Quadriceps exercise intolerance in patients with chronic obstructive pulmonary disease: the potential role of altered skeletal muscle mitochondrial respiration.

PubMed

Gifford, Jayson R; Trinity, Joel D; Layec, Gwenael; Garten, Ryan S; Park, Song-Young; Rossman, Matthew J; Larsen, Steen; Dela, Flemming; Richardson, Russell S

2015-10-15

This study sought to determine if qualitative alterations in skeletal muscle mitochondrial respiration, associated with decreased mitochondrial efficiency, contribute to exercise intolerance in patients with chronic obstructive pulmonary disease (COPD). Using permeabilized muscle fibers from the vastus lateralis of 13 patients with COPD and 12 healthy controls, complex I (CI) and complex II (CII)-driven State 3 mitochondrial respiration were measured separately (State 3:CI and State 3:CII) and in combination (State 3:CI+CII). State 2 respiration was also measured. Exercise tolerance was assessed by knee extensor exercise (KE) time to fatigue. Per milligram of muscle, State 3:CI+CII and State 3:CI were reduced in COPD (P < 0.05), while State 3:CII and State 2 were not different between groups. To determine if this altered pattern of respiration represented qualitative changes in mitochondrial function, respiration states were examined as percentages of peak respiration (State 3:CI+CII), which revealed altered contributions from State 3:CI (Con 83.7 ± 3.4, COPD 72.1 ± 2.4%Peak, P < 0.05) and State 3:CII (Con 64.9 ± 3.2, COPD 79.5 ± 3.0%Peak, P < 0.05) respiration, but not State 2 respiration in COPD. Importantly, a diminished contribution of CI-driven respiration relative to the metabolically less-efficient CII-driven respiration (CI/CII) was also observed in COPD (Con 1.28 ± 0.09, COPD 0.81 ± 0.05, P < 0.05), which was related to exercise tolerance of the patients (r = 0.64, P < 0.05). Overall, this study indicates that COPD is associated with qualitative alterations in skeletal muscle mitochondria that affect the contribution of CI and CII-driven respiration, which potentially contributes to the exercise intolerance associated with this disease.

Seasonal forecasts of impact-relevant climate information indices developed as part of the EUPORIAS project

NASA Astrophysics Data System (ADS)

Spirig, Christoph; Bhend, Jonas

2015-04-01

Climate information indices (CIIs) represent a way to communicate climate conditions to specific sectors and the public. As such, CIIs provide actionable information to stakeholders in an efficient way. Due to their non-linear nature, such CIIs can behave differently than the underlying variables, such as temperature. At the same time, CIIs do not involve impact models with different sources of uncertainties. As part of the EU project EUPORIAS (EUropean Provision Of Regional Impact Assessment on a Seasonal-to-decadal timescale) we have developed examples of seasonal forecasts of CIIs. We present forecasts and analyses of the skill of seasonal forecasts for CIIs that are relevant to a variety of economic sectors and a range of stakeholders: heating and cooling degree days as proxies for energy demand, various precipitation and drought-related measures relevant to agriculture and hydrology, a wild fire index, a climate-driven mortality index and wind-related indices tailored to renewable energy producers. Common to all examples is the finding of limited forecast skill over Europe, highlighting the challenge for providing added-value services to stakeholders operating in Europe. The reasons for the lack of forecast skill vary: often we find little skill in the underlying variable(s) precisely in those areas that are relevant for the CII, in other cases the nature of the CII is particularly demanding for predictions, as seen in the case of counting measures such as frost days or cool nights. On the other hand, several results suggest there may be some predictability in sub-regions for certain indices. Several of the exemplary analyses show potential for skillful forecasts and prospect for improvements by investing in post-processing. Furthermore, those cases for which CII forecasts showed similar skill values as those of the underlying meteorological variables, forecasts of CIIs provide added value from a user perspective.

Nature of KaiB-KaiC binding in the cyanobacterial circadian oscillator

PubMed Central

Pattanayek, Rekha; Yadagiri, Kirthi Kiran; Ohi, Melanie D.; Egli, Martin

2013-01-01

In the cyanobacteria Synechococcus elongatus and Thermosynechococcus elongatus, the KaiA, KaiB and KaiC proteins in the presence of ATP generate a post-translational oscillator (PTO) that can be reconstituted in vitro. KaiC is the result of a gene duplication and resembles a double doughnut with N-terminal CI and C-terminal CII hexameric rings. Six ATPs are bound between subunits in both the CI and CII ring. CI harbors ATPase activity, and CII catalyzes phosphorylation and dephosphorylation at T432 and S431 with a ca. 24-h period. KaiA stimulates KaiC phosphorylation, and KaiB promotes KaiC subunit exchange and sequesters KaiA on the KaiB-KaiC interface in the final stage of the clock cycle. Studies of the PTO protein-protein interactions are convergent in terms of KaiA binding to CII but have led to two opposing models of the KaiB-KaiC interaction. Electron microscopy (EM) and small angle X-ray scattering (SAXS), together with native PAGE using full-length proteins and separate CI and CII rings, are consistent with binding of KaiB to CII. Conversely, NMR together with gel filtration chromatography and denatured PAGE using monomeric CI and CII domains support KaiB binding to CI. To resolve the existing controversy, we studied complexes between KaiB and gold-labeled, full-length KaiC with negative stain EM. The EM data clearly demonstrate that KaiB contacts the CII ring. Together with the outcomes of previous analyses, our work establishes that only CII participates in interactions with KaiA and KaiB as well as with the His kinase SasA involved in the clock output pathway. PMID:23388462

Hydroxyl Radical Modification of Collagen Type II Increases Its Arthritogenicity and Immunogenicity

PubMed Central

Shahab, Uzma; Ahmad, Saheem; Moinuddin; Dixit, Kiran; Habib, Safia; Alam, Khursheed; Ali, Asif

2012-01-01

Background The oxidation of proteins by endogenously generated free radicals causes structural modifications in the molecules that lead to generation of neo-antigenic epitopes that have implications in various autoimmune disorders, including rheumatoid arthritis (RA). Collagen induced arthritis (CIA) in rodents (rats and mice) is an accepted experimental model for RA. Methodology/Principal Findings Hydroxyl radicals were generated by the Fenton reaction. Collagen type II (CII) was modified by •OH radical (CII-OH) and analysed by ultraviolet-visible (UV-VIS), fluorescence and circular dichroism (CD) spectroscopy. The immunogenicity of native and modified CII was checked in female Lewis rats and specificity of the induced antibodies was ascertained by enzyme linked immunosorbent assay (ELISA). The extent of CIA was evaluated by visual inspection. We also estimated the oxidative and inflammatory markers in the sera of immunized rats. A slight change in the triple helical structure of CII as well as fragmentation was observed after hydroxyl radical modification. The modified CII was found to be highly arthritogenic and immunogenic as compared to the native form. The CII-OH immunized rats exhibited increased oxidative stress and inflammation as compared to the CII immunized rats in the control group. Conclusions/Significance Neo-antigenic epitopes were generated on •OH modified CII which rendered it highly immunogenic and arthritogenic as compared to the unmodified form. Since the rodent CIA model shares many features with human RA, these results illuminate the role of free radicals in human RA. PMID:22319617

Suppression of collagen induced arthritis by idiotype coupled lymphoid cells

DOE Office of Scientific and Technical Information (OSTI.GOV)

Nagler-Anderson, C.; Gurish, M.F.; Robinson, M.E.

1986-03-01

Studies were initiated to evaluate the regulatory influence of idiotype (Id) networks in an experimental auto-immune disease. Collagen induced arthritis is an animal model of polyarthritis induced in susceptible mice by immunization with collagen II (CII). A humoral immune response to CII appears to be critical for the development of diseases. If subpopulations of the anti-CII abs, important for the induction of arthritis, could be identified and manipulated through the presence of a major Id, it should be possible to decrease arthritis incidence by suppressing the production of these Ids. Specifically purified anti-CII abs from arthritic DBA/1 mice were coupledmore » to syngeneic spleen cells and administered IV prior to intradermal immunization with CII. By day 34 after 1/sup 0/ immunization, 100% of control mice and 50% of treated mice had developed arthritis. Suppression of the Id population administered to the treated group was confirmed by RIA. Sera from individual mice were tested as inhibitors of binding of /sup 125/I-labelled polyclonal DBA/1 anti-CII to a rabbit anti-Id directed against polyclonal anti-CII isolated from the sera of arthritic mice. Mean percentage of inhibition of binding of /sup 125/I-Id to rabbit anti-Id by sera from non-arthritic treated mice was found to be significantly lower than that observed in the arthritic control group (p = .045), but did not correlate with total anti-CII ab titers.« less

Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

PubMed

Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

2018-05-24

Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

The Lambda Select cII Mutation Detection System.

PubMed

Besaratinia, Ahmad; Tommasi, Stella

2018-04-26

A number of transgenic animal models and mutation detection systems have been developed for mutagenicity testing of carcinogens in mammalian cells. Of these, transgenic mice and the Lambda (λ) Select cII Mutation Detection System have been employed for mutagenicity experiments by many research groups worldwide. Here, we describe a detailed protocol for the Lambda Select cII mutation assay, which can be applied to cultured cells of transgenic mice/rats or the corresponding animals treated with a chemical/physical agent of interest. The protocol consists of the following steps: (1) isolation of genomic DNA from the cells or organs/tissues of transgenic animals treated in vitro or in vivo, respectively, with a test compound; (2) recovery of the lambda shuttle vector carrying a mutational reporter gene (i.e., cII transgene) from the genomic DNA; (3) packaging of the rescued vectors into infectious bacteriophages; (4) infecting a host bacteria and culturing under selective conditions to allow propagation of the induced cII mutations; and (5) scoring the cII-mutants and DNA sequence analysis to determine the cII mutant frequency and mutation spectrum, respectively.

GOT C+: Galactic Plane Survey of the 1.9 THz [CII] Line

NASA Astrophysics Data System (ADS)

Langer, William

2012-01-01

The ionized carbon [CII] 1.9 THz fine structure line is a major gas coolant in the interstellar medium (ISM) and controls the thermal conditions in diffuse gas clouds and Photodissociation Regions (PDRs). The [CII] line is also an important tracer of the atomic gas and atomic to molecular transition in diffuse clouds throughout the Galaxy. I will review some of the results from the recently completed Galactic Observations of Terahertz C+ (GOT C+) survey. This Herschel Open Time Key Project is a sparse, but uniform volume sample survey of [CII] line emission throughout the Galactic disk using the HIFI heterodyne receiver. HIFI observations, with their high spectral resolution, isolate and locate individual clouds in the Galaxy and provide excitation information on the gas. I will present [CII] position-velocity maps that reveal the distribution and motion of the clouds in the inner Galaxy and discuss results on the physical properties of the gas using spectral observations of [CII] and ancillary HI and 12CO, 13CO, and C18O J=1-0 data. The [CII] emission is also a useful tracer of the "Dark H2 Gas", and I will discuss its distribution in a sample of interstellar clouds. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration.

Cross-Specificities between cII-like Proteins and pRE-like Promoters of Lambdoid Bacteriophages

PubMed Central

Wulff, Daniel L.; Mahoney, Michael E.

1987-01-01

We have investigated the activation of transcription from the pRE promoters of phages λ, 21 and P22 by the λ and 21 cII proteins and the P22 c1 (cII-like) protein, using an in vivo system in which cII protein from a derepressed prophage activates transcription from a pRE DNA fragment on a multicopy plasmid. We find that each protein is highly specific for its own cognate pRE promoter, although measureable cross-reactions are observed. The primary recognition sequence for cII protein on λ pRE is a pair of TTGC repeat sequences in the sequence 5'-TTGCN 6TTGC-3' at the -35 region of the promoter. This same sequence is found in 21 pRE, while P22 pRE has the sequence 5'-TTGCN6TTGT-3', which is the same as that of λctr1, a pRE+ variant of λ. λctr1 pRE is half as active as λ + pRE when assayed with either the λ cII or the P22 c1 proteins. Therefore, the single base change in the P22 repeat sequence cannot explain why the P22 c1 protein is much more active with P22 pRE than λ p RE. The dya5 mutation, a G→A change at position -43 of pRE, makes pRE a stronger promoter when assayed with either the λ or 21 cII proteins or the P22 c1 protein. We conclude that efficient activation of a cII-dependent promoter by a cII protein requires sequence information in addition to the TTGC repeat sequences. We do not know the characteristics of the proteins which are responsible for the specificity of each protein for its own cognate promoter. However, λdya8, which has a Glu27→Lys alteration in the λ cII protein and a cII+ phenotype, results in a mutant cII protein that is much more highly specific than wild-type cII protein for its own cognate λ p RE promoter. This is especially remarkable because the dya8 amino acid alteration makes the helix-2 region (the region of the protein predicted to make contact with the phosphodiester backbone of the DNA) of λ cII protein conform exactly with the helix-2 region of the P22 c1 protein in both charge and charge distribution. PMID:2953649

Clinically isolated enterovirus A71 subgenogroup C4 strain with lethal pathogenicity in 14-day-old mice and the application as an EV-A71 mouse infection model.

PubMed

Xu, Yi; Ma, Shuzhi; Zhu, Limeng; Huang, Zhiqiu; Chen, Liyun; Xu, Yuhua; Yin, Haibin; Peng, Tao; Wang, Yi

2017-01-01

The Enterovirus A71 (EV-A71) subgenogroup C4 is prevalent in China. EV-A71 causes hand, foot and mouth disease (HFMD) in children and may lead to severe neurological diseases. The development of antiviral and protective vaccines against EV-A71 is significantly hindered by the lack of suitable animal models to recapitulate human neurological symptoms. In this study, GZ-CII, a highly virulent EV-A71 subgenogroup C4 strain, was isolated from hospitalized children with HFMD. Intraperitoneal infections of GZ-CII resulted in progressive neurological disease in mice as old as 14 days. Administration of an inactivated EV-A71 vaccine or an anti-EV-A71 immune serum protected the mice against the GZ-CII infection. This demonstrated that a mouse model with EV-A71 GZ-CII could be used to evaluate potential vaccine candidates and therapeutics for subgenogroup C4. Comparing the genome sequence of GZ-CII with that of the avirulent EV-A71 subgenogroup C4 strain revealed unique mutations in GZ-CII. When mutation VP2-K149I was introduced into the nonpathogenic EV-A71 subgenogroup C4 strain, the variant similar to GZ-CII significantly increased viral replication and virulence in mice. These results indicated that the VP2-K149I mutation played an important role in enhancing the virulence of the EV-A71 subgenogroup C4 strain in mice, and that mice infected with the GZ-CII strain are a promising model for evaluating vaccines and therapeutics against the EV-A71 subgenogroup C4. Copyright © 2016 Elsevier B.V. All rights reserved.

[CII] observations of H2 molecular layers in transition clouds

NASA Astrophysics Data System (ADS)

Velusamy, T.; Langer, W. D.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

2010-10-01

We present the first results on the diffuse transition clouds observed in [CII] line emission at 158 μm (1.9 THz) towards Galactic longitudes near 340° (5 LOSs) & 20° (11 LOSs) as part of the HIFI tests and GOT C+ survey. Out of the total 146 [CII] velocity components detected by profile fitting we identify 53 as diffuse molecular clouds with associated 12CO emission but without 13CO emission and characterized by AV < 5 mag. We estimate the fraction of the [CII] emission in the diffuse HI layer in each cloud and then determine the [CII] emitted from the molecular layers in the cloud. We show that the excess [CII] intensities detected in a few clouds is indicative of a thick H2 layer around the CO core. The wide range of clouds in our sample with thin to thick H2 layers suggests that these are at various evolutionary states characterized by the formation of H2 and CO layers from HI and C+, respectively. In about 30% of the clouds the H2 column densities (“dark gas”) traced by the [CII] is 50% or more than that traced by 12CO emission. On the average ~25% of the total H2 in these clouds is in an H2 layer which is not traced by CO. We use the HI, [CII], and 12CO intensities in each cloud along with simple chemical models to obtain constraints on the FUV fields and cosmic ray ionization rates. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

GOT C+ Survey of [CII] 158 Micrometer Emission: Atomic to Molecular Cloud Transitions in the Inner Galaxy

NASA Technical Reports Server (NTRS)

Velusamy, T.; Langer, W. D.; Willacy, K.; Pineda, J. L.; Goldsmith, P. F.

2012-01-01

We present the results of the distribution of CO-dark H2 gas in a sample of 2200 interstellar clouds in the inner Galaxy (l = 90 deg to +57 deg) detected in the velocity resolved [CII] spectra observed in the GOT C+ survey using the Herschel HIFI. We analyze the [CII] intensities along with the ancillary HI, (12)CO and (13)CO data for each cloud to determine their evolutionary state and to derive the H2 column densities in the C(+) and C(+)/CO transition layers in the cloud. We discuss the overall Galactic distribution of the [CII] clouds and their properties as a function Galactic radius. GOT C+ results on the global distribution of [CII] clouds and CO-dark H2 gas traces the FUV and star formation rates in the Galactic disk.

GOT C+ Survey of [CII] 158 μm Emission: Atomic to Molecular Cloud Transitions in the Inner Galaxy

NASA Astrophysics Data System (ADS)

Velusamy, T.; Langer, W. D.; Willacy, K.; Pineda, J. L.; Goldsmith, P. F.

2013-03-01

We present the results of the distribution of CO-dark H2 gas in a sample of 2223 interstellar clouds in the inner Galaxy (l=-90° to +57°) detected in the velocity resolved [CII] spectra observed in the GOT C+ survey using the Herschel HIFI. We analyze the [CII] intensities along with the ancillary HI, 12CO and 13CO data for each cloud to determine their evolutionary state and to derive the H2 column densities in the C+ and C+/CO transition layers in the cloud. We discuss the overall Galactic distribution of the [CII] clouds and their properties as a function Galactic radius. GOT C+ results on the global distribution of [CII] clouds and CO-dark H2 gas traces the FUV intensity and star formation rate in the Galactic disk.

Spatially Resolved Analysis of the Interstellar Medium in the Cosmic Eye, a Lensed Lyman Break Galaxy at z=3.074

NASA Astrophysics Data System (ADS)

Ball, Catherine; Riechers, Dominik A.; Pavesi, Riccardo

2018-01-01

The [CII]/[NII] ratio combines the [CII] line, a tracer of photodissociation and HII regions emerging from the neutral and ionized phases of the interstellar medium (ISM), with [NII] emission, which only originates from the ionized ISM. In this, the [CII]/[NII] ratio can be used to separate the fractions of [CII] emission emerging from the different phases of the ISM. We present Atacama Large sub-Millimeter Array (ALMA) observations of the Cosmic Eye, a gravitationally lensed Lyman Break Galaxy (LBG). As an LBG, the Cosmic Eye represents a "normal" star forming galaxy in the z>2 universe. LBGs were host to the bulk of star formation during the peak epoch of star formation. Diagnosing star formation in these galaxies provides insight into the evolution of “normal” galaxies in a cosmic sense. The high magnification (30x) allows us to resolve the [CII] 158μm and the [NII] 205μm lines in detail, allowing for a position-resolved analysis of their ratio. We find variations of the line ratio across the galaxy, suggesting the galaxy’s internal structure affects this ratio. We consider the Cosmic Eye in the context of both higher redshift LBGs and local luminous and ultraluminous infrared galaxies, finding that the Cosmic Eye’s line ratio is similar to those of both higher- and lower- redshift galaxies. The Cosmic Eye’s global [CII]/[NII] ratio sits between two previous measurements of z>5 LBGs at low resolution, suggesting that the ratio may correlate more significantly with LFIR than with redshift in this epoch. Furthermore, the Cosmic Eye’s [CII]/[NII] ratio is similar to those of the nearby LIRG/ULIRGs, though we expect local [CII]/[NII] values to be lower due to their different metallicities and dust content. High-resolution studies like this one probe the evolution of [CII]/[NII] over cosmic time by examining the evolution of the ISM’s structure. With a better understanding of the [CII]/[NII] line ratio, we can more effectively use it as a probe of the nature of star formation in high-redshift galaxies. CJB participated in the summer 2017 REU program in the Center for Astrophysics and Planetary Science at Cornell University under NSF award AST-1659264.

[Cii] emission from L1630 in the Orion B molecular cloud.

PubMed

Pabst, C H M; Goicoechea, J R; Teyssier, D; Berné, O; Ochsendorf, B B; Wolfire, M G; Higgins, R D; Riquelme, D; Risacher, C; Pety, J; Le Petit, F; Roueff, E; Bron, E; Tielens, A G G M

2017-10-01

L1630 in the Orion B molecular cloud, which includes the iconic Horsehead Nebula, illuminated by the star system σ Ori, is an example of a photodissociation region (PDR). In PDRs, stellar radiation impinges on the surface of dense material, often a molecular cloud, thereby inducing a complex network of chemical reactions and physical processes. Observations toward L1630 allow us to study the interplay between stellar radiation and a molecular cloud under relatively benign conditions, that is, intermediate densities and an intermediate UV radiation field. Contrary to the well-studied Orion Molecular Cloud 1 (OMC1), which hosts much harsher conditions, L1630 has little star formation. Our goal is to relate the [Cii] fine-structure line emission to the physical conditions predominant in L1630 and compare it to studies of OMC1. The [Cii] 158 μ m line emission of L1630 around the Horsehead Nebula, an area of 12' × 17', was observed using the upgraded German Receiver for Astronomy at Terahertz Frequencies (upGREAT) onboard the Stratospheric Observatory for Infrared Astronomy (SOFIA). Of the [Cii] emission from the mapped area 95%, 13 L ⊙ , originates from the molecular cloud; the adjacent Hii region contributes only 5%, that is, 1 L ⊙ . From comparison with other data (CO(1-0)-line emission, far-infrared (FIR) continuum studies, emission from polycyclic aromatic hydrocarbons (PAHs)), we infer a gas density of the molecular cloud of n H ∼ 3 · 10 3 cm -3 , with surface layers, including the Horsehead Nebula, having a density of up to n H ∼ 4 · 10 4 cm -3 . The temperature of the surface gas is T ∼ 100 K. The average [Cii] cooling efficiency within the molecular cloud is 1.3 · 10 -2 . The fraction of the mass of the molecular cloud within the studied area that is traced by [Cii] is only 8%. Our PDR models are able to reproduce the FIR-[Cii] correlations and also the CO(1-0)-[Cii] correlations. Finally, we compare our results on the heating efficiency of the gas with theoretical studies of photoelectric heating by PAHs, clusters of PAHs, and very small grains, and find the heating efficiency to be lower than theoretically predicted, a continuation of the trend set by other observations. In L1630 only a small fraction of the gas mass is traced by [Cii]. Most of the [Cii] emission in the mapped area stems from PDR surfaces. The layered edge-on structure of the molecular cloud and limitations in spatial resolution put constraints on our ability to relate different tracers to each other and to the physical conditions. From our study, we conclude that the relation between [Cii] emission and physical conditions is likely to be more complicated than often assumed. The theoretical heating efficiency is higher than the one we calculate from the observed [Cii] emission in the L1630 molecular cloud.

[Cii] emission from L1630 in the Orion B molecular cloud

PubMed Central

Pabst, C. H. M.; Goicoechea, J. R.; Teyssier, D.; Berné, O.; Ochsendorf, B. B.; Wolfire, M. G.; Higgins, R. D.; Riquelme, D.; Risacher, C.; Pety, J.; Le Petit, F.; Roueff, E.; Bron, E.; Tielens, A. G. G. M.

2017-01-01

Context L1630 in the Orion B molecular cloud, which includes the iconic Horsehead Nebula, illuminated by the star system σ Ori, is an example of a photodissociation region (PDR). In PDRs, stellar radiation impinges on the surface of dense material, often a molecular cloud, thereby inducing a complex network of chemical reactions and physical processes. Aims Observations toward L1630 allow us to study the interplay between stellar radiation and a molecular cloud under relatively benign conditions, that is, intermediate densities and an intermediate UV radiation field. Contrary to the well-studied Orion Molecular Cloud 1 (OMC1), which hosts much harsher conditions, L1630 has little star formation. Our goal is to relate the [Cii] fine-structure line emission to the physical conditions predominant in L1630 and compare it to studies of OMC1. Methods The [Cii] 158 μm line emission of L1630 around the Horsehead Nebula, an area of 12′ × 17′, was observed using the upgraded German Receiver for Astronomy at Terahertz Frequencies (upGREAT) onboard the Stratospheric Observatory for Infrared Astronomy (SOFIA). Results Of the [Cii] emission from the mapped area 95%, 13 L⊙, originates from the molecular cloud; the adjacent Hii region contributes only 5%, that is, 1 L⊙. From comparison with other data (CO(1-0)-line emission, far-infrared (FIR) continuum studies, emission from polycyclic aromatic hydrocarbons (PAHs)), we infer a gas density of the molecular cloud of nH ∼ 3 · 103 cm−3, with surface layers, including the Horsehead Nebula, having a density of up to nH ∼ 4 · 104 cm−3. The temperature of the surface gas is T ∼ 100 K. The average [Cii] cooling efficiency within the molecular cloud is 1.3 · 10−2. The fraction of the mass of the molecular cloud within the studied area that is traced by [Cii] is only 8%. Our PDR models are able to reproduce the FIR-[Cii] correlations and also the CO(1-0)-[Cii] correlations. Finally, we compare our results on the heating efficiency of the gas with theoretical studies of photoelectric heating by PAHs, clusters of PAHs, and very small grains, and find the heating efficiency to be lower than theoretically predicted, a continuation of the trend set by other observations. Conclusions In L1630 only a small fraction of the gas mass is traced by [Cii]. Most of the [Cii] emission in the mapped area stems from PDR surfaces. The layered edge-on structure of the molecular cloud and limitations in spatial resolution put constraints on our ability to relate different tracers to each other and to the physical conditions. From our study, we conclude that the relation between [Cii] emission and physical conditions is likely to be more complicated than often assumed. The theoretical heating efficiency is higher than the one we calculate from the observed [Cii] emission in the L1630 molecular cloud. PMID:28989177

Selected issues of the universal communication environment implementation for CII standard

NASA Astrophysics Data System (ADS)

Zagoździńska, Agnieszka; Poźniak, Krzysztof T.; Drabik, Paweł K.

2011-10-01

In the contemporary FPGA market there is the wide assortment of structures, integrated development environments, and boards of different producers. The variety allows to fit resources to requirements of the individual designer. There is the need of standardization of the projects to make it useful in research laboratories equipped with different producers tools. Proposed solution is CII standardization of VHDL components. This paper contains specification of the universal communication environment for CII standard. The link can be used in different FPGA structures. Implementation of the link enables object oriented VHDL programming with the use of CII standardization. The whole environment contains FPGA environment and PC software. The paper contains description of the selected issues of FPGA environment. There is description of some specific solutions that enables environment usage in structures of different producers. The flexibility of different size data transmissions with the use of CII is presented. The specified tool gives the opportunity to use FPGA structures variety fully and design faster and more effectively.

OT2_pgolds01_6: Herschel [NII] Observations to Define the Source of [CII] Emission

NASA Astrophysics Data System (ADS)

Goldsmith, P.

2011-09-01

The 158 micron line of ionized carbon is the strongest single long-wavelength emission feature from the interstellar medium and is the most important coolant of gas in which hydrogen is in atomic form. It is a key determinant of the evolution of these largely atomic regions into denser, cooler molecular clouds in which new stars are formed, and is widely used as a tracer of star formation in the Milky Way and other galaxies. There is, however, an ongoing, serious controversy about the origin of the [CII] emission, which has been asserted to come from the extended low-density warm interstellar medium, but has more generally been associated with the primarily molecular photon dominated regions (PDRs) intimately associated with massive, young stars. We propose a combined HIFI and PACS study of the two far-infrared [NII] fine structure lines in order to resolve the important question of the fraction of CII emission that arises in ionized gas. Specifically, we will (1) utilize the fact that due to its ionization potential NII is found only in HII regions, and with PACS 122 and 205 micron observations, determine electron densities in a sample of such regions in the Galactic plane; (2) utilize available data on radio free-free and H-alpha emission to determine the NII column densities and from this the CII column densities in the HII regions; (3) use the electron densities to determine the fraction of CII emission arising in the ionized interstellar medium. These observations will be carried out at 150 of the positions in the Galactic plane observed in [CII] by the GOT-C+ project. We will also carry out HIFI observations of 10 selected positions in the 205 micron line to determine spectral characteristics of the NII emission line, which with CII, CI, and CO profiles already in hand will serve as a further discriminant among the proposed sources of CII emission.

Anti-type II collagen antibodies, anti-CCP, IgA RF and IgM RF are associated with joint damage, assessed eight years after onset of juvenile idiopathic arthritis (JIA)

PubMed Central

2014-01-01

Background Early appearance of antibodies specific for native human type II collagen (anti-CII) characterizes an early inflammatory and destructive phenotype in adults with rheumatoid arthritis (RA). The objective of this study was to investigate the occurrence of anti-CII, IgM RF, IgA RF and anti-CCP in serum samples obtained early after diagnosis, and to relate the occurrence of autoantibodies to outcome after eight years of disease in children with juvenile idiopathic arthritis (JIA). Methods The Nordic JIA database prospectively included JIA patients followed for eight years with data on remission and joint damage. From this database, serum samples collected from 192 patients, at a median of four months after disease onset, were analysed for IgG anti-CII, IgM RF, IgA RF and IgG anti-CCP. Joint damage was assessed based on Juvenile Arthritis Damage Index for Articular damage (JADI-A), a validated clinical instrument for joint damage. Results Elevated serum levels of anti-CII occurred in 3.1%, IgM RF in 3.6%, IgA RF in 3.1% and anti-CCP in 2.6% of the patients. Occurrence of RF and anti-CCP did to some extent overlap, but rarely with anti-CII. The polyarticular and oligoarticular extended categories were overrepresented in patients with two or more autoantibodies. Anti-CII occurred in younger children, usually without overlap with the other autoantibodies and was associated with high levels of C-reactive protein (CRP) early in the disease course. All four autoantibodies were significantly associated with joint damage, but not with active disease at the eight-year follow up. Conclusions Anti-CII, anti-CCP, IgA RF and IgM RF detected early in the disease course predicted joint damage when assessed after eight years of disease. The role of anti-CII in JIA should be further studied. PMID:24944545

Mitochondrial Targeting of Vitamin E Succinate Enhances Its Pro-apoptotic and Anti-cancer Activity via Mitochondrial Complex II*

PubMed Central

Dong, Lan-Feng; Jameson, Victoria J. A.; Tilly, David; Cerny, Jiri; Mahdavian, Elahe; Marín-Hernández, Alvaro; Hernández-Esquivel, Luz; Rodríguez-Enríquez, Sara; Stursa, Jan; Witting, Paul K.; Stantic, Bela; Rohlena, Jakub; Truksa, Jaroslav; Kluckova, Katarina; Dyason, Jeffrey C.; Ledvina, Miroslav; Salvatore, Brian A.; Moreno-Sánchez, Rafael; Coster, Mark J.; Ralph, Stephen J.; Smith, Robin A. J.; Neuzil, Jiri

2011-01-01

Mitochondrial complex II (CII) has been recently identified as a novel target for anti-cancer drugs. Mitochondrially targeted vitamin E succinate (MitoVES) is modified so that it is preferentially localized to mitochondria, greatly enhancing its pro-apoptotic and anti-cancer activity. Using genetically manipulated cells, MitoVES caused apoptosis and generation of reactive oxygen species (ROS) in CII-proficient malignant cells but not their CII-dysfunctional counterparts. MitoVES inhibited the succinate dehydrogenase (SDH) activity of CII with IC50 of 80 μm, whereas the electron transfer from CII to CIII was inhibited with IC50 of 1.5 μm. The agent had no effect either on the enzymatic activity of CI or on electron transfer from CI to CIII. Over 24 h, MitoVES caused stabilization of the oxygen-dependent destruction domain of HIF1α fused to GFP, indicating promotion of the state of pseudohypoxia. Molecular modeling predicted the succinyl group anchored into the proximal CII ubiquinone (UbQ)-binding site and successively reduced interaction energies for serially shorter phytyl chain homologs of MitoVES correlated with their lower effects on apoptosis induction, ROS generation, and SDH activity. Mutation of the UbQ-binding Ser68 within the proximal site of the CII SDHC subunit (S68A or S68L) suppressed both ROS generation and apoptosis induction by MitoVES. In vivo studies indicated that MitoVES also acts by causing pseudohypoxia in the context of tumor suppression. We propose that mitochondrial targeting of VES with an 11-carbon chain localizes the agent into an ideal position across the interface of the mitochondrial inner membrane and matrix, optimizing its biological effects as an anti-cancer drug. PMID:21059645

Determining the Nature of [CII] 158 Micron Emission: an Improved Star Formation Rate Indicator

NASA Astrophysics Data System (ADS)

Sutter, Jessica; Dale, Daniel A.; KINGFISH Team

2018-06-01

The brightest observed emission line from most normal star-forming galaxies is the 158 micron line arising from singly-ionized carbon (also known as C+ or CII). In fact, astronomers have recently begun using the bright emission line to detect and characterize galaxies in the furthermost reaches of the universe. It is thus imperative that we have the tools to fully understand how this emission line could be utilized as an indicator of star formation rate, a primary parameter by which galaxies and their constituent star-forming regions are characterized. There are two main challenges to utilizing the [CII] 158 micron line as a star formation rate indicator. First, advances in long-wavelength astronomical instrumentation have only recently enabled its detection in statistically-significant samples of galaxies. Second, it is both a blessing and a curse that singly-ionized carbon can be created in both star-forming regions (ionized HII regions) and in non-star forming regions (neutral photo-dissociation regions). In order to better understand and quantify the [CII] emission as an indicator of star-formation rate, the relationship between the [NII] 205 micron emission, which can only arise from the ionized interstellar medium (ISM), and the [CII] 158 micron emission has been employed to determine the fraction of [CII] emission that originates from each phase of the ISM. Sub-kiloparsec measurements of the [NII] 205 micron line in nearby galaxies have recently become available as part of the KINGFISH program. We use these two far-infrared lines along with the full suite of KINGFISH panchromatic data to present an improved calibration of the [CII] emission line as a star formation rate indicator.

Further Validation of the Conner's Adult Attention Deficit/Hyperactivity Rating Scale Infrequency Index (CII) for Detection of Non-Credible Report of Attention Deficit/Hyperactivity Disorder Symptoms.

PubMed

Cook, Carolyn M; Bolinger, Elizabeth; Suhr, Julie

2016-06-01

Attention deficit/hyperactivity disorder (ADHD) can be easily presented in a non-credible manner, through non-credible report of ADHD symptoms and/or by non-credible performance on neuropsychological tests. While most studies have focused on detection of non-credible performance using performance validity tests, there are few studies examining the ability to detect non-credible report of ADHD symptoms. We provide further validation data for a recently developed measure of non-credible ADHD symptom report, the Conner's Adult ADHD Rating Scales (CAARS) Infrequency Index (CII). Using archival data from 86 adults referred for concerns about ADHD, we examined the accuracy of the CII in detecting extreme scores on the CAARS and invalid reporting on validity indices of the Minnesota Multiphasic Personality Inventory-2 Restructured Format (MMPI-2-RF). We also examined the accuracy of the CII in detecting non-credible performance on standalone and embedded performance validity tests. The CII was 52% sensitive to extreme scores on CAARS DSM symptom subscales (with 97% specificity) and 20%-36% sensitive to invalid responding on MMPI-2-RF validity scales (with near 90% specificity), providing further evidence for the interpretation of the CII as an indicator of non-credible ADHD symptom report. However, the CII detected only 18% of individuals who failed a standalone performance validity test (Word Memory Test), with 87.8% specificity, and was not accurate in detecting non-credible performance using embedded digit span cutoffs. Future studies should continue to examine how best to assess for non-credible symptom report in ADHD referrals. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Recombinant human type II collagen hydrogel provides a xeno-free 3D micro-environment for chondrogenesis of human bone marrow-derived mesenchymal stromal cells.

PubMed

Muhonen, Virpi; Narcisi, Roberto; Nystedt, Johanna; Korhonen, Matti; van Osch, Gerjo J V M; Kiviranta, Ilkka

2017-03-01

Recombinant human type II collagen (rhCII) hydrogel was tested as a xeno-free micro-environment for the chondrogenesis of human bone marrow-derived mesenchymal stromal cells (BM-MSCs). The rhCII hydrogels were seeded with BM-MSCs and cultured in a xeno-free chondro-inductive medium for 14, 28 and 84 days. High-density pellet cultures served as controls. The samples were subjected to biochemical, histological and gene expression analyses. Although the cells deposited glycosaminoglycans into the extracellular space significantly more slowly in the rhCII hydrogels compared to the high-density pellets, a similar potential of matrix deposition was reached by the end of the 84-day culture. At day 28 of culture, the gene expression level for cartilage marker genes (i.e. genes encoding for Sox9 transcription factor, Collagen type II and Aggrecan) were considerably lower in the rhCII hydrogels than in the high-density pellets, but at the end of the 84-day culture period, all the cartilage marker genes analysed were expressed at a similar level. Interestingly, the expression of the matrix metallopeptidases (MMP)-13, MMP-14 and MMP-8, i.e. extracellular collagen network-degrading enzymes, were transiently upregulated in the rhCII hydrogel, indicating active matrix reorganization. This study demonstrated that the rhCII hydrogel functions as a xeno-free platform for BM-MSC chondrogenesis, although the process is delayed. The reversible catabolic reaction evoked by the rhCII hydrogel might be beneficial in graft integration in vivo and pinpoints the need to further explore the use of hydrogels containing recombinant extracellular matrix (ECM) proteins to induce the chondrogenesis of MSCs. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

Galactic Observations of Terahertz C+ (GOT C+): [CII] Detection of Warm "Dark Gas" in the ISM

NASA Astrophysics Data System (ADS)

Langer, W. D.; Velusamy, T.; Pineda, J.; Goldsmith, P.; Li, D.; Yorke, H. W.

2011-11-01

The Herschel HIFI Key Program, Galactic Observations of Terahertz C+ (GOT C+) is a survey of [CII] 1.9 THz emission throughout the Galaxy. Comparison of the first results of this survey with HI and CO isotopomer emission reveals excess [CII] emission beyond that expected from HI and CO layers alone, and is best explained as coming from a hidden layer of H2 gas, the so-called ISM "dark gas".

Inhibitory effects of polyphenol punicalagin on type-II collagen degradation in vitro and inflammation in vivo.

PubMed

Jean-Gilles, Dinorah; Li, Liya; Vaidyanathan, V G; King, Roberta; Cho, Bongsup; Worthen, David R; Chichester, Clinton O; Seeram, Navindra P

2013-09-25

Cartilage destruction is a crucial process in arthritis and is characterized by the degradation of cartilage proteins, proteoglycans, and type II collagen (CII), which are embedded within the extracellular matrix. While proteoglycan loss can be reversed, the degradation of CII is irreversible and has been correlated with an over-expression and over-activation of matrix metalloproteinases (MMPs). Among the various MMPs, the collagenase MMP-13 possesses the greatest catalytic activity for CII degradation. Here we show that the pomegranate-derived polyphenols, punicalagin (PA) and ellagic acid (EA), inhibit MMP-13-mediated degradation of CII in vitro. Surface plasmon resonance studies and molecular docking simulations suggested multiple binding interactions of PA and EA with CII. The effects of PA on bovine cartilage degradation (stimulated with IL-1β) were investigated by assaying proteoglycan and CII release into cartilage culture media. PA inhibited the degradation of both proteins in a concentration-dependent manner. Finally, the anti-inflammatory effects of PA (daily IP delivery at 10 and 50mg/kg for 14days) were tested in an adjuvant-induced arthritis rat model. Disease development was assessed by daily measurements of body weight and paw volume (using the water displacement method). PA had no effect on disease development at the lower dose but inhibited paw volume (P<0.05) at the higher dose. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

Novel Type of Renal Amyloidosis Derived from Apolipoprotein-CII.

