated this issue within the context of American schools that are members of the Tri-Association (Mexico, Central America, Colombia, and the Caribbean). The results showed that about the same percentage…

  20. "Just Try Harder and You Will Shine": A Study of 20 Lazy Children

    ERIC Educational Resources Information Center

    Gilmore, Linda; Boulton-Lewis, Gillian

    2009-01-01

    Attributions of laziness, reflected in teacher comments such as "Just try harder and you will shine", may mask specific cognitive, learning, attentional or emotional problems that could explain low motivation in some children. This paper reports findings from an investigation of 20 children, aged 7 to 10 years, who were regarded as lazy…

  1. Outlook: The Growing Latino Presence in the Tri-State Region.

    ERIC Educational Resources Information Center

    Latino Commission of Tri-State, New York, NY.

    This study uses 1980 Census information and post-Census trends to develop an information base for the Latino community in the tri-state region of Southern New York, Northern New Jersey, and Western Connecticut. This reference base provides a demographic and socioeconomic profile of the Latino community in the following categories: (1) the…

  2. Outlook: The Growing Asian Presence in the Tri-State Region.

    ERIC Educational Resources Information Center

    United Way of Tri-State, New York, NY.

    Data from the 1980 Census, post-Census supplements, and other sources are used to establish a base of information on the Asian American community in the tri-state (New York/New Jersey/Connecticut) metropolitan area, in order to assess the social service needs of this population. The Asian American presence and the growth and diversity of the…

  3. Traversing State Boundaries with Distance Education: The Tri-State Agricultural Distance Delivery Alliance.

    ERIC Educational Resources Information Center

    Anderson, Erik T.; Makus, Larry; Fanno, Wayne; Swan, Mike

    The Tri-State Agricultural Distance Delivery Alliance (TADDA) is a new distance education consortium. The three land grant universities in the Pacific Northwest (the University of Idaho, Oregon State University, and Washington State University) developed TADDA in cooperation with Eastern Oregon University and four of the region's community…

  4. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    ERIC Educational Resources Information Center

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette

    2005-01-01

    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  5. Development of education program for physical therapy assistant in Quang Tri province of Vietnam

    PubMed Central

    Noh, Jin Won; Cho, Sang Hyun; Kim, Min Hee; Kim, Eun Joo

    2017-01-01

    [Purpose] The purpose of the present study was to develop an education program for physical therapy assistants in order to provide high quality physical therapy for the province of Quang Tri in Vietnam. [Subjects and Methods] Subjects consisted of 9 professors in Quang Tri medical college and 1 physical therapist in Quang Tri General hospital. The survey research to lecturer for education of physical therapy assistant in Quang Tri medical college was conducted as pre-analysis of demand for the physical therapy assistant curriculum development. The priority rank of expectation and consciousness were measured in curriculum subjects. [Results] Results of educational expectation of the curriculum total educational expectation were presented as minimum 4 to maximum 5. In the result of educational expectation according to background variable, the differences of educational expectation on scores according to the educational experience were significant. Among the consciousness priority of each curriculum subject, the priority rank of basic kinesiology and physical therapy for international medicine & surgery were 9, the highest first rank frequency. [Conclusion] The curriculum for physical therapy assistant was developed to 5 main subjects including a total of 420 hours (120 hours of theory and 300 hours of practice). PMID:28265176

  6. Wood-based Tri-Axial Sandwich Composite Materials: Design, Fabrication, Testing, Modeling and Application

    Treesearch

    Jinghao Li; John F. Hunt; Shaoqin Gong; Zhiyong Cai

    2014-01-01

    As the demand for sustainable materials increases, there are unique challenges and opportunities to develop light-weight green composites materials for a wide range of applications. Thus wood-based composite materials from renewable forests may provide options for some niche applications while helping to protect our environment. In this paper, the wood-based tri-axial...

  7. Structure of the human TRiC/CCT Subunit 5 associated with hereditary sensory neuropathy

    DOE PAGES

    Pereira, Jose H.; McAndrew, Ryan P.; Sergeeva, Oksana A.; ...

    2017-06-16

    The human chaperonin TRiC consists of eight non-identical subunits, and its protein-folding activity is critical for cellular health. Misfolded proteins are associated with many human diseases, such as amyloid diseases, cancer, and neuropathies, making TRiC a potential therapeutic target. A detailed structural understanding of its ATP-dependent folding mechanism and substrate recognition is therefore of great importance. Of particular health-related interest is the mutation Histidine 147 to Arginine (H147R) in human TRiC subunit 5 (CCT5), which has been associated with hereditary sensory neuropathy. In this paper, we describe the crystal structures of CCT5 and the CCT5-H147R mutant, which provide important structuralmore » information for this vital protein-folding machine in humans. This first X-ray crystallographic study of a single human CCT subunit in the context of a hexadecameric complex can be expanded in the future to the other 7 subunits that form the TRiC complex.« less

  8. A Tri-Reference Point Theory of Decision Making under Risk

    ERIC Educational Resources Information Center

    Wang, X. T.; Johnson, Joseph G.

    2012-01-01

    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…

  9. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    ERIC Educational Resources Information Center

    Grier-Reed, Tabitha; Ganuza, Zoila

    2012-01-01

    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  10. Molecular Medicine - CHI's 17th International Tri-Conference: Mastering Medicinal Chemistry - CHI's Seventh Annual Conference.

    PubMed

    Semple, Graeme

    2010-04-01

    CHI's 17th International Tri-Conference on Molecular Medicine, held in San Francisco, included topics covering the drug discovery process, with an emphasis on lead optimization. This conference report highlights selected presentations on the development of several launched and investigational drugs, including Plerixafor, Trox-1 (CombinatoRX Inc), lorcaserin (Arena Pharmaceuticals Inc), vorapaxar (Merck & Co Inc) and ulimorelin (Tranzyme Pharma Inc).

  11. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    ERIC Educational Resources Information Center

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette

    2005-01-01

    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  12. A Tri-Reference Point Theory of Decision Making under Risk

    ERIC Educational Resources Information Center

    Wang, X. T.; Johnson, Joseph G.

    2012-01-01

    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…

  13. Ideas: Mercy College's Sociology Department Tries New Ways to Select Textbooks.

    ERIC Educational Resources Information Center

    Ingalls, Zoe

    1983-01-01

    THE FOLLOWING IS THE FULL TEXT OF THIS DOCUMENT: Choosing the textbook for an introductory course can be a frustrating, haphazard, and time-consuming process. This year, members of the sociology department at Mercy College tried a selection process that eliminated at least the first two of those three problems. To begin, the department sent…

  14. Metallic conductance at the interface of tri-color titanate superlattices

    SciTech Connect

    Kareev, M. Cao, Yanwei; Liu, Xiaoran; Middey, S.; Meyers, D.; Chakhalian, J.

    2013-12-02

    Ultra-thin tri-color (tri-layer) titanate superlattices ([3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}/3 u.c. YTiO{sub 3}], u.c. = unit cells) were grown in a layer-by-layer way on single crystal TbScO{sub 3} (110) substrates by pulsed laser deposition. High sample quality and electronic structure were characterized by the combination of in-situ photoelectron and ex-situ structure and surface morphology probes. Temperature-dependent sheet resistance indicates the presence of metallic interfaces in both [3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layers and all the tri-color structures, whereas a [3 u.c. YTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layer shows insulating behavior. Considering that in the bulk YTiO{sub 3} is ferromagnetic below 30 K, the tri-color titanate superlattices provide an opportunity to induce tunable spin-polarization into the two-dimensional electron gas with Mott carriers.

  15. Simplifying touch data from tri-axial sensors using a new data visualization tool.

    PubMed

    Salud, Lawrence H; Kwan, Calvin; Pugh, Carla M

    2013-01-01

    Quantification and evaluation of palpation is a growing field of research in medicine and engineering. A newly developed tri-axial touch sensor has been designed to capture a multi-dimensional profile of touch-loaded forces. We have developed a data visualization tool as a first step in simplifying interpretation of touch for assessing hands-on clinical performance.

  16. 76. ARAII. After SL1 explosion, operators shielded crane cab try ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    76. ARA-II. After SL-1 explosion, operators shielded crane cab try to open door of SL-1 tank building. January 6, 1961. Ineel photo no. 61-80. Photographer: Holmes. - Idaho National Engineering Laboratory, Army Reactors Experimental Area, Scoville, Butte County, ID

  17. Arabidopsis TTG2 regulates TRY expression through enhancement of activator complex-triggered activation.

    PubMed

    Pesch, Martina; Dartan, Burcu; Birkenbihl, Rainer; Somssich, Imre E; Hülskamp, Martin

    2014-10-01

    Trichome patterning in Arabidopsis thaliana is regulated by a regulatory feedback loop of the trichome promoting factors TRANSPARENT TESTA GLABRA1 (TTG1), GLABRA3 (GL3)/ENHANCER OF GL3 (EGL3), and GL1 and a group of homologous R3MYB proteins that act as their inhibitors. Together, they regulate the temporal and spatial expression of GL2 and TTG2, which are considered to control trichome cell differentiation. In this work, we show that TTG2 is a specific activator of TRY (but not CPC or GL2). The WRKY protein TTG2 binds to W-boxes in a minimal promoter fragment of TRY, and these W-boxes are essential for rescue of the try mutant phenotype. We further show that TTG2 alone is not able to activate TRY expression, but rather drastically enhances the activation by TTG1 and GL3. As TTG2 physically interacts with TTG1 and because TTG2 can associate with GL3 through its interaction with TTG1, we propose that TTG2 enhances the activity of TTG1 and GL3 by forming a protein complex.

  18. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    NASA Astrophysics Data System (ADS)

    Goff, John Eric; Lipscombe, Trevor Davis

    2015-02-01

    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This startlingly quick score, though, is of interest to physics players as well as rugby players. Howells' try serves as an intriguing way to involve students in one of the "core competencies" of physicists—to model events in the real world. And with the Rugby World Cup taking place in 2015 in England, and rugby sevens making its debut in the 2016 Summer Olympics in Brazil (U.S. teams have qualified for both events), rugby is increasing in popularity in America and is even gaining some coverage on television. Thanks to You-Tube, Howells' try is readily available to serve as a laboratory experiment for students to analyze.

  19. Tri-P-LETS: Changing the Face of High School Computer Science

    ERIC Educational Resources Information Center

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James

    2012-01-01

    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  20. Challenges and Mental Health Experiences of Lesbian and Bisexual Women Who Are Trying to Conceive

    ERIC Educational Resources Information Center

    Yager, Christina; Brennan, David; Steele, Leah S.; Epstein, Rachel; Ross, Lori E.

    2010-01-01

    To date, there is little evidence to inform social work practice with lesbian and bisexual women who are trying to conceive (TTC). The authors report a preliminary examination of the mental health experiences of lesbian and bisexual women who are TTC, through a comparison with lesbian and bisexual women in the postpartum period (PP). Thirty-three…

  1. Tri-integrable coupling of the Kaup-Newell soliton hierarchy and Liouville integrability

    NASA Astrophysics Data System (ADS)

    Yu, Shuimeng; Ye, Yujian; Zhang, Jun; Song, Junquan

    2016-07-01

    Based on a matrix Lie algebra consisting of 4 × 4 block matrices, new tri-integrable coupling of the Kaup-Newell soliton hierarchy is constructed. Then, the bi-Hamiltonian structure which leads to Liouville integrability of this coupling is furnished by the variational identity.

  2. The TriCouncil for Nursing: An Interorganizational Collaboration for Advancing the Profession.

    PubMed

    Bednash, Geraldine Polly

    2015-01-01

    The TriCouncil for Nursing is a coalition of 4 leading nursing organizations: the American Association of Colleges of Nursing, the American Nurses Association, the American Organization of Nurse Executives, and the National League for Nursing. This informal, yet highly complex, collaboration has endeavored to advance the profession for almost 4 decades despite the inherent challenges in coalition formation and sustainment. Coalition building occurs when organizations seek the potential to advance common issues or protect individual resources or status, and by their very nature have the potential to fail. The history of the TriCouncil for Nursing provides evidence of the challenges associated with the process of developing consensus and the benefits of working to create consensus to achieve common goals. The commitment of the TriCouncil member organizations to sustain this coalition and find consensus across an array of challenging issues and in complex environments has created significant policy advances for the profession, which provides evidence of the benefits associated with this type of collaborative work. This coalition has continued despite the inherent challenges for organizations seeking consensus. The TriCouncil commitment to lead in advocacy for the profession and create significant policy to change health care models the value of this type of effort.

  3. Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37

    PubMed Central

    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G.; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf

    2014-01-01

    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  4. Effect of seeing tobacco use in films on trying smoking among adolescents: cross sectional study

    PubMed Central

    Sargent, James D; Beach, Michael L; Dalton, Madeline A; Mott, Leila A; Tickle, Jennifer J; Ahrens, M Bridget; Heatherton, Todd F

    2001-01-01

    Objective To test the hypothesis that greater exposure to smoking in films is associated with trying smoking among adolescents. Design Cross sectional survey of 4919 schoolchildren aged 9-15 years, and assessment of occurrence of smoking in 601 films. Setting Randomly selected middle schools in Vermont and New Hampshire, USA. Main outcome measure Number of schoolchildren who had ever tried smoking a cigarette. Results The films contained a median of 5 (interquartile range 1-12) occurrences of smoking. The typical adolescent had seen 17 of 50 films listed. Exposure to smoking in films varied widely: median 91 (49-152) occurrences. The prevalence of ever trying smoking increased with higher categories of exposure: 4.9% among students who saw 0-50 occurrences of smoking, 13.7% for 51-100 occurrences, 22.1% for 101-150, and 31.3% for >150. The association remained significant after adjustment for age; sex; school performance; school; parents' education; smoking by friend, sibling, or parent; and receptivity to tobacco promotions. The adjusted odds ratios of ever trying smoking for students in the higher categories of exposure, compared with students exposed to 0-50 occurrences of smoking in films, were 1.7 (95% confidence interval 1.2 to 2.4), 2.4 (1.7 to 3.4), and 2.7 (2.0 to 3.8). These odds ratios were not substantially affected by adjustment for parenting style or for personality traits of the adolescent. Conclusion In this sample of adolescents there was a strong, direct, and independent association between seeing tobacco use in films and trying cigarettes, a finding that supports the hypothesis that smoking in films has a role in the initiation of smoking in adolescents. What is already known on this topicSmoking is often depicted in films, and watching films is a favourite activity of adolescentsAdolescents whose favourite actors smoke in films are more likely to have tried smokingWhat this study addsAdolescents' exposure to smoking in films varies widely

  5. Fully integrated optical coherence tomography, ultrasound, and indocyanine green-based fluorescence tri-modality system for intravascular imaging.

    PubMed

    Li, Yan; Jing, Joseph; Qu, Yueqiao; Miao, Yusi; Zhang, Buyun; Ma, Teng; Yu, Mingyue; Zhou, Qifa; Chen, Zhongping

    2017-02-01

    We present a tri-modality imaging system and fully integrated tri-modality probe for intravascular imaging. The tri-modality imaging system is able to simultaneously acquire optical coherence tomography (OCT), ultrasound (US), and fluorescence imaging. Moreover, for fluorescence imaging, we used the FDA-approved indocyanine green (ICG) dye as the contrast agent to target lipid-loaded macrophages. We conducted imaging from a male New Zealand white rabbit to evaluate the performance of the tri-modality system. In addition, tri-modality images of rabbit aortas were correlated with hematoxylin and eosin (H&E) histology to check the measurement accuracy. The fully integrated miniature tri-modality probe, together with the use of ICG dye suggest that the system is of great potential for providing a more accurate assessment of vulnerable plaques in clinical applications.

  6. Fully integrated optical coherence tomography, ultrasound, and indocyanine green-based fluorescence tri-modality system for intravascular imaging

    PubMed Central

    Li, Yan; Jing, Joseph; Qu, Yueqiao; Miao, Yusi; Zhang, Buyun; Ma, Teng; Yu, Mingyue; Zhou, Qifa; Chen, Zhongping

    2017-01-01

    We present a tri-modality imaging system and fully integrated tri-modality probe for intravascular imaging. The tri-modality imaging system is able to simultaneously acquire optical coherence tomography (OCT), ultrasound (US), and fluorescence imaging. Moreover, for fluorescence imaging, we used the FDA-approved indocyanine green (ICG) dye as the contrast agent to target lipid-loaded macrophages. We conducted imaging from a male New Zealand white rabbit to evaluate the performance of the tri-modality system. In addition, tri-modality images of rabbit aortas were correlated with hematoxylin and eosin (H&E) histology to check the measurement accuracy. The fully integrated miniature tri-modality probe, together with the use of ICG dye suggest that the system is of great potential for providing a more accurate assessment of vulnerable plaques in clinical applications. PMID:28271001

  7. High Performance Computing for Dsm Extraction from ZY-3 Tri-Stereo Imagery

    NASA Astrophysics Data System (ADS)

    Lu, Shuning; Huang, Shicun; Pan, Zhiqiang; Deng, Huawu; Stanley, David; Xin, Yubin

    2016-06-01

    ZY-3 has been acquiring high quality imagery since its launch in 2012 and its tri-stereo (three-view or three-line-array) imagery has become one of the top choices for extracting DSM (Digital Surface Model) products in China over the past few years. The ZY-3 tri-stereo sensors offer users the ability to capture imagery over large regions including an entire territory of a country, such as China, resulting in a large volume of ZY-3 tri-stereo scenes which require timely (e.g., near real time) processing, something that is not currently possible using traditional photogrammetry workstations. This paper presents a high performance computing solution which can efficiently and automatically extract DSM products from ZY-3 tri-stereo imagery. The high performance computing solution leverages certain parallel computing technologies to accelerate computation within an individual scene and then deploys a distributed computing technology to increase the overall data throughput in a robust and efficient manner. By taking advantage of the inherent efficiencies within the high performance computing environment, the DSM extraction process can exploit all combinations offered from a set of tri-stereo images (forward-backword, forward-nadir and backword-nadir). The DSM results merged from all of the potential combinations can minimize blunders (e.g., incorrect matches) and also offer the ability to remove potential occlusions which may exist in a single stereo pair, resulting in improved accuracy and quality versus those that are not merged. Accelerated performance is inherent within each of the individual steps of the DSM extraction workflow, including the collection of ground control points and tie points, image bundle adjustment, the creation of epipolar images, and computing elevations. Preliminary experiments over a large area in China have proven that the high performance computing system can generate high quality and accurate DSM products in a rapid manner.

  8. Crystal structures of three complexes of zinc chloride with tri-tert-butyl-phosphane.

    PubMed

    Finke, Aaron D; Gray, Danielle L; Moore, Jeffrey S

    2016-01-01

    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl-phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis-[chlorido-bis-(tri-tert-butyl-phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter-act weakly with C-H groups on the phosphane ligand. In the presence of THF, monomeric di-chlorido-(tetra-hydro-furan-κO)(tri-tert-butyl-phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra-hedral Zn complex has weak C-H⋯Cl inter-actions between the Cl atoms and phosphane and THF C-H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl-phospho-nium aqua-tri-chlorido-zincate 1,2-di-chloro-ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3](+) [(H2O)ZnCl3](-)·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3](-) anions from hydrogen-bonding inter-actions between the water H atoms and Cl atoms that propagate along the b axis.

  9. Crystal structures of three N-ar-yl-2,2,2-tri-bromo-acetamides.

    PubMed

    Sreenivasa, S; Naveen, S; Lokanath, N K; Supriya, G M; Lakshmikantha, H N; Suchetan, P A

    2015-09-01

    Three N-ar-yl-2,2,2-tri-bromo-acetamides, namely, 2,2,2-tri-bromo-N-(2-fluoro-phen-yl)-acetamide, C8H5Br3FNO, (I), 2,2,2-tri-bromo-N-[3-(tri-fluoro-methyl)-phen-yl]-acetamide, C9H5Br3F3NO, (II) and 2,2,2-tri-bromo-N-(4-fluoro-phen-yl)-acetamide, C8H5Br3FNO, (III) were synthesized and their crystal structures were analysed. In the crystal structure of (I), C-Br⋯πar-yl inter-actions connect the mol-ecules into dimers, which in turn are connected via Br⋯Br contacts [3.6519 (12) Å], leading to the formation of a one-dimensional ladder-type architecture. The crystal structure of (II) features chains linked by N-H⋯O and C-H⋯O hydrogen bonds. Two such chains are inter-linked to form ribbons through Br⋯Br [3.6589 (1) Å] and Br⋯F [3.0290 (1) Å] inter-actions. C-Br⋯πar-yl and C-F⋯πar-yl inter-actions between the ribbons extend the supra-molecular architecture of (II) from one dimension to two. In (III), the mol-ecules are connected into R 2 (2)(8) dimers via pairs of C-H⋯F inter-actions and these dimers form ribbons through Br⋯Br [3.5253 (1) Å] contacts. The ribbons are further inter-linked into columns via C-Br⋯O=C contacts, forming a two-dimensional architecture.

  10. Tri-linear interpolation-based cerebral white matter fiber imaging.

    PubMed

    Jiang, Shan; Zhang, Pengfei; Han, Tong; Liu, Weihua; Liu, Meixia

    2013-08-15

    Diffusion tensor imaging is a unique method to visualize white matter fibers three-dimensionally, non-invasively and in vivo, and therefore it is an important tool for observing and researching neural regeneration. Different diffusion tensor imaging-based fiber tracking methods have been already investigated, but making the computing faster, fiber tracking longer and smoother and the details shown clearer are needed to be improved for clinical applications. This study proposed a new fiber tracking strategy based on tri-linear interpolation. We selected a patient with acute infarction of the right basal ganglia and designed experiments based on either the tri-linear interpolation algorithm or tensorline algorithm. Fiber tracking in the same regions of interest (genu of the corpus callosum) was performed separately. The validity of the tri-linear interpolation algorithm was verified by quantitative analysis, and its feasibility in clinical diagnosis was confirmed by the contrast between tracking results and the disease condition of the patient as well as the actual brain anatomy. Statistical results showed that the maximum length and average length of the white matter fibers tracked by the tri-linear interpolation algorithm were significantly longer. The tracking images of the fibers indicated that this method can obtain smoother tracked fibers, more obvious orientation and clearer details. Tracking fiber abnormalities are in good agreement with the actual condition of patients, and tracking displayed fibers that passed though the corpus callosum, which was consistent with the anatomical structures of the brain. Therefore, the tri-linear interpolation algorithm can achieve a clear, anatomically correct and reliable tracking result.