PubMed

Nasr, Samih H; Dasari, Surendra; Hasadsri, Linda; Theis, Jason D; Vrana, Julie A; Gertz, Morie A; Muppa, Prasuna; Zimmermann, Michael T; Grogg, Karen L; Dispenzieri, Angela; Sethi, Sanjeev; Highsmith, W Edward; Merlini, Giampaolo; Leung, Nelson; Kurtin, Paul J

2017-02-01

Amyloidosis is characterized by extracellular deposition of misfolded proteins as insoluble fibrils. Most renal amyloidosis cases are Ig light chain, AA, or leukocyte chemotactic factor 2 amyloidosis, but rare hereditary forms can also involve the kidneys. Here, we describe the case of a 61-year-old woman who presented with nephrotic syndrome and renal impairment. Examination of the renal biopsy specimen revealed amyloidosis with predominant involvement of glomeruli and medullary interstitium. Proteomic analysis of Congo red-positive deposits detected large amounts of the Apo-CII protein. DNA sequencing of the APOC2 gene in the patient and one of her children detected a heterozygous c.206A→T transition, causing an E69V missense mutation. We also detected the mutant peptide in the proband's renal amyloid deposits. Using proteomics, we identified seven additional elderly patients with Apo-CII-rich amyloid deposits, all of whom had kidney involvement and histologically exhibited nodular glomerular involvement. Although prior in vitro studies have shown that Apo-CII can form amyloid fibrils and that certain mutations in this protein promote amyloid fibrillogenesis, there are no reports of this type of amyloidosis in humans. We propose that this study reveals a new form of hereditary amyloidosis (AApoCII) that is derived from the Apo-CII protein and appears to manifest in the elderly and preferentially affect the kidneys. Copyright © 2017 by the American Society of Nephrology.

Alpha-tocopheryl succinate induces apoptosis by targeting ubiquinone-binding sites in mitochondrial respiratory complex II.

PubMed

Dong, L-F; Low, P; Dyason, J C; Wang, X-F; Prochazka, L; Witting, P K; Freeman, R; Swettenham, E; Valis, K; Liu, J; Zobalova, R; Turanek, J; Spitz, D R; Domann, F E; Scheffler, I E; Ralph, S J; Neuzil, J

2008-07-17

Alpha-tocopheryl succinate (alpha-TOS) is a selective inducer of apoptosis in cancer cells, which involves the accumulation of reactive oxygen species (ROS). The molecular target of alpha-TOS has not been identified. Here, we show that alpha-TOS inhibits succinate dehydrogenase (SDH) activity of complex II (CII) by interacting with the proximal and distal ubiquinone (UbQ)-binding site (Q(P) and Q(D), respectively). This is based on biochemical analyses and molecular modelling, revealing similar or stronger interaction energy of alpha-TOS compared to that of UbQ for the Q(P) and Q(D) sites, respectively. CybL-mutant cells with dysfunctional CII failed to accumulate ROS and underwent apoptosis in the presence of alpha-TOS. Similar resistance was observed when CybL was knocked down with siRNA. Reconstitution of functional CII rendered CybL-mutant cells susceptible to alpha-TOS. We propose that alpha-TOS displaces UbQ in CII causing electrons generated by SDH to recombine with molecular oxygen to yield ROS. Our data highlight CII, a known tumour suppressor, as a novel target for cancer therapy.

α-Tocopheryl succinate induces apoptosis by targeting ubiquinone-binding sites in mitochondrial respiratory complex II

PubMed Central

Dong, Lan-Feng; Low, Pauline; Dyason, Jeffrey C.; Wang, Xiu-Fang; Prochazka, Lubomir; Witting, Paul K.; Freeman, Ruth; Swettenham, Emma; Valis, Karel; Liu, Ji; Zobalova, Renata; Turanek, Jaroslav; Spitz, Doug R.; Domann, Frederick E.; Scheffler, Immo E.; Ralph, Stephen J.; Neuzil, Jiri

2009-01-01

α-Tocopheryl succinate (α-TOS) is a selective inducer of apoptosis in cancer cells, which involves the accumulation of reactive oxygen species (ROS). The molecular target of α-TOS has not been identified. Here we show that α-TOS inhibits succinate dehydrogenase (SDH) activity of complex II (CII) by interacting with the proximal and distal ubiquinone (UbQ) binding site (QP and QD, respectively). This is based on biochemical analyses and molecular modelling, revealing similar or stronger interaction energy of α-TOS compared to that of UbQ for the QP and QD sites, respectively. CybL-mutant cells with dysfunctional CII failed to accumulate ROS and undergo apoptosis in the presence of α-TOS. Similar resistance was observed when CybL was knocked down with siRNA. Reconstitution of functional CII rendered CybL-mutant cells susceptible to α-TOS. We propose that α-TOS displaces UbQ in CII causing electrons generated by SDH to recombine with molecular oxygen to yield ROS. Our data highlight CII, a known tumour suppressor, as a novel target for cancer therapy. PMID:18372923

Alternative assembly of respiratory complex II connects energy stress to metabolic checkpoints.

PubMed

Bezawork-Geleta, Ayenachew; Wen, He; Dong, LanFeng; Yan, Bing; Vider, Jelena; Boukalova, Stepana; Krobova, Linda; Vanova, Katerina; Zobalova, Renata; Sobol, Margarita; Hozak, Pavel; Novais, Silvia Magalhaes; Caisova, Veronika; Abaffy, Pavel; Naraine, Ravindra; Pang, Ying; Zaw, Thiri; Zhang, Ping; Sindelka, Radek; Kubista, Mikael; Zuryn, Steven; Molloy, Mark P; Berridge, Michael V; Pacak, Karel; Rohlena, Jakub; Park, Sunghyouk; Neuzil, Jiri

2018-06-07

Cell growth and survival depend on a delicate balance between energy production and synthesis of metabolites. Here, we provide evidence that an alternative mitochondrial complex II (CII) assembly, designated as CII low , serves as a checkpoint for metabolite biosynthesis under bioenergetic stress, with cells suppressing their energy utilization by modulating DNA synthesis and cell cycle progression. Depletion of CII low leads to an imbalance in energy utilization and metabolite synthesis, as evidenced by recovery of the de novo pyrimidine pathway and unlocking cell cycle arrest from the S-phase. In vitro experiments are further corroborated by analysis of paraganglioma tissues from patients with sporadic, SDHA and SDHB mutations. These findings suggest that CII low is a core complex inside mitochondria that provides homeostatic control of cellular metabolism depending on the availability of energy.

Planning and Performance in Small Groups: Collective Implementation Intentions Enhance Group Goal Striving.

PubMed

Thürmer, J Lukas; Wieber, Frank; Gollwitzer, Peter M

2017-01-01

There are two key motivators to perform well in a group: making a contribution that (a) is crucial for the group (indispensability) and that (b) the other group members recognize (identifiability). We argue that indispensability promotes setting collective ("We") goals whereas identifiability induces individual ("I") goals. Although both goals may enhance performance, they should align with different strategies. Whereas pursuing collective goals should involve more cooperation, pursuing individual goals should involve less cooperation. Two experiments support this reasoning and show that planning out collective goals with collective implementation intentions (cIIs or "We-plans") relies on cooperation but planning out individual goals with individual implementation intentions (IIs or "I-plans") does not. In Experiment 1, three-member groups first formed a collective or an individual goal and then performed a first round of a physical persistence task. Groups then either formed a respective implementation intention (cII or II) or a control plan and then performed a second round of the task. Although groups with cIIs and IIs performed better on a physical persistence task than respective control groups, only cII groups interacted more cooperatively during task performance. To confirm the causal role of these interaction processes, Experiment 2 used the same persistence task and manipulated whether groups could communicate: When communication was hindered, groups with cIIs but not groups with IIs performed worse. Communication thus qualifies as a process making cIIs effective. The present research offers a psychology of action account to small group performance.

Kinematics of [CII] Emission in Trumpler 14 & Carina I Probed with Stratospheric Terahertz Observatory

NASA Astrophysics Data System (ADS)

Seo, Youngmin; Goldsmith, Paul; Walker, Christopher; Kulesa, Craig; STO2 Team

2018-01-01

We present observations of the Trumpler 14 / Carina I regions carried out with the Stratospheric Terahertz Observatory 2 (STO2). The Trumpler 14 / Carina I region is in the west part of the Carina Nebula, which is one of the most active star-forming regions in the Milky Way. The Trumpler 14 / Carina I region is a promising place to study multiple, interacting phases of the ISM, including photon-dominated regions, HII regions, and dense molecular clouds. We observed Trumpler 14 / Carina I in the 158 μm transition of [CII] with a spatial resolution of 48 arcseconds and a velocity resolution of 0.17 km/s. The observations cover a 0.25°by 0.28°area with the center position at l= 297.33° b= -0.60°. We found that the [CII] emission is extended covering roughly 80% of the observed area with >5 K intensity. The peak intensity of [CII] is located four arcminutes southwest of Trumpler 14 and one arcminute east of the CO peak intensity of Carina I. The kinematics show that [CII] structures are spatially and spectrally correlated with the surfaces of CO clumps illuminated by Eta Carinae and Trumpler 14. The [CII] emission also shows a good correlation with dust continuum emission at 160 μm, which is typically originating from heated dust grains to ~20 K. Our results show layered structures of photon-dominated regions in the Trumpler 14 / Carina I region.

On the interaction of the highly charged peptides casocidins with biomimetic membranes.

PubMed

Becucci, Lucia; Aloisi, Giovanni; Scaloni, Andrea; Caira, Simonetta; Guidelli, Rolando

2018-04-19

Casocidin I and II (CI and CII) are structurally related antimicrobial peptides made of 39 and 31 amino acids, respectively, which derive from natural proteolytic processing of α s2 -casein and adopt an ordered α-helical structure in biomimetic membranes. Their putative membrane-permeabilizing activity was investigated at Hg-supported self-assembled monolayers (SAMs) and at tethered bilayer lipid membranes (tBLMs); the latter consisted of a monolayer of 2,3,di-O-phytanyl-sn-glycerol-1-tetraethylene-glycol-d,l-α lipoic acid ester thiolipid (DPTL), with a dioleoylphosphatidylcholine (DOPC) or dioleoylphosphatidylserine (DOPS) monolayer on top of it. Interaction of CI and CII with these biomimetic membranes was studied by four electrochemical techniques at pH 3, 5.4 and 6.8. Peptide incorporation in tBLMs was attempted via scans of electrochemical impedance spectra. Experiments demonstrated that CI and CII penetrate SAMs as well as the distal DOPC monolayer of DPTL/DOPC tBLMs, but not the proximal phytanyl monolayer, with the only exception of CII at pH 5.4. Conversely, CII permeabilized DPTL/DOPS tBLMs to a moderate extent at all investigated pH values by forming holes across the membrane, but not ion channels. Structural distribution of charged residues seemed to prevent CII from having a hydrophobic side of the α-helix capable of stabilizing a regular ion channel in the lipid matrix. Copyright © 2018 Elsevier B.V. All rights reserved.

Effect of carbon ion implantation on the tribology of metal-on-metal bearings for artificial joints.

PubMed

Koseki, Hironobu; Tomita, Masato; Yonekura, Akihiko; Higuchi, Takashi; Sunagawa, Sinya; Baba, Koumei; Osaki, Makoto

2017-01-01

Metal-on-metal (MoM) bearings have become popular due to a major advantage over metal-on-polymer bearings for total hip arthroplasty in that the larger femoral head and hydrodynamic lubrication of the former reduce the rate of wear. However, concerns remain regarding adverse reactions to metal debris including metallosis caused by metal wear generated at the taper-head interface and another modular junction. Our group has hypothesized that carbon ion implantation (CII) may improve metal wear properties. The purpose of this study was to investigate the wear properties and friction coefficients of CII surfaces with an aim to ultimately apply these surfaces to MoM bearings in artificial joints. CII was applied to cobalt-chromium-molybdenum (Co-Cr-Mo) alloy substrates by plasma source ion implantation. The substrates were characterized using scanning electron microscopy and a 3D measuring laser microscope. Sliding contact tests were performed with a simple geometry pin-on-plate wear tester at a load of 2.5 N, a calculated contact pressure of 38.5 MPa (max: 57.8 MPa), a reciprocating velocity of 30 mm/s, a stroke length of 60 mm, and a reciprocating cycle count of 172,800 cycles. The surfaces of the CII substrates were generally featureless with a smooth surface topography at the same level as untreated Co-Cr-Mo alloy. Compared to the untreated Co-Cr-Mo alloy, the CII-treated bearings had lower friction coefficients, higher resistance to catastrophic damage, and prevented the adhesion of wear debris. The results of this study suggest that the CII surface stabilizes the wear status due to the low friction coefficient and low infiltration of partner materials, and these properties also prevent the adhesion of wear debris and inhibit excessive wear. Carbon is considered to be biologically inert; therefore, CII is anticipated to be applicable to the bearing surfaces of MoM prostheses.

The Compression Intensity Index: a practical anatomical estimate of the biomechanical risk for a deep tissue injury.

PubMed

Gefen, Amit

2008-01-01

Pressure-related deep tissue injury (DTI) is a severe form of pressure ulcer that initiates in compressed muscle tissues under bony prominences, and progresses superficially towards the skin. Patients with impaired motosensory capacities are at high risk of developing DTI. There is a critical medical need for developing risk assessment tools for DTI. A new anatomical index, the Compression Intensity Index: CII=(BW/Rt);[1/2], which depends on the body weight (BW), radius of curvature of the ischial tuberosities (R) and thickness of the underlying gluteus muscles (t), is suggested for approximating the loading intensity in muscle tissue during sitting in permanent wheelchair users, as part of a clinically-oriented risk assessment for DTI. Preliminary CII data were calculated for 6 healthy and 4 paraplegic subjects following MRI scans, and data were compared between the groups and with respect to a gold standard, being a previously developed subject-specific MRI-finite-element (MRI-FE) method of calculating muscle tissue stresses (Linder-Ganz et al., J. Biomech. 2007). Marked differences between the R and t parameters of the two groups caused the CII values of the paraplegics to be approximately 1.6-fold higher than for the healthy (p<0.001), thereby indicating on the sensitivity of this parameter to the pathoanatomical changes that occur in the buttocks with paraplegia. Data of CII correlated reasonably with the gold standard calculations of MRI-FE muscle stresses (correlation coefficient 0.65). Since CII measurements do not require highly-specialized biomechanical numerical analyses such as MRI-FE, CII has the potential to serve as a practical, quick, and cost-effective approximation of the loading intensity in muscles of wheelchair-bound or bedridden patients. Hence, CII measurements can be integrated into DTI-risk-assessment tools, the need of which is now being discussed intensively in the American and European Pressure Ulcer Advisory Panel meetings.

Effect of carbon ion implantation on the tribology of metal-on-metal bearings for artificial joints

PubMed Central

Koseki, Hironobu; Tomita, Masato; Yonekura, Akihiko; Higuchi, Takashi; Sunagawa, Sinya; Baba, Koumei; Osaki, Makoto

2017-01-01

Metal-on-metal (MoM) bearings have become popular due to a major advantage over metal-on-polymer bearings for total hip arthroplasty in that the larger femoral head and hydrodynamic lubrication of the former reduce the rate of wear. However, concerns remain regarding adverse reactions to metal debris including metallosis caused by metal wear generated at the taper-head interface and another modular junction. Our group has hypothesized that carbon ion implantation (CII) may improve metal wear properties. The purpose of this study was to investigate the wear properties and friction coefficients of CII surfaces with an aim to ultimately apply these surfaces to MoM bearings in artificial joints. CII was applied to cobalt-chromium-molybdenum (Co-Cr-Mo) alloy substrates by plasma source ion implantation. The substrates were characterized using scanning electron microscopy and a 3D measuring laser microscope. Sliding contact tests were performed with a simple geometry pin-on-plate wear tester at a load of 2.5 N, a calculated contact pressure of 38.5 MPa (max: 57.8 MPa), a reciprocating velocity of 30 mm/s, a stroke length of 60 mm, and a reciprocating cycle count of 172,800 cycles. The surfaces of the CII substrates were generally featureless with a smooth surface topography at the same level as untreated Co-Cr-Mo alloy. Compared to the untreated Co-Cr-Mo alloy, the CII-treated bearings had lower friction coefficients, higher resistance to catastrophic damage, and prevented the adhesion of wear debris. The results of this study suggest that the CII surface stabilizes the wear status due to the low friction coefficient and low infiltration of partner materials, and these properties also prevent the adhesion of wear debris and inhibit excessive wear. Carbon is considered to be biologically inert; therefore, CII is anticipated to be applicable to the bearing surfaces of MoM prostheses. PMID:28615939

Hydrophobic Man-1-P derivatives correct abnormal glycosylation in Type I congenital disorder of glycosylation fibroblasts.

PubMed

Eklund, Erik A; Merbouh, Nabyl; Ichikawa, Mie; Nishikawa, Atsushi; Clima, Jessica M; Dorman, James A; Norberg, Thomas; Freeze, Hudson H

2005-11-01

Patients with Type I congenital disorders of glycosylation (CDG-I) make incomplete lipid-linked oligosaccharides (LLO). These glycans are poorly transferred to proteins resulting in unoccupied glycosylation sequons. Mutations in phosphomannomutase (PMM2) cause CDG-Ia by reducing the activity of PMM, which converts mannose (Man)-6-P to Man-1-P before formation of GDP-Man. These patients have reduced Man-1-P and GDP-Man. To replenish intracellular Man-1-P pools in CDG-Ia cells, we synthesized two hydrophobic, membrane permeable acylated versions of Man-1-P and determined their ability to normalize LLO size and N-glycosylation in CDG-Ia fibroblasts. Both compounds, compound I (diacetoxymethyl 2,3,4,6-tetra-O-acetyl-alpha-D-mannopyranosyl phosphate) (C-I) and compound II (diacetoxymethyl 2,3,4,6-tetra-O-ethyloxycarbonyl-alpha-D-mannopyranosyl phosphate) (C-II), contain two acetoxymethyl (CH2OAc) groups O-linked to phosphorous. C-I contains acetyl esters and C-II contains ethylcarbonate (CO2Et) esters on the Man residue. Both C-I and C-II normalized truncated LLO, but C-II was about 2-fold more efficient than C-I. C-II replenished the GDP-Man pool in CDG-Ia cells and was more efficiently incorporated into glycoproteins than exogenous Man at low concentrations (25-75 mM). In a glycosylation assay of DNaseI in CDG-Ia cells, C-II restored glycosylation to control cell levels. C-II also corrected impaired LLO biosynthesis in cells from a Dolichol (Dol)-P-Man deficient patient (CDG-Ie) and partially corrected LLO in cells from an ALG12 mannosyltransferase-deficient patient (CDG-Ig), whereas cells from an ALG3-deficient patient (CDG-Id) and from an MPDU1-deficient patient (CDG-If) were not corrected. These results validate the general concept of using pro-Man-1-P substrates as potential therapeutics for CDG-I patients.

[CII] At 1 < z < 2: Observing Star Formation in the Early Universe with Zeus (1 and 2)

NASA Technical Reports Server (NTRS)

Ferkinhoff, Carl; Hailey-Dunsheath, S.; Nikola, T.; Oberst, T.; Parshley, S.; Stacey, G.; Benford, D.; staguhn, J.

2010-01-01

We report the detection of the [CII] 158 micron fine structure line from six submillimeter galaxies with redshifts between 1.12 and 1.73. This more than doubles the total number of [CII] 158 micron detections reported from high redshift sources. These observations were made with the Redshift(z) and Early Universe Spectrometer(ZEUS) at the Caltech Submillimeter Observatory on Mauna Kea, Hawaii between December 2006 and March 2009. ZEUS is a background limited submm echelle grating spectrometer (Hailey-Dunsheath 2009). Currently we are constructing ZEUS-2. This new instrument will utilize the same grating but will feature a two dimensional transition-edge sensed bolometer array with SQUID multiplexing readout system enabling simultaneous background limited observations in the 200, 340,450 and 650 micron telluric windows. ZEUS-2 will allow for long slit imaging spectroscopy in nearby galaxies and a [CII] survey from z 0.25 to 2.5.

Class I and II Small Heat Shock Proteins Together with HSP101 Protect Protein Translation Factors during Heat Stress1[OPEN

PubMed Central

Basha, Eman; Fowler, Mary E.; Kim, Minsoo; Bordowitz, Juliana; Katiyar-Agarwal, Surekha

2016-01-01

The ubiquitous small heat shock proteins (sHSPs) are well documented to act in vitro as molecular chaperones to prevent the irreversible aggregation of heat-sensitive proteins. However, the in vivo activities of sHSPs remain unclear. To investigate the two most abundant classes of plant cytosolic sHSPs (class I [CI] and class II [CII]), RNA interference (RNAi) and overexpression lines were created in Arabidopsis (Arabidopsis thaliana) and shown to have reduced and enhanced tolerance, respectively, to extreme heat stress. Affinity purification of CI and CII sHSPs from heat-stressed seedlings recovered eukaryotic translation elongation factor (eEF) 1B (α-, β-, and γ-subunits) and eukaryotic translation initiation factor 4A (three isoforms), although the association with CI sHSPs was stronger and additional proteins involved in translation were recovered with CI sHSPs. eEF1B subunits became partially insoluble during heat stress and, in the CI and CII RNAi lines, showed reduced recovery to the soluble cell fraction after heat stress, which was also dependent on HSP101. Furthermore, after heat stress, CI sHSPs showed increased retention in the insoluble fraction in the CII RNAi line and vice versa. Immunolocalization revealed that both CI and CII sHSPs were present in cytosolic foci, some of which colocalized with HSP101 and with eEF1Bγ and eEF1Bβ. Thus, CI and CII sHSPs have both unique and overlapping functions and act either directly or indirectly to protect specific translation factors in cytosolic stress granules. PMID:27474115

6 CFR 29.1 - Purpose and scope.

Code of Federal Regulations, 2013 CFR

2013-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

6 CFR 29.1 - Purpose and scope.

Code of Federal Regulations, 2012 CFR

2012-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

6 CFR 29.1 - Purpose and scope.

Code of Federal Regulations, 2011 CFR

2011-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

6 CFR 29.1 - Purpose and scope.

Code of Federal Regulations, 2014 CFR

2014-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

Measuring the Epoch of Reionization using [CII] Intensity Mapping with TIME-Pilot

NASA Astrophysics Data System (ADS)

Crites, Abigail; Bock, James; Bradford, Matt; Bumble, Bruce; Chang, Tzu-Ching; Cheng, Yun-Ting; Cooray, Asantha R.; Hailey-Dunsheath, Steve; Hunacek, Jonathon; Li, Chao-Te; O'Brient, Roger; Shirokoff, Erik; Staniszewski, Zachary; Shiu, Corwin; Uzgil, Bade; Zemcov, Michael B.; Sun, Guochao

2017-01-01

TIME-Pilot (the Tomographic Ionized carbon Intensity Mapping Experiment) is a new instrument designed to probe the epoch of reionization (EoR) by measuring the 158 um ionized carbon emission line [CII] from redshift 5 - 9. TIME-Pilot will also probe the molecular gas content of the universe during the epoch spanning the peak of star formation (z ~ 1 -3) by making an intensity mapping measurement of the CO transitions in the TIME-Pilot band (CO(3-2), CO(4-3), CO(5-4), and CO(6-5)). I will describe the instrument we are building which is an R of ~100 spectrometer sensitive to the 200-300 GHz radiation. The camera is designed to measure the line emission from galaxies using an intensity mapping technique. This instrument will allow us to detect the [CII] clustering fluctuations from faint galaxies during EoR and compare these measurements to predicted [CII] amplitudes from current models. The CO measurements will allow us to constrain models for galaxies at lower redshift. The [CII] intensity mapping measurements that will be made with TIME-Pilot and detailed measurements made with future more sensitive mm-wavelength spectrometers are complimentary to 21-cm measurements of the EoR and complimentary to direct detections of high redshift galaxies with HST, ALMA, and, in the future, JWST.

C+ detection of warm dark gas in diffuse clouds

NASA Astrophysics Data System (ADS)

Langer, W. D.; Velusamy, T.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

2010-10-01

We present the first results of the Herschel open time key program, Galactic Observations of Terahertz C+ (GOT C+) survey of the [CII] 2P3/2-2P1/2 fine-structure line at 1.9 THz (158 μm) using the HIFI instrument on Herschel. We detected 146 interstellar clouds along sixteen lines-of-sight towards the inner Galaxy. We also acquired HI and CO isotopologue data along each line-of-sight for analysis of the physical conditions in these clouds. Here we analyze 29 diffuse clouds (AV < 1.3 mag) in this sample characterized by having [CII] and HI emission, but no detectable CO. We find that [CII] emission is generally stronger than expected for diffuse atomic clouds, and in a number of sources is much stronger than anticipated based on their HI column density. We show that excess [CII] emission in these clouds is best explained by the presence of a significant diffuse warm H2, dark gas, component. This first [CII] 158 μm detection of warm dark gas demonstrates the value of this tracer for mapping this gas throughout the Milky Way and in galaxies. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Class I and II Small Heat Shock Proteins Together with HSP101 Protect Protein Translation Factors during Heat Stress.

PubMed

McLoughlin, Fionn; Basha, Eman; Fowler, Mary E; Kim, Minsoo; Bordowitz, Juliana; Katiyar-Agarwal, Surekha; Vierling, Elizabeth

2016-10-01

The ubiquitous small heat shock proteins (sHSPs) are well documented to act in vitro as molecular chaperones to prevent the irreversible aggregation of heat-sensitive proteins. However, the in vivo activities of sHSPs remain unclear. To investigate the two most abundant classes of plant cytosolic sHSPs (class I [CI] and class II [CII]), RNA interference (RNAi) and overexpression lines were created in Arabidopsis (Arabidopsis thaliana) and shown to have reduced and enhanced tolerance, respectively, to extreme heat stress. Affinity purification of CI and CII sHSPs from heat-stressed seedlings recovered eukaryotic translation elongation factor (eEF) 1B (α-, β-, and γ-subunits) and eukaryotic translation initiation factor 4A (three isoforms), although the association with CI sHSPs was stronger and additional proteins involved in translation were recovered with CI sHSPs. eEF1B subunits became partially insoluble during heat stress and, in the CI and CII RNAi lines, showed reduced recovery to the soluble cell fraction after heat stress, which was also dependent on HSP101. Furthermore, after heat stress, CI sHSPs showed increased retention in the insoluble fraction in the CII RNAi line and vice versa. Immunolocalization revealed that both CI and CII sHSPs were present in cytosolic foci, some of which colocalized with HSP101 and with eEF1Bγ and eEF1Bβ. Thus, CI and CII sHSPs have both unique and overlapping functions and act either directly or indirectly to protect specific translation factors in cytosolic stress granules. © 2016 American Society of Plant Biologists. All Rights Reserved.

The [CII]/[NII] far-infrared line ratio at z>5: extreme conditions for “normal” galaxies

NASA Astrophysics Data System (ADS)

Pavesi, Riccardo; Riechers, Dominik; Capak, Peter L.; Carilli, Chris Luke; Sharon, Chelsea E.; Stacey, Gordon J.; Karim, Alexander; Scoville, Nicholas; Smolcic, Vernesa

2017-01-01

Thanks to the Atacama Large (sub-)Millimeter Array (ALMA), observations of atomic far-infrared fine structure lines are a very productive way of measuring physical properties of the interstellar medium (ISM) in galaxies at high redshift, because they provide an unobscured view into the physical conditions of star formation. While the bright [CII] line has become a routine probe of the dynamical properties of the gas, its intensity needs to be compared to other lines in order to establish the physical origin of the emission. [NII] selectively traces the emission coming from the ionized fraction of the [CII]-emitting gas, offering insight into the phase structure of the ISM. Here we present ALMA measurements of [NII] 205 μm fine structure line emission from a representative sample of galaxies at z=5-6 spanning two orders of magnitude in star formation rate (SFR). Our results show at least two different regimes of ionized gas properties for galaxies in the first billion years of cosmic time, separated by their L[CII]/L[NII] ratio. First, we find extremely low [NII] emission compared to [CII] from a “typical” Lyman Break Galaxy (LBG-1), likely due to low dust content and reminiscent of local dwarfs. Second, the dusty Lyman Break Galaxy HZ10 and the extreme starburst AzTEC-3 show ionized gas fractions typical of local star-forming galaxies and show hints of spatial variations in their [CII]/[NII] line ratio. These observations of far-infrared lines in “normal” galaxies at z>5 yield some of the first constraints on ISM models for young galaxies in the first billion years of cosmic time and shed light on the observed evolution of the dust and gas properties.

Relationship between residual feed intake and lymphocyte mitochondrial complex protein concentration and ratio in crossbred steers.

PubMed

Davis, M P; Brooks, M A; Kerley, M S

2016-04-01

Rate of oxygen uptake by muscle mitochondria and respiratory chain protein concentrations differed between high- and low-residual feed intake (RFI) animals. The hypothesis of this research was that complex I (CI), II (CII), and III (CIII) mitochondria protein concentrations in lymphocyte (blood) mitochondria were related to the RFI phenotype of beef steers. Daily feed intake (ADFI) was individually recorded for 92 Hereford-crossbreed steers over 63 d using GrowSafe individual feed intake system. Predicted ADFI was calculated as the regression of ADFI on ADG and midtest BW. Difference between ADFI and predicted ADFI was RFI. Lymphocytes were isolated from low-RFI (-1.32 ± 0.11 kg/d; = 10) and high-RFI (1.34 ± 0.18 kg/d; = 8) steers. Immunocapture of CI, CII, and CIII proteins from the lymphocyte was done using MitoProfile CI, CII, and CIII immunocapture kits (MitoSciences Inc., Eugene, OR). Protein concentrations of CI, CII, and CIII and total protein were quantified using bicinchoninic acid colorimetric procedures. Low-RFI steers consumed 30% less ( = 0.0004) feed and had a 40% improvement ( < 0.0001) in feed efficiency compared with high-RFI steers with similar growth ( = 0.78) and weight measurements ( > 0.65). High- and low-RFI steers did not differ in CI ( = 0.22), CII ( = 0.69), and CIII ( = 0.59) protein concentrations. The protein concentration ratios for CI to CII ( = 0.03) were 20% higher and the ratios of CI to CIII ( = 0.01) were 30% higher, but the ratios of CII to CIII ( = 0.89) did not differ when comparing low-RFI steers with high-RFI steers. The similar magnitude difference in feed intake, feed efficiency measurements, and CI-to-CIII ratio between RFI phenotypes provides a plausible explanation for differences between the phenotypes. We also concluded that mitochondria isolated from lymphocytes could be used to study respiratory chain differences among differing RFI phenotypes. Further research is needed to determine if lymphocyte mitochondrial complex proteins can be used for identification of RFI phenotype.

Maintaining the Database for Information Object Analysis, Intent, Dissemination and Enhancement (IOAIDE) and the US Army Research Laboratory Campus Sensor Network (ARL CSN)

DTIC Science & Technology

2017-01-01

CII-B 2800 Powder Mill Road Adelphi, MD 20783-1138 8. PERFORMING ORGANIZATION REPORT NUMBER ARL-TR-7921 9. SPONSORING/MONITORING AGENCY NAME(S...server database, structured query language, information objects, instructions, maintenance , cursor on target events, unattended ground sensors...unlimited. iii Contents List of Figures iv 1. Introduction 1 2. Computer and Software Development Tools Requirements 1 3. Database Maintenance 2 3.1

Collaborative Access Control For Critical Infrastructures

NASA Astrophysics Data System (ADS)

Baina, Amine; El Kalam, Anas Abou; Deswarte, Yves; Kaaniche, Mohamed

A critical infrastructure (CI) can fail with various degrees of severity due to physical and logical vulnerabilities. Since many interdependencies exist between CIs, failures can have dramatic consequences on the entire infrastructure. This paper focuses on threats that affect information and communication systems that constitute the critical information infrastructure (CII). A new collaborative access control framework called PolyOrBAC is proposed to address security problems that are specific to CIIs. The framework offers each organization participating in a CII the ability to collaborate with other organizations while maintaining control of its resources and internal security policy. The approach is demonstrated on a practical scenario involving the electrical power grid.

6 CFR 29.1 - Purpose and scope.

Code of Federal Regulations, 2010 CFR

2010-01-01

... INFORMATION § 29.1 Purpose and scope. (a) Purpose of this Part. This Part implements sections 211 through 215... receipt, care, and storage of Critical Infrastructure Information (CII) voluntarily submitted to the... herein as the Critical Infrastructure Information Act of 2002 (CII Act). Consistent with the statutory...

47 CFR 22.973 - Information exchange.

Code of Federal Regulations, 2012 CFR

2012-10-01

... 47 Telecommunication 2 2012-10-01 2012-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

47 CFR 22.973 - Information exchange.

Code of Federal Regulations, 2011 CFR

2011-10-01

... 47 Telecommunication 2 2011-10-01 2011-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

47 CFR 22.973 - Information exchange.

Code of Federal Regulations, 2014 CFR

2014-10-01

... 47 Telecommunication 2 2014-10-01 2014-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

47 CFR 22.973 - Information exchange.

Code of Federal Regulations, 2013 CFR

2013-10-01

... 47 Telecommunication 2 2013-10-01 2013-10-01 false Information exchange. 22.973 Section 22.973... Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII... information to the public safety/CII licensee at least 10 business days before a new cell site is activated or...

Equitable Access to Healthcare Services and Income Replacement for Cancer: Is Critical Illness Insurance a Help or a Hindrance?

PubMed Central

Longo, Christopher J.

2010-01-01

Canada's publicly funded healthcare system ensures that medically necessary hospital and physician services are available without financial barriers, but not all community-based care is covered. Consequently, many patients experience financial shocks (FS) related to community-based healthcare services not funded by government, and perhaps also from lost income, a situation that may be difficult for patients to avoid. Critical illness insurance (CII) offers a patient-funded alternative to those who qualify and desire protection against FS, leaving those without CII exposed. The author discusses the benefits and limitations of CII to mitigate financially derived healthcare access inequities, using cancer as an example. PMID:21532761

Computer-assisted rehabilitation of attention in pediatric multiple sclerosis and ADHD patients: a pilot trial.

PubMed

Simone, Marta; Viterbo, Rosa Gemma; Margari, Lucia; Iaffaldano, Pietro

2018-06-08

The treatment of cognitive deficits is challenging in pediatric onset multiple sclerosis (POMS) and in patients with attention deficit hyperactivity disorder (ADHD). We performed a pilot double-blind RCT to evaluate the efficacy of a home-based computerized-program for retraining attention in two cohorts of POMS and ADHD patients. POMS and ADHD patients failing in at least 2/4 attention tests on a neuropsychological battery were randomized to specific or nonspecific computerized training (ST, nST), performed in one-hour sessions, twice/week for 3 months. The primary outcome was the effect of the training on global neuropsychological performances measured by the cognitive impairment index (CII). The efficacy of the intervention was evaluated in each disease group by using repeated measures ANOVA. Sixteen POMS (9 females, age 15.75 ± 1.74 years) and 20 ADHD (2 females, age 11.19 ± 2.49 years) patients were enrolled. In POMS patients the ST exposure was associated to a significantly more pronounced improvement of the CII (p < 0.0001) and on cognitive test exploring attention, concentration, planning strategies and visuo-spatial memory performances in comparison to nST exposure. In ADHD patients the difference between the ST and nST on the CII was not statistical significant (p = 0.06), but a greater effect of the ST was found only on cognitive test exploring attention and delayed recall of visuo-spatial memory performances. Our data suggest that a cognitive rehabilitation program that targets attention is a suitable tool for improving global cognitive functioning in POMS patients, whereas it has a less pronounced transfer effect in ADHD patients. ClinicalTrials.gov; NCT03190902 ; registration date: June 15, 2017; retrospectively registered.

Blast Noise Prediction. Volume II. BNOISE 3.2 Computer Program Description and Program Listing.

DTIC Science & Technology

1981-03-01

tttim itit) k cii he sCli h I Apptif 4\\1111,1C’ I Lin ~Ist I Itis is tj ’it. hi ilti Ituitph inlI N’ skiLl I ink, hi k I i e II it,~ 11it I Mi...to which the point (XMIN,YMIN) will correspond SCLE Card cc 1 SCLI - PS( A L Format (A4,2X,G8.3) where. PSCALF (col 7-14t is the plotter scale factor

46 CFR 193.50-10 - Location.

Code of Federal Regulations, 2014 CFR

2014-10-01

.... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

46 CFR 193.50-10 - Location.

Code of Federal Regulations, 2012 CFR

2012-10-01

.... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

46 CFR 193.50-10 - Location.

Code of Federal Regulations, 2010 CFR

2010-10-01

.... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

46 CFR 193.50-10 - Location.

Code of Federal Regulations, 2013 CFR

2013-10-01

.... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

46 CFR 193.50-10 - Location.

Code of Federal Regulations, 2011 CFR

2011-10-01

.... Trunks to machinery spaces Do. Fuel tanks Do. Scientific spaces Chemistry laboratory or scientific laboratory C-II 1 dry chemical and 1 carbon dioxide for each 300 square feet or fraction thereof, with one (1) of each kind located in the vicinity of the exit. Chemical storeroom C-II Same as for the chemistry...

Far-infrared line emission from the galaxy. Ph.D. Thesis

NASA Technical Reports Server (NTRS)

Stacey, G. J.

1985-01-01

The diffuse 157.74 micron (CII) emission from the Galaxy was sampled at several galactic longitudes near the galactic plane including complete scan across the plane at (II) = 2.16 deg and (II) = 7.28 deg. The observed (CII) emission profiles follow closely the nearby (12)CO (J=1to0) emission profiles. The (CII) emission probably arises in neutral photodissociation regions near the edges of giant moleclar clouds (GMC's). These regions have densities of approximately 350 cm(-3) and temperatures of approximately 300 K, and amount to 4x10(8) solar mass of hydrogen in the inner Galaxy. The total 157.74 micron luminosity of the Galaxy is estimated to be 6x10(7) solar luminosity. Estimates were also made of the galactic emission in other far-infrared (FIR) cooling lines. The (CII) line was found to be the dominant FIR emission line from the galaxy and the primary coolant for the warm neutral gas near the galactic plane. Other cooling lines predicted to be prominent in the galactic spectrum are discussed. The 145.53 micron (OI) emission line from the Orion nebula was also measured.

Targeting of viral interleukin-10 with an antibody fragment specific to damaged arthritic cartilage improves its therapeutic potency

PubMed Central

2014-01-01

Introduction We previously demonstrated that a single-chain fragment variable (scFv) specific to collagen type II (CII) posttranslationally modified by reactive oxygen species (ROS) can be used to target anti-inflammatory therapeutics specifically to inflamed arthritic joints. The objective of the present study was to demonstrate the superior efficacy of anti-inflammatory cytokines when targeted to inflamed arthritic joints by the anti-ROS modified CII (anti-ROS-CII) scFv in a mouse model of arthritis. Methods Viral interleukin-10 (vIL-10) was fused to anti-ROS-CII scFv (1-11E) with a matrix-metalloproteinase (MMP) cleavable linker to create 1-11E/vIL-10 fusion. Binding of 1-11E/vIL-10 to ROS-CII was determined by enzyme-linked immunosorbent assay (ELISA), Western blotting, and immune-staining of arthritic cartilage, whereas vIL-10 bioactivity was evaluated in vitro by using an MC-9 cell-proliferation assay. Specific in vivo localization and therapeutic efficacy of 1-11E/vIL-10 was tested in the mouse model of antigen-induced arthritis. Results 1-11E/vIL-10 bound specifically to ROS-CII and to damaged arthritic cartilage. Interestingly, the in vitro vIL-10 activity in the fusion protein was observed only after cleavage with MMP-1. When systemically administered to arthritic mice, 1-11E/vIL-10 localized specifically to the arthritic knee, with peak accumulation observed after 3 days. Moreover, 1-11E/vIL-10 reduced inflammation significantly quicker than vIL-10 fused to the control anti-hen egg lysozyme scFv (C7/vIL10). Conclusions Targeted delivery of anti-inflammatory cytokines potentiates their anti-arthritic action in a mouse model of arthritis. Our results further support the hypothesis that targeting biotherapeutics to arthritic joints may be extended to include anti-inflammatory cytokines that lack efficacy when administered systemically. PMID:25029910

C+/CO Transitions in the Diffuse ISM: Transitional Cloud Sample from the GOT C+ Survey of [CII] in the inner Galaxy at l = -30deg to 30deg

NASA Astrophysics Data System (ADS)

Velusamy, T.; Pineda, J. L.; Langer, W. D.; Willacy, K.; Goldsmith, P. F.

2011-05-01

Our knowledge of interstellar gas has been limited primarily to the diffuse atomic phase traced by HI and the well-shielded molecular phase traced by CO. Recently, using the first results of the Herschel Key Project GOT C+, a HIFI C+ survey of the Galactic plane, Velusamy, Langer, Pineda et al. (A&A 521, L18, 2010) have shown that in the diffuse interstellar transition clouds a significant fraction of the carbon exists primarily as C^+ with little C^0 and CO in a warm 'dark gas' layer in which hydrogen is mostly H_2 with little atomic H, surrounding a modest 12CO-emitting core. The [CII] fine structure transition, at 1.9 THz (158 μm) is the best tracer of this component of the interstellar medium, which is critical to our understanding of the atomic to molecular cloud transitions. The Herschel Key Project GOT C+ is designed to study such clouds by observing with HIFI the [CII] line emission along 500 lines of sight (LOSs) throughout the Galactic disk. Here we present the identification and chemical status of a few hundred diffuse and transition clouds traced by [CII], along with auxiliary HI and CO data covering ~100 LOSs in the inner Galaxy between l= -30° and 30°. We identify transition clouds as [CII] components that are characterized by the presence of both HI and 12CO, but no 13CO emission. The intensities, I(CII) and I(HI), are used as measures of the visual extinction, AV, in the cloud up to the C^+/C^0/CO transition layer and a comparison with I(12CO) yields a more complete H_2 molecular inventory. Our results show that [CII] emission is an excellent tool to study transition clouds and their carbon chemistry in the ISM, in particular as a unique tracer of molecular H_2, which is not easily observed by other means. The large sample presented here will serve as a resource to study the chemical and physical status of diffuse transition clouds in a wide range of Galactic environments and constrain the physical parameters such as the FUV intensity and cosmic ray ionization rate that drive the CO chemistry in the diffuse ISM.

MX, A DRINKING WATER CARCINOGEN, DOES NOT INDUCE MUTATIONS IN THE LIVER OF CII TRANSGENIC MEDAKA

EPA Science Inventory

MX, a drinking water carcinogen, does not induce mutations in the liver of cII transgenic medaka
Geter, DR; Winn, RN; Fournie, JW; Norris, MB; DeAngelo, AB; and Hawkins, WE

Abstract

Geter et al., page 2
Abstract
"Salmonella" mutagenicity assays have shown t...

A computational approach for hypersonic nonequilibrium radiation utilizing space partition algorithm and Gauss quadrature

NASA Astrophysics Data System (ADS)

Shang, J. S.; Andrienko, D. A.; Huang, P. G.; Surzhikov, S. T.

2014-06-01

An efficient computational capability for nonequilibrium radiation simulation via the ray tracing technique has been accomplished. The radiative rate equation is iteratively coupled with the aerodynamic conservation laws including nonequilibrium chemical and chemical-physical kinetic models. The spectral properties along tracing rays are determined by a space partition algorithm of the nearest neighbor search process, and the numerical accuracy is further enhanced by a local resolution refinement using the Gauss-Lobatto polynomial. The interdisciplinary governing equations are solved by an implicit delta formulation through the diminishing residual approach. The axisymmetric radiating flow fields over the reentry RAM-CII probe have been simulated and verified with flight data and previous solutions by traditional methods. A computational efficiency gain nearly forty times is realized over that of the existing simulation procedures.

Role of the RNA polymerase α subunits in CII-dependent activation of the bacteriophage λ pE promoter: identification of important residues and positioning of the α C-terminal domains

PubMed Central

Kedzierska, Barbara; Lee, David J.; Węgrzyn, Grzegorz; Busby, Stephen J. W.; Thomas, Mark S.

2004-01-01

The bacteriophage λ CII protein stimulates the activity of three phage promoters, pE, pI and paQ, upon binding to a site overlapping the –35 element at each promoter. Here we used preparations of RNA polymerase carrying a DNA cleavage reagent attached to specific residues in the C-terminal domain of the RNA polymerase α subunit (αCTD) to demonstrate that one αCTD binds near position –41 at pE, whilst the other αCTD binds further upstream. The αCTD bound near position –41 is oriented such that its 261 determinant is in close proximity to σ70. The location of αCTD in CII-dependent complexes at the pE promoter is very similar to that found at many activator-independent promoters, and represents an alternative configuration for αCTD at promoters where activators bind sites overlapping the –35 region. We also used an in vivo alanine scan analysis to show that the DNA-binding determinant of αCTD is involved in stimulation of the pE promoter by CII, and this was confirmed by in vitro transcription assays. We also show that whereas the K271E substitution in αCTD results in a drastic decrease in CII-dependent activation of pE, the pI and paQ promoters are less sensitive to this substitution, suggesting that the role of αCTD at the three lysogenic promoters may be different. PMID:14762211

SPAIDE: A Real-time Research Platform for the Clarion CII/90K Cochlear Implant

NASA Astrophysics Data System (ADS)

Van Immerseel, L.; Peeters, S.; Dykmans, P.; Vanpoucke, F.; Bracke, P.

2005-12-01

SPAIDE ( sound-processing algorithm integrated development environment) is a real-time platform of Advanced Bionics Corporation (Sylmar, Calif, USA) to facilitate advanced research on sound-processing and electrical-stimulation strategies with the Clarion CII and 90K implants. The platform is meant for testing in the laboratory. SPAIDE is conceptually based on a clear separation of the sound-processing and stimulation strategies, and, in specific, on the distinction between sound-processing and stimulation channels and electrode contacts. The development environment has a user-friendly interface to specify sound-processing and stimulation strategies, and includes the possibility to simulate the electrical stimulation. SPAIDE allows for real-time sound capturing from file or audio input on PC, sound processing and application of the stimulation strategy, and streaming the results to the implant. The platform is able to cover a broad range of research applications; from noise reduction and mimicking of normal hearing, over complex (simultaneous) stimulation strategies, to psychophysics. The hardware setup consists of a personal computer, an interface board, and a speech processor. The software is both expandable and to a great extent reusable in other applications.

Herschel Observations of C+ in the Vicinity of Star Forming Complexes in the Galactic Plane

NASA Astrophysics Data System (ADS)

Pineda, Jorge; Velusamy, T.; Langer, W.; Goldsmith, P.; Li, D.; Yorke, H.

2010-05-01

The CII fine-structure line at 158 um, is an excellent tracer of the warm diffuse gas and the hot, dense Photon Dominated Regions (PDRs). We can, therefore, use the CII emission as a probe to understand the effects of star formation on their interstellar environment. Here we present the first results from the Galactic Observations of Terahertz C+ (GOT C+), a Herschel Key Project study of CII fine structure emission in the vicinity of star forming complexes. In the Priority Science Phase of HIFI observations, the GOT C+ project collects data along a dozen lines of sight passing near star forming regions in the inner Galaxy from longitude 310 degrees to 25 degrees. We discuss our first results on the transition between dense and hot gas (traced by CII) and dense and cold gas (traced by 12CO and 13CO). This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP was supported under the NASA Postdoctoral Program at JPL, Caltech, administered by Oak Ridge Associated Universities through a contract with NASA, and is currently supported as a Caltech-JPL Postdoc.

METSAT information content: Cloud screening and solar correction investigations on the influence of NOAA-6 advanced very high resolution radiometer derived vegetation assessment

NASA Technical Reports Server (NTRS)

Mathews, M. L.

1983-01-01

The development of the cloud indicator index (CII) for use with METSAT's advanced very high resolution radiometer (AVHRR) is described. The CII is very effective at identification of clouds. Also, explored are different solar correction and standard techniques and the impact of these corrections have on the information content of AVHRR data.

Obesity aggravates the joint inflammation in a collagen-induced arthritis model through deviation to Th17 differentiation

PubMed Central

Jhun, Joo-Yeon; Yoon, Bo-Young; Park, Mi-Kyung; Oh, Hye-Joa; Byun, Jae-Kyeong; Lee, Seon-Young; Min, Jun-Ki; Park, Sung-Hwan; Kim, Ho-Youn

2012-01-01

White fat cells secrete adipokines that induce inflammation and obesity has been reported to be characterized by high serum levels of inflammatory cytokines such as IL-6 and TNF-α. Rheumatoid arthritis (RA) is a prototype of inflammatory arthritis, but the relationship between RA and obesity is controversial. We made an obese inflammatory arthritis model: obese collagen-induced arthritis (CIA). C57BL/6 mice were fed a 60-kcal high fat diet (HFD) from the age of 4 weeks and they were immunized twice with type II collagen (CII). After immunization, the obese CIA mice showed higher arthritis index scores and histology scores and a more increased incidence of developing arthritis than did the lean CIA mice. After treatment with CII, mixed lymphocyte reaction also showed CII-specific response more intensely in the obese CIA mice than lean CIA. The anti-CII IgG and anti-CII IgG2a levels in the sera of the obese CIA mice were higher than those of the lean CIA mice. The number of Th17 cells was higher and the IL-17 mRNA expression of the splenocytes in the obese CIA mice was higher than that of the lean CIA mice. Obese CIA mice also showed high IL-17 expression on synovium in immunohistochemistry. Although obesity may not play a pathogenic role in initiating arthritis, it could play an important role in amplifying the inflammation of arthritis through the Th1/Th17 response. The obese CIA murine model will be an important tool when we investigate the effect of several therapeutic target molecules to treat RA. PMID:22513335

Mammalian proliferating cell nuclear antigen stimulates the processivity of two wheat embryo DNA polymerases.

PubMed Central

Laquel, P; Litvak, S; Castroviejo, M

1993-01-01

Multiple DNA polymerases have been described in all organisms studied to date. Their specific functions are not easy to determine, except when powerful genetic and/or biochemical tools are available. However, the processivity of a DNA polymerase could reflect the physiological role of the enzyme. In this study, analogies between plant and animal DNA polymerases have been investigated by analyzing the size of the products synthesized by wheat DNA polymerases A, B, CI, and CII as a measure of their processivity. Thus, incubations have been carried out with poly(dA)-oligo(dT) as a template-primer under varying assay conditions. In the presence of MgCl2, DNA polymerase A was highly processive, whereas DNA polymerases B, CI, and CII synthesized much shorter products. With MnCl2 instead of MgCl2, DNA polymerase A was highly processive, DNA polymerases B and CII were moderately processive, and DNA polymerase CI remained strictly distributive. The effect of calf thymus proliferating cell nuclear antigen (PCNA) on wheat polymerases was studied as described for animal DNA polymerases. The high processivity of DNA polymerase A was PCNA independent, whereas both enzyme activity and processivity of wheat DNA polymerases B and CII were significantly stimulated by PCNA. On the other hand, DNA polymerase CI was not stimulated by PCNA and, like animal DNA polymerase beta, was distributive in all cases. From these results, we propose that wheat DNA polymerase A could correspond to a DNA polymerase alpha, DNA polymerases B and CII could correspond to the delta-like enzyme, and DNA polymerase CI could correspond to DNA polymerase beta. PMID:7906418

Anti-rheumatoid arthritic effects of Saussurea involucrata on type II collagen-induced arthritis in rats.

PubMed

Xu, Meihong; Guo, Qianying; Wang, Shuangjia; Wang, Na; Wei, Liren; Wang, Junbo

2016-02-01

Saussurea involucrata (SI) has long been used under the herbal name "snow lotus" for treatment of inflammation and pain-related diseases in traditional Chinese medicine. The present study aimed to evaluate the pharmacological effects of SI on collagen II (CII)-induced arthritis in rats. Rats with collagen II (CII)-induced arthritis were orally administered SI (420 mg kg(-1)) for 40 consecutive days. Histopathological examination indicated that SI alleviates infiltration of inflammatory cells and synovial hyperplasia and slows joint destruction. SI intervention reduced the serum levels of RF, COMP, CRP and anti-CII IgG. Results also showed that SI is a potential therapeutic agent for alleviating the severity of the disease based on the reduced arthritic index. It was concluded that SI can ameliorate inflammation and joint destruction in CIA rats.

Investigation of Modularly Configured Attached Processors with Intelligent Memories

DTIC Science & Technology

1994-09-30

sequence of computations becomes cl = c11 + C[i, i] := Cli, j] + A[i, k) * Blk, j]; al x bti, c12 - c12 + k X bkX2, C13 = C1 3 + alk X b 3 , ... , c =n...Cin + alk X bkn, C2 1 = Cat + a2k x bkl , The sequence of computations becomes cii = a I x bli, C22 = cU2 + a2k x b2, ... Cj a2 1x bij, ca3j = aa x...1 to 1/2 Least significant 1/2 address bits Fig. 1. Block diagram of a memory module PREGVJKE is v I pis P16 16 ItO16 = 4-81T OECD - = AMKSS A s-Byrf

The Tomographic Ionized-Carbon Mapping Experiment (TIME) CII Imaging Spectrometer

NASA Astrophysics Data System (ADS)

Staniszewski, Z.; Bock, J. J.; Bradford, C. M.; Brevik, J.; Cooray, A.; Gong, Y.; Hailey-Dunsheath, S.; O'Brient, R.; Santos, M.; Shirokoff, E.; Silva, M.; Zemcov, M.

2014-09-01

The Tomographic Ionized-Carbon Mapping Experiment (TIME) and TIME-Pilot are proposed imaging spectrometers to measure reionization and large scale structure at redshifts 5-9. We seek to exploit the 158 restframe emission of [CII], which becomes measurable at 200-300 GHz at reionization redshifts. Here we describe the scientific motivation, give an overview of the proposed instrument, and highlight key technological developments underway to enable these measurements.

A Herschel and CARMA synergistic study of turbulent gas in Hickson Compact Groups

NASA Astrophysics Data System (ADS)

Appleton, Philip N.; Alatalo, Katherine A.; Lisenfeld, Ute; Bitsakis, Thodoris; Guillard, Pierre; Charmandaris, Vassilis; Cluver, Michelle; Dopita, Michael A.; Freeland, Emily; Hickson Compact Group Team

2015-01-01

We have performed deep PACS and SPIRE imaging, [CII] and [OI] spectroscopy and CARMA CO J= 1-0 imaging of a dozen Hickson Compact Groups (HCGs). The observations attempt to explore the physical conditions of the gas in a subset of galaxies containing large quantities of warm molecular hydrogen based on previous Spitzer IRS observations. The H2 is too powerful to be heated in PDR regions, and is most likely powered by turbulence and shocks. Such galaxies are found to fall in a region of the IR color-color space believed to show galaxies rapidly transitioning from the blue cloud to the red sequence, and so shocks may play a role in quenching star formation. We explore far-IR line luminosities and surface densities for extended diffuse [CII] emission and compare this to similar quanties in the CO emitting gas, and the far-IR continuum. Preliminary results suggest that high [CII]/FIR and [CII]/CO ratios are common in these systems, and in some cases correlate with peculiar velocities in the CO emitting gas. Star formation suppression may be seen in some of the systems with the highest warm H2/PAH ratios found by Spitzer, implying that turbulence may suppress star formation.

Chemical changes demonstrated in cartilage by synchrotron infrared microspectroscopy in an antibody-induced murine model of rheumatoid arthritis

NASA Astrophysics Data System (ADS)

Croxford, Allyson M.; Selva Nandakumar, Kutty; Holmdahl, Rikard; Tobin, Mark J.; McNaughton, Don; Rowley, Merrill J.

2011-06-01

Collagen antibody-induced arthritis develops in mice following passive transfer of monoclonal antibodies (mAbs) to type II collagen (CII) and is attributed to effects of proinflammatory immune complexes, but transferred mAbs may react directly and damagingly with CII. To determine whether such mAbs cause cartilage damage in vivo in the absence of inflammation, mice lacking complement factor 5 that do not develop joint inflammation were injected intravenously with two arthritogenic mAbs to CII, M2139 and CIIC1. Paws were collected at day 3, decalcified, paraffin embedded, and 5-μm sections were examined using standard histology and synchrotron Fourier-transform infrared microspectroscopy (FTIRM). None of the mice injected with mAb showed visual or histological evidence of inflammation but there were histological changes in the articular cartilage including loss of proteoglycan and altered chondrocyte morphology. Findings using FTIRM at high lateral resolution revealed loss of collagen and the appearance of a new peak at 1635 cm-1 at the surface of the cartilage interpreted as cellular activation. Thus, we demonstrate the utility of synchrotron FTIRM for examining chemical changes in diseased cartilage at the microscopic level and establish that arthritogenic mAbs to CII do cause cartilage damage in vivo in the absence of inflammation.

Blind Spectroscopic Galaxy Surveys Using an Ultra-Wide-Band Imaging Spectrograph on AtLAST and LST

NASA Astrophysics Data System (ADS)

Kohno, Kotaro

2018-01-01

A novel approach to elucidation of cosmic star formation history is a blind search for CO and [CII] emissions using a ultra-wide-band imaging spectrograph on the future large submm telescopes like AtLAST and LST. In particular, searching for [CII] emitters in the appropriate frequency range allows us to sample those sources very efficiently for a redshift range of 3.5 to 9 (190 to 420 GHz), reaching the star-formation in the EoR. Further, spectroscopic analysis of CO in the lower frequency bands will constrain the evolution of CO luminosity functions across cosmic time. We conducted a feasibility study of ``CO/[CII] tomography'' based on a mock galaxy catalog containing 1.4 million objects drawn from the S(3) -SAX (Obreschkow et al. 2009). We find that a blind spectroscopic survey using a 50-m telescope equipped with a 100-pixel imaging spectrograph, which covers 70-370 GHz simultaneously, will be promising indeed. A survey of 2 deg(2) in 1,000 hr (on-source) will uncover > 10^5 line-emitting galaxies in total, including 10^3 [CII] emitters in the EoR (Tamura et al., in prep.). Wider surveys (10 deg^2 or wider) will also be discussed for RSD science cases.

Experimental arthritis and uveitis in rats associated with Mycobacterium butyricum.

PubMed

Petty, R E; Hunt, D W; Mathers, D M; McCormick, A Q; Barker, H; Southwood, T R; Corson, L

1994-08-01

To determine if the anterior uveitis associated with adjuvant arthritis (AA) in the rat can be passively transferred with arthritis to syngeneic recipients using spleen cells or T cell lines prepared from animals given complete Freund's adjuvant (CFA) and Mycobacterium butyricum (M. butyricum) in incomplete Freund's adjuvant (IFA). Spleen cells from Lewis or Lewis SsN rats given IFA, CFA, type I collagen in IFA (CI-IFA), or type II collagen in IFA (CII-IFA) were administered to naive rats or rats treated with pertussis toxin or bacterial endotoxin. Three CD4+ T cell lines, propagated from CFA injected rats and maintained in vitro with M. butyricum (M-1), bovine proteoglycan (PR-1) or an extract of M. butyricum (MBE-1) were administered to naive or immunosuppressed rats. The arthritogenic and uveitogenic properties of these cell preparations and intradermal MBE-IFA, CII-IFA and intraperitoneal (ip) M. butyricum without adjuvant were evaluated. Uveitis was observed in 15/69 (22%) arthritic rats given CFA. Spleen cells prepared from CFA injected rats caused arthritis in 55 (82%) and uveitis in 2 (3%) of 67 cell recipients. Uveitis occurred in 2/6 cell recipients pretreated with bacterial endotoxin. Neither uveitis nor arthritis was observed in rats given IFA (0/6) or spleen cells prepared from rats given IFA (0/27), CI-IFA (0/6), or CII-IFA (0/28). CII-IFA produced polyarthritis in 5/6 rats, but no uveitis. CII-IFA induced arthritis associated uveitis in 1/15 animals receiving spleen cells from rats given CII-IFA, but not those given CI-IFA (0/3) or IFA (0/13). Uveitis was observed in one recipient of the M-1 T cell line and in 2 recipients of the PR-1 T cell line. Immunization with 400 micrograms of MBE-IFA induced uveitis but not arthritis in 3/11 animals. The MBE specific T cell line was neither arthritogenic nor uveitogenic. A high frequency (5/6) of uveitis accompanied arthritis in male Lewis rats given ip M. butyricum. Arthritis occurred in 4/10 female Lewis rats given ip M. butyricum and 2 arthritic animals also developed uveitis. Uveitis occurs infrequently in arthritic rats given spleen cells from CFA injected animals. The ip administration of M. butyricum constitutes a novel disease model in which the immunopathological relationships between arthritis and uveitis may be more reliably studied.

[CII] emission from NGC 4258 with SOFIA/FIFI-LS

NASA Astrophysics Data System (ADS)

Fadda, Dario; Appleton, Philip N.; Diaz Santos, Tanio; Togi, Aditya; Ogle, Patrick

2018-06-01

We present the [CII]157.7μm map of the NGC 4258 (M106) galaxy obtained with the FIFI-LS spectrometer onboard SOFIA.M106 contains an active nucleus classified as type 1.9 Seyfert with a warped inner rotating disk of water-vapor masers which allowed for the first high accuracy measurements of the mass of a supermassive black hole in any galaxy. A relativistic jet is thought to be responsible for anomalous radio-continuum spiral arms, which appear several kpc from the center, and extend outwards through the outer disk. These arms do not correlate with the galaxy's underlying stellar spiral structure, and their presence suggest that in the past, the jet has strongly interacted with the galaxy's outer disk , exciting synchrotron radiation. Since that time, a new burst of activity seems to have occurred, creating a compact jet at the core of the galaxy, and two radio hotspots further out associated with optical "bow-shocks". The position angle of this new "active" jet is different from that needed to excited the outer radio arms, presumably because the jet has precessed, perhaps as a result of precession of the axis of the inner warped accretion disk.Our observations reveal three main sources of [CII] emission: two associated with large regions of gas at the ends of the active jet, and a third minor axis filament associated with linear clumps of star formation and dust seen in HST images offset from the nucleus. We combine the SOFIA observations with previous Spitzer mid-IR, Chandra X-ray and VLA radio observations to explore the nature of the detected [CII] emission. In regions along the northern active jet, we see a significant deficiency in the [CII]/FIR ratio, and higher ratios near the ends of the jet. This implies that the jet has changed the conditions of the gas along its length. In several places near the jet, the [CII] emission shows very broad lines, suggestive of enhanced turbulence. Additionally, the minor-axis filament we discovered may represent gas in-falling towards the nucleus perpendicular to the jet. The results provide clues about how radio jets in active galaxies can influence the star formation properties of their host galaxies.

STARFIRE: The Spectroscopic Terahertz Airborne Receiver for Far-InfraRed Exploration

NASA Astrophysics Data System (ADS)

Aguirre, James; STARFIRE Collaboration

2018-01-01

Understanding the formation and evolution of galaxies is one of the foremost goals of astrophysics and cosmology today. The cosmic star formation rate has undergone a dramatic evolution over the course of the last seven billion years, with a peak in cosmic star formation near z ~ 1, largely in dust-obscured star forming galaxies (DSFGs), followed by a dramatic fall in both the star formation rate and the fraction of star formation occurring in DSFGs. A variety of unextincted diagnostic lines are present in the far-infrared (FIR) which can provide insight into the conditions of star formation in DSFGs. Spectroscopy in the far-infrared is thus scientifically crucial for understanding galaxy evolution, yet remains technically difficult, particularly for wavelengths shorter than those accessible to ALMA.STARFIRE (the Spectroscopic Terahertz Airborne Receiver for Far-InfraRed Exploration) is a proposed integral-field spectrometer using kinetic inductance detectors, operating from 240 - 420 μm and coupled to a 2.5 meter low-emissivity carbon-fiber balloon-borne telescope. Using dispersive spectroscopy and the stratospheric platform, STARFIRE can achieve better performance than SOFIA or Herschel-SPIRE FTS. STARFIRE is designed to study the ISM of galaxies from 0.5 < z < 1.5, primarily in the [CII](158 μm) line, and also in cross-correlation with [NII] (122 μm). This offers a view of the star-forming medium with minimal impact from dust extinction through the period of peak cosmic star formation and into the current epoch where the star formation rate begins to decline. STARFIRE will be capable of making a high significance detection of the [CII] power spectrum in at least 4 redshift bins and measuring the [CII] x [NII] power spectrum at z ~ 1. The intensity mapped power spectra will be sensitive to one- and two-halo clustering, as well as shot noise, and will relate the mean [CII] intensity as a function of redshift (a proxy for star formation rate density) to the large scale structure. In addition, STARFIRE will detect at least 50 galaxies directly in the [CII] line, and will also be able to stack on optical galaxies to below the SPIRE confusion limit to measure the [CII] luminosity of more typical galaxies.

Validation of DSMC results for chemically nonequilibrium air flows against measurements of the electron number density in RAM-C II flight experiment

DOE Office of Scientific and Technical Information (OSTI.GOV)

Shevyrin, Alexander A.; Vashchenkov, Pavel V.; Bondar, Yevgeniy A.

An ionized flow around the RAM C-II vehicle in the range of altitudes from 73 to 81 km is studied by the Direct Simulation Monte Carlo (DSMC) method with three models of chemical reactions. It is demonstrated that vibration favoring in reactions of dissociation of neutral molecules affects significantly the predicted values of plasma density in the shock layer, and good agreement between the results of experiments and DSMC computations can be achieved in terms of the plasma density as a function of the flight altitude.

In situ analysis of lung antigen-presenting cells during murine pulmonary infection with virulent Mycobacterium tuberculosis

PubMed Central

Pedroza-González, Alexander; García-Romo, Gina S; Aguilar-León, Diana; Calderon-Amador, Juana; Hurtado-Ortiz, Raquel; Orozco-Estevez, Hector; Lambrecht, Bart N; Estrada-García, Iris; Hernández-Pando, Rogelio; Flores-Romo, Leopoldo

2004-01-01

Scarce information exists about the role of lung antigen-presenting cells (APCs) in vivo during pulmonary tuberculosis. As APCs activate cellular immunity, following intratracheal inoculation with virulent Mycobacterium tuberculosis, we assessed in situ lung APC recruitment, distribution, granuloma involvement, morphology and mycobacterial burden by using MHC-CII, CD14, scavenger receptor class A (SRA), the murine dendritic cell (DC)-restricted marker CD11c and Ziehl–Neelsen staining. CD11c+ DC and CD14+ cell recruitment into lungs appeared by day 14, continuing until day 60. MHC-CII+ cells increased since day 7, persisting until day 60. Thus, virulent mycobacteria delays (14–21 days) lung APC recruitment compared to model antigens and nonvirulent bacilli (24–48 h). Regarding granuloma constitution, highly bacillary CD14+ and SRA+ cells were centrally located. MHC-CII+ cells were more peripheral, with less mycobacteria. CD11c+ cells were heterogeneously distributed within granulomas, with scarce bacilli. When labelling lung suspensions for MHC-CII and classifying cells as macrophages or DC, then staining for Ziehl–Neelsen, a remarkable segregation was found regarding bacillary burden. Most macrophage-like cells contained numerous bacilli, while DC had no or scarce mycobacteria. This implies differential APC contributions in situ during pulmonary tuberculosis regarding mycobacterial uptake, granuloma involvement and perhaps bacillary growth. PMID:15255967

Lipoprotein lipase activity and mass, apolipoprotein C-II mass and polymorphisms of apolipoproteins E and A5 in subjects with prior acute hypertriglyceridaemic pancreatitis

PubMed Central

2009-01-01

Background Severe hypertriglyceridaemia due to chylomicronemia may trigger an acute pancreatitis. However, the basic underlying mechanism is usually not well understood. We decided to analyze some proteins involved in the catabolism of triglyceride-rich lipoproteins in patients with severe hypertriglyceridaemia. Methods Twenty-four survivors of acute hypertriglyceridaemic pancreatitis (cases) and 31 patients with severe hypertriglyceridaemia (controls) were included. Clinical and anthropometrical data, chylomicronaemia, lipoprotein profile, postheparin lipoprotein lipase mass and activity, hepatic lipase activity, apolipoprotein C II and CIII mass, apo E and A5 polymorphisms were assessed. Results Only five cases were found to have LPL mass and activity deficiency, all of them thin and having the first episode in childhood. No cases had apolipoprotein CII deficiency. No significant differences were found between the non-deficient LPL cases and the controls in terms of obesity, diabetes, alcohol consumption, drug therapy, gender distribution, evidence of fasting chylomicronaemia, lipid levels, LPL activity and mass, hepatic lipase activity, CII and CIII mass or apo E polymorphisms. However, the SNP S19W of apo A5 tended to be more prevalent in cases than controls (40% vs. 23%, NS). Conclusion Primary defects in LPL and C-II are rare in survivors of acute hypertriglyceridaemic pancreatitis; lipase activity measurements should be restricted to those having their first episode during chilhood. PMID:19534808

Isolation, molecular properties, and kinetic characterization of lipoprotein lipase from rat heart

DOE Office of Scientific and Technical Information (OSTI.GOV)

Chung, J.; Scanu, A.M.

1977-06-25

Lipoprotein lipase was isolated to electrophoretic and chromatographic purity from rat heart acetone/ether powder by a combination of n-butyl alcohol precipitation and heparin/sepharose affinity column chromatography. By sedimentation equilibrium ultracentrifugation in 6 M guanidine hydrochloride, and by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, the enzyme was found to have a minimum molecular weight of about 34,000. It had a relative abundance of glutamic acid and contains 3.3 percent carbohydrate by weight. The composition was as follows, in moles per 34,000 g: mannose (neutral sugars), 5.1; sialic acid, 0.8; and glucosamine, 2.3. When tested against a triolein emulsion, the enzyme was activemore » only in the presence of apolipoprotein glutamic acid (apo C-II); it was inactivated by 1 M NaCl and by apolipoproteins serine and alanine isolated from human serum very low density lipoprotein. In order to define the kinetics of hydrolysis of triglyceride by lipoprotein lipase, we carried out studies on monomolecular films of glyceryl tri(1-/sup 14/C)octanoate. In the presence of excess apo C-II, the hydrolysis followed first order time course and yielded a second order rate constant of 1.85 x 10/sup 5/ M/sup -1/ S/sup -1/. The apparent first order rate constants, k/sub exp/, were proportional to enzyme concentrations over at least a 5-fold range. When enzyme concentrations of 0.22, 0.35, and 0.66 ..mu..g/ml were used, the rate of hydrolysis increased as a function of apo C-II concentration and reached a maximum at a concentration of apo C-II corresponding to a molar ratio of enzyme to apo C-II of about 1 : 1, respectively, which suggests the formation of a stoichiometric complex. The availability of a pure enzyme and the knowledge of its kinetics should stimulate further studies on the molecular basis of enzyme action.« less

Myocardial Infarction Injury in Patients with Chronic Lung Disease Entering Pulmonary Rehabilitation: Frequency and Association with Heart Rate Parameters.

PubMed

Sima, Carmen A; Lau, Benny C; Taylor, Carolyn M; van Eeden, Stephan F; Reid, W Darlene; Sheel, Andrew W; Kirkham, Ashley R; Camp, Pat G

2018-03-14

Myocardial infarction (MI) remains under-recognized in chronic lung disease (CLD) patients. Rehabilitation health professionals need accessible clinical measurements to identify the presence of prior MI in order to determine appropriate training prescription. To estimate prior MI in CLD patients entering a pulmonary rehabilitation program, as well as its association with heart rate parameters such as resting heart rate and chronotropic response index. Retrospective cohort design. Pulmonary rehabilitation outpatient clinic in a tertiary care university-affiliated hospital. Eighty-five CLD patients were studied. Electrocardiograms at rest and peak cardiopulmonary exercise testing, performed before pulmonary rehabilitation, were analyzed. Electrocardiographic evidence of prior MI, quantified by the Cardiac Infarction Injury Score (CIIS), was contrasted with reported myocardial events and then correlated with resting heart rate and chronotropic response index parameters. CIIS, resting heart rate, and chronotropic response index. Sixteen CLD patients (19%) demonstrated electrocardiographic evidence of prior MI, but less than half (8%) had a reported MI history (P < .05). The Cohen's kappa test revealed poor level of agreement between CIIS and medical records (kappa = 0.165), indicating that prior MI diagnosis was under-reported in the medical records. Simple and multiple regression analyses showed that resting heart rate but not chronotropic response index was positively associated with CIIS in our population (R 2 = 0.29, P < .001). CLD patients with a resting heart rate higher than 80 beats/min had approximately 5 times higher odds of having prior MI, as evidenced by a CIIS ≥20. CLD patients entering pulmonary rehabilitation are at risk of unreported prior MI. Elevated resting heart rate seems to be an indicator of prior MI in CLD patients; therefore, careful adjustment of training intensity such as intermittent training is recommended under these circumstances. III. Copyright © 2018 American Academy of Physical Medicine and Rehabilitation. Published by Elsevier Inc. All rights reserved.

Neon and [CII] 158 μm Emission Line Profiles in Dusty Starbursts and Active Galactic Nuclei

NASA Astrophysics Data System (ADS)

Samsonyan, A.; Weedman, D.; Lebouteiller, V.; Barry, D.; Sargsyan, L.

2017-07-01

Identifying and understanding the initial formation of massive galaxies and quasars in the early universe is a fundamental goal of observational cosmology. A rapidly developing capability for tracing luminosity sources to high redshifts is the observation of the [CII] 158 μm emission line at redshifts z > 4 using ground based submillimeter interferometers, with detections now having been made to z = 7. This has long been known as the strongest far-infrared line in most sources, often carrying about 1% of the total source luminosity, and is thought to be associated with star formation because it should arise within the photodissociation region (PDR) surrounding starbursts. The sample of 382 extragalactic sources has been analysed that have mid-infrared,high resolution spectroscopy with the Spitzer Infrared Spectrograph (IRS) and also spectroscopy of the [CII] 158 μm line with the Herschel Photodetector Array Camera and Spectrometer (PACS). The emission line profiles of [NeII] 12.81μm , [NeIII] 15.55 μm , and [CII] 158 μm are studied, and intrinsic line widths are determined. All line profiles together with overlays comparing positions of PACS and IRS observations are made available in the Cornell Atlas of Spitzer IRS Sources (CASSIS). Sources are classified from AGN to starburst based on equivalent widths of the 6.2 μm polycyclic aromatic hydrocarbon feature. It is found that intrinsic line widths do not change among classification for [CII], with median widths of 207 km s-1 for AGN, 248 km s-1 for composites, and 233 km s-1 for starbursts. The [NeII] line widths also do not change with classification, but [NeIII] lines are progressively broader from starburst to AGN. A small number of objects with unusually broad lines or unusual redshift differences in any feature are identified.

Escherichia coli heat-labile enterotoxin B subunit prevents autoimmune arthritis through induction of regulatory CD4+ T cells.

PubMed

Luross, Jeffrey A; Heaton, Tricia; Hirst, Timothy R; Day, Michael J; Williams, Neil A

2002-06-01

The receptor-binding B subunit of Escherichia coli heat-labile enterotoxin (EtxB) is a highly stable, nontoxic protein that is capable of modulating immune responses. This study was conducted to determine whether mucosal administration of EtxB can block collagen-induced arthritis (CIA) and to investigate the mechanisms involved. Clinical arthritis in DBA/1 mice was monitored following mucosal administration of EtxB on 4 occasions. The dependence of disease prevention on receptor binding by EtxB and the associated alterations to the immune response to type II collagen (CII) were assessed. Adoptive transfer experiments and lymph node cell cocultures were used to investigate the underlying mechanisms. Both intranasal and intragastric delivery of EtxB were effective in preventing CIA; a 1-microg dose of EtxB was protective after intranasal administration. A non-receptor-binding mutant of EtxB failed to prevent disease. Intranasal EtxB lowered both the incidence and severity of arthritis when given either at the time of disease induction or 25 days later. EtxB markedly reduced levels of anti-CII IgG2a antibodies and interferon-gamma (IFNgamma) production while not affecting levels of IgG1, interleukin-4 (IL-4), or IL-10. Disease protection could be transferred by CD4+ T cells from treated mice, an effect that was abrogated upon depletion of the CD25+ population. In addition, CD4+CD25+ T cells from treated mice were able to suppress anti-CII IFNgamma production by CII-primed lymph node cells. Mucosal administration of EtxB can be used to prevent or treat CIA. Modulation of the anti-CII immune response by EtxB is associated with a reduction in Th1 cell reactivity without a concomitant shift toward Th2. Instead, EtxB mediates its effects through enhancing the activity of a population of CD4+ regulatory T cells.

The apolipoprotein E/CI/CII gene cluster and late-onset Alzheimer disease

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yu, Chang-En; Nemens, E.; Olson, J.M.

1994-04-01

The chromosome 19 apolipoprotein E/CI/CII gene cluster was examined for evidence of linkage to a familial Alzheimer disease (FAD) locus. The family groups studied were Volga German (VG), early-onset non-VG (ENVG; mean age at onset <60 years), and late-onset families. A genetic association was observed between apolipoprotein E (ApoE) allele E4 and FAD in late-onset families; the E4 allele frequency was .51 in affected subjects, .37 in at-risk subjects, .11 in spouses, and .19 in unrelated controls. The differences between the E4 frequencies in affected subjects versus controls and in at-risk subjects versus controls were highly significant. No association betweenmore » the E4 allele and FAD was observed in the ENVG or VG groups. A statistically significant allelic association between E4 and AD was also observed in a group of unrelated subjects; the E4 frequency was .26 in affected subjects, versus .19 in controls (Z[sub SND] = 2.20, P < .03). Evidence of linkage of ApoE and ApoCII to FAD was examined by maximum-likelihood methods, using three models and assuming autosomal dominant inheritance: (1) age-dependent penetrance, (2) extremely low (1%) penetrance, and (3) age-dependent penetrance corrected for sporadic Alzheimer disease (AD). For ApoCII in late-onset families, results for close linkage were negative, and only small positive lod-score-statistic (Z) values were obtained. For ApoE in late-onset kindreds, positive Z values were obtained when either allele frequencies from controls or allele frequencies from the families were used. When linkage disequilibrium was incorporated into the analysis, the Z values increased. For the ENVG group, results for ApoE and ApoCII were uniformly negative. Affected-pedigree-member analysis gave significant results for the late-onset kindreds, for ApoE, when control allele frequencies were used but not when allele frequencies were derived from the families. 58 refs., 6 tabs.« less

3D-DIVIMP(HC) code modeling of DIII-D DiMES porous plug injector experiments

NASA Astrophysics Data System (ADS)

Mu, Y.; Elder, J. D.; Stangeby, P. C.; McLean, A. G.

2011-08-01

A Porous Plug Injector (PPI) system for the Divertor Material Evaluation System (DiMES) on DIII-D has been employed for in situ study of chemical erosion in the tokamak divertor environment. The 3D-DIVIMP(HC) code has been applied to the interpretation of the CI, CII and other spectroscopic measurements made at the PPI location, for (a) the synthetic source due to injection of CH4 through the PPI, and (b) the natural emission from the PPI head itself, which was inserted above surrounding graphite tiles by ˜0.3 mm.The code successfully replicated the MDS (spectrometer)-measured absolute emissions of CH, CI, CII 427 nm, 514 nm, and 658 nm [1] and the DiMES TV-measured spatial shapes of the CH, CI, and CII 514 nm [1] emission "clouds" to within the combined uncertainties. It is thus concluded that the most important physics and chemistry of chemical sputtering have most likely been included in the model.

Mitochondrial complex II is a source of the reserve respiratory capacity that is regulated by metabolic sensors and promotes cell survival.

PubMed

Pfleger, J; He, M; Abdellatif, M

2015-07-30

The survival of a cell depends on its ability to meet its energy requirements. We hypothesized that the mitochondrial reserve respiratory capacity (RRC) of a cell is a critical component of its bioenergetics that can be utilized during an increase in energy demand, thereby, enhancing viability. Our goal was to identify the elements that regulate and contribute to the development of RRC and its involvement in cell survival. The results show that activation of metabolic sensors, including pyruvate dehydrogenase and AMP-dependent kinase, increases cardiac myocyte RRC via a Sirt3-dependent mechanism. Notably, we identified mitochondrial complex II (cII) as a target of these metabolic sensors and the main source of RRC. Moreover, we show that RRC, via cII, correlates with enhanced cell survival after hypoxia. Thus, for the first time, we show that metabolic sensors via Sirt3 maximize the cellular RRC through activating cII, which enhances cell survival after hypoxia.

Teaching and learning in the operating room is a two-way street: resident perceptions.

PubMed

Vikis, Elena A; Mihalynuk, Tanis V; Pratt, Dan D; Sidhu, Ravi S

2008-05-01

The transformation of a trainee into a surgeon is influenced strongly by communication patterns in the operating room (OR). In the current era of limited educational opportunities, elucidation of teaching and learning strategies in this environment is critical. The aim of this study was to further understand the elements of an effective communicative instructional interaction (CII) as perceived by surgical residents. Qualitative research methodology was used to explore University of British Columbia surgery residents' perceptions of what constitutes an effective CII in the OR. Purposeful sampling was used to select participants from various years of training. Eighteen residents participated in semistructured interviews to facilitate reflection of their OR experiences. Interviews were transcribed, analyzed, and fed back to residents to confirm their accuracy. Independent coding and analysis led to the development of key emergent themes. Themes represented the interplay of ideals expressed by the residents. The primary emergent theme was that both teacher and learner play a major role in the creation of an effective CII. The ideal teacher had an instructional plan, facilitated surgical independence, and showed support and empathy for the surgical resident. The ideal resident was receptive, prepared, and acknowledged limitations. The contextual constraints of the OR played a central role in learning, and residents identified ways to maintain educational value despite primarily nonmodifiable contextual elements (ie, time constraints). In a unique environment such as the OR, both teacher and learner may benefit by an enhanced understanding of the elements of an effective CII.

Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism

DOE Office of Scientific and Technical Information (OSTI.GOV)

Egli, Martin; Mori, Tetsuya; Pattanayek, Rekha

The circadian clock of the cyanobacterium Synechococcus elongatus can be reconstituted in vitro from three proteins, KaiA, KaiB, and KaiC in the presence of ATP, to tick in a temperature-compensated manner. KaiC, the central cog of this oscillator, forms a homohexamer with 12 ATP molecules bound between its N- and C-terminal domains and exhibits unusual properties. Both the N-terminal (CI) and C-terminal (CII) domains harbor ATPase activity, and the subunit interfaces between CII domains are the sites of autokinase and autophosphatase activities. Hydrolysis of ATP correlates with phosphorylation at threonine and serine sites across subunits in an orchestrated manner, suchmore » that first T432 and then S431 are phosphorylated, followed by dephosphorylation of these residues in the same order. Although structural work has provided insight into the mechanisms of ATPase and kinase, the location and mechanism of the phosphatase have remained enigmatic. From the available experimental data based on a range of approaches, including KaiC crystal structures and small-angle X-ray scattering models, metal ion dependence, site-directed mutagenesis (i.e., E318, the general base), and measurements of the associated clock periods, phosphorylation patterns, and dephosphorylation courses as well as a lack of sequence motifs in KaiC that are typically associated with known phosphatases, we hypothesized that KaiCII makes use of the same active site for phosphorylation and dephosphorlyation. We observed that wild-type KaiC (wt-KaiC) exhibits an ATP synthase activity that is significantly reduced in the T432A/S431A mutant. We interpret the first observation as evidence that KaiCII is a phosphotransferase instead of a phosphatase and the second that the enzyme is capable of generating ATP, both from ADP and P{sub i} (in a reversal of the ATPase reaction) and from ADP and P-T432/P-S431 (dephosphorylation). This new concept regarding the mechanism of dephosphorylation is also supported by the strikingly similar makeups of the active sites at the interfaces between {alpha}/{beta} heterodimers of F1-ATPase and between monomeric subunits in the KaiCII hexamer. Several KaiCII residues play a critical role in the relative activities of kinase and ATP synthase, among them R385, which stabilizes the compact form and helps kinase action reach a plateau, and T426, a short-lived phosphorylation site that promotes and affects the order of dephosphorylation.« less

Mutation Analysis in Cultured Cells of Transgenic Rodents

PubMed Central

Zheng, Albert; Bates, Steven E.; Tommasi, Stella

2018-01-01

To comply with guiding principles for the ethical use of animals for experimental research, the field of mutation research has witnessed a shift of interest from large-scale in vivo animal experiments to small-sized in vitro studies. Mutation assays in cultured cells of transgenic rodents constitute, in many ways, viable alternatives to in vivo mutagenicity experiments in the corresponding animals. A variety of transgenic rodent cell culture models and mutation detection systems have been developed for mutagenicity testing of carcinogens. Of these, transgenic Big Blue® (Stratagene Corp., La Jolla, CA, USA, acquired by Agilent Technologies Inc., Santa Clara, CA, USA, BioReliance/Sigma-Aldrich Corp., Darmstadt, Germany) mouse embryonic fibroblasts and the λ Select cII Mutation Detection System have been used by many research groups to investigate the mutagenic effects of a wide range of chemical and/or physical carcinogens. Here, we review techniques and principles involved in preparation and culturing of Big Blue® mouse embryonic fibroblasts, treatment in vitro with chemical/physical agent(s) of interest, determination of the cII mutant frequency by the λ Select cII assay and establishment of the mutation spectrum by DNA sequencing. We describe various approaches for data analysis and interpretation of the results. Furthermore, we highlight representative studies in which the Big Blue® mouse cell culture model and the λ Select cII assay have been used for mutagenicity testing of diverse carcinogens. We delineate the advantages of this approach and discuss its limitations, while underscoring auxiliary methods, where applicable. PMID:29337872

The role of lipopolysaccharide injected systemically in the reactivation of collagen-induced arthritis in mice

PubMed Central

Yoshino, Shin; Ohsawa, Motoyasu

2000-01-01

We investigated the role of bacterial lipopolysaccharide (LPS) in the reactivation of autoimmune disease by using collagen-induced arthritis (CIA) in mice in which autoimmunity to the joint cartilage component type II collagen (CII) was involved.CIA was induced by immunization with CII emulsified with complete Freund's adjuvant at the base of the tail (day 0) followed by a booster injection on day 21. Varying doses of LPS from E. coli were i.p. injected on day 50.Arthritis began to develop on day 25 after immunization with CII and reached a peak on day 35. Thereafter, arthritis subsided gradually but moderate joint inflammation was still observed on day 50. An i.p. injection of LPS on day 50 markedly reactivated arthritis on a dose-related fashion. Histologically, on day 55, there were marked oedema of synovium which had proliferated by the day of LPS injection, new formation of fibrin, and intense infiltration of neutrophils accompanied with a large number of mononuclear cells. The reactivation of CIA by LPS was associated with increases in anti-CII IgG and IgG2a antibodies as well as various cytokines including IL-12, IFN-γ, IL-1β, and TNF-α. LPS from S. enteritidis, S. typhimurium, and K. neumoniae and its component, lipid A from E. coli also reactivated the disease. Polymyxin B sulphate suppressed LPS- or lipid A-induced reactivation of CIA.These results suggest that LPS may play an important role in the reactivation of autoimmune joint inflammatory diseases such as rheumatoid arthritis in humans. PMID:10742285

Prophylactic Injection of Recombinant Alpha-Enolase Reduces Arthritis Severity in the Collagen-Induced Arthritis Mice Model

PubMed Central

Guillou, Clément; Derambure, Céline; Fréret, Manuel; Verdet, Mathieu; Avenel, Gilles; Golinski, Marie-Laure; Sabourin, Jean-Christophe; Loarer, François Le; Adriouch, Sahil; Boyer, Olivier; Lequerré, Thierry; Vittecoq, Olivier

2015-01-01

Objective To evaluate the ability of the glycolytic enzyme alpha-enolase (ENO1) or its immunodominant peptide (pEP1) to reduce the severity of CIA in DBA/1 mice when injected in a prophylactic way. Methods Mice were treated with mouse ENO1 or pEP1 one day prior to collagen II immunization. Clinical assessment was evaluated using 4 parameters (global and articular scores, ankle thickness and weight). Titers of serum anti-ENO1, anti-cyclic citrullinated peptides (anti-CCP) and anti-CII (total IgG and IgG1/IgG2a isotypes) antibodies were measured by ELISA at different time-points. Disease activity was assessed by histological analysis of both anterior and hind paws at the end of experimentation. Results Prophylactic injection of 100 μg of ENO1 reduced severity of CIA. Serum levels of anti-CII antibodies were reduced in ENO1-treated mice. Concordantly, ENO1-treated mice joints presented less severe histological signs of arthritis. ENO1 did not induce a shift toward a Th2 response since IgG1/IgG2a ratio of anti-CII antibodies remained unchanged and IL-4 serum levels were similar to those measured in the control group. Conclusions Pre-immunization with ENO1 or its immunodominant peptide pEP1 reduces CIA severity at the clinical, immunological and histological levels. Effects of pEP1 were less pronounced. This immunomodulatory effect is associated with a reduction in anti-CII antibodies production but is not due to a Th1/Th2 shift. PMID:26302382

Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

PubMed

Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

2009-02-01

Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

OT1_mputman_1: ASCII: All Sky observations of Galactic CII

NASA Astrophysics Data System (ADS)

Putman, M.

2010-07-01

The Milky Way and other galaxies require a significant source of ongoing star formation fuel to explain their star formation histories. A new ubiquitous population of discrete, cold clouds have recently been discovered at the disk-halo interface of our Galaxy that could potentially provide this source of fuel. We propose to observe a small sample of these disk-halo clouds with HIFI to determine if the level of [CII] emission detected suggests they represent the cooling of warm clouds at the interface between the star forming disk and halo. These cooling clouds are predicted by simulations of warm clouds moving into the disk-halo interface region. We target 5 clouds in this proposal for which we have high resolution HI maps and can observe the densest core of the cloud. The results of our observations will also be used to interpret the surprisingly high detections of [CII] for low HI column density clouds in the Galactic Plane by the GOT C+ Key Program by extending the clouds probed to high latitude environments.

Resistance to collagen-induced arthritis in SHPS-1 mutant mice

DOE Office of Scientific and Technical Information (OSTI.GOV)

Okuzawa, Chie; Kaneko, Yoriaki; Murata, Yoji

SHPS-1 is a transmembrane protein that binds the protein tyrosine phosphatases SHP-1 and SHP-2 through its cytoplasmic region and is abundantly expressed on dendritic cells and macrophages. Here we show that mice expressing a mutant form of SHPS-1 fail to develop type-II collagen (CII)-induced arthritis (CIA), a model for rheumatoid arthritis in humans. Histological examinations of the arthritic paws from immunized wild-type mice revealed that cartilage was destroyed in association with marked mononuclear cell infiltration, while only mild cell infiltration was observed in immunized SHPS-1 mutant mice. Consistently, the serum levels of both IgG and IgG2a specific to CII andmore » of IL-1{beta} in immunized SHPS-1 mutant mice were markedly reduced compared with those apparent for wild-type mice. The CII-induced proliferation of, and production of cytokines by, T cells from immunized SHPS-1 mutant mice were reduced compared to wild-type cells. These results suggest that SHPS-1 is essential for development of CIA.« less

Understanding Emission From The Ism In The Milky Way And Other Galaxies Using [Nii] And Other Tracers

NASA Astrophysics Data System (ADS)

Goldsmith, Paul

We propose to combine recently-obtained data on the far-infrared fine structure lines of ionized nitrogen ([NII]) with studies of radio continuum and other far-infrared lines, to address a number of key questions about the structure of the interstellar medium, star formation, and to bootstrap our detailed understanding of processes in the Milky Way to more distant galaxies. The [CII] 158 μm line is the most powerful single far-infrared line emitted by galaxies, but since carbon can be ionized by photons having wavelengths longer than required to ionized hydrogen, [CII] emission can originate in atomic, molecular, and ionized regions. Due to its ionization potential being higher than that of hydrogen, nitrogen is a more selective tracer than carbon, and can serve as a critical ingredient to determine how much of the [CII] emission is produced in HII regions powered by massive young stars. We propose to take advantage of a newly-completed Herschel survey of the Galactic plane in both of the [NII] lines at 205 μm and 122 μm wavelength, complementing the GOT C+ survey of [CII]. The relative intensity of the two [NII] lines is a direct indicator of the electron density, and thus allows determination of the N+ column density. With the two data sets we can then determine what fraction of the [CII] emission is produced in HII regions, and what may be from the more diffuse components, thus enabling reconciliation of the Herschel and COBE measurements of this critical tracer. We also propose to use Planck and WMAP all-sky maps of the radio free-free emission to determine the emission measure. Comparison with the electron density and ionized nitrogen column density enables a novel probe of clumpiness in this component of the interstellar medium in addition to giving an improved method of determining the overall Galactic electron density distribution. A second aspect of our investigation of clumpiness will be to utilize the fact that each [NII] observation with the PACS instrument on Herschel consists of 25 spectra on a 5x5 grid. Using these, we will compare derived column densities and electron densities over these small regions to assess the degree of clumpiness. A third input to our analysis of inhomogeneities will be to compare the Planck & WMAP images of selected regions with much higher resolution ground-based data from survey such as CORNISH and GALFACTS. We also will use the improved understanding of [CII] and [NII] emission to develop a template for use in interpreting emission of these (and possibly other) tracers from other galaxies. We will be able to calculate the relative luminosities of these two tracers as a function of Galactocentric distance in the Milky Way, which will be available for comparison with existing and future data on other galaxies. This very active field suffers from an inability to distinguish the multiple sources of [CII] emission, and the understanding of how this spectral line works as a tracer of star formation is of very great interest to a large community of extragalactic astronomers. Together these studies will significantly improve our understanding of [CII] emission and its role as a coolant of the ISM, and the role of HII regions produced by massive young stars as sources of far-infrared line emission. In addition to a better appreciation of the life cycle of the interstellar medium, this work will also set the stage for better understanding of far-infrared emission from other galaxies though development of an improved Milky Way template. All of the data have been taken and are available including our own Herschel [NII] data, which have been reduced. As indicated in the proposal, we have made a limited demonstration of the required techniques, so that we are confident that this proposal will yield the desired new information and astrophysical results.

The TIME-Pilot intensity mapping experiment

NASA Astrophysics Data System (ADS)

Crites, A. T.; Bock, J. J.; Bradford, C. M.; Chang, T. C.; Cooray, A. R.; Duband, L.; Gong, Y.; Hailey-Dunsheath, S.; Hunacek, J.; Koch, P. M.; Li, C. T.; O'Brient, R. C.; Prouve, T.; Shirokoff, E.; Silva, M. B.; Staniszewski, Z.; Uzgil, B.; Zemcov, M.

2014-08-01

TIME-Pilot is designed to make measurements from the Epoch of Reionization (EoR), when the first stars and galaxies formed and ionized the intergalactic medium. This will be done via measurements of the redshifted 157.7 um line of singly ionized carbon ([CII]). In particular, TIME-Pilot will produce the first detection of [CII] clustering fluctuations, a signal proportional to the integrated [CII] intensity, summed over all EoR galaxies. TIME-Pilot is thus sensitive to the emission from dwarf galaxies, thought to be responsible for the balance of ionizing UV photons, that will be difficult to detect individually with JWST and ALMA. A detection of [CII] clustering fluctuations would validate current theoretical estimates of the [CII] line as a new cosmological observable, opening the door for a new generation of instruments with advanced technology spectroscopic array focal planes that will map [CII] fluctuations to probe the EoR history of star formation, bubble size, and ionization state. Additionally, TIME-Pilot will produce high signal-to-noise measurements of CO clustering fluctuations, which trace the role of molecular gas in star-forming galaxies at redshifts 0 < z < 2. With its unique atmospheric noise mitigation, TIME-Pilot also significantly improves sensitivity for measuring the kinetic Sunyaev-Zel'dovich (kSZ) effect in galaxy clusters. TIME-Pilot will employ a linear array of spectrometers, each consisting of a parallel-plate diffraction grating. The spectrometer bandwidth covers 185-323 GHz to both probe the entire redshift range of interest and to include channels at the edges of the band for atmospheric noise mitigation. We illuminate the telescope with f/3 horns, which balances the desire to both couple to the sky with the best efficiency per beam, and to pack a large number of horns into the fixed field of view. Feedhorns couple radiation to the waveguide spectrometer gratings. Each spectrometer grating has 190 facets and provides resolving power above 100. At this resolution, the longest dimension of the grating is 31 cm, which allows us to stack gratings in two blocks (one for each polarization) of 16 within a single cryostat, providing a 1x16 array of beams in a 14 arcminute field of view. Direct absorber TES sensors sit at the output of the grating on six linear facets over the output arc, allowing us to package and read out the detectors as arrays in a modular manner. The 1840 detectors will be read out with the NIST time-domain-multiplexing (TDM) scheme and cooled to a base temperature of 250 mK with a 3He sorption refrigerator. We present preliminary designs for the TIME-Pilot cryogenics, spectrometers, bolometers, and optics.

A new macroseismic intensity prediction equation and magnitude estimates of the 1811-1812 New Madrid and 1886 Charleston, South Carolina, earthquakes

NASA Astrophysics Data System (ADS)

Boyd, O. S.; Cramer, C. H.

2013-12-01

We develop an intensity prediction equation (IPE) for the Central and Eastern United States, explore differences between modified Mercalli intensities (MMI) and community internet intensities (CII) and the propensity for reporting, and estimate the moment magnitudes of the 1811-1812 New Madrid, MO, and 1886 Charleston, SC, earthquakes. We constrain the study with North American census data, the National Oceanic and Atmospheric Administration MMI dataset (responses between 1924 and 1985), and the USGS ';Did You Feel It?' CII dataset (responses between June, 2000 and August, 2012). The combined intensity dataset has more than 500,000 felt reports for 517 earthquakes with magnitudes between 2.5 and 7.2. The IPE has the basic form, MMI=c1+c2M+c3exp(λ)+c4λ. where M is moment magnitude and λ is mean log hypocentral distance. Previous IPEs use a limited dataset of MMI, do not differentiate between MMI and CII data in the CEUS, nor account for spatial variations in population. These factors can have an impact at all magnitudes, especially the last factor at large magnitudes and small intensities where the population drops to zero in the Atlantic Ocean and Gulf of Mexico. We assume that the number of reports of a given intensity have hypocentral distances that are log-normally distributed, the distribution of which is modulated by population and the propensity for individuals to report their experience. We do not account for variations in stress drop, regional variations in Q, or distance-dependent geometrical spreading. We simulate the distribution of reports of a given intensity accounting for population and use a grid search method to solve for the fraction of population to report the intensity, the standard deviation of the log-normal distribution and the mean log hypocentral distance, which appears in the above equation. We find that lower intensities, both CII and MMI, are less likely to be reported than greater intensities. Further, there are strong spatial variations in the level of CII reporting. For example, large metropolitan areas appear to have a lower level of reporting relative to rural areas. In general, we find that intensities decrease with increasing distance and decreasing magnitude, as expected. Coefficients for the IPE are c1=1.98×0.13 c2=1.76×0.02 c3=-0.0027×0.0004, and c4=-1.26×0.03. We find significant differences in mean log hypocentral distance between MMI- and CII-based reporting, particularly at smaller mean log distance and higher intensity. Values of mean log distance for CII at high intensity tend to be smaller than for MMI at the same value of intensity. The new IPE leads to magnitude estimates for the 1811-1812 New Madrid earthquakes that are within the broad range of those determined previously. Using three MMI datasets for the New Madrid mainshocks, the new relation results in estimates for the moment magnitudes of the December 16th, 1811, January 23rd, 1812, and February 7th, 1812 mainshocks and December 16th dawn aftershock of 7.1¬¬-7.4, 7.2, 7.5-7.7, and 6.7-7.2, respectively, with a magnitude uncertainty of about ×0.4 units. We estimate a magnitude of 7.0×0.3 for the 1886 Charleston, SC earthquake.

Constraining star formation through redshifted CO and CII emission in archival CMB data

NASA Astrophysics Data System (ADS)

Switzer, Eric

LCDM is a strikingly successful paradigm to explain the CMB anisotropy and its evolution into observed galaxy clustering statistics. The formation and evolution of galaxies within this context is more complex and only partly characterized. Measurements of the average star formation and its precursors over cosmic time are required to connect theories of galaxy evolution to LCDM evolution. The fine structure transition in CII at 158 um traces star formation rates and the ISM radiation environment. Cold, molecular gas fuels star formation and is traced well by a ladder of CO emission lines. Catalogs of emission lines in individual galaxies have provided the most information about CII and CO to-date but are subject to selection effects. Intensity mapping is an alternative approach to measuring line emission. It surveys the sum of all line radiation as a function of redshift, and requires angular resolution to reach cosmologically interesting scales, but not to resolve individual sources. It directly measures moments of the luminosity function from all emitting objects. Intensity mapping of CII and CO can perform an unbiased census of stars and cold gas across cosmic time. We will use archival COBE-FIRAS and Planck data to bound or measure cosmologically redshifted CII and CO line emission through 1) the monopole spectrum, 2) cross-power between FIRAS/Planck and public galaxy survey catalogs from BOSS and the 2MASS redshift surveys, 3) auto-power of the FIRAS/Planck data itself. FIRAS is unique in its spectral range and all-sky coverage, provided by the space-borne FTS architecture. In addition to sensitivity to a particular emission line, intensity mapping is sensitive to all other contributions to surface brightness. We will remove CMB and foreground spatial and spectral templates using models from WMAP and Planck data. Interlopers and residual foregrounds additively bias the auto-power and monopole, but both can still be used to provide rigorous upper bounds. The cross-power with galaxy surveys directly constrains the redshifted line emission. Residual foregrounds and interlopers increase errors but do not add bias. There are 300 resolution elements of the 7 degree FIRAS top-hat inside the BOSS quasar survey, spanning 66 spectral pixels to z 2. While FIRAS noise per voxel is 200 times brighter than the expected peak cosmological CII emission, strt-N averaging of spatial and spectral modes above results in a gain of 140. Intensity mapping is in its infancy, with predictions for surface brightness of line emission ranging over an order of magnitude, and limited knowledge of the intensity-weighted bias. Even if only upper bounds are possible, they complement existing measurements of individual galaxies, which can constitute a lower bound because they measure only a portion of the luminosity function. FIRAS and Planck provide unique opportunities to pursue CII and CO intensity mapping with well-characterized instruments that overlap with galaxy surveys in angular coverage and redshift. We will re-analyze the FIRAS data to optimize sensitivity and robustness, developing a spectral line response model, splitting the data into sub-missions to isolate noise properties, and re- evaluating data cuts. The tools and results here will support future survey concepts with significantly lower noise, such as PIXIE, PRISM, SPHEREX and proposed suborbital experiments designed specifically for intensity mapping. There is a growing appreciation that many phenomena could lie just below the published FIRAS bounds. The proposed work is an early step toward this new science.

Do Postpartum Levels of Apolipoproteins Prospectively Predict the Development of Type 2 Diabetes in Women with Previous Gestational Diabetes Mellitus?

PubMed

Lappas, Martha; Georgiou, Harry M; Velagic, Anida; Willcox, Jane C; Permezel, Michael; Shub, Alexis

2018-03-12

The risk of developing type 2 diabetes is greater in women with previous gestational diabetes mellitus (GDM). Apolipoprotein (Apo) species have been associated with the development of type 2 diabetes in the general population. The aim of this study was to determine if circulating levels of Apo species can predict development of type 2 diabetes in women with previous GDM. Apo AI, Apo AII, Apo B, Apo CII, Apo CIII and Apo E levels were measured in 95 women with normal glucose tolerance, 12 weeks following an index GDM pregnancy. Women were assessed for up to 10 years for the development of type 2 diabetes. Postpartum Apo CIII levels, and Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, Apo CIII/Apo E and Apo E/Apo CIII ratios were significantly and positively associated with the development of type 2 diabetes. After controlling for age and BMI, these associations, except for the Apo E/Apo CIII ratio, remained significant. In a clinical model of prediction of type 2 diabetes that included age, BMI, and pregnancy and postnatal fasting glucose, the addition of Apo CIII levels, Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, and Apo CIII/Apo E resulted in a net reclassification improvement of 16.2%. High Apo CIII levels and the Apo CIII/Apo AI, Apo CIII/Apo AII, Apo CIII/Apo CII, and Apo CIII/Apo E ratios are all significant risk factors for the development of type 2 diabetes in women with a previous GDM pregnancy. © Georg Thieme Verlag KG Stuttgart · New York.

Dynamics of the CMZ - Giant Magnetic Loops Connection in the Galactic Center

NASA Astrophysics Data System (ADS)

Langer, William

2012-10-01

Understanding the mass transfer and dynamics among the Galactic Center, the disk, and the halo of the Milky Way is fundamental to the study of the evolution of galaxies and star formation. Several giant molecular loops (GML), detected in CO maps of the Galactic Center, are likely the result of the magnetic Parker instability. We have new evidence of a possible dynamical connection between these loops and the Central Molecular Zone (CMZ) from a sparse [CII] sampling from our Herschel Open Time Key Project GOT C+. The CMZ-GML region is dynamically active and is likely to have a significant ionized component. However, we have no information on the distribution and dynamics of the ionized gas. The fine-structure lines of [NII] are key probes of the warm ionized medium (WIM) and along with the [CII] can isolate the different ionization components. We have a Herschel OT2 Priority 1 program to map the GML and the CMZ-GML connection in [CII] in more detail. However, we did not propose needed [NII] observations due to an incomplete analysis of our limited GOT C+ data at the time. Here we propose to observe with the SOFIA/GREAT instrument, [NII] in the CMZ-GML interface region using the L1b band, and serendipitously CO (16-15) using band L2. With this data, combined with our Herschel HIFI [CII], Mopra 12CO (1-0) and 13CO (1-0), and HI, we will characterize these important ISM components and their motions in these Galactic Center features. These observations of the nearest such regions of galactic center activity, also have bearing on the dynamics of other galactic nuclei.

Rapidly star-forming galaxies adjacent to quasars at redshifts exceeding 6

PubMed Central

Decarli, R.; Walter, F.; Venemans, B.P.; Bañados, E.; Bertoldi, F.; Carilli, C.; Fan, X.; Farina, E.P.; Mazzucchelli, C.; Riechers, D.; Rix, H.-W.; Strauss, M.A.; Wang, R.; Yang, Y.

2017-01-01

The existence of massive (1011 Msun) elliptical galaxies by redshift z~4[1,2,3] (when the Universe was 1.5 billion years old) necessitates the presence of galaxies with star formation rates SFR>100 Msun/yr at z>6 (corresponding to an age of the Universe of less than 1 billion years). Surveys have discovered hundreds of galaxies at these early cosmic epochs, but their star formation rates are more than an order of magnitude lower[4]. The only known examples of very high rate galaxies at z>6 are, with only one exception[5], quasar host galaxies[6,7,8,9], i.e. galaxies that host an accreting supermassive (~109 Msun) black hole that likely affects the host properties. Here we report observations of the [CII] 158 μm line in 4 galaxies that are companions of quasars, with velocity offsets of less than 600 kilometres per second and linear offsets of less than 100 kiloparsecs. The discovery of these four galaxies was serendipitous; they are close to their companion quasars and appear bright in the far-infrared. Based upon the [CII] measurements, we estimate star formation rates of >100 Msun/yr. These sources are similar to the quasar hosts in [CII] brightness, line width and implied dynamical masses, but do not show evidence for accreting supermassive black holes. Similar systems have previously been found at lower redshift[10,11,12]. We find such close companions in 4 out of 25 z>6 quasars surveyed, a fraction that needs to be accounted for in simulations[13,14]. If representative of the bright end of the [CII] luminosity function, they can account for the population of massive elliptical galaxies at z~4 in terms of cosmic space density. PMID:28541326

Probing the Epoch of Reionization via CII Tomography with TIME-Pilot

NASA Astrophysics Data System (ADS)

Bradford, Matt; Crites, Abigail; Hunacek, Jonathon; Hailey-Dunsheath, Steve; Zemcov, Michael B.; Bock, James; Cooray, Asantha R.; Chang, Tzu-Ching; Li, Chao-Te; Bumble, Bruce; Shirokoff, Erik; Staniszewski, Zachary; O'Brient, Roger; Shiu, Corwin; Cheng, Yun-Ting; Uzgil, Bade

2016-01-01

Deep UV dropout surveys in small fields shown that the EoR galaxies are intrinsically faint, even on the scale of the deepest Hubble, JWST, and ALMA surveys. The luminosity functions show steep and/or uncertain faint-end slopes, so that the total light integral is poorly constrained. 3-D tomographic intensity mapping of a bright spectral line can probe the nature of the EoR galaxies in aggregate via their imprint on large-scale structure. Specifically, the 2-halo clustering signal on ~degree scales is sensitive to the luminosity function integral.TIME-Pilot is designed for a first measurement of EoR clustering via the 158-micron [CII] transition redshifted into the millimeter band. 32 waveguide spectrometers disperse the 183-326 GHz band (z=5.5-9 for [CII]) at resolving power of 100 to arrays totaling 1840 TES bolometers, all cooled to below 300 mK. TIME-Pilot will be deployed to the JCMT, and the survey volume will consist of an on-sky footprint of 1 degree (~150 cmlc) by 1 beam (~0.8 cMpc), with depth ~1200 cMpc provided by the spectral coverage. Our models indicate that the raw sensitivity of TIME-Pilot is sufficient to provide a detection of the [CII] clustering signal in a couple of hundred hours on sky. However, the dominant signal in the experiment will be the CO-emitting galaxies at z~0.5 to 3. This signal is interesting in its own right, but will need to be measured and removed to reveal the [CII].TIME-Pilot is also ideally suited to measure the kSZ effect due to peculiar velocities in galaxy clusters. While previous kSZ surveys have been limited by imperfect atmospheric subtraction, TIME-Pilot will use a unique atmospheric subtraction technique demonstrated with Z-Spec, in which the water vapor fluctuations are monitored via total power measurements at the spectrometer band edges, and removed from the science dataset. Finally, the instrument includes 11 broad-band 150-GHz photometers to measure the tSZ effect in the decrement. TIME-Pilot has a kSZ sensitivity of 500 km/s in an 8 hour observation, 5 times improved over previous experiments and sufficient to enable the first cosmological kSZ surveys.

A novel APOC2 gene mutation identified in a Chinese patient with severe hypertriglyceridemia and recurrent pancreatitis.

PubMed

Jiang, Jingjing; Wang, Yuhui; Ling, Yan; Kayoumu, Abudurexiti; Liu, George; Gao, Xin

2016-01-16

The severe forms of hypertriglyceridemia are usually caused by genetic defects. In this study, we described a Chinese female with severe hypertriglyceridemia caused by a novel homozygous mutation in the APOC2 gene. Lipid profiles of the pedigree were studied in detail. LPL and HL activity were also measured. The coding regions of 5 candidate genes (namely LPL, APOC2, APOA5, LMF1, and GPIHBP1) were sequenced using genomic DNA from peripheral leucocytes. The ApoE gene was also genotyped. Serum triglyceride level was extremely high in the proband, compared with other family members. Plasma LPL activity was also significantly reduced in the proband. Serum ApoCII was very low in the proband as well as in the heterozygous mutation carriers. A novel mutation (c.86A > CC) was identified on exon 3 [corrected] of the APOC2 gene, which converted the Asp [corrected] codon at position 29 into Ala, followed by a termination codon (TGA). This study presented the first case of ApoCII deficiency in the Chinese population, with a novel mutation c.86A > CC in the APOC2 gene identified. Serum ApoCII protein might be a useful screening test for identifying mutation carriers.

Dose and temporal evaluation of ethylene oxide-induced mutagenicity in the lungs of male big blue mice following inhalation exposure to carcinogenic concentrations.

PubMed

Manjanatha, Mugimane G; Shelton, Sharon D; Chen, Ying; Parsons, Barbara L; Myers, Meagan B; McKim, Karen L; Gollapudi, B Bhaskar; Moore, Nigel P; Haber, Lynne T; Allen, Bruce; Moore, Martha M

2017-04-01

Ethylene oxide (EO) is a direct acting alkylating agent; in vitro and in vivo studies indicate that it is both a mutagen and a carcinogen. However, it remains unclear whether the mode of action (MOA) for cancer for EO is a mutagenic MOA, specifically via point mutation. To investigate the MOA for EO-induced mouse lung tumors, male Big Blue (BB) B6C3F1 mice (10/group) were exposed to EO by inhalation, 6 hr/day, 5 days/week for 4 (0, 10, 50, 100, or 200 ppm EO), 8, or 12 weeks (0, 100, or 200 ppm EO). Lung DNA samples were analyzed for cII mutant frequency (MF) at 4, 8 and 12 weeks of exposure; the mutation spectrum was analyzed for mutants from control and 200 ppm EO treatments. Although EO-induced cII MFs were 1.5- to 2.7-fold higher than the concurrent controls at 4 weeks, statistically significant increases in the cII MF were found only after 8 and 12 weeks of exposure and only at 200 ppm EO (P ≤ 0.05), which is twice the highest concentration used in the cancer bioassay. Consistent with the positive response, DNA sequencing of cII mutants showed a significant shift in the mutational spectra between control and 200 ppm EO following 8 and 12 week exposures (P ≤ 0.035), but not at 4 weeks. Thus, EO mutagenic activity in vivo was relatively weak and required higher than tumorigenic concentrations and longer than 4 weeks exposure durations. These data do not follow the classical patterns for a MOA mediated by point mutations. Environ. Mol. Mutagen. 58:122-134, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

A thermodynamically consistent model of the post-translational Kai circadian clock

PubMed Central

Lubensky, David K.; ten Wolde, Pieter Rein

2017-01-01

The principal pacemaker of the circadian clock of the cyanobacterium S. elongatus is a protein phosphorylation cycle consisting of three proteins, KaiA, KaiB and KaiC. KaiC forms a homohexamer, with each monomer consisting of two domains, CI and CII. Both domains can bind and hydrolyze ATP, but only the CII domain can be phosphorylated, at two residues, in a well-defined sequence. While this system has been studied extensively, how the clock is driven thermodynamically has remained elusive. Inspired by recent experimental observations and building on ideas from previous mathematical models, we present a new, thermodynamically consistent, statistical-mechanical model of the clock. At its heart are two main ideas: i) ATP hydrolysis in the CI domain provides the thermodynamic driving force for the clock, switching KaiC between an active conformational state in which its phosphorylation level tends to rise and an inactive one in which it tends to fall; ii) phosphorylation of the CII domain provides the timer for the hydrolysis in the CI domain. The model also naturally explains how KaiA, by acting as a nucleotide exchange factor, can stimulate phosphorylation of KaiC, and how the differential affinity of KaiA for the different KaiC phosphoforms generates the characteristic temporal order of KaiC phosphorylation. As the phosphorylation level in the CII domain rises, the release of ADP from CI slows down, making the inactive conformational state of KaiC more stable. In the inactive state, KaiC binds KaiB, which not only stabilizes this state further, but also leads to the sequestration of KaiA, and hence to KaiC dephosphorylation. Using a dedicated kinetic Monte Carlo algorithm, which makes it possible to efficiently simulate this system consisting of more than a billion reactions, we show that the model can describe a wealth of experimental data. PMID:28296888

Expression of three sHSP genes involved in heat pretreatment-induced chilling tolerance in banana fruit.

PubMed

He, Li-hong; Chen, Jian-ye; Kuang, Jian-fei; Lu, Wang-jin

2012-07-01

Banana fruit is highly susceptible to chilling injury. In previous research it was shown that heat pretreatment of banana fruit at 38 °C for 3 days before storage at a chilling temperature of 8 °C for 12 days prevented increases in visible chilling injury index, electrolyte leakage and malondialdehyde content and also decreases in lightness and chroma, indicating that heat pretreatment could effectively alleviate chilling injury of banana fruit. However, little is known about the role of small heat shock proteins (sHSPs) in postharvest chilling tolerance of banana fruit. In the present study, three cytosolic sHSP expression profiles in peel and pulp tissues of banana fruit during heat pretreatment and subsequent chilled storage (8 °C) were investigated in relation to heat pretreatment-induced chilling tolerance. Three full-length cDNAs of cytosolic sHSP genes, including two class I sHSP (CI sHSP) and one class II sHSP (CII sHSP) cDNAs, named Ma-CI sHSP1, Ma-CI sHSP2 and Ma-CII sHSP3 respectively, were isolated and characterised from harvested banana fruit. Accumulation of Ma-CI sHSP1 mRNA transcripts in peel and pulp tissues and Ma-CII sHSP3 mRNA transcripts in peel tissue increased during heat pretreatment. Expression of all three Ma-sHSP genes in peel and pulp tissues was induced during subsequent chilled storage. Furthermore, Ma-CI sHSP1 and Ma-CII sHSP3 mRNA transcripts in pulp tissue and Ma-CI sHSP2 mRNA transcripts in peel and pulp tissues were obviously enhanced by heat pretreatment at days 6 and 9 of subsequent chilled storage. These results suggested that heat pretreatment enhanced the expression of Ma-sHSPs, which might be involved in heat pretreatment-induced chilling tolerance of banana fruit. Copyright © 2012 Society of Chemical Industry.

Palmitoylethanolamide and luteolin ameliorate development of arthritis caused by injection of collagen type II in mice.

PubMed

Impellizzeri, Daniela; Esposito, Emanuela; Di Paola, Rosanna; Ahmad, Akbar; Campolo, Michela; Peli, Angelo; Morittu, Valeria Maria; Britti, Domenico; Cuzzocrea, Salvatore

2013-01-01

N-palmitoylethanolamine (PEA) is an endogenous fatty acid amide belonging to the family of the N-acylethanolamines (NAEs). Recently, several studies demonstrated that PEA is an important analgesic, antiinflammatory, and neuroprotective mediator. The aim of this study was to investigate the effect of co-ultramicronized PEA + luteolin formulation on the modulation of the inflammatory response in mice subjected to collagen-induced arthritis (CIA). CIA was induced by an intradermally injection of 100 μl of the emulsion (containing 100 μg of bovine type II collagen (CII)) and complete Freund adjuvant (CFA) at the base of the tail. On day 21, a second injection of CII in CFA was administered. Mice subjected to CIA were administered PEA (10 mg/kg 10% ethanol, intraperitoneally (i.p.)) or co-ultramicronized PEA + luteolin (1 mg/kg, i.p.) every 24 hours, starting from day 25 to 35. Mice developed erosive hind-paw arthritis when immunized with CII in CFA. Macroscopic clinical evidence of CIA first appeared as periarticular erythema and edema in the hindpaws. The incidence of CIA was 100% by day 28 in the CII-challenged mice, and the severity of CIA progressed over a 35-day period with a resorption of bone. The histopathology of CIA included erosion of the cartilage at the joint. Treatment with PEA or PEA + luteolin ameliorated the clinical signs at days 26 to 35 and improved histologic status in the joint and paw. The degree of oxidative and nitrosative damage was significantly reduced in PEA + luteolin-treated mice, as indicated by nitrotyrosine and malondialdehyde (MDA) levels. Plasma levels of the proinflammatory cytokines and chemokines were significantly reduced by PEA + luteolin treatment. We demonstrated that PEA co-ultramicronized with luteolin exerts an antiinflammatory effect during chronic inflammation and ameliorates CIA.

Palmitoylethanolamide and luteolin ameliorate development of arthritis caused by injection of collagen type II in mice

PubMed Central

2013-01-01

Introduction N-palmitoylethanolamine (PEA) is an endogenous fatty acid amide belonging to the family of the N-acylethanolamines (NAEs). Recently, several studies demonstrated that PEA is an important analgesic, antiinflammatory, and neuroprotective mediator. The aim of this study was to investigate the effect of co-ultramicronized PEA + luteolin formulation on the modulation of the inflammatory response in mice subjected to collagen-induced arthritis (CIA). Methods CIA was induced by an intradermally injection of 100 μl of the emulsion (containing 100 μg of bovine type II collagen (CII)) and complete Freund adjuvant (CFA) at the base of the tail. On day 21, a second injection of CII in CFA was administered. Mice subjected to CIA were administered PEA (10 mg/kg 10% ethanol, intraperitoneally (i.p.)) or co-ultramicronized PEA + luteolin (1 mg/kg, i.p.) every 24 hours, starting from day 25 to 35. Results Mice developed erosive hind-paw arthritis when immunized with CII in CFA. Macroscopic clinical evidence of CIA first appeared as periarticular erythema and edema in the hindpaws. The incidence of CIA was 100% by day 28 in the CII-challenged mice, and the severity of CIA progressed over a 35-day period with a resorption of bone. The histopathology of CIA included erosion of the cartilage at the joint. Treatment with PEA or PEA + luteolin ameliorated the clinical signs at days 26 to 35 and improved histologic status in the joint and paw. The degree of oxidative and nitrosative damage was significantly reduced in PEA + luteolin-treated mice, as indicated by nitrotyrosine and malondialdehyde (MDA) levels. Plasma levels of the proinflammatory cytokines and chemokines were significantly reduced by PEA + luteolin treatment. Conclusions We demonstrated that PEA co-ultramicronized with luteolin exerts an antiinflammatory effect during chronic inflammation and ameliorates CIA. PMID:24246048

KPOT_wlanger_1: State of the Diffuse ISM: Galactic Observations of the Terahertz CII Line (GOT CPlus)

NASA Astrophysics Data System (ADS)

Langer, W.