  11. Male injection drug users try new drugs following U.S. deportation to Tijuana, Mexico.

    PubMed

    Robertson, Angela M; Rangel, M Gudelia; Lozada, Remedios; Vera, Alicia; Ojeda, Victoria D

    2012-01-01

    Among male injection drug users (IDUs) in Tijuana, Mexico, U.S. deportation is associated with HIV transmission. Changing drug use behaviors following deportation, including the use of new drugs, may increase HIV risk but are understudied. We identify correlates of trying new drugs following male IDUs' most recent U.S. deportation to Mexico. In 2010, we recruited 328 deported male IDUs in Tijuana, Mexico. Questionnaires collected retrospective data on drug use and other HIV risk behaviors throughout migratory events. Logistic regression identified correlates of trying new drugs/combinations following their most recent deportations. Informed consent was obtained from all participants. Nearly one in six men (n=52, 16%) tried new drugs following their most recent deportation, including heroin (n=31), methamphetamine (n=5), and heroin/methamphetamine combined (n=17). Trying new drugs following deportation was independently associated with U.S. incarceration (adjusted odds ratio [AOR]=3.96; 95% confidence interval [C.I.] 1.78, 8.84), increasing numbers of U.S. deportations (AOR=1.11 per deportation; C.I. 1.03, 1.20), feeling sad following deportation (AOR 2.69; C.I. 1.41, 5.14), and perceiving that one's current lifestyle increases HIV/AIDS risk (AOR 3.91; C.I. 2.05, 7.44). Trying new drugs following U.S. deportation may be related to the unique contexts and stressors experienced by drug-abusing migrants as they attempt to reestablish their lives in Mexico. Findings imply an unmet need for health and social programs to alleviate pre- and post-deportation stressors faced by undocumented and return migrants in the U.S.-Mexico context. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  12. Male injection drug users try new drugs following U.S. deportation to Tijuana, Mexico

    PubMed Central

    Robertson, Angela M.; Rangel, M. Gudelia; Lozada, Remedios; Vera, Alicia; Ojeda, Victoria D.

    2011-01-01

    Background Among male injection drug users (IDUs) in Tijuana, Mexico, U.S. deportation is associated with HIV transmission. Changing drug use behaviors following deportation, including the use of new drugs, may increase HIV risk but are understudied. We identify correlates of trying new drugs following male IDUs’ most recent U.S. deportation to Mexico. Methods In 2010, we recruited 328 deported male IDUs in Tijuana, Mexico. Questionnaires collected retrospective data on drug use and other HIV risk behaviors throughout migratory events. Logistic regression identified correlates of trying new drugs/combinations following their most recent deportations. Informed consent was obtained from all participants. Results Nearly one in six men (n=52, 16%) tried new drugs following their most recent deportation, including heroin (n=31), methamphetamine (n=5), and heroin/methamphetamine combined (n=17). Trying new drugs following deportation was independently associated with U.S. incarceration (adjusted odds ratio [AOR]= 3.96; 95% confidence interval [C.I.] 1.78, 8.84), increasing numbers of U.S. deportations (AOR=1.11 per deportation; C.I. 1.03, 1.20), feeling sad following deportation (AOR 2.69; C.I. 1.41, 5.14), and perceiving that one’s current lifestyle increases HIV/AIDS risk (AOR 3.91; C.I. 2.05, 7.44). Conclusions Trying new drugs following U.S. deportation may be related to the unique contexts and stressors experienced by drug-abusing migrants as they attempt to reestablish their lives in Mexico. Findings imply an unmet need for health and social programs to alleviate pre-and post-deportation stressors faced by undocumented and return migrants in the U.S.-Mexico context. PMID:21835559

  13. Quantification of Tri5 gene, expression, and deoxynivalenol production during the malting of barley.

    PubMed

    Vegi, Anuradha; Schwarz, Paul; Wolf-Hall, Charlene E

    2011-11-01

    Fusarium can survive, grow, and produce mycotoxins during malting. We evaluated the percentage of barley kernels infected with Fusarium (FI) and deoxynivalenol (DON) concentration in three barley treatments (high-quality, naturally infected, and Fusarium graminearum inoculated barley) during various stages of malting. We also applied real-time polymerase chain reaction (real-time PCR) and real-time reverse transcriptase PCR (real-time RT-PCR) methods to quantify trichothecene-producing (Tri5) DNA concentration and expression, respectively. We observed that FI significantly (P<0.05) increased during the germination stage of malting in all barley treatments. Temperatures of 49°C and higher during kilning reduced the FI in high-quality barley treatments, but for inoculated treatments temperatures in excess of 60°C were needed to reduce FI. The Tri5 DNA concentration ranged from non-detectable to 3.9 ng/50mg, 0.1 to 109.8 ng/50mg and 3.4 to 397.5 ng/50 mg in malted high-quality, inoculated and naturally infected barley treatments respectively. Strong gene expression (Tri5) in naturally infected barley treatments was found during the third day of germination, when compared to high-quality and inoculated barley treatments during malting. Deoxynivalenol was present even at high kilning temperatures, as DON is heat stable. The average DON concentration ranged from non-detectable to 0.1 μg/g, non-detectable to 1.1 μg/g, and 1.5 to 45.9 μg/g during various stages of malting in high-quality, inoculated and infected barley and malt samples respectively. Overall, the last 2 days of germination and initial stages of kilning were peak stages for FI, Tri5 gene production, Tri5 gene expression and DON production.

  14. Shock initiation of the tri-amino-tri-nitro-benzene based explosive PBX 9502 cooled to -55 bold">°C

    NASA Astrophysics Data System (ADS)

    Gustavsen, Richard L.; Gehr, Russell J.; Bucholtz, Scott M.; Alcon, Robert R.; Bartram, Brian D.

    2012-10-01

    We report a series of shock initiation experiments on PBX 9502 cooled to -55 °C. PBX 9502 consists of 95% dry aminated tri-amino-tri-nitro-benzene (TATB) and 5% poly-chloro-trifluoro-ethylene5 (Kel-F 800) binder. PBX 9502 samples were shock initiated by projectile impact from a two stage gas gun. Buildup to detonation was measured with 10 or more particle velocity gauges embedded at different depths in the sample. Three shock wave trackers measured the position of the shock front with time. Particle velocity vs. time wave-profiles and coordinates for onset of detonation were obtained as a function of the impact stress or pressure. PBX 9502 sample temperatures were monitored using type-E thermocouples, two inside the sample and two on the sample surface. Additional thermocouples were mounted on other parts of the cooling apparatus. Wave profiles from embedded gauges are qualitatively similar to those observed at 23 °C. However, at -55 °C, PBX 9502 is much less sensitive than at 23 °C. For example, at an inpact stress of 15.4 GPa, the distance to detonation at -55 °C is 7.8 mm. At 23 °C, the distance is 4.3 mm.

  15. [Gd(Try-TTDA)(H2O)]2-: a new MRI contrast agent for copper ion sensing.

    PubMed

    Kasala, Dayananda; Lin, Tsung-Sheng; Chen, Chiao-Yun; Liu, Gin-Chung; Kao, Chai-Lin; Cheng, Tian-Lu; Wang, Yun-Ming

    2011-05-14

    In this study, we have developed two new L-tryptophan based contrast agents [Gd(Try-TTDA)(H(2)O)](2-) and [Gd(Try-ac-DOTA)(H(2)O)](-). Upon addition of Cu(II) to [Gd(Try-TTDA)(H(2)O)](2-), significant increases in the relaxivity (r(1)) and hydration number of [Gd(Try-TTDA)(H(2)O)](2-) were observed. However, it only induced a minute increase in the relaxivity (r(1)) in the case of [Gd(Try-ac-DOTA)(H(2)O)](-). Furthermore, the interaction of Cu(II) with the indole ring of Gd(III) complexes was explored by measuring the intrinsic fluorescence of the tryptophan of the Gd(III) complex. With the addition of one equivalent of Cu(II) to [Gd(Try-TTDA)(H(2)O)](2-) the indole fluorescence was completely quenched. Moreover, the [Gd(Try-TTDA)(H(2)O)](2-) complex shows excellent selectivity towards Cu(II) over other metal ions (Cu(II) > La(III) > Mg(II)). Importantly, the significant signal intensity (2073 ± 67) for in vitro MR imaging using [Gd(Try-TTDA)(H(2)O)](2-) in the presence of Cu(II) implicates that this new smart contrast agent ([Gd(Try-TTDA)(H(2)O)](2-)) can serve as a Cu(II) sensor for MR imaging.

  16. 75 FR 25310 - Port Harbor Railroad, Inc.-Lease and Operation Exemption-Line of Tri-City Regional Port District

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-05-07

    ... Surface Transportation Board Port Harbor Railroad, Inc.--Lease and Operation Exemption--Line of Tri-City... of exemption under 49 CFR 1150.31 to lease from Tri- City Regional Port District (Tri-City), and to... as a result of this transaction will not exceed $5 million. According to Port Harbor, Tri-City is not...

  17. Measurements of shock initiation in the tri-amino-tri-nitro-benzene based explosive PBX 9502: Wave forms from embedded gauges and comparison of four different material lots

    NASA Astrophysics Data System (ADS)

    Gustavsen, R. L.; Sheffield, S. A.; Alcon, R. R.

    2006-06-01

    We have completed a series of ambient temperature (23+/-2 °C) shock initiation experiments on four lots (batches) of the insensitive high explosive PBX 9502. PBX 9502 consists by weight of 95% dry-aminated tri-amino-tri-nitro-benzene (TATB) and 5% of the plastic binder Kel-F 800, a 3/1 copolymer of chloro-trifluoro-ethylene and vinylidene-fluoride. Two of the four lots were manufactured using the ``virgin'' process. Both of these lots had few fine TATB particles. One virgin lot was stored the majority of its life (>15 yr) as a molding powder and pressed as a 240 mm diameter by 130 mm thick cylinder. The other virgin lot was stored the majority of its life as a hollow hemispherical pressing. Two lots were manufactured using the ``recycle'' process and had many fine TATB particles. One recycled lot was stored the majority of its life as a molding powder, while the other was stored as a pressed charge. Shock initiation experiments were performed using precisely characterized planar shocks generated by impacting an explosive sample with a projectile accelerated in a two-stage gas gun. The evolution of the shock into a detonation was measured using 10 or 11 embedded electromagnetic particle velocity gauges and three ``shock tracker'' gauges. Results include the following: (1) high quality particle velocity wave forms which should be useful for calibrating reactive burn models, (2) no difference in the sustained shock initiation response between lots regardless of material processing or storage history, (3) responses for all lots equivalent to those measured by Dick et al. [J. Appl. Phys. 63, 4881 (1988)], additional Hugoniot and Pop-plot data for PBX 9502, and (5) the short shock response which, when compared to the sustained shock response, shows no extension in the run distance unless the rarefaction overtakes the shock front prior to the distance it would have run towards a detonation as a sustained shock.

  18. Histone acetylation dependent energy landscapes in tri-nucleosome revealed by residue-resolved molecular simulations

    PubMed Central

    Chang, Le; Takada, Shoji

    2016-01-01

    Histone tail acetylation is a key epigenetic marker that tends to open chromatin folding and activate transcription. Despite intensive studies, precise roles of individual lysine acetylation in chromatin folding have only been poorly understood. Here, we revealed structural dynamics of tri-nucleosomes with several histone tail acetylation states and analyzed histone tail interactions with DNA by performing molecular simulations at an unprecedentedly high resolution. We found versatile acetylation-dependent landscapes of tri-nucleosome. The H4 and H2A tail acetylation reduced the contact between the first and third nucleosomes mediated by the histone tails. The H3 tail acetylation reduced its interaction with neighboring linker DNAs resulting in increase of the distance between consecutive nucleosomes. Notably, two copies of the same histone in a single nucleosome have markedly asymmetric interactions with DNAs, suggesting specific pattern of nucleosome docking albeit high inherent flexibility. Estimated transcription factor accessibility was significantly high for the H4 tail acetylated structures. PMID:27698366

  19. Solar tri-diurnal variation of cosmic rays in a wide range of rigidity

    NASA Technical Reports Server (NTRS)

    Mori, S.; Ueno, H.; Fujii, Z.; Morishita, I.; Nagashima, K.

    1985-01-01

    Solar tri-diurnal variations of cosmic rays have been analyzed in a wide range of rigidity, using data from neutron monitors, and the surface and underground muon telescopes for the period 1978-1983. The rigidity spectrum of the anisotropy in space is assumed to be of power-exponential type as (P/gamma P sub o) to the gamma exp (gamma-P/P sub o). By means of the best-fit method between the observed and the expected variations, it is obtained that the spectrum has a peak at P (=gamma P sub o) approx = 90 GV, where gamma=approx 3.0 and P sub o approx. 30 GV. The phase in space of the tri-diurnal variation is also obtained as 7.0 hr (15 hr and 23 hr LT), which is quite different from that of approx. 1 hr. arising from the axisymmetric distribution of cosmic rays with respect to the IMF.

  20. NASA Marshall Space Flight Center Tri-gas Thruster Performance Characterization

    NASA Technical Reports Server (NTRS)

    Dorado, Vanessa; Grunder, Zachary; Schaefer, Bryce; Sung, Meagan; Pedersen, Kevin

    2013-01-01

    Historically, spacecraft reaction control systems have primarily utilized cold gas thrusters because of their inherent simplicity and reliability. However, cold gas thrusters typically have a low specific impulse. It has been determined that a higher specific impulse can be achieved by passing a monopropellant fluid mixture through a catalyst bed prior to expulsion through the thruster nozzle. This research analyzes the potential efficiency improvements from using tri-gas, a mixture of hydrogen, oxygen, and an inert gas, which in this case is helium. Passing tri-gas through a catalyst causes the hydrogen and oxygen to react and form water vapor, ultimately heating the exiting fluid and generating a higher specific impulse. The goal of this project was to optimize the thruster performance by characterizing the effects of varying several system components including catalyst types, catalyst lengths, and initial catalyst temperatures.

  1. Efficient tri-wavelength actively Q-switched Yb:GAGG laser

    NASA Astrophysics Data System (ADS)

    Zhao, Ruwei; Zhang, Baitao; Jia, Zhitai; Su, Xiancui; Lou, Fei; Zhang, Haikun; He, Jingliang; Liu, Fengqin

    2015-01-01

    An efficient acousto-optic Q-switched Yb-doped Gd3AlxGa5-xO12 (GAGG) (x = 0.5) laser is demonstrated. Under the absorbed pump power of 7.4 W, the maximum average output power of 1.4 W is obtained at the pulse repletion rate of 1 kHz , with the slope efficiency as high as 32%. The pulse width of 40 ns is achieved with the pulse energy and peak power of 1.4 mJ and 35 kW, respectively. What' more, the output spectrum shows itself tri-wavelength in either CW or Q-switching mode. To our knowledge, this is the first time for realizing simultaneous tri-wavelength Yb:GAGG laser actively Q-switched operation.

  2. Tri-Gate Normally-Off GaN Power MISFET

    SciTech Connect

    Lu, B; Matioli, E; Palacios, T

    2012-03-01

    We present a new normally-off GaN transistor-the tri-gate normally-off GaN metal-insulator-semiconductor field-effect transistor (MISFET). Due to the excellent channel control of a new 3-D gate structure, a breakdown voltage of 565 V has been achieved at a drain leakage current of 0.6 mu A/mm and V-gs = 0. The new device has an on/off current ratio of more than eight orders of magnitude and a subthreshold slope of 86 +/- 9 mV/decade. The threshold voltage of the new device is 0.80 +/- 0.06 V with a maximum drain current of 530 mA/mm. These results confirm the great potential of the tri-gate normally-off GaN-on-Si MISFETs for the next generation of power electronics.

  3. Status of the TRI μP project. Results of commissioning experiments

    NASA Astrophysics Data System (ADS)

    Wilschut, H. W.; Dammalapati, U.; de, S.; Dendooven, P.; Dermois, O.; Jungmann, K.; Mol, A. J.; Onderwater, C. J. G.; Rogachevskiy, A.; da Silva, M.; Sohani, M.; Traykov, E.; Willmann, L.

    2007-01-01

    At KVI the technical structures for the TRI μP facility are nearly all in place. The aim of the project is to use radioactive ions to study fundamental interactions and symmetries. We will measure β-recoil correlations in nuclear β decay. There the V,A structure of the Weak interaction may be violated. The second line of research is the search for a permanent electric dipole moment in Ra, with a magnitude forbidden by the Standard Model. By trapping these radioactive nuclei in atom traps a pure sample that can be manipulated facilitates these searches. The TRI μP facility consists of a production target and magnetic separator on the high energy side and a Radio-Frequency Quadrupole (RFQ) cooler and buncher on the low energy side. An ion catcher stops the fast product nuclides and transport them into the RFQ cooler. New technological approaches were implemented for several of these devices.

  4. Direct simulations of spherical particle suspensions in a sliding tri-perioidic cell

    NASA Astrophysics Data System (ADS)

    Ryol Hwang, Wook; Hulsen, Martien A.; Kwon, Tai Hun; Meijer, Han E. H.

    2007-11-01

    We present a finite-element/fictitious-domain scheme for 3D direct simulations of suspensions of spherical particles in a Newtonian fluid in simple shear flow in a tri-periodic computational domain, which is a 3D extension of the authors' previous 2-D work [J. Comput. Phys. 194 (2004) 742]. The sliding tri-periodic cell, where suspensions in an unbounded domain in simple shear may be treated by a representative particulate problem in a unit cell, has been implemented with the mortar element method. The force-free torque-free rigid body motion of ta spherical particle is described by the rigid-shell description and implemented by Lagrangian multipliers only on the particle boundary. The bulk stress is obtained by simple boundary integrals. Through the several example problems, we discuss the the rheological properties of the bulk shear viscosity and the first/second normal stress coefficients.

  5. Dual and tri-band bandpass filters based on novel Π-shaped resonator

    NASA Astrophysics Data System (ADS)

    Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

    2014-05-01

    A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

  6. The Dycal try-in technique for Resin-bonded bridges.

    PubMed

    Poyser, Neil J; Briggs, Peter F A

    2004-09-01

    The resin-bonded bridge (RBB) is a predictable technique that has a useful place in modern day dentistry. Practitioners' main concerns, regarding this technique, are a lower survival rate when compared with conventional prostheses, and unpredictable aesthetics. Unfortunately, the minimal preparation and adhesive concepts used with RBBs complicates provisional cementation. Ideally, the RBB should be assessed as if it were the definitively bonded prosthesis. It is possible to achieve a good final aesthetic result as the grey shine-through of the metal wing can be eliminated by the use of opaque resin cements such as Panavia 21 OP. Ideally, the restoration should be assessed with an identical opaque try-in paste but, unfortunately, such a proprietary paste is not available. This paper describes the use of Dycal as a try-in paste for provisionally cementing a resin-bonded bridge and the benefits this offers.

  7. Three-dimensional shape measurement of small object based on tri-frequency heterodyne method

    NASA Astrophysics Data System (ADS)

    Liu, Shouqi; Feng, Wei; Zhang, Qican; Liu, Yuankun

    2015-08-01

    Among temporal phase unwrapping methods based on structured light projection, tri-frequency heterodyne method, with the merits of less projected fringe, high precision and high reliability, has become a practical method in objects three-dimensional (3D) shape measurement. In this paper, a 3D shape measuring system was developed with a digital micromirror device (DMD) and synchronously trigged CCD camera. The 3D shape of a measured object was reconstructed from the deformed fringe patterns based on tri-frequency heterodyne method. The practical experiments were carried on some coins, and the results show that the system can restore their 3D shape on the tested partition with an accuracy of microns. This measurement system is prominent in 3D shape measurement of small or tiny objects, sample testing, and many other application fields.

  8. Operator Interface and Control Software for the Reconfigurable Surface System Tri-ATHLETE

    NASA Technical Reports Server (NTRS)

    Norris, Jeffrey S.; Vona, Marsette A.; Rus, Daniela

    2012-01-01

    Graphical operator interface methods have been developed for modular, reconfigurable articulated surface systems in general, and a specific instantiation thereof for JPL's Tri-ATHLETE. The All- Terrain Hex-Limbed Extra-Terrestrial Explorer Robot (ATHLETE) has six limbs with six kinematic degrees of freedom each. The core advancement of this work was the development of a novel set of algorithms for dynamically maintaining a reduced coordinate model of any connected assembly of robot modules.

  9. Crystal structures of three 3,4,5-tri-meth-oxy-benzamide-based derivatives.

    PubMed

    Gomes, Ligia R; Low, John Nicolson; Oliveira, Catarina; Cagide, Fernando; Borges, Fernanda

    2016-05-01

    The crystal structures of three benzamide derivatives, viz. N-(6-hy-droxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C16H25NO5, (1), N-(6-anilinohex-yl)-3,4,5-tri-meth-oxy-benzamide, C22H30N2O4, (2), and N-(6,6-di-eth-oxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C20H33NO6, (3), are described. These compounds differ only in the substituent at the end of the hexyl chain and the nature of these substituents determines the differences in hydrogen bonding between the mol-ecules. In each mol-ecule, the m-meth-oxy substituents are virtually coplanar with the benzyl ring, while the p-meth-oxy substituent is almost perpendicular. The carbonyl O atom of the amide rotamer is trans related with the amidic H atom. In each structure, the benzamide N-H donor group and O acceptor atoms link the mol-ecules into C(4) chains. In 1, a terminal -OH group links the mol-ecules into a C(3) chain and the combined effect of the C(4) and C(3) chains is a ribbon made up of screw related R 2 (2)(17) rings in which the ⋯O-H⋯ chain lies in the centre of the ribbon and the tri-meth-oxy-benzyl groups forms the edges. In 2, the combination of the benzamide C(4) chain and the hydrogen bond formed by the terminal N-H group to an O atom of the 4-meth-oxy group link the mol-ecules into a chain of R 2 (2)(17) rings. In 3, the mol-ecules are linked only by C(4) chains.