2007-10-01

Star formation activity throughout the Galactic disk depends on the thermal and dynamical state of the interstellar gas, which in turn depends on heating and cooling rates, modulated by the gravitational potential and shock and turbulent pressures. Molecular cloud formation, and thus the star formation, may be regulated by pressures in the interstellar medium (ISM). To understand these processes we need information about the properties of the diffuse atomic and diffuse molecular gas clouds, and Photon Dominated Regions (PDR). An important tracer of these regions is the CII line at 158 microns (1900.5 GHz). We propose a "pencil-beam" survey of CII with HIFI band 7b, based on deep integrations and systematic sparse sampling of the Galactic disk plus selected targets, totaling over 900 lines of sight. We will detect both emission and, against the bright inner Galaxy and selected continuum sources, absorption lines. These spectra will provide the astronomical community with a large rich statistical database of the diffuse cloud properties throughout the Galaxy for understanding the Milky Way ISM and, by extension, other galaxies. It will be extremely valuable for determining the properties of the atomic gas, the role of barometric pressure and turbulence in cloud evolution, and the properties of the interface between the atomic and molecular clouds. The CII line is one of the major ISM cooling lines and is present throughout the Galactic plane. It is the strongest far-IR emission line in the Galaxy, with a total luminosity about a 1000 times that of the CO J=1-0 line. Combined with other data, it can be used to determine density, pressure, and radiation environment in gas clouds, and PDRs, and their dynamics via velocity fields. HSO is the best opportunity over the next several years to probe the ISM in this tracer and will provide a template for large-scale surveys with dedicated small telescopes and future surveys of other important ISM tracers.

GOT C+: A Herschel Space Observatory Key Program to Study the Diffuse ISM

NASA Astrophysics Data System (ADS)

Langer, William; Velusamy, T.; Goldsmith, P. F.; Li, D.; Pineda, J.; Yorke, H.

2010-01-01

Star formation activity is regulated by pressures in the interstellar medium, which in turn depend on heating and cooling rates, modulated by the gravitational potential, and shock and turbulent pressures. To understand these processes we need information about the diffuse atomic and diffuse molecular gas cloud properties. The ionized carbon CII fine structure line at 1.9 THz is an important tracer of the atomic gas in the diffuse regions and the atomic to molecular cloud transformation. Furthermore, C+ is a major ISM coolant, the Galaxy's strongest emission line, with a total luminosity about a 1000 times that of CO J=1-0. Galactic Observations of the Terahertz C+ Line (GOT C+) is a Herschel Space Observatory Open Time Key Program to study the diffuse interstellar medium by sampling CII line emission throughout the Galactic disk. GOT C+ will obtain high spectral resolution CII using the Heterodyne Instrument for the Far Infrared (HIFI) instrument. It employees deep integrations, wide velocity coverage (350 km s-1) with 0.22 km s-1 resolution, and systematic sparse sampling of the Galactic disk together with observations of selected targets, of over 900 lines of sight. It will be a resource of the atomic gas properties, in the (a) Galactic disk, (b) Galaxy's central 300pc, (c) Galactic warp, (d) high latitude HI clouds, and (e) Photon Dominated Regions (PDRs). Along with HI, CO isotopes, and CI spectra, our C+ data will provide the astronomical community with a rich statistical database of diffuse cloud properties, for understanding the role of barometric pressure and turbulence in cloud evolution in the Galactic ISM and, by extension, other galaxies. The GOT C+ project will provide a template for future even larger-scale CII surveys. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology and is supported by a NASA grant.

Herschel HIFI GOT C+ Survey: CII, HI, and CO Emissions in a Sample of Transition Clouds and Star-Forming regions in the Inner Galaxy

NASA Astrophysics Data System (ADS)

Pineda, Jorge; Velusamy, Thangasamy; Langer, William D.; Goldsmith, Paul; Li, Di; Yorke, Harold

The GOT C+ a HIFI Herschel Key Project, studies the diffuse ISM throughout the Galactic Plane, using C+ as cloud tracer. The C+ line at 1.9 THz traces a so-far poorly studied stage in ISM cloud evolution -the transitional clouds going from atomic HI to molecular H2. This transition cloud phase, which is difficult to observe in HI and CO alone, may be best characterized via CII emission or absorption. The C+ line is also an excellent tracer of the warm diffuse gas and the warm, dense gas in the Photon Dominated Regions (PDRs). We can, therefore, use the CII emission as a probe to understand the effects of star formation on their interstellar environment. We present our first results on the transition between dense and hot gas (traced by CII) and dense and cold gas (traced by 12CO and 13CO) along a few representative lines of sight in the inner Galaxy from longitude 325 degrees to 25 degrees, taken during the HIFI Priority Science Phase. Comparisons of the high spectral resolution ( 1 km/s) HIFI data on C+ with HI, 12CO, and 13CO spectra allow us to separate out the different ISM components along each line of sight. Our results provide detailed information about the transition of diffuse atomic to molecular gas clouds needed to understand star formation and the lifecycle of the interstellar gas. These observations are being carried out with the Herschel Space Observatory, which is an ESA cornerstone mission, with contributions from NASA. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP was supported under the NASA Postdoctoral Program at JPL, Caltech, administered by Oak Ridge Associated Universities through a contract with NASA, and is currently supported as a Caltech-JPL Postdoctoral associate.

SDP_wlanger_3: State of the Diffuse ISM: Galactic Observations of the Terahertz CII Line (GOT CPlus)

NASA Astrophysics Data System (ADS)

Langer, W.

2011-09-01

Star formation activity throughout the Galactic disk depends on the thermal and dynamical state of the interstellar gas, which in turn depends on heating and cooling rates, modulated by the gravitational potential and shock and turbulent pressures. Molecular cloud formation, and thus the star formation, may be regulated by pressures in the interstellar medium (ISM). To understand these processes we need information about the properties of the diffuse atomic and diffuse molecular gas clouds, and Photon Dominated Regions (PDR). An important tracer of these regions is the CII line at 158 microns (1900.5 GHz). We propose a "pencil-beam" survey of CII with HIFI band 7b, based on deep integrations and systematic sparse sampling of the Galactic disk plus selected targets, totaling over 900 lines of sight. We will detect both emission and, against the bright inner Galaxy and selected continuum sources, absorption lines. These spectra will provide the astronomical community with a large rich statistical database of the diffuse cloud properties throughout the Galaxy for understanding the Milky Way ISM and, by extension, other galaxies. It will be extremely valuable for determining the properties of the atomic gas, the role of barometric pressure and turbulence in cloud evolution, and the properties of the interface between the atomic and molecular clouds. The CII line is one of the major ISM cooling lines and is present throughout the Galactic plane. It is the strongest far-IR emission line in the Galaxy, with a total luminosity about a 1000 times that of the CO J=1-0 line. Combined with other data, it can be used to determine density, pressure, and radiation environment in gas clouds, and PDRs, and their dynamics via velocity fields. HSO is the best opportunity over the next several years to probe the ISM in this tracer and will provide a template for large-scale surveys with dedicated small telescopes and future surveys of other important ISM tracers.

Detector modules and spectrometers for the TIME-Pilot [CII] intensity mapping experiment

NASA Astrophysics Data System (ADS)

Hunacek, Jonathon; Bock, James; Bradford, C. Matt; Bumble, Bruce; Chang, Tzu-Ching; Cheng, Yun-Ting; Cooray, Asantha; Crites, Abigail; Hailey-Dunsheath, Steven; Gong, Yan; Li, Chao-Te; O'Brient, Roger; Shirokoff, Erik; Shiu, Corwin; Sun, Jason; Staniszewski, Zachary; Uzgil, Bade; Zemcov, Michael

2016-07-01

This proceeding presents the current TIME-Pilot instrument design and status with a focus on the close-packed modular detector arrays and spectrometers. Results of laboratory tests with prototype detectors and spectrometers are discussed. TIME-Pilot is a new mm-wavelength grating spectrometer array under development that will study the Epoch of Reionization (the period of time when the first stars and galaxies ionized the intergalactic medium) by mapping the fluctuations of the redshifted 157:7 μm emission line of singly ionized carbon ([CII]) from redshift z 5:2 to 8:5. As a tracer of star formation, the [CII] power spectrum can provide information on the sources driving reionization and complements 21 cm data (which traces neutral hydrogen in the intergalactic medium). Intensity mapping provides a measure of the mean [CII] intensity without the need to resolve and detect faint sources individually. We plan to target a 1 degree by 0.35 arcminute field on the sky and a spectral range of 199-305 GHz, producing a spatial-spectral slab which is 140 Mpc by 0.9 Mpc on-end and 1230 Mpc in the redshift direction. With careful removal of intermediate-redshift CO sources, we anticipate a detection of the halo-halo clustering term in the [CII] power spectrum consistent with current models for star formation history in 240 hours on the JCMT. TIME-Pilot will use two stacks of 16 parallel-plate waveguide spectrometers (one stack per polarization) with a resolving power R 100 and a spectral range of 183 to 326 GHz. The range is divided into 60 spectral channels, of which 16 at the band edges on each spectrometer serve as atmospheric monitors. The diffraction gratings are curved to produce a compact instrument, each focusing the diffracted light onto an output arc sampled by the 60 bolometers. The bolometers are built in buttable dies of 8 (low freqeuency) or 12 (high frequency) spectral channels by 8 spatial channels and are mated to the spectrometer stacks. Each detector consists of a gold micro-mesh absorber and a titanium transition edge sensor (TES). The detectors (1920 total) are designed to operate from a 250 mK base temperature in an existing cryostat with a photon-noise-dominated NEP of 2 * 10-17 WHz-1-2. A set of flexible superconducting cables connect the detectors to a time-domain multiplexing SQUID readout system.

Cognitive dysfunction in antiphospholipid antibody (aPL)-negative systemic lupus erythematosus (SLE) versus aPL-positive non-SLE patients.

PubMed

Kozora, Elizabeth; Erkan, Doruk; Zhang, Lening; Zimmerman, Robert; Ramon, Glendalee; Ulug, Aziz M; Lockshin, Michael D

2014-01-01

The aim of this study was to compare the cognitive function of antiphospholipid antibody (aPL)-negative systemic lupus erythematosus (SLE) and aPL-positive non-SLE patients. Twenty aPL-negative SLE and 20 aPL-positive non-SLE female patients with no history of overt neuropsychiatric manifestations took standardised cognitive tests of learning and memory, attention and working memory, executive functions, verbal fluency, visuoconstruction, and motor function. The primary outcome measure was an established global cognitive impairment index (CII). Cranial magnetic resonance imaging (MRI) was also obtained on all patients. Twelve of 20 (60%) of the SLE and 8/20 (40%) of the aPL-positive patients had global cognitive impairment on CII; there were no group differences on CII or on individual measures. Cognitive impairment was not associated with duration of disease, level of disease activity, or prednisone use. No correlations were found between clinical disease factors and cognitive impairment, and neither group showed an association between incidental or major MRI abnormalities and cognitive dysfunction. Both aPL-negative SLE and aPL-positive non-SLE patients, without other overt neuropsychiatric disease, demonstrated high levels of cognitive impairment. No clinical, serologic, or radiologic characteristics were associated with cognitive impairment. Cognitive dysfunction is common in APS and in SLE, but its mechanisms remain unknown.

The Italian validation of the minimal assessment of cognitive function in multiple sclerosis (MACFIMS) and the application of the Cognitive Impairment Index scoring procedure in MS patients.

PubMed

Argento, Ornella; Incerti, Chiara C; Quartuccio, Maria E; Magistrale, Giuseppe; Francia, Ada; Caltagirone, Carlo; Pisani, Valerio; Nocentini, Ugo

2018-04-27

Cognitive dysfunction occurs in almost 50-60% of patients with multiple sclerosis (MS) even in early stages of the disease and affects different aspects of patient's life. Aims of the present study were (1) to introduce and validate an Italian version of the minimal assessment of cognitive functions in MS (MACFIMS) battery and (2) to propose the use of the Cognitive Impairment Index (CII) as a scoring procedure to define the degree of impairment in relapsing-remitting (RRMS) and secondary-progressive (SPMS) patients. A total of 240 HC and 123 MS patients performed the Italian version of the MACFIMS composed by the same tests as the original except for the Paced Auditory Serial Addition Test. The CII was derived for each score of the 11 scales for participants of both groups. The results of the study show that cognitive impairment affects around 50% of our sample of MS patients. In RRMS group, only the 15.7% of patients reported a severe impairment, while in the group of SPMS, the 51.4% of patients felt in the "severely impaired" group. Results are in line with previously reported percentages of impairment in MS patients, showing that the calculation of the CII applied to the Italian version of the MACFIMS is sensitive and reliable in detecting different degrees of impairment in MS patients.

Utility of the Conners' Adult ADHD Rating Scale validity scales in identifying simulated attention-deficit hyperactivity disorder and random responding.

PubMed

Walls, Brittany D; Wallace, Elizabeth R; Brothers, Stacey L; Berry, David T R

2017-12-01

Recent concern about malingered self-report of symptoms of attention-deficit hyperactivity disorder (ADHD) in college students has resulted in an urgent need for scales that can detect feigning of this disorder. The present study provided further validation data for a recently developed validity scale for the Conners' Adult ADHD Rating Scale (CAARS), the CAARS Infrequency Index (CII), as well as for the Inconsistency Index (INC). The sample included 139 undergraduate students: 21 individuals with diagnoses of ADHD, 29 individuals responding honestly, 54 individuals responding randomly (full or half), and 35 individuals instructed to feign. Overall, the INC showed moderate sensitivity to random responding (.44-.63) and fairly high specificity to ADHD (.86-.91). The CII demonstrated modest sensitivity to feigning (.31-.46) and excellent specificity to ADHD (.91-.95). Sequential application of validity scales had correct classification rates of honest (93.1%), ADHD (81.0%), feigning (57.1%), half random (42.3%), and full random (92.9%). The present study suggests that the CII is modestly sensitive (true positive rate) to feigned ADHD symptoms, and highly specific (true negative rate) to ADHD. Additionally, this study highlights the utility of applying the CAARS validity scales in a sequential manner for identifying feigning. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Detection of the 158 Micrometers[CII] Transition at z=1.3: Evidence for a Galaxy-Wide Starburst

NASA Technical Reports Server (NTRS)

Hailey-Dunsheath, S.; Nikola, T.; Oberst, T. E.; Parshley, S. C.; Benford, D. J.; Staguhn, J. G.; Tucker, C. E.

2010-01-01

We report the detection of 158 micron [C II] fine-structure line emission from MIPS J142824.0+352619, a hyperluminous ( L(sub IR) approximates 10(exp 13) L (sub solar)) starburst galaxy at z = 1.3. The line is bright, corresponding to a fraction L(sub [Cu II] L(sub Fir) approximates 2 x 10(exp -3) of the far-IR (FIR) continuum. The [C II], CO, and FIR continuum emission may be modeled as arising from photodissociation regions (PDRs) that have a characteristic gas density of n approximates 10(exp 4.2) /cm(exp 3) , and that are illuminated by a far-UV radiation field approximately 10(exp 3.2) times more intense than the local interstellar radiation field. The mass in these PDRs accounts for approximately half of the molecular gas mass in this galaxy. The L(sub [CII])/L(sub FIR) ratio is higher than observed in local ultralummous infrared galaxies or in the few high-redshift QSOs detected in [C II], but the L(sub [CII])/L(sub FIR) and L(sub CO)/L(sub FIR) ratios are similar to the values seen in nearby starburst galaxies. This suggests that MIPS J142824.0+352619 is a scaled-up version of a starburst nucleus, with the burst extended over several kiloparsecs.

Apolipoprotein CII

MedlinePlus

... improve treatment. Because of this, most health insurance companies will not pay for the test. If you ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

Consistent response of bird populations to climate change on two continents

USGS Publications Warehouse

Stephens, Philip A.; Mason, Lucy R.; Green, Rhys E.; Gregory, Richard D.; Sauer, John R.; Alison, Jamie; Aunins, Ainars; Brotons, Lluís; Butchart, Stuart H.M.; Campedelli, Tommaso; Chodkiewicz, Tomasz; Chylarecki, Przemyslaw; Crowe, Olivia; Elts, Jaanus; Escandell, Virginia; Foppen, Ruud P.B.; Heldbjerg, Henning; Herrando, Sergi; Husby, Magne; Jiguet, Frédéric; Lehikoinen, Aleksi; Lindström, Åke; Noble, David G.; Paquet, Jean-Yves; Reif, Jiri; Sattler, Thomas; Szép, Tibor; Teufelbauer, Norbert; Trautmann, Sven; Van Strien, Arco; van Turnhout, Chris A.M.; Vorisek, Petr; Willis, Stephen G.

2016-01-01

Global climate change is a major threat to biodiversity. Large-scale analyses have generally focused on the impacts of climate change on the geographic ranges of species and on phenology, the timing of ecological phenomena. We used long-term monitoring of the abundance of breeding birds across Europe and the United States to produce, for both regions, composite population indices for two groups of species: those for which climate suitability has been either improving or declining since 1980. The ratio of these composite indices, the climate impact indicator (CII), reflects the divergent fates of species favored or disadvantaged by climate change. The trend in CII is positive and similar in the two regions. On both continents, interspecific and spatial variation in population abundance trends are well predicted by climate suitability trends.

Exploring star formation in high-z galaxies using atomic and molecular emission lines

NASA Astrophysics Data System (ADS)

Gullberg, Bitten

2016-03-01

The conditions under which stars are formed and the reasons for triggering and quenching of starburst events in high-z galaxies, are still not well understood. Studying the interstellar medium (ISM) and the morphology of high-z galaxies are therefore key points in order to understand galaxy evolution. The cosmic star formation rate density peaks between 1>1, and low to moderate [CII] optical depth tau(CII)<1. Combining millimetre/sub-millimetre and optical data cubes for the high-z radio galaxy (HzRG) MRC0943-242, has revealed a much more complicated morphology than seen in the individual data sets. The millimetre/sub-millimetre observations data have allowed us to spatially separate of the AGN and starburst dominated components, which ~65 kpc apart. The optical data reveal structures of emitting and absorbing gas at multiple wavelengths. A deep high resolution millimetre/sub-millimetre study of the HzRG MRC1138-262, shows emission from water (H2O) and an unusually large amount of neutral atomic carbon ([CI]) relative to highly excited CO compared to lensed DSFGs. The detection of water (H2O) emission, which is not associated with the 246GHz continuum emission, suggests excitation by shocks. The uncommon line ratio between [CI]2-1 and CO(7-6) might be due special conditions of the ISM in MRC1138-262 dominated by cosmic rays or differential lensing in other DSFGs thereby not representing the intrinsic ratio. These three studies of the physical conditions of the ISM and morphology of high-z galaxies at z>2, pave the road for future investigations of the star-forming ISM in high-z galaxies, by illustrating the importance of multi-wavelength, fine structure- and molecular line studies.

Herschel Galactic plane survey of ionized gas traced by [NII

NASA Astrophysics Data System (ADS)

Yildiz, Umut; Goldsmith, Paul; Pineda, Jorge; Langer, William

2015-01-01

Far infrared and sub-/millimeter atomic & ionic fine structure and molecular rotational lines are powerful tracers of star formation on both Galactic and extragalactic scales. Although CO lines trace cool to moderately warm molecular gas, ionized carbon [CII] produces the strongest lines, which arise from almost all reasonably warm (T>50 K) parts of the ISM. However, [CII] alone cannot distinguish highly ionized gas from weakly ionized gas. [NII] plays a significant role in star formation as it is produced only in ionized regions; in [HII] regions as well as diffuse ionized gas. The ionization potential of nitrogen (14.5 eV) is greater than that of hydrogen (13.6 eV), therefore the ionized nitrogen [NII] lines reflect the effects of massive stars, with possible enhancement from X-ray and shock heating from the surroundings. Two far-infrared 122 um and 205 um [NII] fine structure spectral lines are targeted via Photodetector Array Camera and Spectrometer (PACS) onboard Herschel Space Observatory. The sample consists of 149 line-of-sight (LOS) positions in the Galactic plane. These positions overlap with the [CII] 158 um observations obtained with the GOT C+ survey. With a reasonable assumption that the emission from both 122 um and 205 um lines originate in the same gas; [NII] 122/205 um line ratio indicates the a good measure of the electron density of each of the LOS positions. [NII] detections are mainly toward the Galactic center direction and the [NII] electron densities are found between 7-50 cm^-3, which is enhanced WIM (Warm Ionized Medium). WIM densities are expected to be much lower (~1 cm-3), therefore non-detections toward the opposite side of the Galactic Center shows abundant of this gas. The pixel to pixel variation of the emission within a single Herschel pointing is relatively small, which is interpreted as the [NII] emission comes from an extended gas. It is important to quantify what fraction of [CII] emission arises in the ionized gas. Thus, with the present work of [NII] observations, it will be possible to resolve the different parts of the ISM leading to determine the total mass of the ISM.

3D-DIVIMP-HC modeling analysis of methane injection into DIII-D using the DiMES porous plug injector

NASA Astrophysics Data System (ADS)

Mu, Y.; McLean, A. G.; Elder, J. D.; Stangeby, P. C.; Bray, B. D.; Brooks, N. H.; Davis, J. W.; Fenstermacher, M. E.; Groth, M.; Lasnier, C. J.; Rudakov, D. L.; Watkins, J. G.; West, W. P.; Wong, C. P. C.

2009-06-01

A self-contained gas injection system for the Divertor Material Evaluation System (DiMES) on DIII-D, the porous plug injector (PPI), has been employed for in situ study of chemical erosion in the tokamak divertor environment by injection of CH 4 [A.G. McLean et al., these Proceedings]. A new interpretive code, 3D-DIVIMP-HC, has been developed and applied to the interpretation of the CH, CI, and CII emissions. Particular emphasis is placed on the interpretation of 2D filtered-camera (TV) pictures in CH, CI and CII light taken from a view essentially straight down on the PPI. The code replicates sufficient measurements to conclude that most of the basic elements of the controlling physics and chemistry have been identified and incorporated in the code-model.

The nonpsychoactive cannabis constituent cannabidiol is an oral anti-arthritic therapeutic in murine collagen-induced arthritis

PubMed Central

Malfait, A. M.; Gallily, R.; Sumariwalla, P. F.; Malik, A. S.; Andreakos, E.; Mechoulam, R.; Feldmann, M.

2000-01-01

The therapeutic potential of cannabidiol (CBD), the major nonpsychoactive component of cannabis, was explored in murine collagen-induced arthritis (CIA). CIA was elicited by immunizing DBA/1 mice with type II collagen (CII) in complete Freund's adjuvant. The CII used was either bovine or murine, resulting in classical acute CIA or in chronic relapsing CIA, respectively. CBD was administered after onset of clinical symptoms, and in both models of arthritis the treatment effectively blocked progression of arthritis. CBD was equally effective when administered i.p. or orally. The dose dependency showed a bell-shaped curve, with an optimal effect at 5 mg/kg per day i.p. or 25 mg/kg per day orally. Clinical improvement was associated with protection of the joints against severe damage. Ex vivo, draining lymph node cells from CBD-treated mice showed a diminished CII-specific proliferation and IFN-γ production, as well as a decreased release of tumor necrosis factor by knee synovial cells. In vitro effects of CBD included a dose-dependent suppression of lymphocyte proliferation, both mitogen-stimulated and antigen-specific, and the blockade of the Zymosan-triggered reactive oxygen burst by peritoneal granulocytes. It also was found that CBD administration was capable of blocking the lipopolysaccharide-induced rise in serum tumor necrosis factor in C57/BL mice. Taken together, these data show that CBD, through its combined immunosuppressive and anti-inflammatory actions, has a potent anti-arthritic effect in CIA. PMID:10920191

Adoptive Cellular Gene Therapy for the Treatment of Experimental Autoimmune Polychondritis Ear Disease.

PubMed

Zhou, Bin; Liao, Yonggan; Guo, Yunkai; Tarner, Ingo H; Liao, Chunfen; Chen, Sisi; Kermany, Mohammad Habiby; Tu, Hanjun; Zhong, Sen; Chen, Peijie

2017-01-01

In the past, the clinical therapy for autoimmune diseases, such as autoimmune polychondritis ear disease, was mostly limited to nonspecific immunosuppressive agents, which could lead to variable responses. Currently, gene therapy aims at achieving higher specificity and less adverse effects. This concept utilizes the adoptive transfer of autologous T cells that have been retrovirally transduced ex vivo to express and deliver immunoregulatory gene products to sites of autoimmune inflammation. In the animal model of collagen-induced autoimmune polychondritis ear disease (CIAPED), the adoptive transfer of IL-12p40-expressing collagen type II (CII)-specific CD4+ T-cell hybridomas resulted in a significantly lower disease incidence and severity compared with untreated or vector-only-treated animals. In vivo cell detection using bioluminescent labels showed that transferred CII-reactive T-cell hybridomas accumulated in the inflamed earlobes of the mice with CIAPED. In vitro analysis demonstrated that IL-12p40-transduced T cells did not affect antigen-specific T-cell activation or systemic anti-CII Ab responses. However, IL-12p40-transduced T cells suppressed IFN-γ and augmented IL-4 production, indicating their potential to act therapeutically by interrupting Th1-mediated inflammatory responses via augmenting Th2 responses. These results indicate that the local delivery of IL-12p40 by T cells could inhibit CIAPED by suppressing autoimmune responses at the site of inflammation. © 2017 S. Karger AG, Basel.

Interstellar medium conditions in z 0.2 Lyman-break analogs

NASA Astrophysics Data System (ADS)

Contursi, A.; Baker, A. J.; Berta, S.; Magnelli, B.; Lutz, D.; Fischer, J.; Verma, A.; Nielbock, M.; Grácia Carpio, J.; Veilleux, S.; Sturm, E.; Davies, R.; Genzel, R.; Hailey-Dunsheath, S.; Herrera-Camus, R.; Janssen, A.; Poglitsch, A.; Sternberg, A.; Tacconi, L. J.

2017-10-01

We present an analysis of far-infrared (FIR) [CII] and [OI] fine structure line and continuum observations obtained with Herschel/PACS, and 12CO(1-0) observations obtained with the IRAM Plateau de Bure Interferometer, of Lyman-break analogs (LBAs) at z 0.2. The principal aim of this work is to determine the typical interstellar medium (ISM) properties of z 1-2 main sequence (MS) galaxies, with stellar masses between 109.5 and 1011M⊙, which are currently not easily detectable in all these lines even with ALMA and NOEMA. We perform PDR modeling and apply different infared diagnostics to derive the main physical parameters of the far-infrared (FIR)-emitting gas and dust and we compare the derived ISM properties to those of galaxies on and above the MS at different redshifts. We find that the ISM properties of LBAs are quite extreme (low gas temperature and high density and thermal pressure) with respect to those found in local normal spirals and more active local galaxies. LBAs have no [CII] deficit despite having the high specific star formation rates (sSFRs) typical of starbursts. Although LBAs lie above the local MS, we show that their ISM properties are more similar to those of high-redshift MS galaxies than of local galaxies above the main sequence. This data set represents an important reference for planning future ALMA [CII] observations of relatively low-mass MS galaxies at the epoch of the peak of the cosmic star formation.

VizieR Online Data Catalog: [CII] emission in the ISM of 20 nearby galaxies (Croxall+, 2017)

NASA Astrophysics Data System (ADS)

Croxall, K. V.; Smith, J. D.; Pellegrini, E.; Groves, B.; Bolatto, A.; Herrera-Camus, R.; Sandstrom, K. M.; Draine, B.; Wolfire, M. G.; Armus, L.; Boquien, M.; Brandl, B.; Dale, D.; Galametz, M.; Hunt, L.; Kennicutt, R.; Kreckel, K.; Rigopoulou, D.; van der Werf, P.; Wilson, C.

2018-04-01

Our observations include photometric and spectral-line observations from both the PACS and SPIRE instruments onboard Herschel, obtained as part of the large KINGFISH (Key Insights on Nearby Galaxies: a Far- Infrared Survey with Herschel, Kennicutt+ 2011PASP..123.1347K) and BtP (Beyond the Peak; OT1_jsmith1; P.I. J.D. Smith) projects. [NII]205um BtP observations were performed with SPIRE-FTS intermediate mapping, which is a 4-point dither. E. Pellegrini et al. (2017, in preparation) will contain a full description of the observations and reductions. [CII]158um and [NII]122um emission lines, and 70 and 160um continuum maps have been observed as part the Herschel Open Time Key Program KINGFISH. The data and the associated reduction are described in Kennicutt+ (2011PASP..123.1347K) and Croxall+ (2013ApJ...777...96C). (2 data files).

Herschel Far Infrared Spectra of Dusty Star-Forming Galaxies

NASA Astrophysics Data System (ADS)

Wilson, Derek; Cooray, Asantha R.; Nayyeri, Hooshang

2017-01-01

We stack archival spectra from the Herschel Space Observatory's SPIRE Spectrometer in three redshift bins from low redshifts (z < 0.2), through intermediate redshifts (0.2 < z < 1), and up to high redshifts (z > 1) in order to determine the average properties of the gas and dust in dusty, star-forming galaxies and (U)LIRGs. In the lower-redshift stack, we detect a host of water and carbon monoxide rotational transition lines, as well as some fine structure lines such as [NII]. At intermediate redshifts, only a [CII] line appears. The high-redshift stack displays strong [CII] emission, as well as faint emission from [OI] and [OIII]. The observed emission lines are used to model the average number density and radiation field strength in the photodissociation regions of our high-redshift sample, and the spectral line energy distributions of CO rotational transitions from the low-redshift stack are presented.

Consistent response of bird populations to climate change on two continents.

PubMed

Stephens, Philip A; Mason, Lucy R; Green, Rhys E; Gregory, Richard D; Sauer, John R; Alison, Jamie; Aunins, Ainars; Brotons, Lluís; Butchart, Stuart H M; Campedelli, Tommaso; Chodkiewicz, Tomasz; Chylarecki, Przemysław; Crowe, Olivia; Elts, Jaanus; Escandell, Virginia; Foppen, Ruud P B; Heldbjerg, Henning; Herrando, Sergi; Husby, Magne; Jiguet, Frédéric; Lehikoinen, Aleksi; Lindström, Åke; Noble, David G; Paquet, Jean-Yves; Reif, Jiri; Sattler, Thomas; Szép, Tibor; Teufelbauer, Norbert; Trautmann, Sven; van Strien, Arco J; van Turnhout, Chris A M; Vorisek, Petr; Willis, Stephen G

2016-04-01

Global climate change is a major threat to biodiversity. Large-scale analyses have generally focused on the impacts of climate change on the geographic ranges of species and on phenology, the timing of ecological phenomena. We used long-term monitoring of the abundance of breeding birds across Europe and the United States to produce, for both regions, composite population indices for two groups of species: those for which climate suitability has been either improving or declining since 1980. The ratio of these composite indices, the climate impact indicator (CII), reflects the divergent fates of species favored or disadvantaged by climate change. The trend in CII is positive and similar in the two regions. On both continents, interspecific and spatial variation in population abundance trends are well predicted by climate suitability trends. Copyright © 2016, American Association for the Advancement of Science.

Modelling the interactions between Pseudomonas putida and Escherichia coli O157:H7 in fish-burgers: use of the lag-exponential model and of a combined interaction index.

PubMed

Speranza, B; Bevilacqua, A; Mastromatteo, M; Sinigaglia, M; Corbo, M R

2010-08-01

The objective of the current study was to examine the interactions between Pseudomonas putida and Escherichia coli O157:H7 in coculture studies on fish-burgers packed in air and under different modified atmospheres (30 : 40 : 30 O(2) : CO(2) : N(2), 5 : 95 O(2) : CO(2) and 50 : 50 O(2) : CO(2)), throughout the storage at 8 degrees C. The lag-exponential model was applied to describe the microbial growth. To give a quantitative measure of the occurring microbial interactions, two simple parameters were developed: the combined interaction index (CII) and the partial interaction index (PII). Under air, the interaction was significant (P < 0.05) only within the exponential growth phase (CII, 1.72), whereas under the modified atmospheres, the interactions were highly significant (P < 0.001) and occurred both in the exponential and in the stationary phase (CII ranged from 0.33 to 1.18). PII values for E. coli O157:H7 were lower than those calculated for Ps. putida. The interactions occurring into the system affected both E. coli O157:H7 and pseudomonads subpopulations. The packaging atmosphere resulted in a key element. The article provides some useful information on the interactions occurring between E. coli O157:H7 and Ps. putida on fish-burgers. The proposed index describes successfully the competitive growth of both micro-organisms, giving also a quantitative measure of a qualitative phenomenon.

Tephrostratigraphy of Grotta del Cavallo, Southern Italy: Insights on the chronology of Middle to Upper Palaeolithic transition in the Mediterranean

NASA Astrophysics Data System (ADS)

Zanchetta, Giovanni; Giaccio, Biagio; Bini, Monica; Sarti, Lucia

2018-02-01

The Grotta del Cavallo contains one of the most important stratification of Mousterian, Uluzzian and Final Epigravettian tecnocomplexes; its chronology is of paramount importance for understanding the timing of the transition between Middle and Upper Palaeolithic in the Mediterranean region as well as the demise of the Neanderthal and the dispersal of the first anatomically modern humans through Europe. Within the stratigraphy of the cave three different volcanic ash layers occur (layer G, Fa and C-II). They are located in the middle section of the Mousterian (layer G), in between the Mousterian and Uluzzian layers (layer Fa) and on top of the Uluzzian horizons (layer C-II). The three tephra layers were chemically fingerprinted and correlated to well-known and precisely dated widespread Late Pleistocene tephra markers. Specifically, layer G, Fa and C-II were correlated to the X-6 (108.7 ± 0.9 ka), Y-6 (45.5 ± 1.0 ka) and Campanian Ignimbrite (39.85 ± 0.14 ka), respectively. These findings provide robust chronological points allowing to conclude that: (i) the Mousterian occupation of the cave took place after the fall of the sea level following the MIS 5e high-stand; (ii) the Mousterian-Uluzzian boundary can be dated to 45.5 ± 1.0 ka and climatostratigraphically firmly placed at the transition between the Greenland Interstadial 12 (GI12)-Greenland Stadial 12 (GS12); (iii) the Uluzzian lasted for at least five millennial spanning the GS12-GI9 period and ended at beginning of the Heinrich Event 4.

Morphology of the tympanic-basicranial region in Mirounga leonina (Phocidae, Carnivora), postnatal ontogeny and sexual dimorphism

PubMed Central

Loza, C M; Scarano, A C; Soibelzon, L H; Negrete, J; Carlini, A A

2015-01-01

The auditory region of pinnipeds has seldom been described. Here we describe and analyze the ontogenetic trajectory of the tympanic bulla of the southern elephant seal, Mirounga leonina (Phocidae, Mammalia). This species is extremely sexually dimorphic and highly polygynous (organized in harems). We examined 118 specimens, arranged in three age classes (CI, CII, and CIII), ranging from newborn to adults (males and females). To analyze the overall size and shape of the tympanic bulla we performed a geometric morphometric analysis including 87 skulls. Females reach definitive shape and size of the bulla at earlier ontogenetic stages than males, in agreement with their earlier involvement in reproductive activities. The internal anatomy of the tympanic region (e.g. form and extension of the paries) does not show remarkable differences between sexes or age classes. The greatest differences between age classes are related to bone thickness, resulting from the apposition of new annual layers. An examination of possible sex-related external differences among age classes shows significant shape differences between males and females in CIII. The morphology observed in neonates is conserved across all individuals from CI, which included specimens up to 1 year old. Clear morphological differences were observed between CI individuals, on one hand, and CII individuals plus CIII females on the other. During cranial development of both male and females, the glenoid cavity expands and compresses the bulla; this condition reaches its maximum expression in CIII males. CIII males showed the greatest morphological differences, with respect to both CI and CII individuals, and CIII females. PMID:25827162

47 CFR 22.880 - Information exchange.

Code of Federal Regulations, 2010 CFR

2010-10-01

... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a) Prior notification. Public safety/CII licensees may notify a commercial aviation air-ground system...

Cytoplasmic Copper Detoxification in Salmonella Can Contribute to SodC Metalation but Is Dispensable during Systemic Infection

PubMed Central

Fenlon, Luke A.

2017-01-01

ABSTRACT Salmonella enterica serovar Typhimurium is a leading cause of foodborne disease worldwide. Severe infections result from the ability of S. Typhimurium to survive within host immune cells, despite being exposed to various host antimicrobial factors. SodCI, a copper-zinc-cofactored superoxide dismutase, is required to defend against phagocytic superoxide. SodCII, an additional periplasmic superoxide dismutase, although produced during infection, does not function in the host. Previous studies suggested that CueP, a periplasmic copper binding protein, facilitates acquisition of copper by SodCII. CopA and GolT, both inner membrane ATPases that pump copper from the cytoplasm to the periplasm, are a source of copper for CueP. Using in vitro SOD assays, we found that SodCI can also utilize CueP to acquire copper. However, both SodCI and SodCII have a significant fraction of activity independent of CueP and cytoplasmic copper export. We utilized a series of mouse competition assays to address the in vivo role of CueP-mediated SodC activation. A copA golT cueP triple mutant was equally as competitive as the wild type, suggesting that sufficient SodCI is active to defend against phagocytic superoxide independent of CueP and cytoplasmic copper export. We also confirmed that a strain containing a modified SodCII, which is capable of complementing a sodCI deletion, was fully virulent in a copA golT cueP background competed against the wild type. These competitions also address the potential impact of cytoplasmic copper toxicity within the phagosome. Our data suggest that Salmonella does not encounter inhibitory concentrations of copper during systemic infection. IMPORTANCE Salmonella is a leading cause of gastrointestinal disease worldwide. In severe cases, Salmonella can cause life-threatening systemic infections, particularly in very young children, the elderly, or people who are immunocompromised. To cause disease, Salmonella must survive the hostile environment inside host immune cells, a location in which most bacteria are killed. Our work examines how one particular metal, copper, is acquired by Salmonella to activate a protein important for survival within immune cells. At high levels, copper itself can inhibit Salmonella. Using a strain of Salmonella that cannot detoxify intracellular copper, we also addressed the in vivo role of copper as an antimicrobial agent. PMID:28924031

Carbon Chemistry in Transitional Clouds from the GOT C+ Survey of CII 158 micron Emission in the Galactic Plane

NASA Astrophysics Data System (ADS)

Langer, W. D.; Velusamy, T.; Pineda, J.; Willacy, K.; Goldsmith, P. F.

2011-05-01

In understanding the lifecycle and chemistry of the interstellar gas, the transition from diffuse atomic to molecular gas clouds is a very important stage. The evolution of carbon from C+ to C0 and CO is a fundamental part of this transition, and C+ along with its carbon chemistry is a key diagnostic. Until now our knowledge of interstellar gas has been limited primarily to the diffuse atomic phase traced by HI and the dense molecular H2 phase traced by CO. However, we have generally been missing an important layer in diffuse and transition clouds, which is denoted by the warm "dark gas'', that is mostly H2 and little HI and CO, and is best traced with C+. Here, we discuss the chemistry in the transition from C+ to C0 and CO in these clouds as understood by a survey of the CII 1.9 THz (158 micron) line from a sparse survey of the inner galaxy over about 40 degrees in longitude as part of the Galactic Observations of Terahertz C+ (GOT C+) program, a Herschel Space Observatory Open Time Key Program to study interstellar clouds by sampling ionized carbon. Using the first results from GOT C+ along 11 LOSs, in a sample of 53 transition clouds, Velusamy, Langer et al. (A&A 521, L18, 2010) detected an excess of CII intensities indicative of a thick H2 layer (a significant warm H2, "dark gas'' component) around the 12CO core. Here we present a much larger, statistically significant sample of a few hundred diffuse and transition clouds traced by CII, along with auxiliary HI and CO data in the inner Galaxy between l=-30° and +30°. Our new and more extensive sample of transition clouds is used to elucidate the time dependent physical and carbon chemical evolution of diffuse to transition clouds, and transition layers. We consider the C+ to CO conversion pathways such as H++ O and C+ + H2 chemistry for CO production to constrain the physical parameters such as the FUV intensity and cosmic ray ionization rate that drive the CO chemistry in the diffuse transition clouds.

Cytoplasmic Copper Detoxification in Salmonella Can Contribute to SodC Metalation but Is Dispensable during Systemic Infection.