  10. Phenomenological implications of two simple modifications to Tri-Bimaximal mixing

    NASA Astrophysics Data System (ADS)

    Channey, Kanwaljeet S.; Kumar, Sanjeev

    2017-08-01

    We study the phenomenological implications of breaking the Tri-Bimaximal (TBM) mixing in such a way that either first or second column of TBM mixing matrix remains invariant. We present two such textures and confront them with the experimental data. We give the predictions of these textures for atmospheric mixing angle 𝜃23 and Dirac-type CP violating phase δ that will be measured in the future experiments.

  11. Reverse osmosis performance with solutions containing tri-n-butyl phosphate

    SciTech Connect

    Siler, J.L.

    1991-10-22

    Tests were conducted to determine whether the reverse osmosis (RO) units at the F/H Effluent Treatment Facility (ETF) at the Savannah River could be made to process solutions containing tri-n-butyl phosphate (TBP). It was desired to test whether operation at a feed pH other than neutral would improve performance. Test results are discussed in this report and indicate that little improvement in the water flux can be expected at other pH values.

  12. Rapid purification of tri-iodothyronine and thyroxine protein conjugates for antibody production.

    PubMed

    Burke, C W; Shakespear, R A

    1975-04-01

    Thyroxine (T-4) and tri-iodothyronine (T-3) were coupled to human serum albumin (HSA) with carbodi-imide. By adsorption chromatography on Sephadex G-25, fractions containing purified conjugate, but not reversibly-bound T-3 or T-4, were obtained, and this procedure took 5 h; considerably less than the conventional dialysis technique. Highly specific high-titre antisera were produced in rabbits and guinea-pigs by injection of these fractions in Freund's adjuvant.

  13. Measurement of Exercise Intensity with a Tri-Axial Accelerometer during Military Training

    DTIC Science & Technology

    2009-10-01

    PO Box 90.004 3509 AA Utrecht The Netherlands ABSTRACT Exercise load and intensity, as reflected in energy expenditure, are determinants of...sustainable lifestyles. Variance in activity energy expenditure, calculated as total energy expenditure minus resting expenditure, was explained for...acceleration measured with the waist- device. In conclusion, after adjusting for differences in body mass, the newly developed tri-axial accelerometer for

  14. Fatigue behavior of wood-fiber-based tri-axial engineered sandwich composite panels (ESCP)

    Treesearch

    Jinghao Li; John F. Hunt; Shaoqin Gong; Zhiyong Cai

    2015-01-01

    The static and fatigue bending behavior of wood-fiber-based tri-axial engineered sandwich composite panels (ESCP) has been investigated by four-point bending tests. Fatigue panels and weakened panels (wESCP) with an initial interface defect were manufactured for the fatigue tests. Stress σ vs. number of cycles curves (S-N) were recorded under the different stress...

  15. Ambipolar Organic Tri-Gate Transistor for Low-Power Complementary Electronics.

    PubMed

    Torricelli, Fabrizio; Ghittorelli, Matteo; Smits, Edsger C P; Roelofs, Christian W S; Janssen, René A J; Gelinck, Gerwin H; Kovács-Vajna, Zsolt M; Cantatore, Eugenio

    2016-01-13

    Ambipolar transistors typically suffer from large off-current inherently due to ambipolar conduction. Using a tri-gate transistor it is shown that it is possible to electrostatically switch ambipolar polymer transistors from ambipolar to unipolar mode. In unipolar mode, symmetric characteristics with an on/off current ratio of larger than 10(5) are obtained. This enables easy integration into low-power complementary logic and volatile electronic memories.

  16. Tri-Service Champus Statistical Database Project (TCSDP): Champus Ambulatory Data Analysis. Detail Report

    DTIC Science & Technology

    1993-03-30

    3 AD-A277 998l IlEHhIlII TRI-SERVICE CHAMPUS STATISTICAL * oDATABASE PROJECT * (TCSDP) l CHAMPUS AMBULATORY DATA ANALYSIS DETAIL REPORT I OFFICE OF...or 5 3 All other requests for reports will be directed to the following: U.S. Department of Commerce National Technical Information Service (NTIS...CLASSIFICATION AUTHORITY 3 DISTRIBUTION /AVAILABILITY OF REPORT * Distribution Unlimited 2b DECLASSIFICATIONI DOWNGRADING SCHEDULE Public

  17. Synergistic Physical Properties of Co-Cured Networks Formed from Di- and Tri-cyanate Esters

    DTIC Science & Technology

    2013-09-01

    Guenthner , Josiah T. Reams, Kevin R. Lamison, Sean M. Ramirez David D. Swanson, Gregory R. Yandek, Christopher M. Sahagun Matthew C. Davis Joseph M...Co-Cured Networks Formed from Di- and Tri-cyanate Esters” Andrew J. Guenthner * 1 , Josiah T. Reams 2 , Kevin R. Lamison 2 , Sean M. Ramirez 2... Guenthner , A. J.; Groshens, T. J.; Reams, J. T.; Mabry, J. M., J. Polym. Sci. Part A, Polym. Chem. 2012, 50, 4127-4136. S2. Guenthner , A. J.; Davis, M

  18. Reverse osmosis performance with solutions containing tri-n-butyl phosphate

    SciTech Connect

    Siler, J.L.

    1991-10-22

    Tests were conducted to determine whether the reverse osmosis (RO) units at the F/H Effluent Treatment Facility (ETF) at the Savannah River could be made to process solutions containing tri-n-butyl phosphate (TBP). It was desired to test whether operation at a feed pH other than neutral would improve performance. Test results are discussed in this report and indicate that little improvement in the water flux can be expected at other pH values.

  19. Autonomous Underwater Vehicle Control Coordination Using a Tri-Level Hybrid Software Architecture

    DTIC Science & Technology

    1996-01-01

    Tri-Level Hybrid Software Architecture A. J. Healey1, D. B. Marco, R. B. McGhee Autonomous Underwater Vehicle Laboratory Naval Postgraduate School...the software architecture to implement them is often composed of three levels for ease of segregation and development of functionality. An...the development of coastal environmental understanding, new technology is being aimed at using (semi)autonomous vehicles, requiring acoustic

  20. Prevention of gastric mucosal lesions in rats by tri-potassium di-citrato bismuthate.

    PubMed

    Malandrino, S; Campagnoli, G; Borsa, M; Guidoboni, R; Tonon, G C

    1984-01-01

    Tri-potassium di-citrato bismuthate given intragastrically to rats 60 min before administration of necrotizing agents such as 85% ethanol, 0.2 N sodium hydroxide or acidified indomethacin, reduced the formation of mucosal lesions dose-dependently. Prostaglandin I2 (PGI2)-like material, determined by bioassay, was higher in the gastric mucosa of animals treated with bismuth subcitrate complex than in control animals.

  1. Tri-Level Optimization Algorithms for Solving Defender-Attacker-Defender Network Models

    DTIC Science & Technology

    2016-06-01

    shortest path, minimum cost flow, algorithms, network defense, network interdiction, network modeling , system defense 15. NUMBER OF PAGES 259 16. PRICE ...ALGORITHMS FOR SOLVING DEFENDER-ATTACKER-DEFENDER NETWORK MODELS by Gary L. Lazzaro June 2016 Dissertation Supervisor: W. Matthew Carlyle THIS PAGE...TITLE AND SUBTITLE TRI-LEVEL OPTIMIZATION ALGORITHMS FOR SOLVING DEFENDER- ATTACKER-DEFENDER NETWORK MODELS 5. FUNDING NUMBERS 6. AUTHOR(S) Gary L

  2. Institutionalizing the Tri-Focal View: Continuing a Performance Evaluation Concept

    DTIC Science & Technology

    2006-02-07

    360 Degree Feedback and Perfomance Appraisal.”Training, Vol. 34, (1997): 62-68. Newman, Richard J, “ Job Reviews go Full Circle.” U.S. News...Institutionalizing the Tri-Focal View: Continuing a Performance Evaluation Concept Subject Area Leadership EWS 2006...and how he (the candidate) views his own performance. This methodology has proved to be an effective litmus test for leadership potential since

  3. Insights into operation of planar tri-gate tunnel field effect transistor for dynamic memory application

    NASA Astrophysics Data System (ADS)

    Navlakha, Nupur; Kranti, Abhinav

    2017-07-01

    Insights into device physics and operation through the control of energy barriers are presented for a planar tri-gate Tunnel Field Effect Transistor (TFET) based dynamic memory. The architecture consists of a double gate (G1) at the source side and a single gate (G2) at the drain end of the silicon film. Dual gates (G1) effectively enhance the tunneling based read mechanism through the enhanced coupling and improved electrostatic control over the channel. The single gate (G2) controls the holes in the potential barrier induced through the proper selection of bias and workfunction. The results indicate that the planar tri-gate achieves optimum performance evaluated in terms of two composite metrics (M1 and M2), namely, product of (i) Sense Margin (SM) and Retention Time (RT) i.e., M1 = SM × RT and (ii) Sense Margin and Current Ratio (CR) i.e., M2 = SM × CR. The regulation of barriers created by the gates (G1 and G2) through the optimal use of device parameters leads to better performance metrics, with significant improvement at scaled lengths as compared to other tunneling based dynamic memory architectures. The investigation shows that lengths of G1, G2 and lateral spacing can be scaled down to 25 nm, 50 nm, and 30 nm, respectively, while achieving reasonable values for (M1, M2). The work demonstrates a systematic approach to showcase the advancement in TFET based Dynamic Random Access Memory (DRAM) through the use of planar tri-gate topology at a lower bias value. The concept, design, and operation of planar tri-gate architecture provide valuable viewpoints for TFET based DRAM.

  4. Mexican American First-Generation/Low-Income Students: A Rural Community College, TRiO Student Support Services Experience

    ERIC Educational Resources Information Center

    O'Meara, Daniel J.

    2012-01-01

    This study is an ethnographic inquiry into the beliefs and perceptions of first-generation/low-income Mexican American students in a rural community college located near the U.S.-Mexico border. It explored their experiences as TRiO Student Support Services participants. TRiO Student Support Services plays an increasingly vital role helping…

  5. In vivo kinetics of U4/U6·U5 tri-snRNP formation in Cajal bodies

    PubMed Central

    Novotný, Ivan; Blažíková, Michaela; Staneˇk, David; Herman, Petr; Malinsky, Jan

    2011-01-01

    The U4/U6·U5 tri-small nuclear ribonucleoprotein particle (tri-snRNP) is an essential pre-mRNA splicing factor, which is assembled in a stepwise manner before each round of splicing. It was previously shown that the tri-snRNP is formed in Cajal bodies (CBs), but little is known about the dynamics of this process. Here we created a mathematical model of tri-snRNP assembly in CBs and used it to fit kinetics of individual snRNPs monitored by fluorescence recovery after photobleaching. A global fitting of all kinetic data determined key reaction constants of tri-snRNP assembly. Our model predicts that the rates of di-snRNP and tri-snRNP assemblies are similar and that ∼230 tri-snRNPs are assembled in one CB per minute. Our analysis further indicates that tri-snRNP assembly is approximately 10-fold faster in CBs than in the surrounding nucleoplasm, which is fully consistent with the importance of CBs for snRNP formation in rapidly developing biological systems. Finally, the model predicted binding between SART3 and a CB component. We tested this prediction by Förster resonance energy transfer and revealed an interaction between SART3 and coilin in CBs. PMID:21177826

  6. 78 FR 17652 - Tri-State Generation and Transmission Association, Inc. v. Public Service Company of New Mexico...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-03-22

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Public Service... Energy Regulatory Commission (Commission), 18 CFR 385.206 and 18 CFR 385.212, Tri-State Generation and...

  7. 75 FR 24799 - Safety Zone; Tri-City Water Follies Hydroplane Races Practice Sessions, Columbia River, Kennewick...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-05-06

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Tri-City Water Follies Hydroplane Races..., Washington for hydroplane race practice sessions being held in preparation for the Tri-City Water Follies Hydroplane Races. The safety zone is necessary to help ensure the safety of the practice session participants...

  8. The Targeted Reading Intervention (TRI): A Classroom Teacher Tier 2 Intervention to Help Struggling Readers in Early Elementary School

    ERIC Educational Resources Information Center

    Vernon-Feagans, Lynne; Amendum, Steve; Kainz, Kirsten; Ginsburg, Marnie

    2009-01-01

    The two studies presented in this report were designed to test the effectiveness of a new diagnostic-based reading intervention for classroom teachers, called the Targeted Reading Intervention (TRI). This TRI Tier 2 intervention stressed diagnostic teaching as the key to helping struggling readers make rapid progress in reading in the regular…

  9. Overexpression of the trichodiene synthase gene tri5 increases trichodermin production and antimicrobial activity in Trichoderma brevicompactum.

    PubMed

    Tijerino, Anamariela; Cardoza, R Elena; Moraga, Javier; Malmierca, Mónica G; Vicente, Francisca; Aleu, Josefina; Collado, Isidro G; Gutiérrez, Santiago; Monte, Enrique; Hermosa, Rosa

    2011-03-01

    Trichoderma brevicompactum produces trichodermin, a simple trichothecene-type toxin that shares the first steps of the sesquiterpene biosynthetic pathway with other phytotoxic trichothecenes from Fusarium spp. Trichodiene synthase catalyses the conversion of farnesyl pyrophosphate to trichodiene and it is encoded by the tri5 gene that was cloned and analysed functionally by homologous overexpression in T. brevicompactum. tri5 expression was up-regulated in media with glucose, H(2)O(2) or glycerol. tri5 repression was observed in cultures supplemented with the antioxidants ferulic acid and tyrosol. Acetone extracts of tri5-overexpressing transformants displayed higher antifungal activity than those from the wild-type. Chromatographic and spectroscopic analyses revealed that tri5 overexpression led to an increased production of trichodermin and tyrosol. Agar diffusion assays with these two purified metabolites from the tri5-overexpressing transformant T. brevicompactum Tb41tri5 showed that only trichodermin had antifungal activity against Saccharomyces cerevisiae, Kluyveromyces marxianus, Candida albicans, Candida glabrata, Candida tropicalis and Aspergillus fumigatus, in most cases such activity being higher than that observed for amphotericin B and hygromycin. Our results point to the significant role of tri5 in the production of trichodermin and in the antifungal activity of T. brevicompactum.

  10. [A model atlas of the crude drug Radix Ophiopogonis in tri-dimensional computer reconstraction from their serial transections].

    PubMed

    Xiao, X H; Shu, G M; Li, J L; Fang, Q M; Xia, W J; Yin, G P; Chen, Q; Li, S G

    1997-06-01

    In this paper, the tri-dimensional computer reconstruction and animated display from the serial transections of the crude drugs Radix Ophiopogonis and Radix Liriopes have been achieved. Accordingly, some tri-dimensional image techniques and information for the computer aided teaching and identification of pharmacognosy have been offered.

  11. Plasma immersion ion implantation for sub-22 nm node devices: FD-SOI and Tri-Gate

    SciTech Connect

    Duchaine, J.; Milesi, F.; Coquand, R.; Barraud, S.; Reboh, S.; Gonzatti, F.; Mazen, F.; Torregrosa, Frank

    2012-11-06

    Here, we present and discuss the electrical characteristics of fully depleted MOSFET transistors of planar and tridimensional architecture, doped by Plasma Immersion Ion Implantation (PIII) or Beam Line Ion Implantation (BLII). Both techniques delivered similar and satisfactory results in considering the planar architecture. For tri-dimensional Tri-Gate transistors, the results obtained with PIII are superior.

  12. The Training and Research Institute for Residential Youth Centers, Inc. (TRI-RYC). Final Report, 1969-1970.

    ERIC Educational Resources Information Center

    Training and Research Inst. for Residential Youth Centers, Inc., New Haven, CT.

    This report describes and details the experiences of the Training and Research Institute for Residential Youth Centers (TRI-RYC) during its first year of operation. The TRI-RYC was established by the Department of Labor, Office of Special Manpower Programs, to provide a capability for initiating, training staff for, and evaluating the…

  13. Mexican American First-Generation/Low-Income Students: A Rural Community College, TRiO Student Support Services Experience

    ERIC Educational Resources Information Center

    O'Meara, Daniel J.

    2012-01-01

    This study is an ethnographic inquiry into the beliefs and perceptions of first-generation/low-income Mexican American students in a rural community college located near the U.S.-Mexico border. It explored their experiences as TRiO Student Support Services participants. TRiO Student Support Services plays an increasingly vital role helping…

  14. Comparison of TRY and the closely related At1g01380 gene in controlling Arabidopsis trichome patterning.

    PubMed

    Esch, Jeffrey J; Chen, Margaret A; Hillestad, Matthew; Marks, M David

    2004-12-01

    A screen of activation-tagged Arabidopsis lines resulted in the identification of At1g01380, which encodes a small R3 single repeat MYB gene, as a negative regulator of trichome initiation. Plants that overexpress this gene have fewer trichomes. The gene is closely related to the previously identified negative regulator TRY, and has a similar pattern of expression as TRY in developing leaves. As previously shown for TRY, At1g01380 protein can inhibit the interaction between the positive trichome regulators GL1 and GL3, and likely limits trichome initiation via this inhibition. While TRY and At1g01380 are closely related, they are not completely functionally equivalent. When placed under the transcriptional control of the TRY promoter, At1g01380 can only partially rescue the try mutant. Interestingly, Atg01380 is highly expressed in gl3-sst trichomes, while TRY expression is greatly reduced. The mutation in gl3-sst causes a reduced interaction between the GL1 and GL3 proteins and results in fewer leaf trichomes that develop in clusters. The differential expression of TRY and At1g01380 in this mutant can be used to explain how its altered trichome pattern in gl3-sst [corrected] is generated.

  15. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River Pima... the Tri-Cities landfill located on the Salt River Pima-Maricopa Indian Community near Phoenix,...

  16. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River Pima... the Tri-Cities landfill located on the Salt River Pima-Maricopa Indian Community near Phoenix,...

  17. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River Pima... the Tri-Cities landfill located on the Salt River Pima-Maricopa Indian Community near Phoenix,...

  18. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River Pima... the Tri-Cities landfill located on the Salt River Pima-Maricopa Indian Community near Phoenix,...

  19. In vivo kinetics of U4/U6·U5 tri-snRNP formation in Cajal bodies.

    PubMed

    Novotný, Ivan; Blažíková, Michaela; Staněk, David; Herman, Petr; Malinsky, Jan

    2011-02-15

    The U4/U6·U5 tri-small nuclear ribonucleoprotein particle (tri-snRNP) is an essential pre-mRNA splicing factor, which is assembled in a stepwise manner before each round of splicing. It was previously shown that the tri-snRNP is formed in Cajal bodies (CBs), but little is known about the dynamics of this process. Here we created a mathematical model of tri-snRNP assembly in CBs and used it to fit kinetics of individual snRNPs monitored by fluorescence recovery after photobleaching. A global fitting of all kinetic data determined key reaction constants of tri-snRNP assembly. Our model predicts that the rates of di-snRNP and tri-snRNP assemblies are similar and that ∼230 tri-snRNPs are assembled in one CB per minute. Our analysis further indicates that tri-snRNP assembly is approximately 10-fold faster in CBs than in the surrounding nucleoplasm, which is fully consistent with the importance of CBs for snRNP formation in rapidly developing biological systems. Finally, the model predicted binding between SART3 and a CB component. We tested this prediction by Förster resonance energy transfer and revealed an interaction between SART3 and coilin in CBs.

  20. Influence of nutritional knowledge on perceived healthiness and willingness to try functional foods.

    PubMed

    Ares, Gastón; Giménez, Ana; Gámbaro, Adriana

    2008-11-01

    In order to assess the influence of nutritional knowledge on perceived healthiness and willingness to try functional foods, 104 consumers filled out a Nutritional Knowledge Questionnaire and answered a conjoint task. Participants had to evaluate 16 concepts consisting of combinations of carrier products (yogurt, milk desserts, pan bread and mayonnaise) and nutritional modifications (regular product, low-fat, enriched with antioxidants, and enriched with fibre). Three groups of consumers were identified with different level of nutritional knowledge. Highly significant differences were found in the healthiness evaluations of the clusters, which mainly depended on nutritional knowledge related to the links of diet and diseases. Highly significant differences in willingness to try functional foods were also found between the clusters. Whereas consumers with the lowest nutritional knowledge were not interested in consuming functional foods, the addition of fibre or antioxidants to healthy products increased the willingness of consumers with the highest level of nutritional knowledge to try the evaluated functional foods. These results suggested that lack of nutritional knowledge might limit the acceptance of functional foods and thus the use of health claims might be necessary to assure that consumers are aware of their health benefits.

  1. Total hip arthroplasty using TRI-LOCK® DePuy bone preservation femoral stem: our experience.

    PubMed

    Sperati, G; Ceri, L

    2014-09-24

    In this study we report our 3-years experience (from January 2010 to December 2013) of 101 total hip arthroplasties using Tri-Lock® DePuy bone preservation femoral stem, all performed in our clinic. 101 patients (F54-M47; median age around 69 yrs, range 42-84 yrs). 51 arthroplasties were implanted on the right side whereas 50 on the left side. The average follow-up was 27,3 months. All the arthroplasties were coupled with Pinnacle® polyethylene acetabular cup system; 98 prostheses were implanted cementless whereas cement was used in 3 cases. The Tri-Lock® femoral stem allows both soft tissues and bone stock preservation, leading to greater trochanter maintenance, less spongy bone removal and distal cavity bone tissue conservation. In our experience, we were able to implant the Tri-Lock® femoral stem even in osteoporotic and overweight patients using Gription® porous coating. This allowed for commencing an intensive rehabilitation program with stable load from the following day, without observing any early complications or loosening. According to us, this device is solid and safe, providing remarkable sparing of both soft tissues and bone stock.

  2. Enhanced separation and analysis procedure reveals production of tri-acylated mannosylerythritol lipids by Pseudozyma aphidis.

    PubMed

    Goossens, Eliane; Wijnants, Marc; Packet, Dirk; Lemière, Filip

    2016-11-01

    Mannosylerythritol lipids (MELs) are one of the most promising biosurfactants because of their high fermentation yields (>100 g l(-1)) and during the last two decades they have gained a lot of attention due to their interesting self-assembling properties and biological activities. In this study, MELs were produced by fed-batch bioreactor fermentation of rapeseed oil with Pseudozyma aphidis MUCL 27852. This high-level MEL-producing yeast secretes four conventional MEL structures, -A, -B, -C and -D, which differ in their degree of acetylation. During our research, unknown compounds synthesized by P. aphidis were detected by thin-layer chromatography. The unknown compounds were separated by flash chromatography and identified as tri-acylated MELs by high-performance liquid chromatography tandem mass spectrometry (HPLC-MS/MS). The third fatty acid chain on the tri-acylated MELs was positioned on the primary alcohol of the erythritol moiety and comprised long-chain acids, mainly oleic and linoleic acid, which are not found in conventional di-acylated MELs. Furthermore, the LC-MS analysis time of conventional MELs was reduced to almost one-third by switching from HPLC-MS/MS to ultraperformance liquid chromatography tandem mass spectrometry (UPLC-MS/MS). Provided optimization of the fermentation yield, P. aphidis could be an interesting novel producer of tri-acylated MELs and, thereby expand the supply and applicability of biosurfactants.

  3. The architecture of the spliceosomal U4/U6.U5 tri-snRNP

    PubMed Central

    Nguyen, Thi Hoang Duong; Galej, Wojciech P.; Bai, Xiao-chen; Savva, Christos G.; Newman, Andrew J.; Scheres, Sjors H. W.; Nagai, Kiyoshi

    2015-01-01

    U4/U6.U5 tri-snRNP is a 1.5 MDa pre-assembled spliceosomal complex comprising U5 snRNA, extensively base-paired U4/U6 snRNAs and >30 proteins, including the key components Prp8, Brr2 and Snu114. The tri-snRNP combines with a pre-mRNA substrate bound to U1 and U2 snRNPs and transforms into a catalytically active spliceosome following extensive compositional and conformational changes triggered by unwinding of the U4/U6 snRNAs. CryoEM single-particle reconstruction of yeast tri-snRNP at 5.9Å resolution reveals the essentially complete organization of its RNA and protein components. The single-stranded region of U4 snRNA between its 3′-stem-loop and the U4/U6 snRNA stem I is loaded into the Brr2 helicase active site ready for unwinding. Snu114 and the N-terminal domain of Prp8 position U5 snRNA to insert its Loop I, which aligns the exons for splicing, into the Prp8 active site cavity. The structure provides crucial insights into the activation process and the active site of the spliceosome. PMID:26106855

  4. Three-wall segment (TriSeg) model describing mechanics and hemodynamics of ventricular interaction.

    PubMed

    Lumens, Joost; Delhaas, Tammo; Kirn, Borut; Arts, Theo

    2009-11-01

    A mathematical model (TriSeg model) of ventricular mechanics incorporating mechanical interaction of the left and right ventricular free walls and the interventricular septum is presented. Global left and right ventricular pump mechanics were related to representative myofiber mechanics in the three ventricular walls, satisfying the principle of conservation of energy. The walls were mechanically coupled satisfying tensile force equilibrium in the junction. Wall sizes and masses were rendered by adaptation to normalize mechanical myofiber load to physiological standard levels. The TriSeg model was implemented in the previously published lumped closed-loop CircAdapt model of heart and circulation. Simulation results of cardiac mechanics and hemodynamics during normal ventricular loading, acute pulmonary hypertension, and chronic pulmonary hypertension (including load adaptation) agreed with clinical data as obtained in healthy volunteers and pulmonary hypertension patients. In chronic pulmonary hypertension, the model predicted right ventricular free wall hypertrophy, increased systolic pulmonary flow acceleration, and increased right ventricular isovolumic contraction and relaxation times. Furthermore, septal curvature decreased linearly with its transmural pressure difference. In conclusion, the TriSeg model enables realistic simulation of ventricular mechanics including interaction between left and right ventricular pump mechanics, dynamics of septal geometry, and myofiber mechanics in the three ventricular walls.

  5. An iterative method for tri-level quadratic fractional programming problems using fuzzy goal programming approach

    NASA Astrophysics Data System (ADS)

    Kassa, Semu Mitiku; Tsegay, Teklay Hailay

    2017-08-01

    Tri-level optimization problems are optimization problems with three nested hierarchical structures, where in most cases conflicting objectives are set at each level of hierarchy. Such problems are common in management, engineering designs and in decision making situations in general, and are known to be strongly NP-hard. Existing solution methods lack universality in solving these types of problems. In this paper, we investigate a tri-level programming problem with quadratic fractional objective functions at each of the three levels. A solution algorithm has been proposed by applying fuzzy goal programming approach and by reformulating the fractional constraints to equivalent but non-fractional non-linear constraints. Based on the transformed formulation, an iterative procedure is developed that can yield a satisfactory solution to the tri-level problem. The numerical results on various illustrative examples demonstrated that the proposed algorithm is very much promising and it can also be used to solve larger-sized as well as n-level problems of similar structure.

  6. The VA, VCD, Raman and ROA spectra of tri-L-serine in aqueous solution.

    PubMed

    Jürgensen, V Würtz; Jalkanen, K

    2006-02-22

    The structures of one conformer of the nonionic neutral and zwitterionic species of L-serinyl L-serinyl L-serine (SSS or tri-L-serine), together with its cationic and anionic species and the capped N-acetyl tri-L-serine N'-methylamide analog were optimized with density functional theory with the Becke 3LYP hybrid exchange correlation (XC) functional and the PW91 GGA XC functional and the 6-31G* and aug-cc-pVDZ basis sets. Subsequently, the vibrational absorption, vibrational circular dichroism, Raman and Raman optical activity spectra were simulated in order to compare them to experimentally measured spectra. In addition, we compare to previously reported studies for both structural determination and spectral simulations and measurements. A comparison of the various ways to treat the effects of the environment and solvation on both the structure and the spectral properties is thoroughly investigated for one conformer, with the goal to determine which level of theory is appropriate to use in the systematic search of the conformational space. In addition, the effects of the counterion, here Cl- anion, are also investigated. Here we present the current state of the art in nanobiology, where the latest methods in experimental and theoretical vibrational spectroscopy are used to gain useful information about the coupling of the nuclear, electronic and magnetic degrees of freedom and structure of tri-L-serine and its capped peptide analog with the environment.

  7. ASPEN modeling of the Tri-State indirect-liquefaction process

    SciTech Connect

    Barker, R.E.; Begovich, J.M.; Clinton, J.H.; Johnson, P.J.

    1983-10-01

    The ASPEN process simulator has been used to model an indirect-liquefaction flowsheet patterned after that of the Tri-State project. This flowsheet uses Lurgi moving-bed gasification with synthesis-gas conversion to methanol folowed by further processing to gasoline using the Mobil MTG process. Models developed in this study include the following: Lurgi gasifier, Texaco gasifier, synthesis gas cooling, Rectisol, methanol synthesis, methanol-to-gasoline, CO-shift, methanation, and naphtha hydrotreating. These models have been successfully developed in modular form so that they can be used to simulate a number of different flowsheets or process alternatives. Simulations of the Tri-State flowsheet have been made using two different coal-feed rates and two types of feed coal. The overall simulation model was adjusted to match the Tri-State flowsheet values for methanol, LPG, isobutane, and gasoline. As a result of this adjustment, the MTG reactor yield structure necessary to match the flowsheet product rates was determined. The models were exercised at different flow rates and were unaffected by such changes, demonstrating their range of operability. The use of Illinois No. 6 coal, with its lower ash content, resulted in slightly higher production rates of each of the products as compared to use of the Kentucky coal.

  8. A self-calibration method for tri-axis rotational inertial navigation system

    NASA Astrophysics Data System (ADS)

    Gao, Pengyu; Li, Kui; Wang, Lei; Liu, Zengjun

    2016-11-01

    The navigation accuracy of the rotational inertial navigation system (RINS) could be greatly improved by periodically rotating the inertial measurement unit (IMU) with gimbals. However, error parameters in RINS should be effectively calibrated and compensated. In this paper, a self-calibration method is proposed for tri-axis RINS using attitude errors and velocity errors as measurements. The proposed calibration scheme is designed as three separate steps, and a certain gimbal rotates continuously in each step. All the error parameters in the RINS are calibrated when the whole scheme finishes. The separate calibration steps reduce the correlations between error parameters, and the observability of errors in this method is clear to demonstrate according to the relations between navigation errors and error parameters when gimbals rotate. Each calibration step only lasts 12 min, thus gyro drifts and accelerometers biases could be regarded as constant. The proposed calibration scheme is tested in both simulation and actual tri-axis RINS, and simulation and experimental results show that all 23 error parameters could be well estimated in tri-axis RINS. A long-term vehicle navigation experiment results show that after calibration and compensation, the navigation performance has doubled approximately, and the velocity accuracy is less than 2 m s-1 while the position accuracy is less than 1500 m, fully illustrating the significance of the proposed self-calibration method in improving the navigation performance of RINS.

  9. Close-in blasting at the TRI-MET light rail tunnels in Portland, Oregon

    SciTech Connect

    Revey, G.F.; Painter, D.Z.

    1995-12-31

    Frontier/Traylor Joint Venture is presently constructing a section of the Tri-County Metropolitan Transit District of Oregon`s (TRI-MET) Westside Light Rail System. This new section will extend Portland`s existing transit system to the western suburbs of Beaverton and Hillsboro. The drill-blast excavations at this project include 10,000 feet of 20 foot tunnel, 18 cross passages, three shafts, an underground railway station, and a U-wall open cut. From a blast designer`s perspective, this job has been extremely challenging. Blast vibration is limited to 0.5 ips at 200 feet or at the nearest structure, and airblast is limited to 129 dB--linear peak and 96 dB--C scale. The tunnels pass under heavily built up areas and have top of tunnel to surface cover distances as low as 70 feet. Surface blasting in the 26,000 cubic yard U-wall excavation was limited to five short nighttime periods due to its proximity to the very busy highway 26. This paper describes the techniques that were used to develop safe blasting designs for the TRI-MET Surface blasts and tunnel rounds. It also discusses the measures that were necessary to mitigate noise, vibration, and flyrock.

  10. Prevention of smoking in Middle School Students: psychometric assessment of the Temptations to Try Smoking Scale.

    PubMed

    McGee, Heather A; Babbin, Steven F; Redding, Colleen; Paiva, Andrea; Oatley, Karin; Meier, Kathryn S; Harrington, Magdalena; Velicer, Wayne F

    2012-04-01

    Establishment of psychometrically sound measures is critical to the development of effective interventions. The current study examined the psychometric properties, including factorial invariance, of a six item Temptations to Try Smoking Scale on a sample of middle school students. The sample of 6th grade students (N=3527) was from 20 Rhode Island middle schools and was 52% male and 84% white. The Temptations to Try Smoking Scale consisted of two correlated subscales: Positive Social and Curiosity/Stress. Structural equation modeling was implemented to evaluate the factorial invariance across four different subgroups defined by gender (male/female), race (white/black), ethnicity (Hispanic/Non-Hispanic), and school size (<200/ >200 6th graders). A model is factorially invariant when the measurement model is the same in each of the subgroups. Three levels of invariance were examined in sequential order: 1) Configural Invariance (unconstrained nonzero factor loadings); 2) Pattern Identity Invariance (equal factor loadings); and 3) Strong Factorial Invariance (equal factor loadings and measurement errors). Strong Factorial Invariance provided a good fit to the model across gender (CFI=.96), race (CFI=.96), ethnicity (CFI=.94), and school size (CFI=.97). Coefficient Alphas for the two subscales, Positive Social and Curiosity/Stress, were .87 and .86, respectively. These findings provide empirical support for the construct validity of the Temptations to Try Smoking Scale in middle school students.

  11. Use of tri-gas incubator for routine culture of Campylobacter species from fecal specimens.

    PubMed Central

    Thompson, J S; Hodge, D S; Smith, D E; Yong, Y A

    1990-01-01

    We evaluated a tri-gas incubator for Campylobacter isolation to be used instead of an anaerobic jar. Fecal specimens were cultured in duplicate onto charcoal selective medium and incubated at 43 degrees C for 48 h in two different environments: a tri-gas incubator (Forma Scientific) adjusted to provide an atmosphere of 10% CO2, 10% O2, and the balance N2; and evacuated anaerobic jars with a replacement gas mixture of 10% CO2, 5% O2, and 85% N2. A total of 106 Campylobacter jejuni and 8 Campylobacter coli isolates were obtained from 2,348 stool specimens. Of the positive specimens, 113 isolates came from the incubator and 111 isolates came from the anaerobic jars. An additional 32 previously positive specimens were replated onto charcoal selective medium and retested by both methods. We recovered 27 C. jejuni isolates, 26 isolates by each method. The isolates from the incubator typically produced discrete colonies, while the isolates from the anaerobic jar showed some degree of swarming in colony formation. The tri-gas incubator provided a cost-effective method for culturing Campylobacter spp. PMID:2280012

  12. Design of a Tri-PET collimator for high-resolution whole-body mouse imaging.

    PubMed

    DiFilippo, Frank P

    2017-08-01

    Tri-PET refers to high-resolution 511-keV emission tomography using a multipinhole collimator in conjunction with lower resolution PET detectors operating in coincidence mode. Tri-PET is unique in that three spatial locations are associated with each event (two detector coordinates and one pinhole location). Spatial resolution and sensitivity are similar to that of 511-keV SPECT and are governed mainly by the collimator design. However because of a third spatial location in Tri-PET, the line-of-response is overdetermined. This feature permits new opportunities in data processing which impact collimator design. In particular, multiplexing can be avoided since the coincidence data identify the pinhole through which the photon passed. In this paper, the principles of Tri-PET collimator design are reviewed and then applied to the case of high-resolution imaging of a small animal in a clinical PET scanner. The design of a 148-pinhole collimator for whole-body imaging of a mouse is presented. Two pinhole designs were investigated: knife-edge pinholes with 1.1 mm aperture and novel hyperboloidal pinholes with 1.2 mm aperture, both having 18° cone angle. The pinhole configuration is unfocused, covering a whole-body mouse field of view with nearly uniform sensitivity. Computer simulations were performed of a micro hot rods phantom imaged with this collimator in a clinical PET scanner. Sensitivity was estimated by simulating a point source centered on-axis at locations spanning a 70-mm axial range, similar to the NEMA NU-4 standard for whole-body mouse imaging. Reconstructed images of the hot rods phantom demonstrated the ability to resolve 1.1 mm structures with the knife-edge pinholes and 1.0 mm structures with the hyperboloidal pinholes. Sensitivity was found to be 0.093% and 0.054% for the knife-edge and hyperboloidal pinholes, respectively. With a properly designed multipinhole collimator, high-resolution and acceptable sensitivity are achievable with Tri-PET using

  13. Single-stage management with combined tri-endoscopic approach for concomitant cholecystolithiasis and choledocholithiasis.

    PubMed

    Lv, Fujing; Zhang, Shutian; Ji, Ming; Wang, Yongjun; Li, Peng; Han, Wei

    2016-12-01

    The aim of this study was to investigate the value of a single stage with combined tri-endoscopic (duodenoscopy, laparoscopy and choledochoscopy) approach for patients with concomitant cholecystolithiasis and choledocholithiasis. Fifty-three patients with combined gallbladder stones and common bile duct stones from February 2014 to April 2015 were randomized assigned to two groups: 29 patients underwent single-stage surgery with combined duodenoscope, laparoscope and choledochoscope (combined tri-endoscopic group), and 29 patients underwent endoscopic sphincterotomy to remove common bile duct stones followed by laparoscopic cholecystectomy several days later (control group). The success rate of complete stone removal, procedure-related complication, hospital stay and the cost of hospitalization were compared between the two groups. Altogether, 53 patients (29 patients in combined tri-endoscopic group and 24 patients in control group) successfully underwent the surgery and ERCP procedure. Three patients in the control group developed post-ERCP pancreatitis. One case of bile leaking and one case of residual stone were noted in the combined tri-endoscopic group. There were no significant differences between the two groups with regard to both complete stone removal [96.6 % (28/29) vs. 100 % (24/24)] and procedure-related complication rate [3.4 % (1/29) vs. 12.5 % (3/24)] (p > 0.05). No open surgery was required in either group. There were significant differences between the two groups with regard to hospital stay (6.72 ± 1.3 days vs. 10.91 ± 1.6 days, p < 0.01) and cost of hospitalization (15,724 ± 1613 CNY vs. 19,829 ± 2433 CNY, p < 0.05). The single-stage combined tri-endoscopic approach for concomitant cholecystolithiasis and choledocholithiasis was just as safe and successful as the control group. In addition, it resulted in a shorter hospital stay and less cost.

  14. Metal binding and antioxidant properties of chimeric tri- and tetra-domained metallothioneins.

    PubMed

    Moreau, Jean-Luc; Baudrimont, Magalie; Carrier, Patrick; Peltier, Gilles; Bourdineaud, Jean-Paul

    2008-05-01

    An unusual tri-domained (alpha-beta-beta) natural oyster metallothionein (MT) is known, and non-oxidative MT dimers occur in vivo in mollusk species and in mammals. To assess the respective role of the MT domains, two chimeric MTs were constructed: a tetra-domained oyster MT corresponding to the alpha-beta-alpha-beta structure, in order to mimic the natural non-oxidative dimeric form, and a tri-domained alpha-beta-alpha oyster MT. Metal binding and putative antioxidant properties of these two chimeric MTs were investigated using expression of the related genes in the bacteria Escherichia coli. In a wild-type strain these MTs could efficiently bind Cd. In a superoxide dismutase (sodA sodB) null mutant, the tri-domained MT was found to exacerbate Cd toxicity whereas the tetra-domained MT efficiently protected bacteria from Cd. The paradoxical toxicity displayed by the tri-domained MT upon Cd contamination was linked to the generation of superoxide radicals generated by a mechanism which most probably involves a copper-redox cycling reaction, since a Cd-contaminated sodA sodB strain expressing this MT produced 4 times more O2(-) than the control bacteria, and MT toxicity disappeared in the presence of bathocuproine disulfonic acid, a copper chelator. In contrast, the tetra-domained form did not. Interestingly, in bacteria producing superoxide dismutase but hypersensitive to oxidative stress due to either mutations in thioredoxin and glutathione reductase pathways (WM104 mutant) or to a lack of gamma-glutamylcysteine synthetase (gshA mutant), both chimeric MTs were protecting against Cd toxicity. However, an unexpected lack of antioxidant function was observed for both chimeric MTs, which were found to enhance the toxicity of hydrogen peroxide in WM104, or that of menadione in QC1726. Altogether, our results suggest that superoxide dismutase activity counteracts the potential prooxidative effect of the tri-domained MT mediated by Cu ions and that the tetra

  15. TriXY-Homogeneous genetic sexing of highly degraded forensic samples including hair shafts.

    PubMed

    Madel, Maria-Bernadette; Niederstätter, Harald; Parson, Walther

    2016-11-01

    Sexing of biological evidence is an important aspect in forensic investigations. A routinely used molecular-genetic approach to this endeavour is the amelogenin sex test, which is integrated in most commercially available polymerase chain reaction (PCR) kits for human identification. However, this assay is not entirely effective in respect to highly degraded DNA samples. This study presents a homogeneous PCR assay for robust sex diagnosis, especially for the analysis of severely fragmented DNA. The introduced triplex for the X and Y chromosome (TriXY) is based on real-time PCR amplification of short intergenic sequences (<50bp) on both gonosomes. Subsequent PCR product examination and molecular-genetic sex-assignment rely on high-resolution melting (HRM) curve analysis. TriXY was optimized using commercially available multi-donor human DNA preparations of either male or female origin and successfully evaluated on challenging samples, including 46 ancient DNA specimens from archaeological excavations and a total of 16 DNA samples extracted from different segments of eight hair shafts of male and female donors. Additionally, sensitivity and cross-species amplification were examined to further test the assay's utility in forensic investigations. TriXY's closed-tube format avoids post-PCR sample manipulations and, therefore, distinctly reduces the risk of PCR product carry-over contamination and sample mix-up, while reducing labour and financial expenses at the same time. The method is sensitive down to the DNA content of approximately two diploid cells and has proven highly useful on severely fragmented and low quantity ancient DNA samples. Furthermore, it even allowed for sexing of proximal hair shafts with very good results. In summary, TriXY facilitates highly sensitive, rapid, and costeffective genetic sex-determination. It outperforms existing sexing methods both in terms of sensitivity and minimum required template molecule lengths. Therefore, we feel confident

  16. Repeated High-Intensity Effort Activity in Relation to Tries Scored and Conceded during Rugby League Match-Play.

    PubMed

    Gabbett, Tim J; Gahan, Caleb W

    2015-09-21

    To examine the nature and frequency of rugby league repeated high-intensity effort (RHIE) activity in relation to tries scored and conceded in successful and unsuccessful teams. One-hundred and eighty-five semi-professional rugby league players (mean ± SD age: 23.7 ± 3.2 yr) from 11 teams participated in this study. Global positioning system (GPS) data was collected during 21 matches. Data were analysed for the total number of RHIE bouts, efforts per bout, duration of efforts and recovery between efforts. Using notational analysis, a RHIE bout frequency distribution, representing 0-60s, 61-120s, 121-180s, 181-240s, and 241-300s prior to scoring and conceding a try was established. Over 50% of RHIE bouts occurred within five minutes of a try. Bottom 4 teams performed a greater proportion of bouts within five minutes of a try than Top 4 teams (61.5% vs. 48.2%, effect size, ES = 0.69 ± 0.28, p=0.0001). Top 4 teams performed a greater number of RHIE bouts per conceded try (3.0 ± 2.1 vs. 1.6 ± 0.7, ES = 0.74 ± 0.51, p<0.05), while Bottom 4 teams performed a greater number of RHIE bouts per try scored (3.6 ± 2.5 vs. 2.1 ± 1.7, ES = 0.70 ± 0.71, p=0.10). The majority of rugby league RHIE bouts occur at critical periods during match-play. Successful rugby league teams perform more RHIE bouts prior to conceding tries, while unsuccessful teams perform more bouts prior to scoring tries. These findings demonstrate that unsuccessful teams are required to work harder to score tries while successful teams work harder to prevent tries.

  17. First analysis of eight Algol-type systems: V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri

    NASA Astrophysics Data System (ADS)

    Zasche, P.