PubMed

Fenlon, Luke A; Slauch, James M

2017-12-15

Salmonella enterica serovar Typhimurium is a leading cause of foodborne disease worldwide. Severe infections result from the ability of S Typhimurium to survive within host immune cells, despite being exposed to various host antimicrobial factors. SodCI, a copper-zinc-cofactored superoxide dismutase, is required to defend against phagocytic superoxide. SodCII, an additional periplasmic superoxide dismutase, although produced during infection, does not function in the host. Previous studies suggested that CueP, a periplasmic copper binding protein, facilitates acquisition of copper by SodCII. CopA and GolT, both inner membrane ATPases that pump copper from the cytoplasm to the periplasm, are a source of copper for CueP. Using in vitro SOD assays, we found that SodCI can also utilize CueP to acquire copper. However, both SodCI and SodCII have a significant fraction of activity independent of CueP and cytoplasmic copper export. We utilized a series of mouse competition assays to address the in vivo role of CueP-mediated SodC activation. A copA golT cueP triple mutant was equally as competitive as the wild type, suggesting that sufficient SodCI is active to defend against phagocytic superoxide independent of CueP and cytoplasmic copper export. We also confirmed that a strain containing a modified SodCII, which is capable of complementing a sodCI deletion, was fully virulent in a copA golT cueP background competed against the wild type. These competitions also address the potential impact of cytoplasmic copper toxicity within the phagosome. Our data suggest that Salmonella does not encounter inhibitory concentrations of copper during systemic infection. IMPORTANCE Salmonella is a leading cause of gastrointestinal disease worldwide. In severe cases, Salmonella can cause life-threatening systemic infections, particularly in very young children, the elderly, or people who are immunocompromised. To cause disease, Salmonella must survive the hostile environment inside host immune cells, a location in which most bacteria are killed. Our work examines how one particular metal, copper, is acquired by Salmonella to activate a protein important for survival within immune cells. At high levels, copper itself can inhibit Salmonella Using a strain of Salmonella that cannot detoxify intracellular copper, we also addressed the in vivo role of copper as an antimicrobial agent. Copyright © 2017 American Society for Microbiology.

Alterations in mitochondrial electron transport system activity in response to warm acclimation, hypoxia-reoxygenation and copper in rainbow trout, Oncorhynchus mykiss.

PubMed

Sappal, Ravinder; MacDougald, Michelle; Fast, Mark; Stevens, Don; Kibenge, Fred; Siah, Ahmed; Kamunde, Collins

2015-08-01

Fish expend significant amounts of energy to handle the numerous potentially stressful biotic and abiotic factors that they commonly encounter in aquatic environments. This universal requirement for energy singularizes mitochondria, the primary cellular energy transformers, as fundamental drivers of responses to environmental change. Our study probed the interacting effects of thermal stress, hypoxia-reoxygenation (HRO) and copper (Cu) exposure in rainbow trout to test the prediction that they act jointly to impair mitochondrial function. Rainbow trout were acclimated to 11 (controls) or 20°C for 2 months. Liver mitochondria were then isolated and their responses in vitro to Cu (0-20μM) without and with HRO were assessed. Sequential inhibition and activation of mitochondrial electron transport system (ETS) enzyme complexes permitted the measurement of respiratory activities supported by complex I-IV (CI-IV) in one run. The results showed that warm acclimation reduced fish and liver weights but increased mitochondrial protein indicating impairment of energy metabolism, increased synthesis of defense proteins and/or reduced liver water content. Whereas acute rise (11→20°C) in temperature increased mitochondrial oxidation rates supported by CI-IV, warm acclimation reduced the maximal (state 3) and increased the basal (state 4) respiration leading to global uncoupling of oxidative phosphorylation (OXPHOS). HRO profoundly inhibited both maximal and basal respiration rates supported by CI-IV, reduced RCR for all except CII and lowered CI:CII respiration ratio, an indication of decreased OXPHOS efficiency. The effects of Cu were less pronounced but more variable and included inhibition of CII-IV maximal respiration rates and stimulation of both CI and CIII basal respiration rates. Surprisingly, only CII and CIII indices exhibited significant 3-way interactions whereas 2-way interactions of acclimation either with Cu or HRO were portrayed mostly by CIV, and those of HRO and Cu were most common in CI and II respiratory indices. Our study suggests that warm acclimation blunts sensitivity of the ETS to temperature rise and that HRO and warm acclimation impose mitochondrial changes that sensitize the ETS to Cu. Overall, our study highlights the significance of the ETS in mitochondrial bioenergetic dysfunction caused by thermal stress, HRO and Cu exposure. Copyright © 2015 Elsevier B.V. All rights reserved.

6 CFR 29.3 - Effect of provisions.

Code of Federal Regulations, 2011 CFR

2011-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

6 CFR 29.3 - Effect of provisions.

Code of Federal Regulations, 2010 CFR

2010-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

6 CFR 29.3 - Effect of provisions.

Code of Federal Regulations, 2013 CFR

2013-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

6 CFR 29.3 - Effect of provisions.

Code of Federal Regulations, 2014 CFR

2014-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

6 CFR 29.3 - Effect of provisions.

Code of Federal Regulations, 2012 CFR

2012-01-01

... Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROTECTED CRITICAL INFRASTRUCTURE... utilize the PCII only for purposes appropriate under the CII Act, including securing critical infrastructure or protected systems. Such PCII may not be utilized for any other collateral regulatory purposes...

47 CFR 22.973 - Information exchange.

Code of Federal Regulations, 2010 CFR

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information exchange. 22.973 Section 22.973 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.973 Information exchange. (a) Prior notification. Public safety/CII...

48 CFR 225.504 - Evaluation examples.

Code of Federal Regulations, 2010 CFR

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation examples. 225.504 Section 225.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... 225.504 Evaluation examples. For examples that illustrate the evaluation procedures in 225.502(c)(ii...

Relative heating costs for Virginia Department of Highways and Transportation buildings.

DOT National Transportation Integrated Search

1982-01-01

This report presents the results of a survey of the energy used to heat various buildings owned and operated by the Virginia Department of Highways and Transportation. Energy intensity and cost intensity indices (EII and CII) for buildings were calcu...

U.S. EPA, Pesticide Product Label, INSECTICIDE CONCENTRATE, 02/11/1985

EPA Pesticide Factsheets

2011-04-21

... ". ... w ••• 11 dft ... ln- .... el ..... wi" .... 4 h., • .. 0 .... . cil eft ..... If I"'tet'''' ,11'1. If ••• 111."- • "I' •• Alee -.ltI"._ C.II. ",11.:1 ... 1_ ... ,tI,. ...

48 CFR 225.504 - Evaluation examples.

Code of Federal Regulations, 2011 CFR

2011-10-01

... 48 Federal Acquisition Regulations System 3 2011-10-01 2011-10-01 false Evaluation examples. 225..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Evaluating Foreign Offers-Supply Contracts 225.504 Evaluation examples. For examples that illustrate the evaluation procedures in 225.502(c)(ii...

Decreased severity of experimental autoimmune arthritis in peptidylarginine deiminase type 4 knockout mice.

PubMed

Suzuki, Akari; Kochi, Yuta; Shoda, Hirofumi; Seri, Yu; Fujio, Keishi; Sawada, Tetsuji; Yamada, Ryo; Yamamoto, Kazuhiko

2016-05-05

Peptidylarginine deiminase type 4 (PADI4) has been identified as a susceptibility gene for rheumatoid arthritis (RA) by genome-wide association studies. PADI4 is highly expressed in the bone marrow, macrophages, neutrophils, and monocytes. Peptidyl citrulline is an interesting molecule in RA because it is a target antigen for anti-citrullinated peptide antibodies, and only PADs (translated proteins from PADI genes) can provide peptidyl citrulline via the modification of protein substrates. The aim of this study was to evaluate the importance of the PADI4 gene in the progression of RA. We generated Padi4 knockout (Padi4(-/-)) DBA1J mice. The Padi4(-/-) DBA1J and wild-type mice were immunized with bovine type II collagen (CII) to develop collagen-induced arthritis (CIA). The expression of various inflammatory cytokines and Padi genes in immune cells was detected by the real-time TaqMan assay. Cytokine concentrations in sera were measured by enzyme-linked immunosorbent assays. Localization of the PAD4 and PAD2 proteins was indicated by immunohistochemistry. We demonstrated that the clinical disease score was significantly decreased in the Padi4(-/-) mice and Padi4 expression was induced by CII immunization. In the Padi4(-/-) mice, serum anti-type II collagen (CII) immunoglobulin M (IgM), IgG, and inflammatory cytokine levels were significantly decreased compared with those in the wild-type mice. Padi2 expression was induced in the immune cells of the Padi4(-/-) mice as a compensation for the defect in Padi4. Padi4 affected disease severity in the CIA mice and was involved in the enhancement of the collagen-initiated inflammatory responses.

Endogenous estrogen status, but not genistein supplementation, modulates 7,12-dimethylbenz[a]anthracene-induced mutation in the liver cII gene of transgenic big blue rats.

PubMed

Chen, Tao; Hutts, Robert C; Mei, Nan; Liu, Xiaoli; Bishop, Michelle E; Shelton, Sharon; Manjanatha, Mugimane G; Aidoo, Anane

2005-06-01

A growing number of studies suggest that isoflavones found in soybeans have estrogenic activity and may safely alleviate the symptoms of menopause. One of these isoflavones, genistein, is commonly used by postmenopausal women as an alternative to hormone replacement therapy. Although sex hormones have been implicated as an important risk factor for the development of hepatocellular carcinoma, there are limited data on the potential effects of the estrogens, including phytoestrogens, on chemical mutagenesis in liver. Because of the association between mutation induction and the carcinogenesis process, we investigated whether endogenous estrogen and supplemental genistein affect 7,12-dimethylbenz[a]anthracene (DMBA)-induced mutagenesis in rat liver. Intact and ovariectomized female Big Blue rats were treated with 80 mg DMBA/kg body weight. Some of the rats also received a supplement of 1,000 ppm genistein. Sixteen weeks after the carcinogen treatment, the rats were sacrificed, their livers were removed, and mutant frequencies (MFs) and types of mutations were determined in the liver cII gene. DMBA significantly increased the MFs in liver for both the intact and ovariectomized rats. While there was no significant difference in MF between the ovariectomized and intact control animals, the mutation induction by DMBA in the ovariectomized groups was significantly higher than that in the intact groups. Dietary genistein did not alter these responses. Molecular analysis of the mutants showed that DMBA induced chemical-specific types of mutations in the liver cII gene. These results suggest that endogenous ovarian hormones have an inhibitory effect on liver mutagenesis by DMBA, whereas dietary genistein does not modulate spontaneous or DMBA-induced mutagenesis in either intact or ovariectomized rats.

Seawater pH Predicted for the Year 2100 Affects the Metabolic Response to Feeding in Copepodites of the Arctic Copepod Calanus glacialis.

PubMed

Thor, Peter; Bailey, Allison; Halsband, Claudia; Guscelli, Ella; Gorokhova, Elena; Fransson, Agneta

2016-01-01

Widespread ocean acidification (OA) is transforming the chemistry of the global ocean, and the Arctic is recognised as a region where the earliest and strongest impacts of OA are expected. In the present study, metabolic effects of OA and its interaction with food availability was investigated in Calanus glacialis from the Kongsfjord, West Spitsbergen. We measured metabolic rates and RNA/DNA ratios (an indicator of biosynthesis) concurrently in fed and unfed individuals of copepodite stages CII-CIII and CV subjected to two different pH levels representative of present day and the "business as usual" IPCC scenario (RCP8.5) prediction for the year 2100. The copepods responded more strongly to changes in food level than to decreasing pH, both with respect to metabolic rate and RNA/DNA ratio. However, significant interactions between effects of pH and food level showed that effects of pH and food level act in synergy in copepodites of C. glacialis. While metabolic rates in copepodites stage CII-CIII increased by 78% as a response to food under present day conditions (high pH), the increase was 195% in CII-CIIIs kept at low pH-a 2.5 times greater increase. This interaction was absent for RNA/DNA, so the increase in metabolic rates were clearly not a reaction to changing biosynthesis at low pH per se but rather a reaction to increased metabolic costs per unit of biosynthesis. Interestingly, we did not observe this difference in costs of growth in stage CV. A 2.5 times increase in metabolic costs of growth will leave the copepodites with much less energy for growth. This may infer significant changes to the C. glacialis population during future OA.

OT2_smalhotr_3: Herschel Extreme Lensing Line Observations (HELLO)

NASA Astrophysics Data System (ADS)

Malhotra, S.

2011-09-01

We request 59.8 hours of Herschel time to observe 20 normal star-forming galaxies in the [CII] 158 micron and [OI] 63 micron lines. These galaxies lie at high redshift (1

Regional projection of climate impact indices over the Mediterranean region

NASA Astrophysics Data System (ADS)

Casanueva, Ana; Frías, M.; Dolores; Herrera, Sixto; Bedia, Joaquín; San Martín, Daniel; Gutiérrez, José Manuel; Zaninovic, Ksenija

2014-05-01

Climate Impact Indices (CIIs) are being increasingly used in different socioeconomic sectors to transfer information about climate change impacts and risks to stakeholders. CIIs are typically based on different weather variables such as temperature, wind speed, precipitation or humidity and comprise, in a single index, the relevant meteorological information for the particular impact sector (in this study wildfires and tourism). This dependence on several climate variables poses important limitations to the application of statistical downscaling techniques, since physical consistency among variables is required in most cases to obtain reliable local projections. The present study assesses the suitability of the "direct" downscaling approach, in which the downscaling method is directly applied to the CII. In particular, for illustrative purposes, we consider two popular indices used in the wildfire and tourism sectors, the Fire Weather Index (FWI) and the Physiological Equivalent Temperature (PET), respectively. As an example, two case studies are analysed over two representative Mediterranean regions of interest for the EU CLIM-RUN project: continental Spain for the FWI and Croatia for the PET. Results obtained with this "direct" downscaling approach are similar to those found from the application of the statistical downscaling to the individual meteorological drivers prior to the index calculation ("component" downscaling) thus, a wider range of statistical downscaling methods could be used. As an illustration, future changes in both indices are projected by applying two direct statistical downscaling methods, analogs and linear regression, to the ECHAM5 model. Larger differences were found between the two direct statistical downscaling approaches than between the direct and the component approaches with a single downscaling method. While these examples focus on particular indices and Mediterranean regions of interest for CLIM-RUN stakeholders, the same study could be extended to other indices and regions.

Extended Star-formation and Disk-like Kinematics in a z~3 Massive ``Main-Sequence'' Galaxy through [CII] Imaging and Multi-J CO Line Observations

NASA Astrophysics Data System (ADS)

Leung, Tsz Kuk Daisy; Riechers, Dominik A.; Clements, David; Cooray, Asantha; Ivison, Rob; Perez-Fournon, Ismael; Wardlow, Julie

2018-01-01

Dusty star-forming galaxies (SFG) at high redshifts are the main contributors to the comoving star formation rate (SFR) density, which peaks between the redshift of z=1-3 (``Cosmic Noon''). Yet, new insights into their gas dynamics, and thus, structural evolution are awaiting spatially resolved observations. I will present the latest results from our kpc-scale [CII] imaging and multi-J CO line observations obtained with ALMA, CARMA, PdBI, and the VLA in one of the most massive ``main-sequence'' disk galaxy known. XMM03 (z=2.9850) is an extremely IR-luminous galaxy with a SFR of ~3000 Msun/yr, but its molecular gas excitation is surprisingly similar to the Milky Way up to J=5, which is in stark contrast with most high-z galaxies studied to date. The monotonic velocity gradient seen in the [CII] line emission suggest that it is a rotating disk galaxy. Based on the molecular gas surface density and the far-UV radiation flux determined from photo-dissociation region (PDR) modeling, the star-forming environment of XMM03 is similar to nearby SFGs. These findings together with the ~1100 km/s wide CO(1-0) line across the entire disk of ~8 kpc in radius showcase the different interstellar medium (ISM) environment that we are probing at the most massive end of galaxies in the early Universe. With a stellar mass of M*~10^12, its specific SFR is consistent with an extrapolation of the ``star-forming main-sequence'' up to M*~10^12 Msun at z~3. Our findings therefore confirm the prevalence of disk-wide star formation responsible for assembling most of the stellar masses toward the ``Cosmic Noon''.

Increased platelet mitochondrial respiration after cardiac arrest and resuscitation as a potential peripheral biosignature of cerebral bioenergetic dysfunction.

PubMed

Ferguson, Michael A; Sutton, Robert M; Karlsson, Michael; Sjövall, Fredrik; Becker, Lance B; Berg, Robert A; Margulies, Susan S; Kilbaugh, Todd J

2016-06-01

Cardiac arrest (CA) results in a sepsis-like syndrome with activation of the innate immune system and increased mitochondrial bioenergetics. To determine if platelet mitochondrial respiration increases following CA in a porcine pediatric model of asphyxia-associated ventricular fibrillation (VF) CA, and if this readily obtained biomarker is associated with decreased brain mitochondrial respiration. CA protocol: 7 min of asphyxia, followed by VF, protocolized titration of compression depth to systolic blood pressure of 90 mmHg and vasopressor administration to a coronary perfusion pressure greater than 20 mmHg. platelet integrated mitochondrial electron transport system (ETS) function evaluated pre- and post-CA/ROSC four hours after return of spontaneous circulation (ROSC). Secondary outcome: correlation of platelet mitochondrial bioenergetics to cerebral bioenergetic function. Platelet maximal oxidative phosphorylation (OXPHOSCI+CII), P < 0.02, and maximal respiratory capacity (ETSCI+CII), P < 0.04, were both significantly increased compared to pre-arrest values. This was primarily due to a significant increase in succinate-supported respiration through Complex II (OXPHOSCII, P < 0.02 and ETSCII, P < 0.03). Higher respiration was not due to uncoupling, as the LEAKCI + CII respiration (mitochondrial respiration independent of ATP-production) was unchanged after CA/ROSC. Larger increases in platelet mitochondrial respiratory control ratio (RCR) compared to pre-CA RCR were significantly correlated with lower RCRs in the cortex (P < 0.03) and hippocampus (P < 0.04) compared to sham respiration. Platelet mitochondrial respiration is significantly increased four hours after ROSC. Future studies will identify mechanistic relationships between this serum biomarker and altered cerebral bioenergetics function following cardiac arrest.

47 CFR 22.880 - Information exchange.

Code of Federal Regulations, 2014 CFR

2014-10-01

... 47 Telecommunication 2 2014-10-01 2014-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

47 CFR 22.880 - Information exchange.

Code of Federal Regulations, 2012 CFR

2012-10-01

... 47 Telecommunication 2 2012-10-01 2012-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

47 CFR 22.880 - Information exchange.

Code of Federal Regulations, 2013 CFR

2013-10-01

... 47 Telecommunication 2 2013-10-01 2013-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

47 CFR 22.880 - Information exchange.

Code of Federal Regulations, 2011 CFR

2011-10-01

... 47 Telecommunication 2 2011-10-01 2011-10-01 false Information exchange. 22.880 Section 22.880...-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.880 Information exchange. (a...-ground system licensee must provide the following information to the public safety/CII licensee at least...

45 CFR 1326.9 - Contributions.

Code of Federal Regulations, 2010 CFR

2010-10-01

..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

45 CFR 1326.9 - Contributions.

Code of Federal Regulations, 2011 CFR

2011-10-01

..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

45 CFR 1326.9 - Contributions.

Code of Federal Regulations, 2013 CFR

2013-10-01

..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

45 CFR 1326.9 - Contributions.

Code of Federal Regulations, 2012 CFR

2012-10-01

..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

45 CFR 1326.9 - Contributions.

Code of Federal Regulations, 2014 CFR

2014-10-01

..., DEPARTMENT OF HEALTH AND HUMAN SERVICES THE ADMINISTRATION ON AGING, OLDER AMERICANS PROGRAMS GRANTS TO INDIAN TRIBES FOR SUPPORT AND NUTRITION SERVICES § 1326.9 Contributions. (a) Each tribal organization... nutrition services contributions only to expand services as provided under section 307(a)(13)(c)(ii) of the...

Effect of temperature on enzymatic and physiological factors related to chilling injury in carambola fruit (Averrhoa carambola L.).

PubMed

Pérez-Tello, G O; Silva-Espinoza, B A; Vargas-Arispuro, I; Briceño-Torres, B O; Martinez-Tellez, M A

2001-10-05

Three groups of carambola fruits (Averrhoa carambola L.) were stored at 2 and 10 degrees C (85-90% relative humidity). The major physicochemical, physiological, and enzymatic responses of fruit were measured in each group over a 30-day period: chilling injury index (CII), decay (%), intracuticular waxes, cuticle permeability, pulp firmness, weight loss, sucrose, fructose and glucose contents, ion electrolyte leakage in pulp (%), ethylene and carbon dioxide production rates, and the activities of peroxidase (POD), polyphenol oxidase (PPO), and phenylalanine ammonia-lyase (PAL) enzymes. CII values were statistically different at 2 and 10 degrees C, showing high significance with respect to sucrose content and weight loss (P < 0.05). Chilling injury included darkened ribs and skin desiccation. According to the CI symptom development, a possible relationship of POD and PPO activities was found at 2 degrees C. A significant sucrose content increase was observed at 10 degrees C. CI symptoms were associated with POD and PAL activities. Copyright 2001 Academic Press.

ZINGRS: CO2-1 observations of strong C+ emitters at z~2

NASA Astrophysics Data System (ADS)

Scrabeck, Alex; Ferkinhoff, Carl; Brisbin, Drew; Lamarche, Cody; Vishwas, Amit; Nikola, Thomas; Stacey, Gordon J.; Higdon, James L.; Higdon, Sarah; Walter, Fabian; Decarli, Roberto

2018-06-01

We present new CO(2-1) line observations from NOEMA of five strong C+ emitting galaxies at high redshift. These galaxies, pulled from the Zeus INvestigated Galaxy Reference Sample (ZINGRS), were observed in their [CII] 158 micron line with the ZEUS instrument showing strong emission, 1 to 2% of their total far-IR luminosity. Our previous work suggests this emission is produced by normal star forming processes in photo-dissociation regions (PDRs), albeit on a galaxy wide scale fueled by cold-flow accretion. However, we could not fully exclude other mechanisms accounting for some or all of the emission. The work presented here, combining the CO emission with the [CII] 158 micron line, is consistent with PDRs being the source of the extreme C+ emission. It is further evidence for the existence of gas-rich galaxies in the early Universe undergoing galaxy-wide starbursts. These systems are not present in the nearby Universe, so represent a unique yet import evolutionary stage at early epochs.

OT2_wlanger_7: Dynamics of Giant Magnetic Gas Loops and Their Connection to the CMZ in the Galactic Center

NASA Astrophysics Data System (ADS)

Langer, W.

2011-09-01

Understanding the mass transfer and dynamics among the Galactic Center, the disk, and the halo of the Milky Way is fundamental to the study of the evolution of galaxies and star formation. Recently several giant loops of molecular gas (GML) have been found in the Galactic Center from CO maps, which are likely the result of the magnetic Parker instability. There is new evidence of a possible connection between these loops and the Central Molecular Zone as shown in a sparse [CII] sampling made by the Herschel Key Project GOT C+. Here we propose to map various features of the GMLs and the interface region in [CII] with HIFI. We will also map the foot points of the loop, which are thought to be highly shocked regions, in the ortho 110-101 line of water, which is a known shock tracer. With this data we will characterize different ISM components and their flow among these Galactic Center features.

Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage

PubMed Central

Ge, Changrong; Tong, Dongmei; Liang, Bibo; Schneider, Nadine; Viljanen, Johan; Stawikowska, Roma; Fields, Gregg B.; Skogh, Thomas; Kihlberg, Jan; Burkhardt, Harald

2017-01-01

Today, it is known that autoimmune diseases start a long time before clinical symptoms appear. Anti-citrullinated protein antibodies (ACPAs) appear many years before the clinical onset of rheumatoid arthritis (RA). However, it is still unclear if and how ACPAs are arthritogenic. To better understand the molecular basis of pathogenicity of ACPAs, we investigated autoantibodies reactive against the C1 epitope of collagen type II (CII) and its citrullinated variants. We found that these antibodies are commonly occurring in RA. A mAb (ACC1) against citrullinated C1 was found to cross-react with several noncitrullinated epitopes on native CII, causing proteoglycan depletion of cartilage and severe arthritis in mice. Structural studies by X-ray crystallography showed that such recognition is governed by a shared structural motif “RG-TG” within all the epitopes, including electrostatic potential-controlled citrulline specificity. Overall, we have demonstrated a molecular mechanism that explains how ACPAs trigger arthritis. PMID:28679953

U.S. EPA, Pesticide Product Label, ISOTOX INSECT KILLER FORMULA IV, 11/19/1992

EPA Pesticide Factsheets

2011-04-13

... StIr.bs ,"'1 "" f ,lpl\\ ] T: s II ' : I ,';' T • j' , •• , S; 'do ... ~t" '''stCII 0' /fI,tn II, plfler~ oriel-jon" ~.-t;, \\ "~l "~' -td R'.-Ul,t 'f''''nlahon occur, For Mfilybul~"IOw.' ...

U.S. EPA, Pesticide Product Label, BALAN E.C., 02/08/1993

EPA Pesticide Factsheets

2011-04-21

... CII CDIIct 517~ • tOO. • • • • Ali 3 ..... 0." lIP DollCllllliPor __ foodI~VUgs • or daI'.1Q.. ... pi' r ,', L • ~"'-cIioiIy"'-- _ . ..., WtIorIn e 6 • ' .. Maid boom .... _ .. ...

Associations between Intimate Partner Violence and Health among Men Who Have Sex with Men: A Systematic Review and Meta-Analysis

PubMed Central

Buller, Ana Maria; Devries, Karen M.; Howard, Louise M.; Bacchus, Loraine J.

2014-01-01

Background Intimate partner violence (IPV) among men who have sex with men (MSM) is a significant problem. Little is known about the association between IPV and health for MSM. We aimed to estimate the association between experience and perpetration of IPV, and various health conditions and sexual risk behaviours among MSM. Methods and Findings We searched 13 electronic databases up to 23 October 2013 to identify research studies reporting the odds of health conditions or sexual risk behaviours for MSM experiencing or perpetrating IPV. Nineteen studies with 13,797 participants were included in the review. Random effects meta-analyses were performed to estimate pooled odds ratios (ORs). Exposure to IPV as a victim was associated with increased odds of substance use (OR = 1.88, 95% CIOR 1.59–2.22, I 2 = 46.9%, 95% CII 2 0%–78%), being HIV positive (OR = 1.46, 95% CIOR 1.26–1.69, I 2 = 0.0%, 95% CII 2 0%–62%), reporting depressive symptoms (OR = 1.52, 95% CIOR 1.24–1.86, I 2 = 9.9%, 95% CII 2 0%–91%), and engagement in unprotected anal sex (OR = 1.72, 95% CIOR 1.44–2.05, I 2 = 0.0%, 95% CII 2 0%–68%). Perpetration of IPV was associated with increased odds of substance use (OR = 1.99, 95% CIOR 1.33–2.99, I 2 = 73.1%). These results should be interpreted with caution because of methodological weaknesses such as the lack of validated tools to measure IPV in this population and the diversity of recall periods and key outcomes in the identified studies. Conclusions MSM who are victims of IPV are more likely to engage in substance use, suffer from depressive symptoms, be HIV positive, and engage in unprotected anal sex. MSM who perpetrate IPV are more likely to engage in substance use. Our results highlight the need for research into effective interventions to prevent IPV in MSM, as well as the importance of providing health care professionals with training in how to address issues of IPV among MSM and the need to raise awareness of local and national support services. Please see later in the article for the Editors' Summary PMID:24594975

Contemporary Issues in Science. Implementation Manual.

ERIC Educational Resources Information Center

Staten Island Continuum of Education, NY.

Contemporary Issues in Science Program (CIIS) is designed to provide teachers and students with the necessary tools and strategies for bringing contemporary scientific issues into the classroom. Provided in this document are discussions of the three major elements in the program, support elements, and major activities. Major elements include the…

76 FR 22447 - Office of Hazardous Materials Safety; Notice of Application for Special Permits

Federal Register 2010, 2011, 2012, 2013, 2014

2011-04-21

... Mohawk Electrical. 49 CFR 173.62.... To authorize the transportation in commerce of three (3) Mines, 1.1D... ethylene 173.31(e)(2)(ii) oxide in a DOT , 173.314, and 105J400W tank car 173.323(c)(ii). with a maximum...

The Design and Analysis of Efficient Learning Algorithms

DTIC Science & Technology

1991-01-01

will be c-close to the target concept with high probability. (Technically, their approach needs some minor modifications to handle, for instance, a...test in the sense that if cii = cik = cik then nothing can be concluded about the relative depth of 17, and Fk . However, our next lemnas give

40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

Code of Federal Regulations, 2011 CFR

2011-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.9324(a) i. Collecting the combustion temperature data according to § 63.9306(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour average combustion temperature...

40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

Code of Federal Regulations, 2014 CFR

2014-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.9324(a) i. Collecting the combustion temperature data according to § 63.9306(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour average combustion temperature...

40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

Code of Federal Regulations, 2010 CFR

2010-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.9324(a) i. Collecting the combustion temperature data according to § 63.9306(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour average combustion temperature...

40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

Code of Federal Regulations, 2013 CFR

2013-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.9324(a) i. Collecting the combustion temperature data according to § 63.9306(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour average combustion temperature...

40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

Code of Federal Regulations, 2012 CFR

2012-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.9324(a) i. Collecting the combustion temperature data according to § 63.9306(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour average combustion temperature...

75 FR 44053 - Proposed Collection; Comment Request: CDFI/CDE Project Profiles Web Form

Federal Register 2010, 2011, 2012, 2013, 2014

2010-07-27

...; Comment Request: CDFI/CDE Project Profiles Web Form ACTION: Notice and request for comments. SUMMARY: The... the Treasury, is soliciting comments concerning the CDFI/CDE Project Profile Web Form, a voluntary... CIIS. The CDFI Fund plans to use the descriptions in CDFI Fund publications, on its Web site and in...

The Comparative Performance of Conditional Independence Indices

ERIC Educational Resources Information Center

Kim, Doyoung; De Ayala, R. J.; Ferdous, Abdullah A.; Nering, Michael L.

2011-01-01

To realize the benefits of item response theory (IRT), one must have model-data fit. One facet of a model-data fit investigation involves assessing the tenability of the conditional item independence (CII) assumption. In this Monte Carlo study, the comparative performance of 10 indices for identifying conditional item dependence is assessed. The…

47 CFR 22.972 - Interference resolution procedures.

Code of Federal Regulations, 2010 CFR

2010-10-01

... include, but not be limited to, the following techniques: (i) Increasing the desired power of the public safety/CII signal; (ii) Decreasing the power of the part 90 ESMR and/or Cellular Radiotelephone system... knowledge or belief after due diligence; (iv) Is not proffered by a contractor or other third party; and (v...

78 FR 8295 - Guarantees for Bonds Issued for Community or Economic Development Purposes

Federal Register 2010, 2011, 2012, 2013, 2014

2013-02-05

.... V. Rulemaking Analysis A. Executive Order (E.O.) 12866; Regulatory Impact Analysis It has been... Budget. The Regulatory Impact Analysis prepared by the CDFI Fund for the interim rule is provided below... Community Investment Impact System (CIIS), which collects data from CDFIs that have received awards from the...

5 CFR 353.110 - OPM placement assistance.

Code of Federal Regulations, 2010 CFR

2010-01-01

..., NW., Washington, DC 20415.) (i) Executive branch employees (other than an employee of an intelligence... control; and (iv) Employees of the intelligence agencies (defined in 5 U.S.C. 2302(a)(2)(C)(ii)) when... competitive status or is eligible to acquire it under 5 U.S.C. 3304(C). If the employee's agency is abolished...

Transpersonal Graduate Education in Psychology: Alumni Self-Identified Thematic Patterns of Development

ERIC Educational Resources Information Center

Campbell, Colleen J.

2010-01-01

In a world that changes every day, individuals who assist others with change, support change, and create strategies for change, herein referred to as "change agents", play an important role in society. The California Institute of Integral Studies (CIIS), The Institute of Transpersonal Psychology (ITP), and Saybrook Graduate School and…

46 CFR 76.50-10 - Location.

Code of Federal Regulations, 2011 CFR

2011-10-01

... square feet or fraction thereof located in vicinity of exits, except that none required for spaces under 500 square feet. Open decks or enclosed promenades None required. Service spaces Galleys B-II or C-II 1 for each 2,500 square feet or fraction thereof suitable for hazards involved. Main pantries A-II 1...

46 CFR 76.50-10 - Location.

Code of Federal Regulations, 2012 CFR

2012-10-01

... square feet or fraction thereof located in vicinity of exits, except that none required for spaces under 500 square feet. Open decks or enclosed promenades None required. Service spaces Galleys B-II or C-II 1 for each 2,500 square feet or fraction thereof suitable for hazards involved. Main pantries A-II 1...

Cellulose pretreatment with 1-n-butyl-3-methylimidazolium chloride for solid acid-catalyzed hydrolysis.

PubMed

Kim, Soo-Jin; Dwiatmoko, Adid Adep; Choi, Jae Wook; Suh, Young-Woong; Suh, Dong Jin; Oh, Moonhyun

2010-11-01

This study has been focused on developing a cellulose pretreatment process using 1-n-butyl-3-methylimidazolium chloride ([bmim]Cl) for subsequent hydrolysis over Nafion(R) NR50. Thus, several pretreatment variables such as the pretreatment period and temperature, and the [bmim]Cl amount were varied. Additionally, the [bmim]Cl-treated cellulose samples were characterized by X-ray diffraction analysis, and their crystallinity index values including CI(XD), CI(XD-CI) and CI(XD-CII) were then calculated. When correlated with these values, the concentrations of total reducing sugars (TRS) obtained by the pretreatment of native cellulose (NC) and glucose produced by the hydrolysis reaction were found to show a distinct relationship with the [CI(NC)-CI(XD)] and CI(XD-CII) values, respectively. Consequently, the cellulose pretreatment step with [bmim]Cl is to loosen a crystalline cellulose through partial transformation of cellulose I to cellulose II and, furthermore, the TRS release, while the subsequent hydrolysis of [bmim]Cl-treated cellulose over Nafion(R) NR50 is effective to convert cellulose II to glucose. Copyright 2010 Elsevier Ltd. All rights reserved.

Design and Fabrication of TES Detector Modules for the TIME-Pilot [CII] Intensity Mapping Experiment

NASA Astrophysics Data System (ADS)

Hunacek, J.; Bock, J.; Bradford, C. M.; Bumble, B.; Chang, T.-C.; Cheng, Y.-T.; Cooray, A.; Crites, A.; Hailey-Dunsheath, S.; Gong, Y.; Kenyon, M.; Koch, P.; Li, C.-T.; O'Brient, R.; Shirokoff, E.; Shiu, C.; Staniszewski, Z.; Uzgil, B.; Zemcov, M.

2016-08-01

We are developing a series of close-packed modular detector arrays for TIME-Pilot, a new mm-wavelength grating spectrometer array that will map the intensity fluctuations of the redshifted 157.7 \\upmu m emission line of singly ionized carbon ([CII]) from redshift z ˜ 5 to 9. TIME-Pilot's two banks of 16 parallel-plate waveguide spectrometers (one bank per polarization) will have a spectral range of 183-326 GHz and a resolving power of R ˜ 100. The spectrometers use a curved diffraction grating to disperse and focus the light on a series of output arcs, each sampled by 60 transition edge sensor (TES) bolometers with gold micro-mesh absorbers. These low-noise detectors will be operated from a 250 mK base temperature and are designed to have a background-limited NEP of {˜ }10^{-17} mathrm {W}/mathrm {Hz}^{1/2}. This proceeding presents an overview of the detector design in the context of the TIME-Pilot instrument. Additionally, a prototype detector module produced at the Microdevices Laboratory at JPL is shown.

Amyloid fibril proteins and amyloidosis: chemical identification and clinical classification International Society of Amyloidosis 2016 Nomenclature Guidelines.

PubMed

Sipe, Jean D; Benson, Merrill D; Buxbaum, Joel N; Ikeda, Shu-Ichi; Merlini, Giampaolo; Saraiva, Maria J M; Westermark, Per

2016-12-01

The Nomenclature Committee of the International Society of Amyloidosis (ISA) met during the XVth Symposium of the Society, 3 July-7 July 2016, Uppsala, Sweden, to assess and formulate recommendations for nomenclature for amyloid fibril proteins and the clinical classification of the amyloidoses. An amyloid fibril must exhibit affinity for Congo red and with green, yellow or orange birefringence when the Congo red-stained deposits are viewed with polarized light. While congophilia and birefringence remain the gold standard for demonstration of amyloid deposits, new staining and imaging techniques are proving useful. To be included in the nomenclature list, in addition to congophilia and birefringence, the chemical identity of the protein must be unambiguously characterized by protein sequence analysis when possible. In general, it is insufficient to identify a mutation in the gene of a candidate amyloid protein without confirming the variant changes in the amyloid fibril protein. Each distinct form of amyloidosis is uniquely characterized by the chemical identity of the amyloid fibril protein that deposits in the extracellular spaces of tissues and organs and gives rise to the disease syndrome. The fibril proteins are designated as protein A followed by a suffix that is an abbreviation of the parent or precursor protein name. To date, there are 36 known extracellular fibril proteins in humans, 2 of which are iatrogenic in nature and 9 of which have also been identified in animals. Two newly recognized fibril proteins, AApoCII derived from apolipoprotein CII and AApoCIII derived from apolipoprotein CIII, have been added. AApoCII amyloidosis and AApoCIII amyloidosis are hereditary systemic amyloidoses. Intracellular protein inclusions displaying some of the properties of amyloid, "intracellular amyloid" have been reported. Two proteins which were previously characterized as intracellular inclusions, tau and α-synuclein, are now recognized to form extracellular deposits upon cell death and thus have been included in Table 1 as ATau and AαSyn.

A highly selective, orally active inhibitor of Janus kinase 2, CEP-33779, ablates disease in two mouse models of rheumatoid arthritis

PubMed Central

2011-01-01

Introduction Janus kinase 2 (JAK2) is involved in the downstream activation of signal transducer and activator of transcription 3 (STAT3) and STAT5 and is responsible for transducing signals for several proinflammatory cytokines involved in the pathogenesis of rheumatoid arthritis (RA), including interleukin (IL)-6, interferon γ (IFNγ) and IL-12. In this paper, we describe the efficacy profile of CEP-33779, a highly selective, orally active, small-molecule inhibitor of JAK2 evaluated in two mouse models of RA. Methods Collagen antibody-induced arthritis (CAIA) and collagen type II (CII)-induced arthritis (CIA) were established before the oral administration of a small-molecule JAK2 inhibitor, CEP-33779, twice daily at 10 mg/kg, 30 mg/kg, 55 mg/kg or 100 mg/kg over a period of 4 to 8 weeks. Results Pharmacodynamic inhibition of JAK2 reduced mean paw edema and clinical scores in both CIA and CAIA models of arthritis. Reduction in paw cytokines (IL-12, IFNγ and tumor necrosis factor α) and serum cytokines (IL-12 and IL-2) correlated with reduced spleen CII-specific T helper 1 cell frequencies as measured by ex vivo IFNγ enzyme-linked immunosorbent spot assay. Both models demonstrated histological evidence of disease amelioration upon treatment (for example, reduced matrix erosion, subchondral osteolysis, pannus formation and synovial inflammation) and reduced paw phosphorylated STAT3 levels. No changes in body weight or serum anti-CII autoantibody titers were observed in either RA model. Conclusions This study demonstrates the utility of using a potent and highly selective, orally bioavailable JAK2 inhibitor for the treatment of RA. Using a selective inhibitor of JAK2 rather than pan-JAK inhibitors avoids the potential complication of immunosuppression while targeting critical signaling pathways involved in autoimmune disease progression. PMID:21510883

Physical Fitness and Mitochondrial Respiratory Capacity in Horse Skeletal Muscle

PubMed Central

Lemieux, Hélène; Mouithys-Mickalad, Ange; Serteyn, Didier

2012-01-01

Background Within the animal kingdom, horses are among the most powerful aerobic athletic mammals. Determination of muscle respiratory capacity and control improves our knowledge of mitochondrial physiology in horses and high aerobic performance in general. Methodology/Principal Findings We applied high-resolution respirometry and multiple substrate-uncoupler-inhibitor titration protocols to study mitochondrial physiology in small (1.0–2.5 mg) permeabilized muscle fibres sampled from triceps brachii of healthy horses. Oxidative phosphorylation (OXPHOS) capacity (pmol O2•s−1•mg−1 wet weight) with combined Complex I and II (CI+II) substrate supply (malate+glutamate+succinate) increased from 77±18 in overweight horses to 103±18, 122±15, and 129±12 in untrained, trained and competitive horses (N = 3, 8, 16, and 5, respectively). Similar to human muscle mitochondria, equine OXPHOS capacity was limited by the phosphorylation system to 0.85±0.10 (N = 32) of electron transfer capacity, independent of fitness level. In 15 trained horses, OXPHOS capacity increased from 119±12 to 134±37 when pyruvate was included in the CI+II substrate cocktail. Relative to this maximum OXPHOS capacity, Complex I (CI)-linked OXPHOS capacities were only 50% with glutamate+malate, 64% with pyruvate+malate, and 68% with pyruvate+malate+glutamate, and ∼78% with CII-linked succinate+rotenone. OXPHOS capacity with glutamate+malate increased with fitness relative to CI+II-supported ETS capacity from a flux control ratio of 0.38 to 0.40, 0.41 and 0.46 in overweight to competitive horses, whereas the CII/CI+II substrate control ratio remained constant at 0.70. Therefore, the apparent deficit of the CI- over CII-linked pathway capacity was reduced with physical fitness. Conclusions/Significance The scope of mitochondrial density-dependent OXPHOS capacity and the density-independent (qualitative) increase of CI-linked respiratory capacity with increased fitness open up new perspectives of integrative and comparative mitochondrial respiratory physiology. PMID:22529950

Gas and dust in the beta Pictoris moving group as seen by the Herschel Space Observatory

NASA Astrophysics Data System (ADS)

Riviere-Marichalar, P.; Barrado, D.; Montesinos, B.; Duchêne, G.; Bouy, H.; Pinte, C.; Menard, F.; Donaldson, J.; Eiroa, C.; Krivov, A. V.; Kamp, I.; Mendigutía, I.; Dent, W. R. F.; Lillo-Box, J.

2014-05-01

Context. Debris discs are thought to be formed through the collisional grinding of planetesimals, and then can be considered as the outcome of planet formation. Understanding the properties of gas and dust in debris discs can help us comprehend the architecture of extrasolar planetary systems. Herschel Space Observatory far-infrared (IR) photometry and spectroscopy have provided a valuable dataset for the study of debris discs gas and dust composition. This paper is part of a series of papers devoted to the study of Herschel-PACS observations of young stellar associations. Aims: This work aims at studying the properties of discs in the beta Pictoris moving group (BPMG) through far-IR PACS observations of dust and gas. Methods: We obtained Herschel-PACS far-IR photometric observations at 70, 100, and 160 μm of 19 BPMG members, together with spectroscopic observations for four of them. These observations were centred at 63.18 μm and 157 μm, aiming to detect [OI] and [CII] emission. We incorporated the new far-IR observations in the SED of BPMG members and fitted modified blackbody models to better characterise the dust content. Results: We have detected far-IR excess emission towards nine BPMG members, including the first detection of an IR excess towards HD 29391.The star HD 172555, shows [OI] emission, while HD 181296 shows [CII] emission, expanding the short list of debris discs with a gas detection. No debris disc in BPMG is detected in both [OI] and [CII]. The discs show dust temperatures in the range 55-264 K, with low dust masses (<6.6 × 10-5 M⊕ to 0.2 M⊕) and radii from blackbody models in the range 3 to ~82 AU. All the objects with a gas detection are early spectral type stars with a hot dust component. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Preliminary three-dimensional analysis of tooth movement and arch dimension change of the maxillary dentition in Class II division 1 malocclusion treated with first premolar extraction: conventional anchorage vs. mini-implant anchorage.

PubMed

Park, Heon-Mook; Kim, Byoung-Ho; Yang, Il-Hyung; Baek, Seung-Hak

2012-12-01

This study aimed to compare the effects of conventional and orthodontic mini-implant (OMI) anchorage on tooth movement and arch-dimension changes in the maxillary dentition in Class II division 1 (CII div.1) patients. CII div.1 patients treated with extraction of the maxillary first and mandibular second premolars and sliding mechanics were allotted to conventional anchorage group (CA, n = 12) or OMI anchorage group (OA, n = 12). Pre- and post-treatment three-dimensional virtual maxillary models were superimposed using the best-fit method. Linear, angular, and arch-dimension variables were measured with software program. Mann-Whitney U-test and Wilcoxon signed-rank test were performed for statistical analysis. Compared to the CA group, the OMI group showed more backward movement of the maxillary central and lateral incisors and canine (MXCI, MXLI, MXC, respectively; 1.6 mm, p < 0.001; 0.9 mm, p < 0.05; 1.2 mm, p < 0.001); more intrusion of the MXCI and MXC (1.3 mm, 0.5 mm, all p < 0.01); less forward movement of the maxillary second premolar, first, and second molars (MXP2, MXM1, MXM2, respectively; all 1.0 mm, all p < 0.05); less contraction of the MXP2 and MXM1 (0.7 mm, p < 0.05; 0.9 mm, p < 0.001); less mesial-in rotation of the MXM1 and MXM2 (2.6°, 2.5°, all p < 0.05); and less decrease of the inter-MXP2, MXM1, and MXM2 widths (1.8 mm, 1.5 mm, 2.0 mm, all p < 0.05). In treatment of CII div.1 malocclusion, OA provided better anchorage and less arch-dimension change in the maxillary posterior teeth than CA during en-masse retraction of the maxillary anterior teeth.

Linking xylem water storage with anatomical parameters in five temperate tree species.

PubMed

Jupa, Radek; Plavcová, Lenka; Gloser, Vít; Jansen, Steven

2016-06-01

The release of water from storage compartments to the transpiration stream is an important functional mechanism that provides the buffering of sudden fluctuations in water potential. The ability of tissues to release water per change in water potential, referred to as hydraulic capacitance, is assumed to be associated with the anatomy of storage tissues. However, information about how specific anatomical parameters determine capacitance is limited. In this study, we measured sapwood capacitance (C) in terminal branches and roots of five temperate tree species (Fagus sylvatica L., Picea abies L., Quercus robur L., Robinia pseudoacacia L., Tilia cordata Mill.). Capacitance was calculated separately for water released mainly from capillary (CI; open vessels, tracheids, fibres, intercellular spaces and cracks) and elastic storage compartments (CII; living parenchyma cells), corresponding to two distinct phases of the moisture release curve. We found that C was generally higher in roots than branches, with CI being 3-11 times higher than CII Sapwood density and the ratio of dead to living xylem cells were most closely correlated with C In addition, the magnitude of CI was strongly correlated with fibre/tracheid lumen area, whereas CII was highly dependent on the thickness of axial parenchyma cell walls. Our results indicate that water released from capillary compartments predominates over water released from elastic storage in both branches and roots, suggesting the limited importance of parenchyma cells for water storage in juvenile xylem of temperate tree species. Contrary to intact organs, water released from open conduits in our small wood samples significantly increased CI at relatively high water potentials. Linking anatomical parameters with the hydraulic capacitance of a tissue contributes to a better understanding of water release mechanisms and their implications for plant hydraulics. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Time Course of Treatment Effect of OROS[R] Methylphenidate in Children with ADHD

ERIC Educational Resources Information Center

Armstrong, Robert B.; Damaraju, C. V.; Ascher, Steve; Schwarzman, Lesley; O'Neill, James; Starr, H. Lynn

2012-01-01

Objective: The authors evaluated the time course of the treatment effect of Osmotic-Release Oral System methylphenidate (OROS[R] MPH) HCl (Concerta[R], Raritan, NJ) CII in children with ADHD. Method: Data were combined from two double-blind, randomized, placebo-controlled, cross-over, analog classroom studies in children (9-12 years) with ADHD.…

Integrating Chemical Information Instruction into the Chemistry Curriculum on Borrowed Time: The Multiyear Development and Evolution of a Virtual Instructional Tutorial

ERIC Educational Resources Information Center

Jacobs, Danielle L.; Dalal, Heather A.; Dawson, Patricia H.

2016-01-01

The impetus to incorporate instruction on the efficient and responsible practice of chemical information literacy into the undergraduate chemistry curriculum has become exceptionally urgent. At Rider University, Chemical Information Instruction (CII) has accordingly evolved from face-to-face sessions into online modules to embed information…

29 CFR 4022.81 - General rules.

Code of Federal Regulations, 2011 CFR

2011-07-01

... after May 1998, the applicable federal mid-term rate (as determined by the Secretary of the Treasury pursuant to section 1274(d)(1)(C)(ii) of the Code) for that month (or, where the rate for a month is not... which the rate is available) based on monthly compounding; and (ii) For May 1998 and earlier months, the...

29 CFR 4022.81 - General rules.

Code of Federal Regulations, 2012 CFR

2012-07-01

... after May 1998, the applicable federal mid-term rate (as determined by the Secretary of the Treasury pursuant to section 1274(d)(1)(C)(ii) of the Code) for that month (or, where the rate for a month is not... which the rate is available) based on monthly compounding; and (ii) For May 1998 and earlier months, the...

29 CFR 4022.81 - General rules.

Code of Federal Regulations, 2014 CFR

2014-07-01

... after May 1998, the applicable federal mid-term rate (as determined by the Secretary of the Treasury pursuant to section 1274(d)(1)(C)(ii) of the Code) for that month (or, where the rate for a month is not... which the rate is available) based on monthly compounding; and (ii) For May 1998 and earlier months, the...

29 CFR 4022.81 - General rules.

Code of Federal Regulations, 2013 CFR

2013-07-01

... after May 1998, the applicable federal mid-term rate (as determined by the Secretary of the Treasury pursuant to section 1274(d)(1)(C)(ii) of the Code) for that month (or, where the rate for a month is not... which the rate is available) based on monthly compounding; and (ii) For May 1998 and earlier months, the...

Exploiting the Spatio-Temporal Coherence of Ocean Ambient Noise for Passive Tomography

DTIC Science & Technology

2012-09-30

ˆ kfCij and corresponds to the entry (i,j) of cross-covariance matrix for the selected horizontal triangular array, denoted );( ˆ kfC at the...diagonal elements );( ˆ kfCii (i=1..3) of the matrix );( ˆ kfC were set to zero to mitigate the bias due to electronic noise and the large

40 CFR Table 1 to Subpart Nnnn of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2010 CFR

2010-07-01

... continuous compliance with the operating limit by . . . 1. thermal oxidizer a. the average combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4167(a) i. collecting the combustion temperature data according to § 63.4168(c);ii. reducing the...

40 CFR Table 1 to Subpart Nnnn of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2011 CFR

2011-07-01

... continuous compliance with the operating limit by . . . 1. thermal oxidizer a. the average combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4167(a) i. collecting the combustion temperature data according to § 63.4168(c);ii. reducing the...

33 CFR 149.409 - How many fire extinguishers are needed?

Code of Federal Regulations, 2010 CFR

2010-07-01

... turbine engines B-II One for each engine. 2 (6) Open electric motors and generators C-II One for each of... fixed system is installed. 2 If the engine is installed on a weather deck or is open to the atmosphere... fans, are exempt. 4 Not required if a fixed foam system is installed in accordance with 46 CFR 108.489. ...

33 CFR 149.409 - How many fire extinguishers are needed?

Code of Federal Regulations, 2013 CFR

2013-07-01

... turbine engines B-II One for each engine. 2 (6) Open electric motors and generators C-II One for each of... fixed system is installed. 2 If the engine is installed on a weather deck or is open to the atmosphere... fans, are exempt. 4 Not required if a fixed foam system is installed in accordance with 46 CFR 108.489...

33 CFR 149.409 - How many fire extinguishers are needed?

Code of Federal Regulations, 2012 CFR

2012-07-01

... turbine engines B-II One for each engine. 2 (6) Open electric motors and generators C-II One for each of... fixed system is installed. 2 If the engine is installed on a weather deck or is open to the atmosphere... fans, are exempt. 4 Not required if a fixed foam system is installed in accordance with 46 CFR 108.489. ...

33 CFR 149.409 - How many fire extinguishers are needed?

Code of Federal Regulations, 2014 CFR

2014-07-01

... turbine engines B-II One for each engine. 2 (6) Open electric motors and generators C-II One for each of... fixed system is installed. 2 If the engine is installed on a weather deck or is open to the atmosphere... fans, are exempt. 4 Not required if a fixed foam system is installed in accordance with 46 CFR 108.489...

33 CFR 149.409 - How many fire extinguishers are needed?

Code of Federal Regulations, 2011 CFR

2011-07-01

... turbine engines B-II One for each engine. 2 (6) Open electric motors and generators C-II One for each of... fixed system is installed. 2 If the engine is installed on a weather deck or is open to the atmosphere... fans, are exempt. 4 Not required if a fixed foam system is installed in accordance with 46 CFR 108.489. ...

Evaluation of the CAARS Infrequency Index for the Detection of Noncredible ADHD Symptom Report in Adulthood

ERIC Educational Resources Information Center

Fuermaier, Anselm B. M.; Tucha, Lara; Koerts, Janneke; Weisbrod, Matthias; Grabemann, Marco; Zimmermann, Marco; Mette, Christian; Aschenbrenner, Steffen; Tucha, Oliver

2016-01-01

The reliance on self-reports in detecting noncredible symptom report of attention-deficit/hyperactivity disorder in adulthood (aADHD) has been questioned due to findings showing that symptoms can easily be feigned on self-report scales. In response, Suhr and colleagues developed an infrequency index for the Conners' Adult ADHD Rating Scale (CII)…

Direct ROS scavenging activity of CueP from Salmonella enterica serovar Typhimurium.

PubMed

Yoon, Bo-Young; Yeom, Ji-Hyun; Kim, Jin-Sik; Um, Si-Hyeon; Jo, Inseong; Lee, Kangseok; Kim, Yong-Hak; Ha, Nam-Chul

2014-02-01

Salmonella enterica serovar Typhimurium (S. Typhimurium) is an intracellular pathogen that has evolved to survive in the phagosome of macrophages. The periplasmic copper-binding protein CueP was initially known to confer copper resistance to S. Typhimurium. Crystal structure and biochemical studies on CueP revealed a putative copper binding site surrounded by the conserved cysteine and histidine residues. A recent study reported that CueP supplies copper ions to periplasmic Cu, Zn-superoxide dismutase (SodCII) at a low copper concentration and thus enables the sustained SodCII activity in the periplasm. In this study, we investigated the role of CueP in copper resistance at a high copper concentration. We observed that the survival of a cueP-deleted strain of Salmonella in macrophage phagosome was significantly reduced. Subsequent biochemical experiments revealed that CueP specifically mediates the reduction of copper ion using electrons released during the formation of the disulfide bond. We observed that the copper ion-mediated Fenton reaction in the presence of hydrogen peroxide was blocked by CueP. This study provides insight into how CueP confers copper resistance to S. Typhimurium in copper-rich environments such as the phagosome of macrophages.

[Allelic variants of apolipoproteins B and CII genes in patients with ischemic heart disease and in healthy persons from the Moscow population].

PubMed

Pogoda, T V; Nikonova, A L; Kolosova, T V; Liudvikova, E K; Perova, N V; Limborskaia, S A

1995-07-01

Allelic frequencies of a microsatellite of the apolipoprotein CII gene (APOCII) and a minisatellite of the apolipoprotein B gene (APOB) were studied using polymerase chain reaction (PCR). The study was conducted on a random sample of male Moscow inhabitants and a sample of patients with coronary heart disease (CHD) from the same population. Fourteen variants of the APOB minisatellite (the 82% heterozygosity level) and 13 alleles of the APOCII microsatellite (the 85% heterozygosity level) were found. CHD patients significantly differed from the control group in the distributions of alleles in these loci: APOB 32, APOB 46, APOB 48, and APOB 50 as well as APOCII 17 and APOCII 29 were found more frequently. A relationship was found between the distributions of APOB and APOCII in the CHD patients. The CHD patients with alleles APOCII 21 and APOCII 30 very often had the allele APOB 32; and patients with the genotype APOB 34, 36 had the allele APOCII 29 even more often than affected individuals in general. Individuals of the control group with the allele APOCII 30 exhibited hypertriglyceridemia without increased levels of total cholesterol and apolipoprotein B in plasma.

Paracetamol and salicylic acid removal from contaminated water by microalgae.

PubMed

Escapa, C; Coimbra, R N; Paniagua, S; García, A I; Otero, M

2017-12-01

The biomass growth, pharmaceutical removal and light conversion efficiency of Chlorella sorokiniana under the presence of paracetamol (PC) and salicylic acid (SaC) were assessed and compared at two different concentrations of these pharmaceuticals (I: 25 mg l -1 , II: 250 mg l -1 ). Microalgae were resistant to these concentrations and, moreover, their growth was significantly stimulated (p ≤ 0.05) under these drugs (biomass concentration increased above 33% PCI, 35% SaCI, 13% PCII and 45% SaCII, as compared with the respective positive controls). At the steady state of the semicontinuous culture, C. sorokiniana showed removal efficiencies above 41% and 69% for PCI and PCII, respectively; and above 93% and 98% for SaCI and SaCII, respectively. Under an irradiance of 370 μE m -2  s -1 , higher quantum yields were reached by microalgae under the presence of drugs, either at dose I or II, than by the respective positive controls. These results point to C. sorokiniana as a robust strain for the bioremediation of paracetamol and salicylic acid concentrated wastewaters. Copyright © 2016 Elsevier Ltd. All rights reserved.

Detection of the 158 Micrometers[CII] Transition at z=1.3: Evidence for a Galaxy-Wide Starburst

NASA Technical Reports Server (NTRS)

Hailey-Dunsheath, S.; Nikola, T.; Stacey, G. J.; Oberst, T. E.; Parshley, S. C.; Benford, D. J.; Staguhn, J. G.; Tucker, C. E.

2010-01-01

We report the detection of 158 micrometer [C II] fine-structure line emission from MIPS J 142824.0+3526l9, a hyperluminous (L(sub IR) approx. 10(exp 13) Solar Luminosity starburst galaxy at z = 1.3. The line is bright, corresponding to a fraction L[C II]/L(sub FIR) approx. equals 2 x l0(exp -3) of the far-IR(FIR) continuum. The [C II], CO, and FIR continuum emission may be modeled as arising from photodissociation regions (PDRs) that have a characteristic gas density of n approx. 10(exp 4.2)/cu cm., and that are illuminated by a far-UV radiation field approx. 10(exp 3.2) times more intense than the local interstellar radiation field. The mass in these PDRs accounts for approximately half of the molecular gas mass in this galaxy. The L[C II]/L(sub F1R) ratio is higher than observed in local ultraluminous infrared galaxies or in the few high-redshift QSOs detected in [C II], but the L[CII]/L(sub FIR) and L(sub CO)/L(sub FIR) ratios are similar to the values seen in nearby starburst galaxies

Rocket-borne observation of singly ionized carbon 158 micron emission from the diffuse interstellar medium

NASA Astrophysics Data System (ADS)

Bock, James Joseph

1994-01-01

We report an observation of 158 micron line emission from singly ionized carbon from the diffuse interstellar medium at high galactic latitude. The integrated line intensity is measured in a 36 arcmin field-of-view along a triangular scan path in a 5 deg x 20 deg region in Ursa Major using a rocket-borne, liquid helium cooled spectrophotometer. The scan includes high latitude infrared cirrus, molecular clouds, a bright external galaxy, M82, and the HI Hole, which is a region of uniquely low neutral hydrogen column density. Emission from (CII) is observed in all regions and, in the absence of appreciable CO emission, is well correlated with neutral hydrogen column density. We observe a (CII) gas cooling rate which varies from (3.25 +/- 0.8 to 1.18 +/- 0.4) x 10-26 ergs-1 H-atom-1, in good agreement with recent observations of UV absorption lines at high galactic latitude. Regions with CO emission have enhanced (CII) line emission over that expected from the correlation with neutral hydrogen column density. The line-to-continuum ratio varies from I(CII)/lambda Ilambda = 0.002 to 0.008 in comparison with the all sky average of 0.0082 reported by FIRAS, which is heavily weighted towards the Galactic plane. The far-infrared continuum intensity, measured at 134 microns, 154 microns, and 186 microns, correlates with the 100 micron brightness measured by IRAS, and in regions excluding molecular clouds, with HI column density. The far-infrared brightness correlated with HI column density is fit by a thermal spectrum with a temperature T = 16.4 (+2.3/-1.8) K assuming an index of emissivity n = 2. The residual brightness after subtracting the emission correlated with neutral hydrogen column density yields an upper limit to the far-infrared extra-galactic background radiation of lambda Ilambda (154 microns) less than 2.6 x 10-12 W cm-2 sr-1. The observation of M82 confirms the laboratory calibration of the instrument. Unique instrumentation was developed to realize the instrument. A high sensitivity detection system consisting of stressed Ge:Ga photoconductors coupled to charge integrating amplifiers is described. We developed a compact, miniature He-4 refrigerator suitable for spaceborne operation. A silicon-gap Fabry-Perot filter, designed for use in high-throughput, compact optical systems, was developed. The performance of a far-infrared low-pass filter stack with high out-of-band rejection is reported. We tested the performance of a telescope baffle system with high-off axis rejection in a combination of ground-based and rocket-borne experiments. A submillimeter-black coating suitable for use in spaceborne telescopes is described. We report the laboratory testing of the instrument and the performance during the flight, and discuss the scientific implications of the observations.

Elevated Ratio of Maternal Plasma ApoCIII to ApoCII in Preeclampsia

DTIC Science & Technology

2011-05-01

presentation of preeclampsia varies significantly between individuals.3 Although both dyslipidemia and endothelial dysfunction are characteristic of...preeclampsia,3,4 a mechanism unifying the 2 phenomena remains to be estab- lished. Dyslipidemia becomes apparent in most patients with preeclampsia before... dyslipidemia components, leading to atherogenesis.8,9 We hypothesize that a similar mechanism may be applicable to the atherosis of preeclampsia. Apolipoprotein

40 CFR Table 3 to Subpart Qqqq of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2011 CFR

2011-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4767(a) i. Collecting the combustion temperature data according to § 63.4768(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour block average combustion...

40 CFR Table 1 to Subpart Rrrr of... - Operating Limits if Using the Emission Rate With Add-on Controls Option

Code of Federal Regulations, 2010 CFR

2010-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4966(a) i. collecting the combustion temperature data according to § 63.4967(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion temperature...

40 CFR Table 1 to Subpart Nnnn of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2012 CFR

2012-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4167(a) i. collecting the combustion temperature data according to § 63.4168(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion temperature...

40 CFR Table 1 to Subpart Nnnn of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2014 CFR

2014-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4167(a) i. collecting the combustion temperature data according to § 63.4168(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion temperature...

40 CFR Table 3 to Subpart Qqqq of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2010 CFR

2010-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4767(a) i. Collecting the combustion temperature data according to § 63.4768(c);ii. Reducing the data to 3-hour block averages; and iii. Maintaining the 3-hour block average combustion...

40 CFR Table 1 to Subpart Rrrr of... - Operating Limits if Using the Emission Rate With Add-on Controls Option

Code of Federal Regulations, 2013 CFR

2013-07-01

... average combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4966(a) i. collecting the combustion temperature data according to § 63.4967(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion...

40 CFR Table 1 to Subpart Rrrr of... - Operating Limits if Using the Emission Rate With Add-on Controls Option

Code of Federal Regulations, 2014 CFR

2014-07-01

... average combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4966(a) i. collecting the combustion temperature data according to § 63.4967(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion...

40 CFR Table 1 to Subpart Nnnn of... - Operating Limits if Using the Emission Rate With Add-On Controls Option

Code of Federal Regulations, 2013 CFR

2013-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4167(a) i. collecting the combustion temperature data according to § 63.4168(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion temperature...

40 CFR Table 1 to Subpart Rrrr of... - Operating Limits if Using the Emission Rate With Add-on Controls Option

Code of Federal Regulations, 2012 CFR

2012-07-01

... average combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4966(a) i. collecting the combustion temperature data according to § 63.4967(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion...

40 CFR Table 1 to Subpart Rrrr of... - Operating Limits if Using the Emission Rate With Add-on Controls Option

Code of Federal Regulations, 2011 CFR

2011-07-01

... combustion temperature in any 3-hour period must not fall below the combustion temperature limit established according to § 63.4966(a) i. collecting the combustion temperature data according to § 63.4967(c);ii. reducing the data to 3-hour block averages; and iii. maintaining the 3-hour average combustion temperature...

50 (Fifty) Years of Research on Man in Flight

DTIC Science & Technology

1985-06-01

h td ~il lcild FlightI IR’c’urch1)71.AI . .. 0 . . . . . . Advanced Flight Research 1970&1984 0 bo a I .41~ CII1(f’(l k/i h t Iu’raru/i l~)7(~-15’.~I I...Hazel, Mrs Branch Secretary BBD BIODYNAMIC EFFECTS BRANCH Bekele, Tamara, Ms Jonopulos, Michael, 9Sgt Kazarian. Leon, Dr Branch Chief Natvig

Remote Unmanned Work System Vehicle Tether Cable Termination and Potting Procedures.

DTIC Science & Technology

1980-12-01

conductors to a lcngthi of, 1 .250 inchics (25.4 cii). 5. Using a k nife . cut aroi nd tilic ilnso ait ion oft hC power onlduictor. 0. Strip tile...deurcc, 0 I’r 10 hours-1. D~O n10 L&urC at A lipglici’ tclipcraurc. or. iainage to solic materials inl the mlixture mayd recsult. MIIYSI(AL PROPERTIES

U.S. EPA, Pesticide Product Label, PYRE-MIST 3610, 05/21/1982

EPA Pesticide Factsheets

2011-04-14

... "fO~ 1'lf Cf.t C.I'; tt d~l;f.td .rth !,t,"fd "t~~t!tS _"",tI tr.td f~· ~ J ... _ .... CII.1$ ~.1'f Gf ff'flO'.t fl~R4 food ~f14 bxlr..aa..;;,& s.,;rt,f:{H C::.r !xt:I .rlJ stl"t lift .11111 ...

MX [3-Chloro-4-(Dichloromethyl)-5-Hydroxy-2[5H]-Furanone], A Drinking-Water Carcinogen, Does Not Induce Mutations in the Liver of Cii Transgenic Medaka (Oryzias latipes)

EPA Science Inventory

Mutagenicity assays with Salmonella have shown that 3-chloro-4-(dichloromethyl)-5-hydroxy-2[5H]-furanone (MX), a drinking water disinfection by-product is a potent mutagen, accounting for about one third of the mutagenic potency/potential of chlorinated drinking water. The abilit...

Head Start Evaluation and Research Center, Boston University. Report C-II, the Expression of Aggression in Pre-School Children.

ERIC Educational Resources Information Center

Dorman, Lynn M.

Ten boys and 16 girls from two Head Start schools in Massachusetts were administered two projective measures of aggression. A third measure was obtained from teacher rankings of behavior based on classroom conduct. For the projective measures, each child was asked to respond to three social situations as depicted by dolls and drawings. The child…

OT2_tvelusam_4: Probing Galactic Spiral Arm Tangencies with [CII

NASA Astrophysics Data System (ADS)

Velusamy, T.

2011-09-01

We propose to use the unique viewing geometry of the Galactic spiral arm tangents , which provide an ideal environment for studying the effects of density waves on spiral structure. We propose a well-sampled map of the[C II] 1.9 THz line emission along a 15-degree longitude region across the Norma-3kpc arm tangential, which includes the edge of the Perseus Arm. The COBE-FIRAS instrument observed the strongest [C II] and [N II] emission along these spiral arm tangencies.. The Herschel Open Time Key Project Galactic Observations of Terahertz C+ (GOT C+), also detects the strongest [CII] emission near these spiral arm tangential directions in its sparsely sampled HIFI survey of [CII] in the Galactic plane survey. The [C II] 158-micron line is the strongest infrared line emitted by the ISM and is an excellent tracer and probe of both the diffuse gases in the cold neutral medium (CNM) and the warm ionized medium (WIM). Furthermore, as demonstrated in the GOTC+ results, [C II] is an efficient tracer of the dark H2 gas in the ISM that is not traced by CO or HI observations. Thus, taking advantage of the long path lengths through the spiral arm across the tangencies, we can use the [C II] emission to trace and characterize the diffuse atomic and ionized gas as well as the diffuse H2 molecular gas in cloud transitions from HI to H2 and C+ to C and CO, throughout the ISM. The main goal of our proposal is to use the well sampled (at arcmin scale) [C II] to study these gas components of the ISM in the spiral-arm, and inter-arm regions, to constrain models of the spiral structure and to understand the influence of spiral density waves on the Galactic gas and the dynamical interaction between the different components. The proposed HIFI observations will consist of OTF 15 degree longitude scans and one 2-degree latitude scan sampled every 40arcsec across the Norma- 3kpc Perseus Spiral tangency.

Centralized Reminder/Recall to Increase Immunization Rates in Young Children: How Much Bang for the Buck?

PubMed

Kempe, Allison; Saville, Alison W; Beaty, Brenda; Dickinson, L Miriam; Gurfinkel, Dennis; Eisert, Sheri; Roth, Heather; Herrero, Diana; Trefren, Lynn; Herlihy, Rachel

2017-04-01

We compared the effectiveness and cost-effectiveness of: 1) centralized reminder/recall (C-R/R) using the Colorado Immunization Information System (CIIS) versus practice-based reminder/recall (PB-R/R) approaches to increase immunization rates; 2) different levels of C-R/R intensity; and 3) C-R/R with versus without the name of the child's provider. We conducted 3 sequential cluster-randomized trials involving children aged 19 to 25 months in 15 Colorado counties in March 2013 (trial 1), October 2013 (trial 2), and May 2014 (trial 3). In C-R/R counties, the intensity of the intervention decreased sequentially in trials 1 through 3, from 3 to 1 recall messages. In PB-R/R counties, practices were offered training using CIIS and financial support. The percentage of children with up-to-date (UTD) vaccinations was compared 6 months after recall. A mixed-effects model assessed the association between C-R/R versus PB-R/R and UTD rates. C-R/R was more effective in trials 1 to 3 (relative risk = 1.11; 95% confidence interval 1.01-1.20; P = .009). Effectiveness did not decrease with decreasing intervention intensity (P = .59). Costs decreased with decreasing intensity in the C-R/R arm, from $18.72 per child brought UTD in trial 1 to $10.11 in trial 3. Costs were higher and more variable in the PB-R/R arm, ranging from $20.63 to $237.81 per child brought UTD. C-R/R was significantly more effective if the child's practice name was included (P < .0001). C-R/R was more effective and cost-effective than PB-R/R for increasing UTD rates in young children and was most effective if messages included the child's provider name. Three reminders were not more effective than one, which may be explained by the increasing accuracy of contact information in CIIS over the course of the trials. Copyright © 2016 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.

Mutagenicity of furan in female Big Blue B6C3F1 mice

PubMed Central

Terrell, Ashley N.; Huynh, Mailee; Grill, Alex E.; Kovi, Ramesh C.; O’Sullivan, M. Gerard; Guttenplan, Joseph B.; Ho, Yen-Yi; Peterson, Lisa A.

2014-01-01

Furan is an abundant food and environmental contaminant that is a potent liver carcinogen in rodent models. To determine if furan is genotoxic in vivo, female B6C3F1 Big Blue transgenic mice were treated with 15 mg/kg bw furan by gavage 5 days a week for 6 weeks, or once weekly for 3 weeks. Liver cII trans-gene mutation-frequency and mutation spectra were determined. Furan did not increase the mutation frequency under either treatment condition. In the 6-week treatment regimen, there was a change in the cII transgene mutation-spectrum, with the fraction of GC to AT transitions significantly reduced. The only other significant change was an increase in GC to CG transversions; these represented a minor contribution to the overall mutation spectrum. A much larger furan-dependent shift was observed in the 3-week study. There was a significant increase in transversion mutations, predominantly GC to TA transversions as well as smaller non-significant changes in GC to CG and AT to TA transversions. To determine if these mutations were caused by cis-2-butene-1,4-dial (BDA), a reactive metabolite of furan, the mutagenic activity and the mutation spectrum of BDA was determined in vitro, in Big Blue mouse embryonic fibroblasts. This compound did not increase the cII gene mutation-frequency but caused a substantial increase in AT to CG transversions. This increase, however, lost statistical significance when adjusted for multiple comparisons. Together, these findings suggest that BDA may not be directly responsible for the in-vivo effects of furan on mutational spectra. Histopathological analysis of livers from furan-treated mice revealed that furan induced multifocal, hepatocellular necrosis admixed with reactive leukocytes and pigment-laden Kupffer cells, enhanced oval-cell hyperplasia, and increased hepatocyte mitoses, some of which were atypical. An indirect mechanism of genotoxicity is proposed in which chronic toxicity followed by inflammation and secondary cell proliferation triggers cancer development in furan-exposed rodents. PMID:25344163

Clinical Investigation Program Report, RCS MED-300 (R-1).

DTIC Science & Technology

1985-10-31

Patients with Locally Advanced Gastric Adenocarcinoma, Phase III. (C) 63 1982 SWOG 8006, Preoperative Reductive Chemotherapy for Stage III or IV Operable...Mesothelioma Localized to One Hemithorax, Phase III. (C) 81 1984 SWOG 8104, Treatment of Advanced Seminoma (Stage cII (4) + clII) with Combined...of Locally or Regionally Recurrent but Surgically Resectable Breast Cancer. (C) 99 1984 SWOG 8300, Treatment of Limited Non-Small Cell Lung Cancer

Microstructural Development in HSLA-100 Steel Weld Metals

DTIC Science & Technology

1990-01-01

martensite or austenitic particles contribute to the "granular appearance" of the ferrite grains. Copper precipitates ... copper precipitation , which conclusively suggests that the polygonal ferrite formation is not fully suppressed in the alloy . For the HSLA- 100 steel with a...Ava’Iablity Codes Avdi rid 1 or Di ’t’CIiJl A1 2 1. INTRODUCTION Precipitation strengthening of steel by finely dispersed copper

Rotational modulation of hydrogen Lyman alpha flux from 44i Bootis

NASA Technical Reports Server (NTRS)

Vilhu, O.; Neff, J. E.; Rahunen, T.

1989-01-01

Observations with IUE that cover the entire 6.4 hr orbital cycle of the late-type contact binary 44i Bootis are presented. Intrinsic stellar hydrogen Lyman alpha emission flux was determined from low-resolution IUE spectra, compensating for geocoronal emission and for interstellar absorption. The variation of the stellar Lyman alpha emission flux correlates well with the variation of the CII and CIV emission fluxes, and shows orbital modulation in phase with the visual light curve. The ratio of Lyman alpha to CII flux (15 to 20) is similar to that observed in solar active regions. Hydrogen Lyman alpha emission is thus one of the most important cooling channels in the outer atmosphere of 44i Boo. A high-resolution spectrum of the Lyman alpha line was obtained between orbital phases 0.0 and 0.6. The integrated flux in the observed high-resolution Lyman alpha profile is consistent with the fluxes determined using low-resolution spectra, and the composite profile indicates that both components of this binary have equally active chromospheres and transition regions. The uncertainty in the interstellar hydrogen column density cannot mimic the observed variation in the integrated Lyman alpha flux, because the stellar line is very much broader than the interstellar absorption.

Limited mutagenicity of electronic cigarettes in mouse or human cells in vitro.

PubMed

Tommasi, Stella; Bates, Steven E; Behar, Rachel Z; Talbot, Prue; Besaratinia, Ahmad

2017-10-01

Electronic cigarettes (e-cig), which are promoted as safe alternatives to tobacco cigarettes or as aides to smoking cessation, are becoming increasingly popular among adult chronic smokers and adolescents experimenting with tobacco products. Despite the known presence of toxicants and carcinogens in e-cig liquid and vapor, the possible carcinogenic effects of e-cig use in humans are unknown. We have utilized two validated in vitro model systems to investigate whether e-cig vapor induces mutation in mouse or human cells. We have exposed transgenic mouse fibroblasts in vitro to e-cig vapor extracts prepared from three popular brands, and determined the induction of mutagenesis in a reporter gene, the cII transgene. Furthermore, we have treated the pSP189 plasmid with e-cig vapor extract, transfected human fibroblast cells with the e-cig-treated plasmid, and screened for the induced mutations in the supF gene. We observed no statistically significant increases in relative mutant frequency in the cII transgene or supF gene in the e-cig treated mouse or human cells, respectively. Our data indicate that e-cig vapor extracts from the selected brands and at concentrations tested in this study have limited mutagenicity in both mouse and human cells in vitro. Copyright © 2017 Elsevier B.V. All rights reserved.

Effects of Koumine on Adjuvant- and Collagen-Induced Arthritis in Rats.

PubMed

Yang, Jian; Cai, Hong-Da; Zeng, Yu-Lan; Chen, Ze-Hong; Fang, Meng-Han; Su, Yan-Ping; Huang, Hui-Hui; Xu, Ying; Yu, Chang-Xi

2016-10-28

To examine the effect of koumine, a Gelsemium alkaloid, on two experimental models of rheumatoid arthritis (RA), rats with adjuvant-induced arthritis (AIA) and collagen-induced arthritis (CIA) were administered koumine (0.6, 3, or 15 mg/kg/day) or vehicle through gastric gavage (i.g.). Clinical evaluation was performed via measurements of hind paw volume, arthritis index (AI) score, mechanical withdrawal threshold, organ weight, and by radiographic and histological examinations. Levels of interleukin (IL)-1β, tumor necrosis factor (TNF)-α, and antitype II collagen (CII) antibody were also examined. In rats with AIA, koumine reduced the AI score and mechanical allodynia of the injected hind paw in a dose-dependent manner and significantly inhibited increase in thymus and liver weights. In rats with CIA, koumine inhibited increase in hind paw volume, AI score, and mechanical allodynia in a dose-dependent manner and reduced joint space narrowing. Furthermore, koumine also attenuated the increase in the expression of IL-1β and TNF-α, as well as the robust increase of serum anti-CII antibodies in response to immunization. These results suggested that koumine effectively attenuated arthritis progression in two rat models of RA and that this therapeutic effect may be associated with its immunoregulatory action.

The Circularization of Amyloid Fibrils Formed by Apolipoprotein C-II

PubMed Central

Hatters, Danny M.; MacRaild, Christopher A.; Daniels, Rob; Gosal, Walraj S.; Thomson, Neil H.; Jones, Jonathan A.; Davis, Jason J.; MacPhee, Cait E.; Dobson, Christopher M.; Howlett, Geoffrey J.

2003-01-01

Amyloid fibrils have historically been characterized by diagnostic dye-binding assays, their fibrillar morphology, and a “cross-β” x-ray diffraction pattern. Whereas the latter demonstrates that amyloid fibrils have a common β-sheet core structure, they display a substantial degree of morphological variation. One striking example is the remarkable ability of human apolipoprotein C-II amyloid fibrils to circularize and form closed rings. Here we explore in detail the structure of apoC-II amyloid fibrils using electron microscopy, atomic force microscopy, and x-ray diffraction studies. Our results suggest a model for apoC-II fibrils as ribbons ∼2.1-nm thick and 13-nm wide with a helical repeat distance of 53 nm ± 12 nm. We propose that the ribbons are highly flexible with a persistence length of 36 nm. We use these observed biophysical properties to model the apoC-II amyloid fibrils either as wormlike chains or using a random-walk approach, and confirm that the probability of ring formation is critically dependent on the fibril flexibility. More generally, the ability of apoC-II fibrils to form rings also highlights the degree to which the common cross-β superstructure can, as a function of the protein constituent, give rise to great variation in the physical properties of amyloid fibrils. PMID:14645087

In silico characterization and expression analysis of the multigene family encoding the Bowman-Birk protease inhibitor in soybean.

PubMed

de Almeida Barros, Beatriz; da Silva, Wiliane Garcia; Moreira, Maurilio Alves; de Barros, Everaldo Gonçalves

2012-01-01

The Bowman-Birk (BBI) protease inhibitors can be used as source of sulfur amino acids, can regulate endogenous protease activity during seed germination and during the defense response of plants to pathogens. In soybean this family has not been fully described. The goal of this work was to characterize in silico and analyze the expression of the members of this family in soybean. We identified 11 potential BBI genes in the soybean genome. In each one of them at least a characteristic BBI conserved domain was detected in addition to a potential signal peptide. The sequences have been positioned in the soybean physical map and the promoter regions were analyzed with respect to known regulatory elements. Elements related to seed-specific expression and also to response to biotic and abiotic stresses have been identified. Based on the in silico analysis and also on quantitative RT-PCR data it was concluded that BBI-A, BBI-CII and BBI-DII are expressed specifically in the seed. The expression profiles of these three genes are similar along seed development. Their expressions reach a maximum in the intermediate stages and decrease as the seed matures. The BBI-DII transcripts are the most abundant ones followed by those of BBI-A and BBI-CII.

H2-M polymorphism in mice susceptible to collagen-induced arthritis involves the peptide binding groove

DOE Office of Scientific and Technical Information (OSTI.GOV)

Walter, W.; Loos, M.; Maeurer, M.J.