    2015-01-01

    Analyzing available photometry from the Super WASP and other databases, we performed the very first light curve analysis of eight eclipsing binary systems V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri. All of these systems were found to be detached ones of Algol-type, having the orbital periods of the order of days. 722 new times of minima for these binaries were derived and presented, trying to identify the period variations caused by the third bodies in these systems.

  18. Sad1 Counteracts Brr2-Mediated Dissociation of U4/U6.U5 in Tri-snRNP Homeostasis

    PubMed Central

    Huang, Yu-Hsin; Chung, Che-Sheng; Kao, Der-I; Kao, Tzu-Chung

    2014-01-01

    The yeast Sad1 protein was previously identified in a screen for factors involved in the assembly of the U4/U6 di-snRNP particle. Sad1 is required for pre-mRNA splicing both in vivo and in vitro, and its human orthologue has been shown to associate with U4/U6.U5 tri-snRNP. We show here that Sad1 plays a role in maintaining a functional form of the tri-snRNP by promoting the association of U5 snRNP with U4/U6 di-snRNP. In the absence of Sad1, the U4/U6.U5 tri-snRNP dissociates into U5 and U4/U6 upon ATP hydrolysis and cannot bind to the spliceosome. The separated U4/U6 and U5 can reassociate upon incubation more favorably in the absence of ATP and in the presence of Sad1. Brr2 is responsible for mediating ATP-dependent dissociation of the tri-snRNP. Our results demonstrate a role of Sad1 in maintaining the integrity of the tri-snRNP by counteracting Brr2-mediated dissociation of tri-snRNP and provide insights into homeostasis of the tri-snRNP. PMID:24190974

  19. Sad1 counteracts Brr2-mediated dissociation of U4/U6.U5 in tri-snRNP homeostasis.

    PubMed

    Huang, Yu-Hsin; Chung, Che-Sheng; Kao, Der-I; Kao, Tzu-Chung; Cheng, Soo-Chen

    2014-01-01

    The yeast Sad1 protein was previously identified in a screen for factors involved in the assembly of the U4/U6 di-snRNP particle. Sad1 is required for pre-mRNA splicing both in vivo and in vitro, and its human orthologue has been shown to associate with U4/U6.U5 tri-snRNP. We show here that Sad1 plays a role in maintaining a functional form of the tri-snRNP by promoting the association of U5 snRNP with U4/U6 di-snRNP. In the absence of Sad1, the U4/U6.U5 tri-snRNP dissociates into U5 and U4/U6 upon ATP hydrolysis and cannot bind to the spliceosome. The separated U4/U6 and U5 can reassociate upon incubation more favorably in the absence of ATP and in the presence of Sad1. Brr2 is responsible for mediating ATP-dependent dissociation of the tri-snRNP. Our results demonstrate a role of Sad1 in maintaining the integrity of the tri-snRNP by counteracting Brr2-mediated dissociation of tri-snRNP and provide insights into homeostasis of the tri-snRNP.

  20. The effects of traditional, superset, and tri-set resistance training structures on perceived intensity and physiological responses.

    PubMed

    Weakley, Jonathon J S; Till, Kevin; Read, Dale B; Roe, Gregory A B; Darrall-Jones, Joshua; Phibbs, Padraic J; Jones, Ben

    2017-07-11

    Investigate the acute and short-term (i.e., 24 h) effects of traditional (TRAD), superset (SS), and tri-set (TRI) resistance training protocols on perceptions of intensity and physiological responses. Fourteen male participants completed a familiarisation session and three resistance training protocols (i.e., TRAD, SS, and TRI) in a randomised-crossover design. Rating of perceived exertion, lactate concentration ([Lac]), creatine kinase concentration ([CK]), countermovement jump (CMJ), testosterone, and cortisol concentrations was measured pre, immediately, and 24-h post the resistance training sessions with magnitude-based inferences assessing changes/differences within/between protocols. TRI reported possible to almost certainly greater efficiency and rate of perceived exertion, although session perceived load was very likely lower. SS and TRI had very likely to almost certainly greater lactate responses during the protocols, with changes in [CK] being very likely and likely increased at 24 h, respectively. At 24-h post-training, CMJ variables in the TRAD protocol had returned to baseline; however, SS and TRI were still possibly to likely reduced. Possible increases in testosterone immediately post SS and TRI protocols were reported, with SS showing possible increases at 24-h post-training. TRAD and SS showed almost certain and likely decreases in cortisol immediately post, respectively, with TRAD reporting likely decreases at 24-h post-training. SS and TRI can enhance training efficiency and reduce training time. However, acute and short-term physiological responses differ between protocols. Athletes can utilise SS and TRI resistance training, but may require additional recovery post-training to minimise effects of fatigue.

  1. Accuracy of perception of ovulation day in women trying to conceive.

    PubMed

    Zinaman, Michael; Johnson, Sarah; Ellis, Jayne; Ledger, William

    2012-05-01

    The likelihood of conception is increased if intercourse is timed to coincide with the fertile period (5 days up to ovulation). However, to be effective, this requires good awareness of the day of ovulation. The aim of this study was to examine the accuracy of women's perceived ovulation day, compared with actual fertile days, in a cohort of women trying to conceive. Comparison of women's estimated day of ovulation with their actual ovulation day (determined by detecting luteinising hormone). This was a sample collection study and volunteer women were recruited via online advertising. At recruitment volunteers reported the cycle day they believed they ovulated. They then used a home urine fertility monitor to test their daily fertility status to time intercourse to try and achieve conception, in addition to collecting early morning urine samples for laboratory analysis. The main outcome measure was a comparison of women's estimated day of ovulation with their actual ovulation day, as determined by urine detection of luteinising hormone. Three hundred and thirty women were recruited onto the study and data was available for 102 volunteers who became pregnant. Thirteen women (12.7%) correctly estimated their ovulation day; median difference +2 days, range -10 to +27 days. The most common days for estimation of ovulation were day 14 (35.5%) and day 15 (15.7%). Only 55% of estimated ovulation days fell within the volunteers' fertile window; only 27% on days of peak fertility. Women trying to conceive may benefit from using a prospective method to identify their fertile phase, as a significant proportion could be incorrectly estimating their fertile days. These observations were made on women who were actively looking for knowledge on fertility and considered only cycles where conception occurred, inaccuracy could be greater if a broader population is considered.

  2. Synthesis and characterization of a new family of bi-, tri-, tetra-, and pentanuclear ferric complexes.

    PubMed

    Boskovic, Colette; Sieber, Andreas; Chaboussant, Grégory; Güdel, Hans U; Ensling, Jürgen; Wernsdorfer, Wolfgang; Neels, Antonia; Labat, Gael; Stoeckli-Evans, Helen; Janssen, Stefan

    2004-08-09

    Nine members of a new family of polynuclear ferric complexes have been synthesized and characterized. The reaction of Fe(O(2)CMe)(2) with polydentate Schiff base proligands (H(2)L) derived from salicylidene-2-ethanolamine, followed in some cases by reaction with carboxylic acids, has afforded new complexes of general formulas [Fe(2)(pic)(2)(L)(2)] (where pic(-) is the anion of 2-picolinic acid), [Fe(3)(O(2)CMe)(3)(L)(3)], [Fe(4)(OR)(2)(O(2)CMe)(2)(L)(4)], and [Fe(5)O(OH)(O(2)CR)(4)(L)(4)]. The tri-, tetra-, and pentanuclear complexes all possess unusual structures and novel core topologies. Mössbauer spectroscopy confirms the presence of high-spin ferric centers in the tri- and pentanuclear complexes. Variable-temperature magnetic measurements suggest spin ground states of S = 0, 1/2, 0, and 5/2 for the bi-, tri-, tetra-, and pentanuclear complexes, respectively. Fits of the magnetic susceptibility data have provided the magnitude of the exclusively antiferromagnetic exchange interactions. In addition, an easy-axis-type magnetic anisotropy has been observed for the pentanuclear complexes, with D values of approximately -0.4 cm(-)(1) determined from modeling the low-temperature magnetization data. A low-temperature micro-SQUID study of one of the pentanuclear complexes reveals magnetization hysteresis at nonzero field. This is attributed to an anisotropy-induced energy barrier to magnetization reversal that is of molecular origin. Finally, an inelastic neutron scattering study of one of the trinuclear complexes has revealed that the magnetic behavior arises from two distinct species.

  3. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession.

    PubMed

    Kim, Daehyun; Kupfer, John A

    2016-01-01

    This research investigated how the strength of vegetation-soil-topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic-abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to-and potentially serves as an indicator of-the intensity and mechanisms of vegetation-soil-topography feedbacks in fluvial biogeomorphic systems.

  4. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers.

    PubMed

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M; Nachon, Florian; Masson, Patrick; Furlong, Clement E; Lockridge, Oksana

    2011-11-01

    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such "fume events". Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers.

  5. Integrated piezoelectric actuators in deep drawing tools to reduce the try-out

    NASA Astrophysics Data System (ADS)

    Neugebauer, Reimund; Mainda, Patrick; Kerschner, Matthias; Drossel, Welf-Guntram; Roscher, Hans-Jürgen

    2011-05-01

    Tool making is a very time consuming and expensive operation because many iteration loops are used to manually adjust tool components during the try-out process. That means that trying out deep drawing tools is 30% of the total costs. This is the reason why an active deep drawing tool was developed at the Fraunhofer Institute for Machine Tools and Forming Technology IWU in cooperation with Audi and Volkswagen to reduce the costs and production rates. The main difference between the active and conventional deep drawing tools is using piezoelectric actuators to control the forming process. The active tool idea, which is the main subject of this research, will be presented as well as the findings of experiments with the custom-built deep drawing tool. This experimental tool was designed according to production requirements and has been equipped with piezoelectric actuators that allow active pressure distribution on the sheet metal flange. The disposed piezoelectric elements are similar to those being used in piezo injector systems for modern diesel engines. In order to achieve the required force, the actuators are combined in a cluster that is embedded in the die of the deep drawing tool. One main objective of this work, i.e. reducing the time-consuming try-out-period, has been achieved with the experimental tool which means that the actuators were used to set static pressure distribution between the blankholder and die. We will present the findings of our analysis and the advantages of the active system over a conventional deep drawing tool. In addition to the ability of changing the static pressure distribution, the piezoelectric actuator can also be used to generate a dynamic pressure distribution during the forming process. As a result the active tool has the potential to expand the forming constraints to make it possible to manage forming restrictions caused by light weight materials in future.

  6. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    PubMed Central

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana

    2011-01-01

    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such “fume events”. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24–48 hours after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  7. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession

    PubMed Central

    Kim, Daehyun; Kupfer, John A.

    2016-01-01

    This research investigated how the strength of vegetation–soil–topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic–abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to—and potentially serves as an indicator of—the intensity and mechanisms of vegetation–soil–topography feedbacks in fluvial biogeomorphic systems. PMID:27649497

  8. Recombinant lipid transfer protein Tri a 14: a novel heat and proteolytic resistant tool for the diagnosis of baker's asthma.

    PubMed

    Palacin, A; Varela, J; Quirce, S; del Pozo, V; Tordesillas, L; Barranco, P; Fernandez-Nieto, M; Sastre, J; Diaz-Perales, A; Salcedo, G

    2009-08-01

    Baker's asthma is an important occupational allergic disease. Wheat lipid transfer protein (LTP) Tri a 14 is a major allergen associated with wheat allergy. No panel of wheat recombinant allergens for component-resolved diagnosis of baker's asthma is currently available. To evaluate the potential role of recombinant Tri a 14 as a novel tool for the diagnosis of baker's asthma, and to test the heat and proteolytic resistance of the wheat LTP allergen. A cDNA encoding Tri a 14 was isolated and sequenced, the recombinant allergen produced in Pichia pastoris and purified by chromatographic methods. Physicochemical and immunological comparison of the natural and recombinant forms of Tri a 14 was carried out by N-terminal amino acid sequencing, matrix-assisted laser desorption/ionization mass spectrometry, circular dichroism (CD) analysis, IgE immunodetection, and specific IgE determination and ELISA-inhibition assays using a pool or individual sera from 26 patients with baker's asthma. Thermal denaturation and simulated gastrointestinal digestion of both Tri a 14 forms were checked by spectroscopic and electrophoretic methods, respectively, and biological activity by basophil activation test (BAT). Natural and recombinant Tri a 14 were similarly folded, as indicated by their nearly identical CD spectra and heat denaturation profiles. A high interclass correlation coefficient (0.882) was found between specific IgE levels to both Tri a 14 proteins in individual sera from baker's asthma patients, but a slightly lower IgE-binding potency of rTri a 14 was detected by ELISA-inhibition assays. Natural and recombinant Tri a 14 elicited positive BAT in two and one out of three patients, respectively. Heat denaturation profiles and simulated gastrointestinal digestion assays indicated that Tri a 14 displayed a high heat and digestive proteolytic resistance, comparable to those of peach Pru p 3, the model food allergen of the LTP family. Recombinant Tri a 14 is a potential tool

  9. Fabrication of C60 Tri-Diethyl Malonate Membrane via an Electrospinning Method and Its Antibacterial Property.

    PubMed

    Li, Hui; Chen, Shou; Peng, Xiaohua; Sun, Jiangning; Shu, Chunying; Jiang, Li; Wang, Chunru

    2016-03-01

    A homogeneous C60 tri-diethyl malonate membrane was fabricated by a facile electro-spinning method. Comprehensive characterizations of its assembling structure, such as SEM, TEM, TGA, UV-vis, and FTIR, were carried out. Different fullerene derivatives show different assembling characters during the electrospining process. Notably, C60 tri-diethyl malonate with close-knite structures can form a stable structure after removing the assistant polymer of PVP. The antibacterial experiments of C60 tri-diethyl malonate membrane were performed, and the results revealed that this membrane owns excellent antibacterial activity.

  10. Biological and chemical study of fused tri- and tetracyclic indazoles and analogues with important antiparasitic activity

    NASA Astrophysics Data System (ADS)

    Díaz-Urrutia, Christian A.; Olea-Azar, Claudio A.; Zapata, Gerald A.; Lapier, Michel; Mura, Francisco; Aguilera-Venegas, Benjamín; Arán, Vicente J.; López-Múñoz, Rodrigo A.; Maya, Juan D.

    A series of fused tri- and tetracyclic indazoles and analogues compounds (NID) with potential antiparasitic effects were studied using voltamperometric and spectroscopic techniques. Nitroanion radicals generated by cyclic voltammetry were characterized by electron spin resonance spectroscopy (ESR) and their spectral lines were explained and analyzed using simulated spectra. In addition, we examined the interaction between radical species generated from nitroindazole derivatives and glutathione (GSH). Biological assays such as activity against Trypanosoma cruzi and cytotoxicity against macrophages were carried out. Finally, spin trapping and molecular modeling studies were also done in order to elucidate the potentials action mechanisms involved in the trypanocidal activity.

  11. Hydridoborylene complexes and di-, tri-, and tetranuclear borido complexes with hydride ligands.

    PubMed

    Bauer, Jürgen; Bertsch, Stefanie; Braunschweig, Holger; Dewhurst, Rian D; Ferkinghoff, Katharina; Hörl, Christian; Kraft, Katharina; Radacki, Krzysztof

    2013-12-16

    Mono- and dinuclear hydridoborylene complexes were prepared by intermetallic borylene transfer from Group VI borylene or metalloborylene reagents. The hydride and borylene ligands were found to interact with each other significantly, although the boron ligand retains much of its former borylene character. Zero-valent platinum fragments were successively added to the dinuclear hydridoborylene complexes, resulting in tri- and tetranuclear borido complexes, in which the B-H interaction has been lost, and the hydride ligands now bridge two metal centers. The complexes were studied spectroscopically, crystallographically, and by DFT methods, and the unusual bonding situation in the M-B-H triangles of hydridoborylene complexes were evaluated.

  12. Tri-directional anaphases as a novel chromosome segregation defect in human oocytes.

    PubMed

    Haverfield, Jenna; Dean, Nicola L; Nöel, Diana; Rémillard-Labrosse, Gaudeline; Paradis, Veronique; Kadoch, Isaac-Jacques; FitzHarris, Greg

    2017-06-01

    What are the chromosome segregation errors in human oocyte meiosis-I that may underlie oocyte aneuploidy? Multiple modes of chromosome segregation error were observed, including tri-directional anaphases, which we attribute to loss of bipolar spindle structure at anaphase-I. Oocyte aneuploidy is common and associated with infertility, but mechanistic information on the chromosome segregation errors underlying these defects is scarce. Lagging chromosomes were recently reported as a possible mechanism by which segregation errors occur. Long-term confocal imaging of chromosome dynamics in 50 human oocytes collected between January 2015 and May 2016. Germinal vesicle (GV) stage oocytes were collected from women undergoing intracytoplasmic sperm injection cycles and also CD1 mice. Oocytes were microinjected with complementary RNAs to label chromosomes, and in a subset of oocytes, the meiotic spindle. Oocytes were imaged live through meiosis-I using confocal microscopy. 3D image reconstruction was used to classify chromosome segregation phenotypes at anaphase-I. Segregation phenotypes were related to spindle dynamics and cell cycle timings. Most (87%) mouse oocytes segregated chromosomes with no obvious defects. We found that 20% of human oocytes segregated chromosomes bi-directionally with no lagging chromosomes. The rest were categorised as bi-directional anaphase with lagging chromosomes (20%), bi-directional anaphase with chromatin mass separation (34%) or tri-directional anaphase (26%). Segregation errors correlated with chromosome misalignment prior to anaphase. Spindles were tripolar when tri-directional anaphases occurred. Anaphase phenotypes did not correlate with meiosis-I duration (P = 0.73). Not applicable. Oocytes were recovered at GV stage after gonadotrophin-stimulation, and the usual oocyte quality caveats apply. Whilst the possibility that imaging may affect oocyte physiology cannot be formally excluded, detailed controls and justifications are presented

  13. Triiodide and mixed tri-halide anions from negative ion electrospray ionization of alkali halide solutions

    NASA Astrophysics Data System (ADS)

    Shukla, Anil

    2017-10-01

    Electrospray ionization of alkali halide solutions in the negative ion mode results in the formation of cluster ions of the general formula, (MX)nX-. However, alkali iodides form triiodide anion, I3-, in high abundance in addition to cluster ions. Br3- ions are observed in low abundance. Also, mixed tri-halide anions, I2Y-, are observed in high abundance when a small amount (<1%) of KI is added to other alkali halide solutions. These results are explained by the uniquely different physical characteristics of lithium and the iodide ions compared with others in the series.

  14. Use of the TriSpan Coil to Facilitate the Transcatheter Occlusion of Pulmonary Arteriovenous Malformation

    SciTech Connect

    Cil, Barbaros E. E-mail: barbaros@hacettepe.edu.tr; Erdogan, Cueneyt; Akmangit, Ilkay; Cekirge, Saruhan; Balkanci, Ferhun

    2004-11-15

    Pulmonary arteriovenous malformation (PAVM) is a rare vascular malformation of the lung which may occur as an isolated entity or in association with hereditary hemorrhagic telangiectasia (HHT). Because of considerable risk of serious complications such as cerebral embolism, brain abscess and pulmonary hemorrhage, definitive treatment should be considered in most patients. Embolization with coils or detachable balloons is currently the preferred treatment. Paradoxical embolization of coils and balloons may happen, especially in patients with PAVMs with large feeding arteries. In this report we present our initial experience with the use of the TriSpan coil to lower the risk of coil migration during the transcatheter occlusion of PAVMs.

  15. Fabrication of planar, layered nanoparticles using tri-layer resist templates.

    PubMed

    Hu, Wei; Zhang, Mingliang; Wilson, Robert J; Koh, Ai Leen; Wi, Jung-Sub; Tang, Mary; Sinclair, Robert; Wang, Shan X

    2011-05-06

    A simple and universal pathway to produce free multilayer synthetic nanoparticles is developed based on lithography, vapor phase deposition and a tri-layer resist lift-off and release process. The fabrication method presented in this work is ideal for production of a broad range of nanoparticles, either free in solution or still attached to an intact release layer, with unique magnetic, optical, radioactive, electronic and catalytic properties. Multi-modal capabilities are implicit in the layered architecture. As an example, directly fabricated magnetic nanoparticles are evaluated to illustrate the structural integrity of thin internal multilayers and the nanoparticle stability in aggressive biological environments, which is highly desired for biomedical applications.

  16. Electron transport through a linear tri-quantum-dot molecule Aharonov-Bohm interference

    NASA Astrophysics Data System (ADS)

    Bai, Jiyuan; He, Zelong; Li, Li; Ye, Shujiang; Sun, Weimin

    2017-09-01

    Using the non-equilibrium Keldysh Green's function technique, electron transport properties through a two-terminal linear tri-quantum-dot molecule Aharonov-Bohm (A-B) interference are investigated. The conductance as a function of electron energy is numerically calculated. The influence of magnetic flux and interdot coupling strength on the conductance is researched. Fano resonances emerge in the conductance spectrum, and two bound states in the continuum form simultaneously when the interdot couplings take appropriate values. A conductance dip is observed and evolves into an antiresonance band with increasing magnetic flux. The system can be designed as a quantum switch by adjusting the intramolecular couplings.

  17. Holmium Nitrate Complexation with Tri-n-butyl Phosphate in Supercritical Carbon Dioxide

    SciTech Connect

    Robert V. Fox; R. Duane Ball; Peter de B. Harrington; Harry W. Rollins; Chien M. Wai

    2005-12-01

    Holmium nitrate pentahydrate was reacted with tri-n-butyl phosphate in supercritical carbon dioxide at 308 K. The products of the complexation reaction were measured under supercritical fluid conditions using UV-vis spectroscopy. The solubility of the metal complexes in the supercritical fluid phase was measured. The mole-ratio titration method was used to determine the stoichiometry of the soluble complexes. Conditional extraction coefficients were calculated from spectral data using least-squares regression and hard-equilibria models. Data indicate that the holmium nitrate-tributyl phosphate system forms 1:2 and 1:4 holmium-tributyl phosphate complexes.

  18. Real Time Filtering of Tweets Using Wikipedia Concepts and Google Tri-gram Semantic Relatedness

    DTIC Science & Technology

    2015-11-20

    retrieval. ACM , 2013, pp. 17–20. [2] A. Islam, E. Milios, and V. Kešelj, “Text similarity using google tri-grams,” in Proceedings of the 25th Canadian...Resnick, and Q. Mei, “Req-rec: High recall retrieval with query pooling and interactive classification,” in Proceedings of the 37th international ACM ...SIGIR conference on Research & development in information retrieval. ACM , 2014, pp. 163–172. [5] C. Zhai and J. Lafferty, “A study of smoothing

  19. Molecular Medicine - CHI's 17th International Tri-Conference: Mastering Medicinal Chemistry - CHI's Seventh Annual Conference.

    PubMed

    Terrett, Nick

    2010-04-01

    CHI's 17th International Tri-Conference on Molecular Medicine, held in San Francisco, included topics covering new developments in the field of medicinal chemistry. This conference report highlights selected presentations on fragment-based drug discovery, quantum mechanical energy decomposition for the analysis of SARs, medicinal chemistry strategies and the role of imaging in drug discovery. Investigational drugs discussed include MLN-4924 (Millennium Pharmaceuticals Inc), GDC-0449 (Chugai Pharmaceutical Co Ltd/Curis Inc/F Hoffmann-La Roche Ltd/Genentech Inc/NCI), RDEA-119 (Ardea Biosciences Inc/Bayer HealthCare AG) and tafamidis (Fx-1006A; FoldRx Pharmaceuticals Inc).

  20. Improve reformer yield and hydrogen selectivity with tri-metalic catalyst

    SciTech Connect

    Morse, R.W.; Vance, P.W.; Novak, W.J.

    1995-05-01

    A new tri-metallic reforming catalyst has been developed for semi-regenerative reforming. This catalyst gives improved C{sub 5}+ yield and improved hydrogen yield compared with conventional Pt/Re catalyst. Its stability is equivalent to balanced Pt/Re catalyst. Commercial experience indicates that the annual increase in product value ranges from $600,000/year to $2.5 million/year for a typical 20,000-b/d reformer at current U.S. product prices depending on the refinery hydrogen balance.

  1. Shape of vaginal suppositories affects willingness-to-try and preference

    PubMed Central

    Li, Bangde; Zaveri, Toral; Ziegler, Gregory R.; Hayes, John E.

    2013-01-01

    HIV and other sexually transmitted infections (STIs) are a global threat to public health that may be countered, in part, by microbicides. A successful microbicide must be both biologically efficacious and highly acceptable to users. Sensory attributes have a direct influence on product acceptability. We created a series of vaginal suppositories appropriate for use as microbicides to investigate the influence of shape on women's willingness-to-try. The influence of perceived size and firmness on acceptability was also assessed. Sexually-active women (n=99) were invited to participate in an evaluation of vaginal suppositories in 5 different shapes including: Bullet, Long Oval, Round Oval, Teardrop and Tampon. The volume (3 ml) and formulation for these 5 prototypes were identical. After manipulating prototypes ex vivo (in their hands), participants rated their willingness-to-try on a 100-point visual analog scale. The appropriateness of size and firmness were evaluated using 5-point just-about-right (JAR) scales. Each participant evaluated all 5 prototypes individually. Samples were presented in a counterbalanced monadic sequence using a Williams design. Mean willingness-to-try varied by shape, with Bullet and Long Oval receiving significantly higher scores. This was consistent with JAR data for size, as 70 and 65% of women indicated these shapes were `just-about–right', respectively. In contrast, a minority of women endorsed the other 3 shapes as having a size that was `just-about-right'. The proportion of women who felt the firmness was `just-about-right' was uniformly high, irrespective of shape, suggesting prior attempts to optimize the formula were successful. Perceptions of size and firmness were influenced by the physical length and width of the prototypes, in spite of having constant volume. Women showed high willingness-to-try when asked to assume they were at risk. These results are relevant for behavioral and formulation scientists working on

  2. Fabrication of Planar, Layered Nanoparticles Using Tri-layer Resist Templates

    PubMed Central

    Hu, Wei; Zhang, Mingliang; Wilson, Robert J.; Koh, Ai Leen; Wi, Jung-Sub; Tang, Mary; Sinclair, Robert; Wang, Shan X.

    2011-01-01

    A simple and universal pathway to produce free multilayer synthetic nanoparticles is developed based on lithography, vapor phase deposition and a tri-layer resist lift off and release process. The fabrication method presented in this work is ideal for production of a broad range of nanoparticles, either free in solution or still attached to an intact release layer, with unique magnetic, optical, radioactive, electronic and catalytic properties. Multi-modal capabilities are implicit in the layered architecture. As an example, directly fabricated magnetic nanoparticles are evaluated to illustrate the structural integrity of thin internal multilayers and the nanoparticle stability in aggressive biological environments, which is highly desired for biomedical applications. PMID:21415483

  3. Syntheses and post-functionalization of tri-substituted polyalkoxohexavanadates containing tris(alkoxo) ligands.

    PubMed

    Hu, Xunliang; Xiao, Zicheng; Huang, Bo; Hu, Xiaokang; Cheng, Min; Lin, Xinjun; Wu, Pingfan; Wei, Yongge

    2017-07-04

    A new synthetic approach to tri-substituted trisalkoxy-hexavanadate clusters containing different organic groups was developed in this work. Four mixed-valence or fully reduced POV hybrids were synthesized and structurally characterized, including an amino-containing derivative of hexavanadate, Na2[VVO10{NH2C(CH2O)3}3] (1). Furthermore, a novel mixed-valence POV hybrid was prepared via the amidation of 1, indicating that 1 can be used as an excellent building block for the design and synthesis of mixed-valence POV functional materials.

  4. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    SciTech Connect

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana

    2011-11-15

    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such 'fume events'. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. -- Highlights: Black-Right-Pointing-Pointer Travel on jet airplanes is associated with an illness, aerotoxic syndrome. Black-Right-Pointing-Pointer A possible cause is exposure to tricresyl

  5. Phase diagrams and magnetic properties of tri-layer superlattices: Mean field study

    NASA Astrophysics Data System (ADS)

    Naji, S.; Belhaj, A.; Labrim, H.; Bahmad, L.; Benyoussef, A.; El Kenz, A.

    2014-04-01

    Motivated by spintronic device applications, we engineer a superlattice model based on periodic tri-layers consisting of spins σ={1}/{2}, S=1 and q={3}/{2} residing on the sites of a square lattice, interacting with an external magnetic field. We study its phase diagrams and magnetic properties. We determine the corresponding ground state phase diagrams. Then, we show that this Ising lattice model exhibits a ferromagnetic phase F1, two ferrimagnetic phases F2, F3 and an antiferromagnetic phase F4. It is found that the magnetic behaviors depend on the moduli space controlled by the exchange interaction couplings. More precisely, the hysteresis loops have been established.

  6. Materials Evaluation in the Tri-Service Thermal Radiation Test Facility.

    DTIC Science & Technology

    1981-02-28

    AD-AI05 Off DAYTON UNIY 04N F/O 20/13 MATERIALS EVALUATION IN THE TRI-SERVICE THERMAL RADIATION TEST -"ETC(U) FEB 1 D ERODEMAN. S H WILT, R A SERVAIS...RPORT DOCUMENTATION PAGE READ INSTRUCTIONSBEFORE COMPLETING FORM "~1.REP R NUM 1.2. GOVT ACCESSION NO. 3.RECIPIENT’S CATALOG NUMBER y NAERIALS...EAB ATION INSTE - ’-LYT125 Jan 80-28 Feb 81,- 7.AUTHO- R (s Dnnis dem_ De Ged n Nichola 5N70lsonF 5 DNA I~-BY-C- 128 VaiLRR414...~ ~O NAME AN DRS q

  7. PCNCP ligands in the chromium-catalyzed oligomerization of ethylene: tri- versus tetramerization.

    PubMed

    Klemps, Christian; Payet, Elina; Magna, Lionel; Saussine, Lucien; Le Goff, Xavier F; Le Floch, Pascal

    2009-08-17

    Chromium(III) complexes bearing R'N(CH2PR2)2 (PCNCP) ligands have been prepared. Upon activation with methylaluminoxane, these complexes proved to be effective in the selective tri- and tetramerization of ethylene. The formation of either 1-hexene or 1-octene was found to be highly dependent on the steric bulk of the substituents R on the phosphine moieties. This observation was rationalized by using density functional theory calculations on selected steps of the metallacyclic mechanism of the ethylene oligomerization reaction.

  8. Research institute tries to ease brain drain by bringing researchers back to Canada.

    PubMed Central

    OReilly, M

    1995-01-01

    The lack of research opportunities in Canada and the large number of them in the US have cost Canada some of its brightest young researchers. The Robarts Research Institute in London, Ont., is trying to reverse that trend by bringing some of these researchers back home. However, Dr. Mark Poznansky says the repatriation efforts will mean little if research budgets keep getting cut in Canada. He says the budget of the Medical Research Council of Canada is barely adequate for today's needs. Images p1110-a p1110-b p1111-a PMID:7712423

  9. Uptake of tri-p-cresyl phosphate (TCP) in soybean plants

    SciTech Connect

    Casterline, J.L. Jr.; Ku, Y.; Barnett, N.M.

    1985-08-01

    Because of the possible release of TCP to the environment, this study was undertaken to determine the uptake and translocation of TCP by soybean plants, using pure tri-p-cresyl phosphate (TpCP) as a model compound. The authors wished to learn the propensity of TpCP to move into the food crops from the soil. This study was not concerned with phytotoxicity, but with the possibility of foods becoming contaminated with TCP through the use of sludge or waste-water on agricultural lands.

  10. VizieR Online Data Catalog: Spectroscopy of V Tri (Ren+, 2017)

    NASA Astrophysics Data System (ADS)

    Ren, A. B.; Zhang, X. B.; Fu, J. N.; Zhang, Y. P.; Cang, T. Q.; Fox-Machado, L.; Li, C. Q.; Khokhuntod, P.; Luo, Y. P.

    2017-08-01

    The spectroscopic observations for V Tri were carried out with the 2.12m telescope at the Observatorio Astronemico Nacional on the Sierra San Pedro Martir (OAN-SPM) in Mexico on 2015 November 03 and 05. We used a 2048*2048 E2V CCD-4240 to collect the high-resolution (the maximum resolution is R=18000 at 5000Å) echelle spectra at the slit size 1''. The spectral range coverage was from 3800 to 7100Å (4 data files).

  11. Measurement of Creep on the Calaveras Fault at Coyote Dam using Terrestrial Radar Interferometry (TRI).

    NASA Astrophysics Data System (ADS)

    Baker, B.; Cassotto, R.; Fahnestock, M. A.; Werner, C. L.; Boettcher, M. S.

    2015-12-01

    The Calaveras fault in central California is part of the San Andreas fault system. Coyote Dam, an earthen dam that straddles the fault ~13km northeast of Gilroy, experiences creep style deformation that ranges from 10 to 15 mm/yr. Uncertainty in the location of the fault, coupled with the historic rate of deformation, affect the dam's safety factor. Assessing the impact of fault creep on the dam's stability is paramount to its safety evaluation, but is difficult to resolve due to limited spatial and temporal sampling of conventional methods. Terrestrial radar interferometry (TRI), like satellite-based observations, produces high spatial resolution maps of ground deformation. Unlike space-based sensors, TRI can be readily deployed and the observation geometry selected to get the maximum line of sight (LOS) signal. TRI also benefits from high temporal sampling which can be used to reduce errors related to atmospheric phase delays and high temporal sampling also facilitates tracking rapidly moving features such as landslides and glaciers. GAMMA Portable Radar Interferometer (GPRI) measurements of Coyote Dam rock faces were made from concrete piers built upstream and downstream of the dam. The GPRI operates at a radar frequency of 17.2 GHz with a spatial resolution at the dam of approximately 0.9 m x 2.0 m. Changes in LOS path length smaller than 0.1mm can be measured. Data were acquired approximately every 2 to 3 weeks over a 7-month period to map the fault trace through the dam faces. Our study exploits the dense record of observations obtained, and the relatively short distance of the radar to the dam to minimize atmospheric affects. We investigate how the deformation evolves in time and the orientation of fault through the dam, including the strike and dip as measured along the dam surface. Our results show rates consistent with GPS data and regional satellite observations, but produce a much more detailed map of the fault on the dam than possible with GPS or

  12. Shape of vaginal suppositories affects willingness-to-try and preference.

    PubMed

    Li, Bangde; Zaveri, Toral; Ziegler, Gregory R; Hayes, John E

    2013-03-01

    HIV and other sexually transmitted infections (STIs) are a global threat to public health that may be countered, in part, by microbicides. A successful microbicide must be both biologically efficacious and highly acceptable to users. Sensory attributes have a direct influence on product acceptability. We created a series of vaginal suppositories appropriate for use as microbicides to investigate the influence of shape on women's willingness-to-try. The influence of perceived size and firmness on acceptability was also assessed. Sexually-active women (n=99) were invited to participate in an evaluation of vaginal suppositories in 5 different shapes including: Bullet, Long Oval, Round Oval, Teardrop and Tampon. The volume (3mL) and formulation for these five prototypes were identical. After manipulating prototypes ex vivo (in their hands), participants rated their willingness-to-try on a 100-point visual analog scale. The appropriateness of size and firmness were evaluated using 5-point just-about-right (JAR) scales. Each participant evaluated all five prototypes individually. Samples were presented in a counterbalanced monadic sequence using a Williams design. Mean willingness-to-try varied by shape, with Bullet and Long Oval receiving significantly higher scores. This was consistent with JAR data for size, as 70% and 65% of women indicated these shapes were 'just-about-right', respectively. In contrast, a minority of women endorsed the other 3 shapes as having a size that was 'just-about-right'. The proportion of women who felt the firmness was 'just-about-right' was uniformly high, irrespective of shape, suggesting prior attempts to optimize the formula were successful. Perceptions of size and firmness were influenced by the physical length and width of the prototypes, in spite of having constant volume. Women showed high willingness-to-try when asked to assume they were at risk. These results are relevant for behavioral and formulation scientists working on

  13. Lithium tri borate (LiB3O5) embedded polymer electret for mechanical sensing application

    NASA Astrophysics Data System (ADS)

    Murugan, S.; Praveen, E.; Prasad, M. V. N.; Jayakumar, K.

    2017-05-01

    Lithium tri borate (LiB3O5) particles were synthesized by precipitation assisted high temperature solid state reaction. The particles were embedded in chitosan polymer and used as an electret. This electret was characterized for the suitability as a sensing element in vibration accelerometer. It is observed that LiB3O5 embedded electret exhibiting piezoelectric property. The electret is also giving an isolation of > 999 MΩ at 100 Vdc, 250 Vdc, 500 Vdc and 1kVdc confirms compatible for intrinsically safe sensing alternative in vibration accelerometer.

  14. A mass balance of tri-hexabrominated diphenyl ethers in lactating cows.

    PubMed

    Kierkegaard, Amelie; De Wit, Cynthia A; Asplund, Lillemor; McLachlan, Michael S; Thomas, Gareth O; Sweetman, Andrew J; Jones, Kevin C

    2009-04-01

    Beef and dairy products can be important vectors of human exposure to polybrominated diphenylethers (BDEs), and hence an understanding of BDE transfer from feed to cows' milk and tissue is important for BDE exposure assessment The fate of tri- to hexaBDEs in lactating cows exposed to a naturally contaminated diet was studied by analyzing feed, feces, and milk samples from a mass balance study. Tissue distribution was studied in one cowslaughtered afterthe experiment The carryover rates from feed to milk ranged from 0.15 to 0.35 for the major congeners. Lower values were observed for several of the tetrabrominated congeners, and this was attributed to metabolism. The dietary absorption efficiency decreased with increasing octanol-water partition coefficient of the BDE congener. The absorption behavior was consistent with a model based on chemical lipophilicity, but agreed less well with a model based on effective molecular diameter, and it violated Lipinski's "rule of 5". The lipid normalized concentrations were similar in all tissues analyzed including liver and milk, suggesting that tissue distribution is governed by partitioning into lipids. Overall, the behavior of the tri- to hexaBDEs was consistent with that observed for other classes of halogenated aromatic contaminants such as PCBs and PCDD/Fs, but it differed markedly from the behavior of the hepta- decaBDEs.

  15. Homogeneous liquid-liquid extraction of uranium(VI) using tri-n-octylphosphine oxide.

    PubMed

    Ghiasvand, Ali Reza; Mohagheghzadeh, Elham

    2004-06-01

    A simple and efficient method for the selective separation and preconcentration of uranium(VI) using homogeneous liquid-liquid extraction was developed. Tri-n-octylphosphine oxide (TOPO) and tri-n-butylphosphate (TBP) were investigated as complexing ligands, and perfluorooctanoate ion (PFOA-) was applied as a phase separator agent under strongly acidic conditions. Under the optimal conditions ([PFOA-] = 1.7 x 10(-3) M, [TOPO] = 5.4 x 10(-4) M, [HNO3] = 0.3 M, [acetone] = 3.2% v/v) 10 microg of uranium in 40 ml aqueous phase could be extracted quantitatively into 8 microl of the sedimented phase. The maximum concentration factor was 5000-fold. However, an effort for the quantitative extraction using TBP was inefficient and the percent recovery was at most 56.7. The influence of the type and concentration of acid solution, optimum amount of the ligand, type and volume of the organic solvent, concentration of PFOA, volume of the aqueous sample and effect of different diverse ions on the extraction and determination of uranium(VI) were investigated. The proposed method was applied to the extraction and determination of uranium(VI) in natural water samples.

  16. A bio-injectable algin-aminocaproic acid thixogel with tri-stimuli responsiveness.

    PubMed

    Chejara, Dharmesh R; Mabrouk, Mostafa; Badhe, Ravindra V; Mulla, Jameel A S; Kumar, Pradeep; Choonara, Yahya E; du Toit, Lisa C; Pillay, Viness

    2016-01-01

    In this article a novel bio-injectable algin-aminocaproic acid (Alg-ACA) tri-stimuli responsive thixogel system is reported. The designed soft thixotrophic hydrogel (thixogel) was characterized using various analytical techniques such as FT-IR, NMR, SEM, AFM and DSC. The soft thixogel system was further investigated for stress responsiveness using different rheological studies which confirmed the thixotropic nature of the gel [Thixotropic area (Ar) of Alg-ACA (1:0.5), Alg-ACA (1:1) and Alg-ACA (1:2), were 23.5%, 43.1%, and 27.59%, respectively, which were higher than that of Na-Alg (2.08%)]. The thixogel also demonstrated temperature and ultrasonication responsiveness. This tri-stimuli responsive soft thixogel system was rendered flowable (fluid) on applying the described physical stimuli and recovered its "rigid" gel structure upon removal of the applied stimuli. This approach of synthesizing a thixogels may be applicable to a broad variety of other natural polymers and has the potential for use in biomedical applications.

  17. Access to Investigational Drugs: FDA Expanded Access Programs or "Right-to-Try" Legislation?

    PubMed

    Holbein, M E Blair; Berglund, Jelena P; Weatherwax, Kevin; Gerber, David E; Adamo, Joan E

    2015-10-01

    The Food and Drug Administration Expanded Access (EA) program and "Right-to-Try" legislation aim to provide seriously ill patients who have no other comparable treatment options to gain access to investigational drugs and biological agents. Physicians and institutions need to understand these programs to respond to questions and requests for access. FDA EA programs and state and federal legislative efforts to provide investigational products to patients by circumventing FDA regulations were summarized and compared. The FDA EA program includes Single Patient-Investigational New Drug (SP-IND), Emergency SP-IND, Intermediate Sized Population IND, and Treatment IND. Approval rates for all categories exceed 99%. Approval requires FDA and Institutional Review Board (IRB) approval, and cooperation of the pharmaceutical partner is essential. "Right-to-Try" legislation bypasses some of these steps, but provides no regulatory or safety oversight. The FDA EA program is a reasonable option for patients for whom all other therapeutic interventions have failed. The SP-IND not only provides patient access to new drugs, but also maintains a balance between immediacy and necessary patient protection. Rather than circumventing existing FDA regulations through proposed legislation, it seems more judicious to provide the knowledge and means to meet the EA requirements. © 2015 Wiley Periodicals, Inc.

  18. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV.

    PubMed

    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad

    2016-05-09

    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability.

  19. Removal of viable and inactivated Cryptosporidium by dual- and tri-media filtration.

    PubMed

    Emelko, Monica B

    2003-07-01

    The limited efficacy of disinfectants, other than ultraviolet irradiation and ozonation, as a barrier against Cryptosporidium parvum in drinking water treatment has underscored the increased importance of oocyst removal by filtration. Currently, no reliable surrogates have been identified for C. parvum removal by filtration. As a result, evaluations of the Cryptosporidium removal by treatment operations have been performed using oocysts. It has typically been assumed that chemically inactivated oocysts are suitable surrogates for viable oocysts. Measurements of electrophoretic mobility, however, have shown that chemical inactivation changes the surface charge of Cryptosporidium oocysts. The present bench-scale research indicated that formalin-inactivated oocysts are reliable surrogates for viable oocysts during both stable filter operation and periods where filtration processes are challenged, such as coagulation failure. This finding is important because of the practical difficulties associated with using viable oocysts in filtration investigations. Poor coagulation conditions severely compromised removal of viable and inactivated oocysts by dual- and tri-media filters compared to stable operating conditions and filter ripening, emphasizing the importance of optimized chemical pre-treatment (coagulation) for the successful removal of oocysts during filtration. The treatment optimization experiments also indicated that tri-media filters offered only marginally higher oocyst removals than dual-media filters.

  20. Health risk assessment of exposure to TriCresyl Phosphates (TCPs) in aircraft: a commentary.

    PubMed

    de Ree, Hans; van den Berg, Martin; Brand, Teus; Mulder, Gerard J; Simons, Ries; Veldhuijzen van Zanten, Brinio; Westerink, Remco H S

    2014-12-01

    Possible exposure to TriCresyl Phosphates (TCPs) has led to concerns among airline crew members. One isomer, Tri-ortho-Cresyl Phosphate (ToCP) is known to be neurotoxic and exposure to ToCP via contaminated cabin air has been suggested to be associated with the alleged Aerotoxic syndrome. The symptoms associated with Aerotoxic syndrome are diverse, including headaches, loss of balance, numbness and neurobehavioral abnormalities such as emotional instability, depression and cognitive dysfunction. Other ortho-isomers are toxic as well, but the non-ortho isomers are regarded as less toxic. In a collaborative effort to increase insight into the possible association between exposure to TCPs via contaminated cabin air and Aerotoxic syndrome, we performed an exposure- and toxicological risk assessment. Measurements in KLM 737 aircraft have demonstrated the presence of non-ortho isomers in low concentrations, though ToCP and other ortho-isomers could not be detected. Based on this exposure assessment, we established a toxicological risk model that also takes into account human differences in bioactivation and detoxification to derive a hazard quotient. From this model it appears unlikely that the health effects and alleged Aerotoxic syndrome are due to exposure to ToCP. Alternative explanations for the reported symptoms are discussed, but evaluation of the current findings in light of the criteria for occupational disease leads to the conclusion that the Aerotoxic Syndrome cannot be regarded as such. Additional research is thus required to unravel the underlying causes for the reported health complaints.

  1. Bismuth tri- and tetraarylcarboxylates: crystal structures, in situ X-ray diffraction, intermediates and luminescence.

    PubMed

    Feyand, Mark; Köppen, Milan; Friedrichs, Gernot; Stock, Norbert

    2013-09-09

    A systematic investigation of the systems Bi(3+)/carboxylic acid/HNO3 for the tri- and tetracarboxylic acids pyromellitic acid (H4Pyr), trimellitic acid (H3Tri) and trimesic acid (H3BTC) acid led to the discovery of five new bismuth carboxylates. Structural characterisation allowed the influence of the linker geometry and the Bi(3+):linker molar ratio in the starting solution on the crystal structure to be determined. The crystallisation of three selected compounds was investigated by in situ energy-dispersive X-ray diffraction. Three new crystalline intermediates were observed within minutes, and two of them could be isolated by quenching of the reaction mixture. Their crystal structures were determined from laboratory and synchrotron X-ray powder diffraction data and allowed a possible reaction pathway to be established. In depth characterisation of the luminescence properties of the three bismuth pyromellate compounds was carried out. Fluorescence and phosphorescence could be assigned to (mainly) ligand- and metal-based transitions. The polymorphs of Bi(HPyr) exhibit different luminescence properties, although their structures are very similar. Surprisingly, doping of the three host structures with Eu(3+) and Tb(3+) ions was only successful for one of the polymorphs.

  2. Along the Ta Diffusion Path Through a Boron and Oxygen Containing Tri-layer Structure

    NASA Astrophysics Data System (ADS)

    Ying, Ji-Feng; Ji, Rong; Wang, Chen Chen; Ter Lim, Sze; Xie, Huiqing; Gerard, Ernult F.

    2014-08-01

    Diffusion and migration of elements are commonly observed in the fabrication of multilayer thin-film devices, including those of STT-RAM. The CoFeB/MgO/CoFeB tri-layer thin-film stack has been widely used in the design of STT-RAM devices as the functional magnetic-tunnel-junction (MTJ) structure. Such issues faced in the fabrication of these devices have been extensively researched from the stand point of engineering the materials property and structure to achieve the best MTJ performance. In this work, we conducted a detailed examination of the chemical-state change of the Ta and B in a CoFeB/MgO/CoFeB/Ta film stack by using x-ray photoelectron spectroscopy (XPS) and time-of-flight secondary ion mass spectrometry. We showed that the chemical-state change of Ta and B is a result of the Ta diffusion phenomena through the CoFeB/MgO/CoFeB tri-layer structure. In particular, we report the evidences of the formation of TaB x O y compound at some considerable depth away from the Ta layer. Also of value to XPS spectroscopy, the Ta binding energy for such TaB x O y compound is reported for the first time.

  3. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV

    PubMed Central

    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad

    2016-01-01

    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability. PMID:27171084

  4. Transient thermal analysis of a tri-axial HTS cable on fault current condition

    NASA Astrophysics Data System (ADS)

    Hu, N.; Cao, K.; Wang, D.; Song, M.; Miyagi, D.; Tsuda, M.; Hamajima, T.

    2013-11-01

    High-temperature superconducting (HTS) tri-axial cable, which consists of three concentric phases, was developed as a potential commercial solution for next generation distribution power network. In our previous research, we simulate the transient thermal behavior of the cable by solving the heat equation using one-dimension difference method. The result shows that it takes time to recover the cable temperature to the steady-state operation level due to a low thermal conductivity of the insulation layer after a fault. However for a long cable system, when middle phase in concentric structure is rated under an over current, accumulated heat from middle phase might continually warm up the liquid nitrogen (LN2) flow by heat transfer even the over current has been stopped. In this research, we improve the numerically calculation which includes the consideration of flowing liquid nitrogen and the heat transfer in both radius and longitudinal directions. A long tri-axial cable system thermal stability is discussed based on the calculation results.

  5. Recovery time analysis in a tri-axial HTS cable after an over-current fault

    NASA Astrophysics Data System (ADS)

    Hu, N.; Toda, M.; Watanabe, T.; Tsuda, M.; Hamajima, T.

    2011-11-01

    A tri-axial HTS cable with the advantage of compact structure, low heat loss, and low cost is a perfect solution for future distribution power network demand. In our previous research, a typical single line to ground (SLG) fault simulation was carried out in an adiabatic condition. A stabilizer layer thickness design of the tri-axial HTS cable based on a calculation of maximum temperature rise in the worst condition was proposed. However, in practical application, after the quenched cable is removed from the network by a breaker, a recovery time is also a very important parameter to decide if the cable is allowed to reconnect to the power network. In this paper, a one-dimensional computational fluid dynamics (CFD) analysis is carried out to simulate the transient thermal behavior of the cable. The result shows that it takes time to recover the cable temperature to the steady-state operation level due to a low thermal conductivity of the insulation layer. Since the cable is cooled by forced liquid nitrogen (LN2) flow, there is a temperature gradient along the cable. The temperature of LN2 gradually rises after the fault until the warmed coolant runs out of the cable.

  6. Tobacco use in a tri-ethnic population of older women in southeastern North Carolina.

    PubMed

    Spangler, John G; Case, L Douglas; Bell, Ronny A; Quandt, Sara A

    2003-01-01

    While many studies have evaluated the epidemiology of tobacco use nationally and among specific populations, less is known about the epidemiology of tobacco use among elderly women. We examined the epidemiology of tobacco use among a tri-racial population of elderly women in southeastern North Carolina. Survey Senior centers, community events, and communal meal settings in Robeson County, North Carolina. Two hundred forty (240) women aged 60 and older, with approximately 80 women recruited from each ethnic group: Native American, African-American, and White. Demographic information, health history, and use of alcohol, cigarettes, and smokeless tobacco (ST). Of the total sample of 240 women, 38 (16%) were current ST users. In logistic regression analysis, current ST use was inversely associated with age and education, but positively associated with Native American or African-American ethnicity. Sixteen (17%) of the total sample were current smokers. In logistic regression, younger age and any alcohol use in the past year were associated with current smoking In a tri-ethnic, community-based sample of older women, rates of current ST use were greater than national rates found among women of all ages in each ethnic group. On the other hand, rates of current smoking among these older women were lower than the national prevalence for women among all ages in these 3 respective ethnic groups. The distinctly different epidemiology of ST use vs cigarette smoking among these women high-lights the need to tailor tobacco interventions to each specific product.

  7. Electre Tri-C, a multiple criteria decision aiding sorting model applied to assisted reproduction.

    PubMed

    Figueira, J R; Almeida-Dias, J; Matias, S; Roy, B; Carvalho, M J; Plancha, C E

    2011-04-01

    The aim of this paper is to apply an informatics tool for dealing with a medical decision aiding problem to help infertile couples to become parents, when using assisted reproduction. A multiple criteria decision aiding method for sorting or ordinal classification problems, called Electre Tri-C, was chosen in order to assign each couple to an embryo-transfer category. The set of categories puts in evidence a way for increasing the single pregnancy rate, while minimizing multiple pregnancies. The decision aiding sorting model was co-constructed through an interaction process between the decision aiding analysts and the medical experts. According to the sample used in this study, the Electre Tri-C method provides a unique category in 86% of the cases and it achieves a sorting accuracy of 61%. Retrospectively, the medical experts do agree that some of their judgments concerning the number of embryos to transfer back to the uterus of the woman could be different according to these results. The current ART methodology achieves a single pregnancy rate of 47% and a twin pregnancy rate of 14%. Thus, this informatics tools may play an important role for supporting ART medical decisions, aiming to increase the single pregnancy rate, while minimizing multiple pregnancies. Building the set of criteria comprises a part of arbitrariness and imperfect knowledge, which require time and expertise to be refined. Among them, three criteria are modeled by means of a holistic classification procedure by the medical experts. 2010 Elsevier Ireland Ltd. All rights reserved.

  8. Multiple-try differential evolution adaptive Metropolis for efficient solution of highly parameterized models

    NASA Astrophysics Data System (ADS)

    Eric, L.; Vrugt, J. A.

    2010-12-01

    Spatially distributed hydrologic models potentially contain hundreds of parameters that need to be derived by calibration against a historical record of input-output data. The quality of this calibration strongly determines the predictive capability of the model and thus its usefulness for science-based decision making and forecasting. Unfortunately, high-dimensional optimization problems are typically difficult to solve. Here we present our recent developments to the Differential Evolution Adaptive Metropolis (DREAM) algorithm (Vrugt et al., 2009) to warrant efficient solution of high-dimensional parameter estimation problems. The algorithm samples from an archive of past states (Ter Braak and Vrugt, 2008), and uses multiple-try Metropolis sampling (Liu et al., 2000) to decrease the required burn-in time for each individual chain and increase efficiency of posterior sampling. This approach is hereafter referred to as MT-DREAM. We present results for 2 synthetic mathematical case studies, and 2 real-world examples involving from 10 to 240 parameters. Results for those cases show that our multiple-try sampler, MT-DREAM, can consistently find better solutions than other Bayesian MCMC methods. Moreover, MT-DREAM is admirably suited to be implemented and ran on a parallel machine and is therefore a powerful method for posterior inference.

  9. Circumference reduction and cellulite treatment with a TriPollar radiofrequency device: a pilot study.

    PubMed

    Manuskiatti, W; Wachirakaphan, C; Lektrakul, N; Varothai, S

    2009-07-01

    A wide variety of treatments for circumference reduction and cellulite are available, but most procedures offer suboptimal clinical effect and/or delayed therapeutic outcome. Objective To determine the safety and efficacy of the TriPollar radiofrequency device for cellulite treatment and circumference reduction. Thirty-nine females with cellulite received eight weekly TriPollar treatments. Treatment areas included the abdomen, thighs, buttocks and arms. Subjects were evaluated using standardized photographs and measurements of body weight, circumference, subcutaneous thickness, and skin elasticity of the treatment sites at baseline, immediately after and 4 weeks after the final treatment. Physicians' evaluation of clinical improvement scores using a quartile grading scale was recorded. Thirty-seven patients (95%) completed the treatment protocol. There was significant circumference reduction of 3.5 and 1.7 cm at the abdomen (P = 0.002) and thigh (P = 0.002) regions, respectively. At 4 weeks after the last treatment, the average circumferential reductions of the abdomen and thighs were sustained. No significant circumferential reductions of the buttocks and arms at the last treatment visit compared to baseline were demonstrated (P = 0.138 and 0.152, respectively). Quartile grading scores correlating to approximately 50% improvement in cellulite appearance were noted. Tripollar radiofrequency provided beneficial effects on the reduction of abdomen and thigh circumference and cellulite appearance.

  10. Federal Nursing Service Award. Impact of TriCare/managed care on total force readiness.

    PubMed

    Ray, M A; Turkel, M C

    2001-04-01

    Mission readiness is dependent on a healthy total force and the response of military medical and nursing services. Managed care has become the norm in U.S. health care, including the Department of Defense Military Health System. Cost management, health maintenance organizations, and other health plans are defined as "managed care," an aggressive cost-control effort by health care purchasers and insurers to limit health care spending and services and advance a market-oriented, profit-driven system. The impact of managed care on mission readiness and retention of active and reserve personnel is and will continue to be profound. The purpose of this research was to conduct a qualitative, phenomenological study (life experiences) of TriCare/managed care to explore the impact and the meaning of the experience on total force mission readiness of the U.S. Air Force and how managed care has changed nursing practice. The results reveal the significance of the impact of TriCare/managed care on total force readiness by identifying, through themes, meta-themes, and a representative model, the negative effect that economics is having on active duty and reserve force health and well-being.

  11. Rationale and initial experience with the Tri-Ad Adams tricuspid annuloplasty ring.

    PubMed

    Milla, Federico; Castillo, Javier G; Varghese, Robin; Chikwe, Joanna; Anyanwu, Anelechi C; Adams, David H

    2012-04-01

    Controversy exists regarding the indication and method of repair of functional tricuspid regurgitation (TR) in patients undergoing mitral valve surgery. Whereas the American College of Cardiology/American Heart Association guidelines recommend tricuspid repair in the setting of severe TR, tricuspid repair is advised for less than severe TR in the setting of annular dilation or pulmonary hypertension. Although multiple repair strategies exist, the use of a ring annuloplasty (semirigid remodeling rings vs flexible bands) is the preferred method of therapy to avoid short- and long-term recurrence of TR. The new Tri-Ad Adams annuloplasty ring combines elements of semirigid and flexible bands that will not only allow for annular remodeling in the region of the right ventricular free wall but also potentially reduce injury to the conduction system with its flexible and "open" ends. In this article, we discuss the rational for an aggressive approach to functional tricuspid regurgitation, and show our initial clinical experience with the Tri-Ad Adams annuloplasty ring. Copyright © 2012 The American Association for Thoracic Surgery. Published by Mosby, Inc. All rights reserved.

  12. The transverse space-charge force in tri-gaussian distribution

    SciTech Connect

    Ng, K.Y.; /Fermilab

    2005-12-01

    In tracking, the transverse space-charge force can be represented by changes in the horizontal and vertical divergences, {Delta}x{prime} and {Delta}y{prime} at many locations around the accelerator ring. In this note, they are going to list some formulas for {Delta}x{prime} and {delta}y{prime} arising from space-charge kicks when the beam is tri-Gaussian distributed. They will discuss separately a flat beam and a round beam. they are not interested in the situation when the emittance growth arising from space charge becomes too large and the shape of the beam becomes weird. For this reason, they can assume the bunch still retains its tri-Gaussian distribution, with its rms sizes {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} increasing by certain factors. Thus after each turn, {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} can be re-calculated.

  13. Nanosized sustained-release drug depots fabricated using modified tri-axial electrospinning.

    PubMed

    Yang, Guang-Zhi; Li, Jiao-Jiao; Yu, Deng-Guang; He, Mei-Feng; Yang, Jun-He; Williams, Gareth R

    2017-01-27

    Nanoscale drug depots, comprising a drug reservoir surrounded by a carrier membrane, are much sought after in contemporary pharmaceutical research. Using cellulose acetate (CA) as a filament-forming polymeric matrix and ferulic acid (FA) as a model drug, nanoscale drug depots in the form of core-shell fibers were designed and fabricated using a modified tri-axial electrospinning process. This employed a solvent mixture as the outer working fluid, as a result of which a robust and continuous preparation process could be achieved. The fiber-based depots had a linear morphology, smooth surfaces, and an average diameter of 0.62±0.07μm. Electron microscopy data showed them to have clear core-shell structures, with the FA encapsulated inside a CA shell. X-ray diffraction and IR spectroscopy results verified that FA was present in the crystalline physical form. In vitro dissolution tests revealed that the fibers were able to provide close to zero-order release over 36h, with no initial burst release and minimal tailing-off. The release properties of the depot systems were much improved over monolithic CA/FA fibers, which exhibited a significant burst release and also considerable tailing-off at the end of the release experiment. Here we thus demonstrate the concept of using modified tri-axial electrospinning to design and develop new types of heterogeneous nanoscale biomaterials.

  14. Preparation and electrochemical performance of gel polymer electrolytes using tri(ethylene glycol) dimethacrylate

    NASA Astrophysics Data System (ADS)

    Kim, Hyun-Soo; Shin, Jung-Han; Doh, Chil-Hoon; Moon, Seong-In; Kim, Sang-Pil

    A gel polymer electrolyte (GPE) is prepared from tri(ethylene glycol) dimethacrylate monomer, benzoyl peroxide, and 1.0 M LiPF 6/ethylene carbonate:diethyl carbonate (1:1 vol.%). The LiCoO 2|graphite cells are assembled and their electrochemical properties are evaluated at various current densities and temperatures. The viscosity of the precursor containing 5 vol.% tri(ethylene glycol) dimethacrylate monomer is around 4.6 mPa s. The ionic conductivity of the gel polymer electrolyte at 20 °C is around 5.9×10 -3 S cm -1. The gel polymer electrolyte has good electrochemical stability up to 4.5 V versus Li/Li +. The capacity of the cell at the 1.0 C rate is 89% of the discharge capacity at the 0.2 C rate. The capacity of the cell at temperature of -10 °C is 81% of the discharge capacity at 20 °C. The discharge capacity of the cell with gel polymer electrolyte is stable with charge-discharge cycling.

  15. Application of a tri-axial accelerometer to estimate jump frequency in volleyball.

    PubMed

    Jarning, Jon M; Mok, Kam-Ming; Hansen, Bjørge H; Bahr, Roald

    2015-03-01

    Patellar tendinopathy is prevalent among athletes, and most likely associated with a high jumping load. If methods for estimating jump frequency were available, this could potentially assist in understanding and preventing this condition. The objective of this study was to explore the possibility of using peak vertical acceleration (PVA) or peak resultant acceleration (PRA) measured by an accelerometer to estimate jump frequency. Twelve male elite volleyball players (22.5 ± 1.6 yrs) performed a training protocol consisting of seven typical motion patterns, including jumping and non-jumping movements. Accelerometer data from the trial were obtained using a tri-axial accelerometer. In addition, we collected video data from the trial. Jump-float serving and spike jumping could not be distinguished from non-jumping movements using differences in PVA or PRA. Furthermore, there were substantial inter-participant differences in both the PVA and the PRA within and across movement types (p < 0.05). These findings suggest that neither PVA nor PRA measured by a tri-axial accelerometer is an applicable method for estimating jump frequency in volleyball. A method for acquiring real-time estimates of jump frequency remains to be verified. However, there are several alternative approaches, and further investigations are needed.

  16. A Tri-part Model for Genetics Literacy: Exploring Undergraduate Student Reasoning About Authentic Genetics Dilemmas

    NASA Astrophysics Data System (ADS)

    Shea, Nicole A.; Duncan, Ravit Golan; Stephenson, Celeste

    2015-08-01

    Genetics literacy is becoming increasingly important as advancements in our application of genetic technologies such as stem cell research, cloning, and genetic screening become more prevalent. Very few studies examine how genetics literacy is applied when reasoning about authentic genetic dilemmas. However, there is evidence that situational features of a reasoning task may influence how students apply content knowledge as they generate and support arguments. Understanding how students apply content knowledge to reason about authentic and complex issues is important for considering instructional practices that best support student thinking and reasoning. In this conceptual report, we present a tri-part model for genetics literacy that embodies the relationships between content knowledge use, argumentation quality, and the role of situational features in reasoning to support genetics literacy. Using illustrative examples from an interview study with early career undergraduate students majoring in the biological sciences and late career undergraduate students majoring in genetics, we provide insights into undergraduate student reasoning about complex genetics issues and discuss implications for teaching and learning. We further discuss the need for research about how the tri-part model of genetics literacy can be used to explore students' thinking and reasoning abilities in genetics.

  17. Tri-party underground symbiosis between a weevil, bacteria and a desert plant.

    PubMed

    Shelef, Oren; Helman, Yael; Friedman, Ariel-Leib-Leonid; Behar, Adi; Rachmilevitch, Shimon

    2013-01-01

    Inhabitants of arid ecosystems face severe nitrogen and water limitations. Inventive adaptations by organisms occupying such habitats are essential for survival. This study describes a tri-party symbiotic interaction between a plant (Salsola inermis), a beetle (Conorhynchus pistor), and a bacterium (Klebsiella pneumonia). The weevil survives by living within a mud structure affixed to the plant roots, thus benefiting from increased carbon and water, and refuge from predators and parasites. Active nitrogen-fixing bacteria harbored within the weevil's gut mediate this interaction, by supplying nitrogen to the system, which eventually promotes seed development. We studied the correlation between the weevil's existence and (i) root carbon and nitrogen content, (ii) soil water content and (iii) seed weight. Roots hosting weevils contained more nitrogen, heavier seeds and less carbon. In addition, water content was higher around the roots than in open spaces a short distance from the plant stem. Bacterial studies and nitrogen-fixation analyses, including molecular and chemical assays, indicated atmospheric nitrogen fixation in the larval stage and identified the bacterium. The coexistence of weevil and bacterial behavior coinciding with the plant's life cycle was revealed here by a long period of field observations. Out of over 60,000 known weevils, this is the only report of a weevil living most of its life underground without harming plants. The unique tri-party interaction described herein shows the important ecological role of desert plant roots and provides an example of a sustainable consortium of living organisms coping with the challenging desert environment.

  18. Effective detection method for falls according to the distance between two tri-axial accelerometers

    NASA Astrophysics Data System (ADS)

    Kim, Jae-Hyung; Park, Geun-Chul; Kim, Soo-Hong; Kim, Soo-Sung; Lee, Hae-Rim; Jeon, Gye-Rok

    2016-04-01

    Falls and fall-related injuries are a significant problem in the elderly population. A number of different approaches for detecting falls and activities of daily living (ADLs) have been conducted in recent years. However, distinguishing between real falls and certain fall-like ADL is often difficult. The aim of this study is to discriminate falls from fall-like ADLs such as jogging, jumping, and jumping down. The distance between two tri-axial accelerometers attached to the abdomen and the sternum was increased from 10 to 30 cm in 10-cm intervals. Experiments for falls and ADLs were performed to investigate the feasibility of the detection system for falls developed in this study. When the distances between the two tri-axial electrometers were 20 and 30 cm, fall-like ADLs were effectively distinguished from falls. The thresholds for three parameters — SVM, Diff Z, and Sum_diff_Z — were set; falls could be distinguished from ADL action sequences when the SVM value was larger than 4 g (TH1), the Diff_Z parameter was larger than 1.25 g (TH2), and the Sum_diff_Z parameter was larger than 15 m/s (TH3). In particular, when the SVM, Diff_Z, and Sum_diff_Z parameter were sequentially applied to thresholds (TH1, TH2, and TH3), fall-like ADL action sequences were accurately discriminated from falls.

  19. Tri-allelic patterns at the D7S820 locus detected in two generations of a Chinese family.

    PubMed

    Jiang, Erlie; Pan, Jie; Han, Mingzhe; Chen, Liang; Ma, Qiaoling; Wei, Jialin; Huang, Yong; Feng, Sizhou; Sun, Qin; Xiao, Peili; Zheng, Zhongzheng

    2016-01-01

    Alleles at the D7S820 STR locus have 6-14 different numbers of a four-nucleotide (GATA) repeat motif arranged in tandem. The D7S820 tri-allelic pattern is rare and has not been reported in the Chinese population. In this study we report a three-banded pattern at the D7S820 locus observed in a Chinese family, in which four family members in two generations had tri-allelic D7S820 genotype 10-11-12 and one family member had an abnormal bi-allele genotype 10-11. All of the four tri-allelic cases had the genotype 10-11-12, probably due to three copies of the D7S820 STR sequence in all cells (Type 2 tri-allelic pattern), and deduced alleles 10-11 were a linked inheritance in this family.

  20. FAQs Related to Response to Petition to Add Oil And Gas Extraction Sector to the TRI Program

    EPA Pesticide Factsheets

    Questions and answers related to EPA's response to a petition by the Environmental Integrity Project and 16 other organizations to add the Oil and Gas Extraction sector to the scope of industries subject to TRI reporting requirements.

  1. Design, Simulation and Experimental Evaluation of Tri-Phasic Piezoelectric Composite Transducers

    NASA Astrophysics Data System (ADS)

    Tamez, Juan Pedro

    Piezoelectric ceramics exhibit excellent piezoelectric and dielectric properties that is the basis of practically all transducers and piezoelectric devices, but their inherent properties, such as brittleness, non-ductility and poor shapeability may limit their applications in areas such as vibration sensing, impact detection, structural health monitoring and other reinforced structures and energy harvesting. To compensate for such limitations, the 1-3 piezoelectric composites transducers have become the material of choice for many high performance ultrasound transducers since it was invented in the late 1970's [ref. Newnham/Cross]. Extensive studies on 1-3 composites have been performed since then to improve the performance of a transducer by modifying their electromechanical coupling, bandwidth, quality factor, and flexibility and by reducing or eliminating the cross talk, i.e., induced noise between the active piezoelectric elements, especially in high power and low frequency applications. These fundamental issues, their possible solutions and their wide impact underline the motivation of the current work in this dissertation report. The motivation for this dissertation was to study and provide a foundation to designing multiphasic piezoelectric transducers that could be useful for multitude of applications. The goal was to improve the 1-3 diphasic composite transducer by eliminating the cross talk between the active piezoelectric elements while maintaining and improving the figures of merit of the design. To achieve the ultimate goal, the steps outlined below were followed: i. Understanding the theoretical and mathematical modeling for tri-phasic piezoelectric composite. ii. Implement Finite Element Analysis (FEA) and simulations of tri-phasic piezoelectric composites where the different active piezoelectric material PZT-5H and PMN-30%PT is surrounded by a vacuum phase that is enclosed by a hexagonal polymer walls. iii. Propose a redesign of the tri

  2. CD40L-Tri, a novel formulation of recombinant human CD40L that effectively activates B cells.

    PubMed

    Naito, Masayasu; Hainz, Ursula; Burkhardt, Ute E; Fu, Buyin; Ahove, Deborah; Stevenson, Kristen E; Rajasagi, Mohini; Zhu, Baogong; Alonso, Anselmo; Witten, Elizabeth; Matsuoka, Ken-Ichi; Neuberg, Donna; Duke-Cohan, Jonathan S; Wu, Catherine J; Freeman, Gordon J

    2013-02-01

    CD40L has a well-established role in enhancing the immunostimulatory capacity of normal and malignant B cells, but a formulation suitable for clinical use has not been widely available. Like other TNF family members, in vivo and in vitro activity of CD40L requires a homotrimeric configuration, and growing evidence suggests that bioactivity depends on higher-order clustering of CD40. We generated a novel formulation of human recombinant CD40L (CD40L-Tri) in which the CD40L extracellular domain and a trimerization motif are connected by a long flexible peptide linker. We demonstrate that CD40L-Tri significantly expands normal CD19+ B cells by over 20- to 30-fold over 14 days and induces B cells to become highly immunostimulatory antigen-presenting cells (APCs). Consistent with these results, CD40L-Tri-activated B cells could effectively stimulate antigen-specific T responses (against the influenza M1 peptide) from normal volunteers. In addition, CD40L-Tri could induce malignant B cells to become effective APCs, such that tumor-directed immune responses could be probed. Together, our studies demonstrate the potent immune-stimulatory effects of CD40L-Tri on B cells that enable their expansion of antigen-specific human T cells. The potent bioactivity of CD40L-Tri is related to its ability to self-multimerize, which may be facilitated by its long peptide linker.

  3. Tri-Layered Nanocomposite Hydrogel Scaffold for the Concurrent Regeneration of Cementum, Periodontal Ligament, and Alveolar Bone.

    PubMed

    Sowmya, S; Mony, Ullas; Jayachandran, P; Reshma, S; Kumar, R Arun; Arzate, H; Nair, Shantikumar V; Jayakumar, R

    2017-04-01

    A tri-layered scaffolding approach is adopted for the complete and concurrent regeneration of hard tissues-cementum and alveolar bone-and soft tissue-the periodontal ligament (PDL)-at a periodontal defect site. The porous tri-layered nanocomposite hydrogel scaffold is composed of chitin-poly(lactic-co-glycolic acid) (PLGA)/nanobioactive glass ceramic (nBGC)/cementum protein 1 as the cementum layer, chitin-PLGA/fibroblast growth factor 2 as the PDL layer, and chitin-PLGA/nBGC/platelet-rich plasma derived growth factors as the alveolar bone layer. The tri-layered nanocomposite hydrogel scaffold is cytocompatible and favored cementogenic, fibrogenic, and osteogenic differentiation of human dental follicle stem cells. In vivo, tri-layered nanocomposite hydrogel scaffold with/without growth factors is implanted into rabbit maxillary periodontal defects and compared with the controls at 1 and 3 months postoperatively. The tri-layered nanocomposite hydrogel scaffold with growth factors demonstrates complete defect closure and healing with new cancellous-like tissue formation on microcomputed tomography analysis. Histological and immunohistochemical analyses further confirm the formation of new cementum, fibrous PDL, and alveolar bone with well-defined bony trabeculae in comparison to the other three groups. In conclusion, the tri-layered nanocomposite hydrogel scaffold with growth factors can serve as an alternative regenerative approach to achieve simultaneous and complete periodontal regeneration. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. The insula modulates arousal-induced reluctance to try novel tastes through adrenergic transmission in the rat

    PubMed Central

    Rojas, Sebastián; Diaz-Galarce, Raúl; Jerez-Baraona, Juan Manuel; Quintana-Donoso, Daisy; Moraga-Amaro, Rodrigo; Stehberg, Jimmy

    2015-01-01

    Reluctance to try novel tastes (neophobia) can be exacerbated in arousing situations, such as when children are under social stress or in rodents, when the new taste is presented in a high arousal context (HA) compared to a low arousal context (LA). The present study aimed at determining whether adrenergic transmission at the Insula regulates the reluctance to try novel tastes induced by arousing contexts. To this end, a combination of systemic and intra-insular manipulations of adrenergic activity was performed before the novel taste (saccharin 0.1%) was presented either in LA or HA contexts in rats. Our results show that systemic adrenergic activity modulates reluctance to try novel tastes. Moreover, intra-insular microinjections of propranolol or norepinephrine (NE) were found to modulate the effects of arousing contexts on reluctance to try novel tastes. Finally, intra-insular propranolol blocked epinephrine-induced increased reluctance, while intra-insular NE blocked oral propranolol-induced decreases in reluctance and increased the reluctance to try novel tastes presented in low arousing contexts. In conclusion, our results suggest that the insula is a critical site for regulating the effects of arousal in the reluctance to try novel tastes via the adrenergic system. PMID:26175672

  5. The insula modulates arousal-induced reluctance to try novel tastes through adrenergic transmission in the rat.

    PubMed

    Rojas, Sebastián; Diaz-Galarce, Raúl; Jerez-Baraona, Juan Manuel; Quintana-Donoso, Daisy; Moraga-Amaro, Rodrigo; Stehberg, Jimmy

    2015-01-01

    Reluctance to try novel tastes (neophobia) can be exacerbated in arousing situations, such as when children are under social stress or in rodents, when the new taste is presented in a high arousal context (HA) compared to a low arousal context (LA). The present study aimed at determining whether adrenergic transmission at the Insula regulates the reluctance to try novel tastes induced by arousing contexts. To this end, a combination of systemic and intra-insular manipulations of adrenergic activity was performed before the novel taste (saccharin 0.1%) was presented either in LA or HA contexts in rats. Our results show that systemic adrenergic activity modulates reluctance to try novel tastes. Moreover, intra-insular microinjections of propranolol or norepinephrine (NE) were found to modulate the effects of arousing contexts on reluctance to try novel tastes. Finally, intra-insular propranolol blocked epinephrine-induced increased reluctance, while intra-insular NE blocked oral propranolol-induced decreases in reluctance and increased the reluctance to try novel tastes presented in low arousing contexts. In conclusion, our results suggest that the insula is a critical site for regulating the effects of arousal in the reluctance to try novel tastes via the adrenergic system.

  6. Using Tri-Axial Accelerometry in Daily Elite Swim Training Practice.

    PubMed

    Ganzevles, Sander; Vullings, Rik; Beek, Peter Jan; Daanen, Hein; Truijens, Martin

    2017-04-29

    Background: Coaches in elite swimming carefully design the training programs of their swimmers and are keen on achieving strict adherence to those programs by their athletes. At present, coaches usually monitor the compliance of their swimmers to the training program with a stopwatch. However, this measurement clearly limits the monitoring possibilities and is subject to human error. Therefore, the present study was designed to examine the reliability and practical usefulness of tri-axial accelerometers for monitoring lap time, stroke count and stroke rate in swimming. Methods: In the first part of the study, a 1200 m warm-up swimming routine was measured in 13 elite swimmers using tri-axial accelerometers and synchronized video recordings. Reliability was determined using the typical error of measurement (TEM) as well as a Bland-Altman analysis. In the second part, training compliance both within and between carefully prescribed training sessions was assessed in four swimmers in order to determine the practical usefulness of the adopted accelerometric approach. In these sessions, targets were set for lap time and stroke count by the coach. Results: The results indicated high reliability for lap time (TEM = 0.26 s, bias = 0.74 [0.56 0.91] with limits of agreement (LoA) from -1.20 [-1.50 -0.90] to 2.70 [2.40 3.00]), stroke count (TEM 0.73 strokes, bias = 0.46 [0.32 0.60] with LoA from -1.70 [-1.94 -1.46] to 2.60 [2.36 2.84]) and stroke rate (TEM 0.72 str∙min(-1), bias = -0.13 [-0.20 -0.06] with LoA from -2.20 [-2.32 -2.08] to 1.90 [1.78 2.02]), while the results for the monitoring of training compliance demonstrated the practical usefulness of our approach in daily swimming training. Conclusions: The daily training of elite swimmers can be accurately and reliably monitored using tri-axial accelerometers. They provide the coach with more useful information to guide and control the training process than hand-clocked times.

  7. Constitutive Behavior of Reinforced Concrete Membrane Elements under Tri-directional Shear

    NASA Astrophysics Data System (ADS)

    Labib, Moheb

    The two-dimensional behavior of typical reinforced concrete (RC) structures has been extensively studied in the past several decades by investigating the constitutive behavior of full-scale reinforced concrete elements subjected to a bi-axial state of stress. In order to understand the true behavior of many large complex structures, the goal of this investigation is to develop new constitutive relationships for RC elements subjected to tri-directional shear stresses. Recently, additional out-of-plane jacks were installed on the panel tester at University of Houston so that concrete elements could be subjected to tri-directional shear stresses. This upgrade makes the panel tester the only one of its kind in the US that is capable of applying such combinations of stresses on full-scale reinforced concrete elements. This dissertation presents the details of the mounting and installation of the additional hydraulic jacks on the universal panel tester. The experimental program includes a series of seven reinforced concrete elements subjected to different combinations of in-plane and out-of-plane shear stresses. Increasing the applied out-of-plane shear stresses reduced the membrane shear strength of the elements. The effect of applying out-of-plane shear stresses on the in-plane shear strength was represented by modifying the softening coefficient in the compression stress strain curve of concrete struts. The modified model was able to capture the behavior and the ultimate capacity of the tested elements. The effect of the in-plane shear reinforcement ratio on the interaction between in-plane and out-of-plane shear stresses was evaluated. The model was implemented in the Finite Element package FEAP and was used to predict the ultimate capacity of many structures subjected to a combination of in-plane and out-of-plane shear stresses. The results of the analytical model were used to develop simplified design equations for members subjected to bi-directional shear loads

  8. Tri-band optical coherence tomography for lipid and vessel spectroscopic imaging

    NASA Astrophysics Data System (ADS)

    Yu, Luoqin; Kang, Jiqiang; Wang, Xie; Wei, Xiaoming; Chan, Kin-Tak; Lee, Nikki P.; Wong, Kenneth K. Y.

    2016-03-01

    Optical coherence tomography (OCT) has been utilized for various functional imaging applications. One of its highlights comes from spectroscopic imaging, which can simultaneously obtain both morphologic and spectroscopic information. Assisting diagnosis and therapeutic intervention of coronary artery disease is one of the major directions in spectroscopic OCT applications. Previously Tanaka et al. have developed a spectral domain OCT (SDOCT) to image lipid distribution within blood vessel [1]. In the meantime, Fleming et al. have demonstrated optical frequency domain imaging (OFDI) by a 1.3-μm swept source and quadratic discriminant analysis model [2]. However, these systems suffered from burdensome computation as the optical properties' variation was calculated from a single-band illumination that provided limited contrast. On the other hand, multi-band OCT facilitates contrast enhancement with separated wavelength bands, which further offers an easier way to distinguish different materials. Federici and Dubois [3] and Tsai and Chan [4] have demonstrated tri-band OCT systems to further enhance the image contrast. However, these previous work provided under-explored functional properties. Our group has reported a dual-band OCT system based on parametrically amplified Fourier domain mode-locked (FDML) laser with time multiplexing scheme [5] and a dual-band FDML laser OCT system with wavelength-division multiplexing [6]. Fiber optical parametric amplifier (OPA) can be ideally incorporated in multi-band spectroscopic OCT system as it has a broad amplification window and offers an additional output range at idler band, which is phase matched with the signal band. The sweeping ranges can thus overcome traditional wavelength bands that are limited by intra-cavity amplifiers in FDML lasers. Here, we combines the dual-band FDML laser together with fiber OPA, which consequently renders a simultaneous tri-band output at 1.3, 1.5, and 1.6 μm, for intravascular applications

  9. 77 FR 43591 - Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River Energy, LLC; Notice of Filing

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-07-25

    ... Energy Regulatory Commission Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River Energy, LLC; Notice of Filing Take notice that on July 10, 2012, Tri-State Financial Co., LLC, d/ b/a North Country Ethanol (Tri-State), and Red River Energy, LLC (Red River) filed an application, pursuant...

  10. 75 FR 34734 - Adequacy Status of the Kentucky Portion of the Huntington-Ashland Tri-State Area 1997 Annual PM2.5

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-06-18

    ... AGENCY Adequacy Status of the Kentucky Portion of the Huntington-Ashland Tri-State Area 1997 Annual PM2.5... the 1997 PM 2.5 attainment demonstration for the Kentucky portion of the tri-state Huntington-Ashland nonattainment area. The tri-state Huntington-Ashland 1997 annual PM 2.5 nonattainment area is comprised of Boyd...

  11. 41 CFR 102-38.70 - May the holding agency abandon or destroy personal property either prior to or after trying to...

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... abandon or destroy personal property either prior to or after trying to sell it? 102-38.70 Section 102-38... trying to sell it? (a) Yes, the holding agency may abandon or destroy personal property either prior to or after trying to sell it, but only when an authorized agency official has made a...

  12. 41 CFR 102-38.70 - May the holding agency abandon or destroy personal property either prior to or after trying to...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... abandon or destroy personal property either prior to or after trying to sell it? 102-38.70 Section 102-38... trying to sell it? (a) Yes, the holding agency may abandon or destroy personal property either prior to or after trying to sell it, but only when an authorized agency official has made a...

  13. 41 CFR 102-38.70 - May the holding agency abandon or destroy personal property either prior to or after trying to...

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... abandon or destroy personal property either prior to or after trying to sell it? 102-38.70 Section 102-38... trying to sell it? (a) Yes, the holding agency may abandon or destroy personal property either prior to or after trying to sell it, but only when an authorized agency official has made a...

  14. 41 CFR 102-38.70 - May the holding agency abandon or destroy personal property either prior to or after trying to...

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... abandon or destroy personal property either prior to or after trying to sell it? 102-38.70 Section 102-38... trying to sell it? (a) Yes, the holding agency may abandon or destroy personal property either prior to or after trying to sell it, but only when an authorized agency official has made a...

  15. 41 CFR 102-38.70 - May the holding agency abandon or destroy personal property either prior to or after trying to...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... abandon or destroy personal property either prior to or after trying to sell it? 102-38.70 Section 102-38... trying to sell it? (a) Yes, the holding agency may abandon or destroy personal property either prior to or after trying to sell it, but only when an authorized agency official has made a...

  16. Improved reformer yield and hydrogen selectivity with tri-metallic catalyst

    SciTech Connect

    Morse, R.W.; Vance, P.W.; Novak, W.J.; Franck, J.P.; Plumail, J.C.

    1995-09-01

    A new tri-metallic reforming catalyst has been developed for semi-regenerative reforming. This catalyst gives improved C{sub 5} + yield and improved hydrogen yield compared with conventional Pt/Re catalyst. Its stability is equivalent to balanced Pt/Re catalyst. The catalyst is in use in several commercial units and the commercial data confirms the increase in yield and the stability of the catalyst. The improved yield substantially impacts the refiners economics. The annual increase in product value ranges from 0.6 MM$/year to 2.5 MM$/year for a typical 20,000 BPD reformer at current US product prices, depending on the refinery hydrogen balance.

  17. 1-nm-thick graphene tri-layer as the ultimate copper diffusion barrier

    SciTech Connect

    Nguyen, Ba-Son; Lin, Jen-Fin

    2014-02-24

    We demonstrate the thinnest ever reported Cu diffusion barrier, a 1-nm-thick graphene tri-layer. X-ray diffraction patterns and Raman spectra show that the graphene is thermally stable at up to 750 °C against Cu diffusion. Transmission electron microscopy images show that there was no inter-diffusion in the Cu/graphene/Si structure. Raman analyses indicate that the graphene may have degraded into a nanocrystalline structure at 750 °C. At 800 °C, the perfect carbon structure was damaged, and thus the barrier failed. The results of this study suggest that graphene could be the ultimate Cu interconnect diffusion barrier.

  18. Tri-band miniaturized wide-angle and polarization-insensitive metasurface for ambient energy harvesting

    NASA Astrophysics Data System (ADS)

    Zhang, Xuanming; Liu, Haixia; Li, Long

    2017-08-01

    In this paper, a tri-band miniaturized wide-angle and polarization-insensitive metasurface is proposed as an ambient energy collector. The metasurface is composed of a subwavelength butterfly-type closed-ring (BCR) array attached to a low-loss substrate with a metallic ground. Each unit cell of the energy harvesting metasurface has only one harvesting port. Its energy harvesting efficiency for different polarization and incident angles was analyzed, and the results show that the maximum harvesting efficiency is 90%, 83%, and 81% at the three frequency bands of 0.9 GHz, 2.6 GHz, and 5.7 GHz, respectively. Moreover, a prototype of the 7 × 7 BCR metasurface harvesting array was fabricated and measured. The experimental results validate that the proposed metasurface performs well under transverse electric and transverse magnetic polarization and is suitable for wide-angle incident energy harvesting in the three frequency bands.

  19. ASC Tri-lab Co-design Level 2 Milestone Report 2015

    SciTech Connect

    Hornung, Rich; Jones, Holger; Keasler, Jeff; Neely, Rob; Pearce, Olga; Hammond, Si; Trott, Christian; Lin, Paul; Vaughan, Courtenay; Cook, Jeanine; Hoekstra, Rob; Bergen, Ben; Payne, Josh; Womeldorff, Geoff

    2015-09-23

    In 2015, the three Department of Energy (DOE) National Laboratories that make up the Advanced Sci- enti c Computing (ASC) Program (Sandia, Lawrence Livermore, and Los Alamos) collaboratively explored performance portability programming environments in the context of several ASC co-design proxy applica- tions as part of a tri-lab L2 milestone executed by the co-design teams at each laboratory. The programming environments that were studied included Kokkos (developed at Sandia), RAJA (LLNL), and Legion (Stan- ford University). The proxy apps studied included: miniAero, LULESH, CoMD, Kripke, and SNAP. These programming models and proxy-apps are described herein. Each lab focused on a particular combination of abstractions and proxy apps, with the goal of assessing performance portability using those. Performance portability was determined by: a) the ability to run a single application source code on multiple advanced architectures, b) comparing runtime performance between \

  20. Tri-State Generation and Transmission Association's Springverville unit 3 earns POWER's highest honor

    SciTech Connect

    Peltier, R.

    2006-09-15

    It is said that pioneers take the arrows. In the case of Springerville Unit 3 - a 418 MW(net) expansion of a Tucson Electric Power facility in Arizona and the first pulverized coal-fired units built in the US in more than decade, the arrows were many. Although Tri-State (the developer), Tuscon Electric (the host), and Bechtel Power (the EPC contractor) were wounded by delayed deliveries of major equipment, bankruptcy of a major supplier, and a labor shortage, the companies showed their pioneering spirit and completed the project ahead of schedule. For ushering in a new generation of clean and desperately needed baseload capacity, Springerville Unit 3 is POWER magazine's 2006 Plant of the Year. 9 figs.