1996-12-31

The ability to develop type II collagen (CII)-induced arthritis (CIA) in mice is associated with the major histocompatibility I-A gene and with as yet poorly defined regulatory molecules of the major histocompatibility complex (MHC) class II antigen processing and presentation pathway. H2-M molecules are thought to be involved in the loading of antigenic peptides into the MHC class II binding cleft. We sequenced H2-Ma, H2-Mb1, and H2-Mb2 genes from CIA-susceptible and -resistant mouse strains and identified four different Ma and Mb2 alleles, and three different Mb1 alleles defined by polymorphic residues within the predicted peptide binding groove. Most CIA-resistant mousemore » strains share common Ma, Mb1, and Mb2 alleles. In contrast, H2-M alleles designated Ma-III, Ma-IV, Mb1-III, and Mb2-IV could be exclusively identified in the CIA-susceptible H2{sup r} and H2{sup q} haplotypes, suggesting that allelic H2-M molecules may modulate the composition of different CII peptides loaded onto MHC class II molecules, presumably presenting {open_quotes}arthritogenic{close_quotes} epitopes to T lymphocytes. 42 refs., 4 figs., 3 tabs.« less

Synthesis of Potential Trypanocides

DTIC Science & Technology

1987-12-01

0188 Ia. REPORT SECURITY CLASSIFICATION 1b RESTRICTIVE MARKINGS Unclassified 2a. SECURITY CLASSIFICATION AUTHORITY 3 . DISTRIBUTION /AVAILABILITY OF...and the phenyl ring, ring structures 2 and 3 , introduction of a -CH:CII- group between the phenyl ring and its 4’-substituent, ring structure 4...imidazole (9, 15) thiazole (11) and pyridine (12-14) into ether-linked and vinyl-linked structures. 3 t % SCHEME 1 HETEROAROMATIC RINGS OHw Ch3 CH3 +1 N% f

Surface Meteorology over the GATE A-Scale.

DTIC Science & Technology

1978-11-01

discn\\uicywill ~al tlit’ rvf 1.vt etA ill the Illatilhi iite ti t t’ ;ui, t ~ wk, s i i1 th li, .,;t iuikit vs ot the cii I (it t l1k’ witii .t .i I-Ne...their results with tlxese obtaiinedl usilvj tdk Milk t±\\imnxcMethxid, itbasiniww and cT~r (1977) ncinxndtx th-at the drai coefficienit C" for iistilrbx

Commensal Gut-Derived Anaerobes as Novel Therapy for Inflammatory Autoimmune Diseases

DTIC Science & Technology

2011-05-01

treatment of arthritis. Treatment of mice with P. histicola as probiotics and therapy are ongoing. In vitro study showed that treatment of mice with P...histicola in CII-immunized mice led to suppression of antigen-specific immune response and reduction in production of inflammatory cytokines. Our data...effect of Prevotella on antigen specific immune response and production of pro-inflammatory cytokines by antigen specific T-cells. Mice were fed

The Modern Catholic Just War Tradition

DTIC Science & Technology

2012-04-15

offered a positive solution to the problems facing humanity. In fact in an address to the Vatican Diplomatic Corps, January 13, 2003, Pope John Paul II...cii Pope John Paul II. “Address of His Holiness Pope John Paul II to the Diplomatice Corps.” Speech to the Vatican Diplomatic Corps Libreria...the Vatican Diplomatic Corps Libreria Editrice Vaticana, January 2003. 4 http://www.vatican.va/holy_father/john_paul_ii/speeches/2003/january

Modeling and measurements of XRD spectra of extended solids under high pressure

NASA Astrophysics Data System (ADS)

Batyrev, I. G.; Coleman, S. P.; Stavrou, E.; Zaug, J. M.; Ciezak-Jenkins, J. A.

2017-06-01

We present results of evolutionary simulations based on density functional calculations of various extended solids: N-Si and N-H using variable and fixed concentration methods of USPEX. Predicted from the evolutionary simulations structures were analyzed in terms of thermo-dynamical stability and agreement with experimental X-ray diffraction spectra. Stability of the predicted system was estimated from convex-hull plots. X-ray diffraction spectra were calculated using a virtual diffraction algorithm which computes kinematic diffraction intensity in three-dimensional reciprocal space before being reduced to a two-theta line profile. Calculations of thousands of XRD spectra were used to search for a structure of extended solids at certain pressures with best fits to experimental data according to experimental XRD peak position, peak intensity and theoretically calculated enthalpy. Comparison of Raman and IR spectra calculated for best fitted structures with available experimental data shows reasonable agreement for certain vibration modes. Part of this work was performed by LLNL, Contract DE-AC52-07NA27344. We thank the Joint DoD / DOE Munitions Technology Development Program, the HE C-II research program at LLNL and Advanced Light Source, supported by BES DOE, Contract No. DE-AC02-05CH112.

The ISO View of Star Forming Galaxies

NASA Technical Reports Server (NTRS)

Helou, George

1999-01-01

ISO studies of normal galaxies in the local Universe have revealed basic new properties whose significant implications for the star formation process and cosmology are only starting to be understood. This review will touch on the general results of a statistical nature, and provide a quick summary of the profusion of exciting results on individual objects. In the mid-infrared, PHT-S has established that the spectra of star forming galaxies between 6 and-13microns are dominated by the Aromatic Features in Emission (AFE), and show little variation as a function of the heating intensity. The Carriers of the AFE (CAFE) are thus a universal component of dust with standard properties, and contribute between 10 and 25% of the total dust luminosity. In addition to AFE, the spectra show a low-level continuum detectable at wavelengths longer than 3.5microns whose origin is still under investigation. The mid-infrared colors formed as the ratio of flux densities in the 6.75micron and the 15micron bands of ISO-CAM remain essentially constant and near unity for quiescent and mildly active galaxies. As dust heating increases further, the 15micron flux increases steeply compared to 6.75microns, indicating that dust heated to 100K

iMARS--mutation analysis reporting software: an analysis of spontaneous cII mutation spectra.

PubMed

Morgan, Claire; Lewis, Paul D

2006-01-31

The sensitivity of any mutational assay is determined by the level at which spontaneous mutations occur in the corresponding untreated controls. Establishing the type and frequency at which mutations occur naturally within a test system is essential if one is to draw scientifically sound conclusions regarding chemically induced mutations. Currently, mutation-spectra analysis is laborious and time-consuming. Thus, we have developed iMARS, a comprehensive mutation-spectrum analysis package that utilises routinely used methodologies and visualisation tools. To demonstrate the use and capabilities of iMARS, we have analysed the distribution, types and sequence context of spontaneous base substitutions derived from the cII gene mutation assay in transgenic animals. Analysis of spontaneous mutation spectra revealed variation both within and between the transgenic rodent test systems Big Blue Mouse, MutaMouse and Big Blue Rat. The most common spontaneous base substitutions were G:C-->A:T transitions and G:C-->T:A transversions. All Big Blue Mouse spectra were significantly different from each other by distribution and nearly all by mutation type, whereas the converse was true for the other test systems. Twenty-eight mutation hotspots were observed across all spectra generally occurring in CG, GA/TC, GG and GC dinucleotides. A mutation hotspot at nucleotide 212 occurred at a higher frequency in MutaMouse and Big Blue Rat. In addition, CG dinucleotides were the most mutable in all spectra except two Big Blue Mouse spectra. Thus, spontaneous base-substitution spectra showed more variation in distribution, type and sequence context in Big Blue Mouse relative to spectra derived from MutaMouse and Big Blue Rat. The results of our analysis provide a baseline reference for mutation studies utilising the cII gene in transgenic rodent models. The potential differences in spontaneous base-substitution spectra should be considered when making comparisons between these test systems. The ease at which iMARS has allowed us to carry out an exhaustive investigation to assess mutation distribution, mutation type, strand bias, target sequences and motifs, as well as predict mutation hotspots provides us with a valuable tool in helping to distinguish true chemically induced hotspots from background mutations and gives a true reflection of mutation frequency.

Wind Variability of B Supergiants. No. 2; The Two-component Stellar Wind of gamma Arae

NASA Technical Reports Server (NTRS)

Prinja, R. K.; Massa, D.; Fullerton, A. W.; Howarth, I. D.; Pontefract, M.

1996-01-01

The stellar wind of the rapidly rotating early-B supergiant, gamma Ara, is studied using time series, high-resolution IUE spectroscopy secured over approx. 6 days in 1993 March. Results are presented based on an analysis of several line species, including N(N), C(IV), Si(IV), Si(III), C(II), and Al(III). The wind of this star is grossly structured, with evidence for latitude-dependent mass loss which reflects the role of rapid rotation. Independent, co-existing time variable features are identified at low-velocity (redward of approx. -750 km/s) and at higher-speeds extending to approx. -1500 km/s. The interface between these structures is 'defined' by the appearance of a discrete absorption component which is extremely sharp (in velocity space). The central velocity of this 'Super DAC' changes only gradually, over several days, between approx. -400 and -750 km/s in most of the ions. However, its location is shifted redward by almost 400 km/s in Al(III) and C(II), indicating that the physical structure giving rise to this feature has a substantial velocity and ionization jump. Constraints on the relative ionization properties of the wind structures are discussed, together with results based on SEI line-profile-fitting methods. The overall wind activity in gamma Ara exhibits a clear ion dependence, such that low-speed features are promoted in low-ionization species, including Al(III), C(II), and Si(III). We also highlight that - in contrast to most OB stars - there are substantial differences in the epoch-to-epoch time-averaged wind profiles of gamma Ara. We interpret the results in terms of a two-component wind model for gamma Ara, with an equatorially compressed low ionization region, and a high speed, higher-ionization polar outflow. This picture is discussed in the context of the predicted bi-stability mechanism for line-driven winds in rapidly rotating early-B type stars, and the formation of compressed wind regions in rapidly rotating hot stars. The apparent absence of a substantial shift in the wind ionization mixture of gamma Ara, and the normal nature of its photospheric spectrum, suggests wind-compression as the likely dominant cause for the observed equatorial density enhancements.

Job Performance Tests for CH-53E Helicopter Mechanics. Volume 2: Administrative Duties and Job Knowledge Tests

DTIC Science & Technology

1992-01-01

SUBTmI.E 5 FU.NDING NUMBERS Job Performance Tests for CII-53E Helicopter Miechanacs - Volume I1: Admiutstrative Duties and Job Knowlede Tests C - N...performance measures to Marine Corps personnel managers . training instructors, and interested researchers who may find them useful. This work comprises...Corps personnel managers , training instructors, and interested researchers who may find them useful. 3. This work comprises two parts: volume I

Casting of Halide and Fluoride Alloys for Laser Windows

DTIC Science & Technology

1976-02-15

exhibit at least microplastic behavior at room temper- ature, it might be expected that their fracture strength will follow a Petch relationship...polishing and testing. Only later was it discovered that this particular annealing procedure degraded the optical properties (i. e., 5. 25 pm Pb- sorption ... sorption coefficient of 4. 8 x 10’ c~ii 1 TABLE 3-5 AP PARENT ABSOi. -)N COEFFICIENTS AN~D SCATTERING CF2CASTING HN 1 5.25 pm Absorption Coefficient

Development of an On-Line Biological Detector

DTIC Science & Technology

1976-07-31

ib . Pert...chemical (Kit 0510). This kit uses the enzymes, glucose oxidase ( Aspergillus niger) and peroxidase (horseradish). In the presence of glucose oxidase, "D...tt -h l o)w the(m to( peteltl rate bt v 1tn t ;w I ib r .I "Flow i i | ;t t r ,I h--Ut cii I r’. 2 Iit I ii I iii t icý, ind M - ) i n i I.t r, i

Acarbose Decreases the Rheumatoid Arthritis Risk of Diabetic Patients and Attenuates the Incidence and Severity of Collagen-induced Arthritis in Mice

PubMed Central

Chen, Hsin-Hua; Chen, Der-Yuan; Chao, Ya-Hsuan; Chen, Yi-Ming; Wu, Chao-Liang; Lai, Kuo-Lung; Lin, Ching-Heng; Lin, Chi-Chen

2015-01-01

Acarbose has been found to decrease some inflammatory parameters in diabetic patients. This study aimed to examine the influence of acarbose on rheumatoid arthritis (RA) risk in diabetes mellitus (DM) patients and on the incidence and severity of collagen-induced arthritis (CIA) in mice. In a nationwide, matched case–control study, we identified 723 incident RA cases and selected 7,230 age-, sex- and RA diagnosis date–matched controls from all newly treated DM patients. We found that use of acarbose at > 16,950 mg per year was associated with a lower RA risk (odds ratio 0.60; 95% CI, 0.41–0.89). In the CIA mouse study, acarbose was orally administered from days -7 to 38 relative to type II collagen (CII) immunization. The results revealed that acarbose at the dose of 500 mg/kg/day attenuated the incidence and severity of arthritis and the expression of proinflammatory cytokines, including TNF-α, IL-6 and IL-17 in the paw tissues. Acarbose further decreased the productions of anti-CII-IgG, IL-17 and IFN-γ by collagen-reactive lymph node cells. This work suggests that the use of acarbose decreased RA risk in DM patients and the incidence of CIA in mice. Acarbose also attenuated the severity of CIA via anti-inflammatory and immunomodulatory effects. PMID:26678745

Acarbose Decreases the Rheumatoid Arthritis Risk of Diabetic Patients and Attenuates the Incidence and Severity of Collagen-induced Arthritis in Mice.

PubMed

Chen, Hsin-Hua; Chen, Der-Yuan; Chao, Ya-Hsuan; Chen, Yi-Ming; Wu, Chao-Liang; Lai, Kuo-Lung; Lin, Ching-Heng; Lin, Chi-Chen

2015-12-18

Acarbose has been found to decrease some inflammatory parameters in diabetic patients. This study aimed to examine the influence of acarbose on rheumatoid arthritis (RA) risk in diabetes mellitus (DM) patients and on the incidence and severity of collagen-induced arthritis (CIA) in mice. In a nationwide, matched case-control study, we identified 723 incident RA cases and selected 7,230 age-, sex- and RA diagnosis date-matched controls from all newly treated DM patients. We found that use of acarbose at > 16,950 mg per year was associated with a lower RA risk (odds ratio 0.60; 95% CI, 0.41-0.89). In the CIA mouse study, acarbose was orally administered from days -7 to 38 relative to type II collagen (CII) immunization. The results revealed that acarbose at the dose of 500 mg/kg/day attenuated the incidence and severity of arthritis and the expression of proinflammatory cytokines, including TNF-α, IL-6 and IL-17 in the paw tissues. Acarbose further decreased the productions of anti-CII-IgG, IL-17 and IFN-γ by collagen-reactive lymph node cells. This work suggests that the use of acarbose decreased RA risk in DM patients and the incidence of CIA in mice. Acarbose also attenuated the severity of CIA via anti-inflammatory and immunomodulatory effects.

The first CO+ image: I. Probing the HI/H2 layer around the ultracompact HII region Mon R2

PubMed Central

Treviño-Morales, S. P.; Fuente, A.; Sánchez-Monge, Á.; Pilleri, P.; Goicoechea, J. R.; Ossenkopf-Okada, V.; Roueff, E.; Rizzo, J. R.; Gerin, M.; Berné, O.; Cernicharo, J.; Gónzalez-García, M.; Kramer, C.; García-Burillo, S.; Pety, J.

2016-01-01

The CO+ reactive ion is thought to be a tracer of the boundary between a HII region and the hot molecular gas. In this study, we present the spatial distribution of the CO+ rotational emission toward the Mon R2 star-forming region. The CO+ emission presents a clumpy ring-like morphology, arising from a narrow dense layer around the HII region. We compare the CO+ distribution with other species present in photon-dominated regions (PDR), such as [CII] 158 µm, H2 S(3) rotational line at 9.3 µm, polycyclic aromatic hydrocarbons (PAHs) and HCO+. We find that the CO+ emission is spatially coincident with the PAHs and [CII] emission. This confirms that the CO+ emission arises from a narrow dense layer of the HI/H2 interface. We have determined the CO+ fractional abundance, relative to C+ toward three positions. The abundances range from 0.1 to 1.9 ×10−10 and are in good agreement with previous chemical model, which predicts that the production of CO+ in PDRs only occurs in dense regions with high UV fields. The CO+ linewidth is larger than those found in molecular gas tracers, and their central velocity are blue-shifted with respect to the molecular gas velocity. We interpret this as a hint that the CO+ is probing photo-evaporating clump surfaces. PMID:27721515

Artemisinin analogue SM934 attenuate collagen-induced arthritis by suppressing T follicular helper cells and T helper 17 cells

PubMed Central

Lin, Ze-Min; Yang, Xiao-Qian; Zhu, Feng-Hua; He, Shi-Jun; Tang, Wei; Zuo, Jian-Ping

2016-01-01

SM934 is an artemisinin analogue with immunosuppressive properties and potent therapeutic activity against lupus-like diseases in autoimmune mice. In this report, the therapeutic efficacy and underlying mechanisms of SM934 on rheumatoid arthritis (RA) was investigated using collagen-induced arthritis (CIA) in DBA/1J mice. We demonstrated that SM934 treatment alleviate the severity of arthritis in CIA mice with established manifestations. The therapeutic benefits were associated with ameliorated joint swelling and reduced extent of bone erosion and destruction. Further, administration of SM934 diminished the development of T follicular helper (Tfh) cells and Th17 cells and suppressed the production of pathogenic antibodies, without altering the proportion of germinal center B cells. Ex vivo, SM934 treatment inhibited the bovine type II collagen (CII) induced proliferation and inflammatory cytokines secretion of CII -reactive T cells. In vitro, SM934 impeded the polarization of naïve CD4+ T cells into Tfh cells and the expression of its transcript factor Bcl-6. Moreover, SM934 decreased the IL-21-producing CD4+ T cells and dampened the IL-21 downstream signaling through STAT3. These finding offered the convincing evidence that artemisinin derivative might attenuate RA by simultaneously interfering with the generation of Tfh cells and Th17 cells as well as the subsequent antibody-mediated immune responses. PMID:27897259

Using global Climate Impact Indicators to assess water resource availability in a Mediterranean mountain catchment: the Sierra Nevada study case (Spain) in the SWICCA platform

NASA Astrophysics Data System (ADS)

José Pérez-Palazón, María; Pimentel, Rafael; Sáenz de Rodrigáñez, Marta; Gulliver, Zacarias; José Polo, María

2017-04-01

Climate services provide water resource managements and users with science-based information on the likely impacts associated to the future climate scenarios. Mountainous areas are especially vulnerable to climate variations due to the expected changes in the snow regime, among others; in Mediterranean regions, this shift involves significant effects on the river flow regime and water resource availability and management. The Guadalfeo River Basin is a 1345 km2 mountainous, coastal catchment in southern Spain, ranging from the Mediterranean Sea coastline to the Sierra Nevada mountains to the north (up to 3450 m a.s.l.) within a 40-km distance. The climate variability adds complexity to this abrupt topography and heterogeneous area. The uncertainty associated to snow occurrence and persistence for the next decades poses a challenge for the current and future water resource uses in the area. The development of easy-to-use local climate indicators and derived decision-making variables is key to assess and face the economic impact of the potential changes. The SWICCA (Service for Water Indicators in Climate Change Adaptation) Platform (http://swicca.climate.copernicus.eu/) has been developed under the Copernicus Climate Change Service (C3S) and provides global climate and hydrology indicators on a Pan-European scale. Different case studies are included to assess the platform development and contents, and analyse the indicators' performance from a proof-of-concept approach that includes end-users feedbacks. The Guadalfeo River Basin is one of these case studies. This work presents the work developed so far to analyse and use the SWICCA Climate Impact Indicators (CIIs) related to river flow in this mountainous area, and the first set of local indicators specifically designed to assess selected end-users on the potential impact associated to different climate scenarios. Different CIIs were extracted from the SWICCA interface and tested against the local information available in the case study. The Essential Climate Variables used were precipitation and flow daily values, obtained at different spatial scales. The analysis led to the use of SWICCA-river flow on a catchment scale as the most suitable global CIIs in this area. Further treatment included local downscaling by means of transfer functions and a final relative anomaly correction. Three final end-users (clients) were identified within the water resource management framework: 1) mini hydropower facilities at the head areas, 2) urban supply at the southern area, and 3) water management decision makers (reservoir operation). From the corrected CIIs, local indicators were defined from the interaction with each client, to tailor water services easily and readily usable. Knowledge brokering from this interaction resulted in a first identification of a set of 4, 3 and 4 indicators for hydropower generation, urban users and water resource decision-makers, respectively, with different time scales. The projections of three future climate scenarios were assessed for each indicator and presented to each client. Local indicators are an efficient tool to assess the potential range of water allocation possibilities in this area on an annual and decadal basis, and get a deeper insight of the seasonal future potential regime of water resource availability. The results are good examples of key information for decision making in the future, and show how to derive local indicators with impact in the short and medium term planning in heterogeneous catchments in this region.

Dust, ice and gas in time (DIGIT): Herschel and Spitzer spectro-imaging of SMM3 and SMM4 in Serpens

NASA Astrophysics Data System (ADS)

Dionatos, O.; Jørgensen, J. K.; Green, J. D.; Herczeg, G. J.; Evans, N. J.; Kristensen, L. E.; Lindberg, J. E.; van Dishoeck, E. F.

2013-10-01

Context. Mid- and far-infrared observations of the environment around embedded protostars reveal a plethora of high excitation molecular and atomic emission lines. Different mechanisms for the origin of these lines have been proposed, including shocks induced by protostellar jets and radiation or heating by the embedded protostar of its immediate surroundings. Aims: By studying of the most important molecular and atomic coolants, we aim at constraining the physical conditions around the embedded protostars SMM3 and SMM4 in the Serpens molecular cloud core and measuring the CO/H2 ratio in warm gas. Methods: Spectro-imaging observations from the Spitzer Infrared Spectrograph (IRS) and the Herschel Photodetector Array Camera and Spectrometer (PACS) provide an almost complete wavelength coverage between 5 and 200 μm. Within this range, emission from all major molecular (H2, CO, H2O and OH) and many atomic ([OI], [CII], [FeII], [SiII] and [SI]) coolants of excited gas are detected. Emission line maps reveal the morphology of the observed emission and indicate associations between the different species. The excitation conditions for molecular species are assessed through rotational diagrams. Emission lines from major coolants are compared to the results of steady-state C- and J-type shock models. Results: Line emission tends to peak at distances of ~10-20″ from the protostellar sources with all but [CII] peaking at the positions of outflow shocks seen in near-IR and sub-millimeter interferometric observations. The [CII] emission pattern suggests that it is most likely excited from energetic UV radiation originating from the nearby flat-spectrum source SMM6. Excitation analysis indicates that H2 and CO originate in gas at two distinct rotational temperatures of ~300 K and 1000 K, while the excitation temperature for H2O and OH is ~100-200 K. The morphological and physical association between CO and H2 suggests a common excitation mechanism, which allows direct comparisons between the two molecules. The CO/H2 abundance ratio varies from ~10-5 in the warmer gas up to ~10-4 in the hotter regions. Shock models indicate that C-shocks can account for the observed line intensities if a beam filling factor and a temperature stratification in the shock front are considered. C-type shocks can best explain the emission from H2O. The existence of J-shocks is suggested by the strong atomic/ionic (except for [CII]) emission and a number of line ratio diagnostics. Dissociative shocks can account for the CO and H2 emission in a single excitation temperature structure. Conclusions: The bulk of cooling from molecular and atomic lines is associated with gas excited in outflow shocks. The strong association between H2 and CO constrain their abundance ratio in warm gas. Both C- and J-type shocks can account for the observed molecular emission; however, J-shocks are strongly suggested by the atomic emission and provide simpler and more homogeneous solutions for CO and H2. The variations in the CO/H2 abundance ratio for gas at different temperatures can be interpreted by their reformation rates in dissociative J-type shocks, or the influence of both C and J shocks. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.Appendices A-C are available in electronic form at http://www.aanda.org

Final Report of the Center of Excellence in Rotary Wing Technology

DTIC Science & Technology

1993-04-01

and theses [eg. 9,10]. These studies considered, as examples, synchronizing shafts on the Boeing CH -47 and tail drive shafts on the Sikorsky UH-60 and...and CH . A reasonable steady lift component correlation with the linear case was obtained. Comparisons of the drag results from the two methods on the...15 Research Forecast and WraQ-Up R. Loewy 2:45 Break 3 3:00 ARO Executive Session CII 4003 3:00 RRTC-TAP Exchange JEC 3117 3:30 Evaluation Feedback CH

National Dam Safety Program. Structure F-2 (MO 20513), Verdigris - Neosho River Basin, Newton County, Missouri. Phase I Inspection Report.

DTIC Science & Technology

1980-08-01

AXIAL- INITIAL [00 NS CL 13~ rf START DEGOF SATI END CONS;0LI- PRINCIPIAL s T. -s STRAIN AT PU n I DIE~)0.1 AT S f A RT OF IA WON STES I ru Pcf cO DA...SAM.PLE. LUCAII’N FIELD SMk -11 N,) (1711H CLOLOCIZ Cii... 3~ ( i_ . __ _ _ _ __ _ _ TNE I LNETU)D AT API’lOV’U) V~ CA CLASSIFICATION Il!LL ill/P1

A Model to Predict Retention and Attrition of Hispanic-Americans in the Navy.

DTIC Science & Technology

1980-10-01

N0001-79- C -0850 UNCLASSIFIED 77C-i-i I, umuu..i..nn.I, E -EEEEEEElllEE EE~lEllEEllEEE IIIEIIIII SECURITY CLASIFICATION OF THI1S PA D-1(W. e F., ’s REPORT...Brislin, R ., Lonner, W., & Thorndike, R . Cross-cultural research methods. New York: John Wiley and Sons, 1973. Browning, H. L., Lopreato, S. C ...Doctoral dissertation, University of Houston, 1976) University Microfilm 77-1502. Chandler, C . R . Value orientations among Mexican Americans in a

Small Tactical Unmanned Aerial System (STUAS) Rapid Integration and Fielding Process (RAIN)

DTIC Science & Technology

2013-09-01

121A4 September 2013 Thesis Advisor: Rama Gehris Co-Advisor: Bonnie Young THIS PAGE INTENTIONALLY LEFT BLANK i REPORT...11~ ... . , - ... $tlo.rotfydle:IW#hlt I •:tl ~dciwolloCII’fil -K ~IOI’I.,....UMdto~~h..,orj ’Bj ~ $11owh~t:~I) Cft .... l’utopK i7, MtM rf Mtdlar...Trndc-off Anolysis Rcsulls ’ll•c trnde-ofl’ Analysis results will be a summary of tho conclusions derived from incorporating aml analyzing tho

Optical photometry and low-resolution spectroscopy of the SN 2014J

NASA Astrophysics Data System (ADS)

Gonzalez Hernandez, Jonay I.; Genova-Santos, Ricardo; Rubiño-Martin, Jose Alberto; Ruiz-Lapuente, Pilar

2014-02-01

We have obtained low-resolution spectroscopic data and broadband (g,r,i,z) photometric images at the 4.2m-WHT equipped with the instrument ACAM at the Observatorio del Roque de los Muchachos (La Palma, Spain) on approximately January 28.13 UT. A preliminary analysis of these spectra show the strong Si II (6355A) line moving at ~12600 km/s, and CII (6580A) and SII (5468A) at ~13700km/s and 12150 km/s, respectively.

Site differences in mild cognitive dysfunction (MCD) among patients with systemic lupus erythematosus (SLE).

PubMed

Kozora, E; Erkan, D; West, S G; Filley, C M; Zhang, L; Ramon, G; Duggan, E; Lockshin, M D

2013-01-01

Mild cognitive dysfunction (MCD) is common in patients with systemic lupus erythematosus (MCD-SLE) but few studies have investigated potential site differences. SLE patients from Denver, CO, and New York, NY, were enrolled in two different cognition studies employing similar screening methods. Using the resulting neuropsychological scores, cognitive impairment was calculated using a cognitive impairment index (CII). The rate of MCD-SLE was 24% at the Denver, CO, site and 60% at the New York, NY, site. The mean CII was 2.6 ± 2.3 versus 4.4 ± 2.7, respectively (p = 0.005). The NY participants had a significantly longer disease duration (p = 0.13) and higher American College of Rheumatology SLE criteria scores (p > 0.001). NY participants had a higher frequency of impairment in semantic verbal fluency (p = 0.005), visuomotor speed (p = 0.013), and motor sequencing (p = 0.001). A correlation was found between cognitive impairment and SLE disease duration (p = 0.03). The rate of MCD-SLE was greater in SLE patients from New York, NY, compared to patients in the Denver, CO, area. The greater duration of disease and higher prevalence of medical complications in the NY group might contribute to this difference. Findings suggest that MCD-SLE may differ by site, but future studies that better evaluate site or selection bias are recommended.

Sequencing analysis of mutations induced by N-ethyl-N-nitrosourea at different sampling times in mouse bone marrow.

PubMed

Wang, Jianyong; Chen, Tao

2010-03-01

In our previous study (Wang et al., 2004, Toxicol. Sci. 82: 124-128), we observed that the cII gene mutant frequency (MF) in the bone marrow of Big Blue mice showed significant increase as early as day 1, reached the maximum at day 3 and then decreased to a plateau by day 15 after a single dose of carcinogen N-ethyl-N-nitrosourea (ENU) treatment, which is different from the longer mutation manifestation time and the constancy of MFs after reaching their maximum in some other tissues. To determine the mechanism underlying the quick increase in MF and the peak formation in the mutant manifestation, we examined the mutation frequencies and spectra of the ENU-induced mutants collected from different sampling times in this study. The cII mutants from days 1, 3 and 120 after ENU treatment were randomly selected from different animals. The mutation frequencies were 33, 217, 305 and 144 x 10(-6) for control, days 1, 3, and 120, respectively. The mutation spectra at days 1 and 3 were significantly different from that at day 120. Considering that stem cells are responsible for the ultimate MF plateau (day 120) and transit cells are accountable for the earlier MF induction (days 1 or 3) in mouse bone marrow, we conclude that transit cells are much more sensitive to mutation induction than stem cells in mouse bone marrow, which resulted in the specific mutation manifestation induced by ENU.

Population-based versus practice-based recall for childhood immunizations: a randomized controlled comparative effectiveness trial.

PubMed

Kempe, Allison; Saville, Alison; Dickinson, L Miriam; Eisert, Sheri; Reynolds, Joni; Herrero, Diana; Beaty, Brenda; Albright, Karen; Dibert, Eva; Koehler, Vicky; Lockhart, Steven; Calonge, Ned

2013-06-01

We compared the effectiveness and cost-effectiveness of population-based recall (Pop-recall) versus practice-based recall (PCP-recall) at increasing immunizations among preschool children. This cluster-randomized trial involved children aged 19 to 35 months needing immunizations in 8 rural and 6 urban Colorado counties. In Pop-recall counties, recall was conducted centrally using the Colorado Immunization Information System (CIIS). In PCP-recall counties, practices were invited to attend webinar training using CIIS and offered financial support for mailings. The percentage of up-to-date (UTD) and vaccine documentation were compared 6 months after recall. A mixed-effects model assessed the association between intervention and whether a child became UTD. Ten of 195 practices (5%) implemented recall in PCP-recall counties. Among children needing immunizations, 18.7% became UTD in Pop-recall versus 12.8% in PCP-recall counties (P < .001); 31.8% had documented receipt of 1 or more vaccines in Pop-recall versus 22.6% in PCP-recall counties (P < .001). Relative risk estimates from multivariable modeling were 1.23 (95% confidence interval [CI] = 1.10, 1.37) for becoming UTD and 1.26 (95% CI = 1.15, 1.38) for receipt of any vaccine. Costs for Pop-recall versus PCP-recall were $215 versus $1981 per practice and $17 versus $62 per child brought UTD. Population-based recall conducted centrally was more effective and cost-effective at increasing immunization rates in preschool children.

The unpredictability of lymphatic drainage from the ear in melanoma patients, and its implications for management.

PubMed

Peach, Howard S; van der Ploeg, Augustinus P T; Haydu, Lauren E; Stretch, Jonathan R; Shannon, Kerwin F; Uren, Roger F; Thompson, John F

2013-05-01

The ear is known to have variable lymphatic drainage. The purpose of this study was to define better the lymphatic drainage patterns of the ear by correlating the location of primary tumors, classified according to the embryologically derived anatomical subunits of the ear, with their mapped sentinel nodes (SNs) identified by lymphoscintigraphy (LS). Lymphatic drainage data for patients with a primary melanoma of the ear were reviewed and correlated with the precise primary melanoma site. Between 1993 and 2010, LS was performed in 111 patients with a primary melanoma on the ear, identifying 281 SNs in 195 lymph node (LN) fields. The mean numbers of SNs and LN fields identified by LS per patient were 2.65 and 1.76. SN biopsy was performed in 71 patients (64 %). The mean number of SNs removed was 2.36. The 111 ear melanomas were mostly located on the helical rim (55 %), followed by the lobule (24.3 %). The five different primary ear sites drained mainly to SNs in level CII, level CV and the preauricular region. Drainage was most often to level CII (36.4 %). Drainage to the contralateral neck was not observed. Lymphatic drainage of the ear has no predictable pattern and can be to SNs anywhere in the ipsilateral neck. Most commonly drainage is to cervical level II and the preauricular and postauricular LN fields. LS defines the lymphatic drainage pattern in individual melanoma patients and is essential for accurate SN identification and reliable SN biopsy.

Medical Store Management: An Integrated Economic Analysis of a Tertiary Care Hospital in Central India

PubMed Central

Mahatme, MS; Dakhale, GN; Hiware, SK; Shinde, AT; Salve, AM

2012-01-01

Economic analysis plays a pivotal role in the management of medical store. The main objectives of this study were to consider always better control-vital, essential and desirable (ABC-VED) analysis with economic order quantity (EOQ), comparison of indexed cost and the actual cost, and to assess the expenditure for the forthcoming years. Based on cost and criticality, a matrix of nine groups by combining ABC and VED analysis was formulated. Drug categories were narrowed down for prioritization to direct supervisory monitoring. The subgroups AE and AV of the categories category I and II should be ordered based on EOQ. The difference between the actual annual drug expenditure (ADE) and the derived indexed cost using the cost inflation index (CII) was calculated. Linear regression was used to assess the expenditure for the forth coming years. The total ADE for the financial year of 2010–2011 was Rs. 1,91,44,253 which was only 7.68% of annual hospital expenditure. Using the inflation index, the indexed cost of acquisition of ADE for year 2010–2011 was Rs. 1,95,10,387. The difference between the two was estimated to be 2.11%. Thus, the CII justifies the demand of increased budget for next year and prompts us for cautious use of drugs. By taking into consideration the ADE of last 10 years, we have forecasted the budget for forthcoming years which will help significantly for making policies according to the available budget. PMID:22754264

Medical store management: an integrated economic analysis of a tertiary care hospital in central India.

PubMed

Mahatme, Ms; Dakhale, Gn; Hiware, Sk; Shinde, At; Salve, Am

2012-04-01

Economic analysis plays a pivotal role in the management of medical store. The main objectives of this study were to consider always better control-vital, essential and desirable (ABC-VED) analysis with economic order quantity (EOQ), comparison of indexed cost and the actual cost, and to assess the expenditure for the forthcoming years. Based on cost and criticality, a matrix of nine groups by combining ABC and VED analysis was formulated. Drug categories were narrowed down for prioritization to direct supervisory monitoring. The subgroups AE and AV of the categories category I and II should be ordered based on EOQ. The difference between the actual annual drug expenditure (ADE) and the derived indexed cost using the cost inflation index (CII) was calculated. Linear regression was used to assess the expenditure for the forth coming years. The total ADE for the financial year of 2010-2011 was Rs. 1,91,44,253 which was only 7.68% of annual hospital expenditure. Using the inflation index, the indexed cost of acquisition of ADE for year 2010-2011 was Rs. 1,95,10,387. The difference between the two was estimated to be 2.11%. Thus, the CII justifies the demand of increased budget for next year and prompts us for cautious use of drugs. By taking into consideration the ADE of last 10 years, we have forecasted the budget for forthcoming years which will help significantly for making policies according to the available budget.

Novel mutations in the GPIHBP1 gene identified in 2 patients with recurrent acute pancreatitis.

PubMed

Ariza, María José; Martínez-Hernández, Pedro Luis; Ibarretxe, Daiana; Rabacchi, Claudio; Rioja, José; Grande-Aragón, Cristina; Plana, Nuria; Tarugi, Patrizia; Olivecrona, Gunilla; Calandra, Sebastiano; Valdivielso, Pedro

2016-01-01

Glycosylphosphatidylinositol-anchored high-density lipoprotein-binding protein 1 (GPIHBP1) has been demonstrated to be essential for the in vivo function of lipoprotein lipase (LPL), the major triglyceride (TG)-hydrolyzing enzyme involved in the intravascular lipolysis of TG-rich lipoproteins. Recently, loss-of-function mutations of GPIHBP1 have been reported as the cause of type I hyperlipoproteinemia in several patients. Two unrelated patients were referred to our Lipid Units because of a severe hypertriglyceridemia and recurrent pancreatitis. We measured LPL activity in postheparin plasma and serum ApoCII and sequenced LPL, APOC2, and GPIHBP1. The 2 patients exhibited very low LPL activity not associated with mutations in LPL gene or with ApoCII deficiency. The sequence of GPIHBP1 revealed 2 novel point mutations. One patient (proband 1) was found to be homozygous for a C>A transversion in exon 3 resulting in the conversion of threonine to lysine at position 80 (p.Thr80Lys). The other patient (proband 2) was found to be homozygous for a G>T transversion in the third base of the ATG translation initiation codon in exon 1, resulting in the conversion of methionine to isoleucine (p.Met1Ile). In conclusion, we have identified 2 novel GPIHBP1 missense mutations in 2 unrelated patients as the cause of their severe hypertriglyceridemia. Copyright © 2016 National Lipid Association. Published by Elsevier Inc. All rights reserved.

An overview of a cohort of South African patients with mitochondrial disorders.

PubMed

Smuts, Izelle; Louw, Roan; du Toit, Hanli; Klopper, Brenda; Mienie, Lodewyk J; van der Westhuizen, Francois H

2010-12-01

Mitochondrial disorders are frequently encountered inherited diseases characterized by unexplained multisystem involvement with a chronic, intermittent, or progressive nature. The objective of this paper is to describe the profile of patients with mitochondrial disorders in South Africa. Patients with possible mitochondrial disorders were accessed over 10 years. Analyses for respiratory chain and pyruvate dehydrogenase complex enzymes were performed on muscle. A diagnosis of a mitochondrial disorder was accepted only if an enzyme activity was deficient. Sixty-three patients were diagnosed with a mitochondrial disorder, including 40 African, 20 Caucasian, one mixed ancestry, and two Indian patients. The most important findings were the difference between African patients and other ethnicities: respiratory chain enzyme complexes CI+III or CII+III deficiencies were found in 52.5% of African patients, being of statistical significance (p value = 0.0061). They also presented predominantly with myopathy (p value = 0.0018); the male:female ratio was 1:1.2. Twenty-five (62.5%) African patients presented with varying degrees of a myopathy accompanied by a myopathic face, high palate, and scoliosis. Fourteen of these 25 also had ptosis and/or progressive external ophthalmoplegia. No patients of other ethnicities presented with this specific myopathic phenotype. Caucasian patients (16/20) presented predominantly with central nervous system involvement. Of the South African pediatric neurology patients, Africans are more likely to present with myopathy and CII+III deficiency, and Caucasian patients are more likely to present with encephalopathy or encephalomyopathy.

Differences in the Spectrum of Anti-Citrullinated Protein Antibody Fine Specificities Between Malaysian and Swedish Patients With Rheumatoid Arthritis: Implications for Disease Pathogenesis.

PubMed

Too, Chun Lai; Murad, Shahnaz; Hansson, Monika; Alm, Linda Mathsson; Dhaliwal, Jasbir Singh; Holmdahl, Rikard; Jakobsson, Per-Johan; Alfredsson, Lars; Klareskog, Lars; Rönnelid, Johan; Padyukov, Leonid

2017-01-01

Antibodies to the citrullinated protein antigens (ACPAs) are important in the diagnosis and pathogenesis of rheumatoid arthritis (RA). However, the prevalence of ACPAs with different fine specificities in different populations is unclear. This study sought to examine the fine specificity of the antibody responses toward citrullinated proteins in RA patients from Malaysia, an area where genetic and environmental determinants of RA are different from those in more frequently studied cohorts of Caucasian subjects. A multiplex analytic microarray system was used to analyze the occurrence of antibodies to 10 different citrullinated peptides (filaggrin [fil307-324], vimentin [Vim2-17, Vim60-75], fibrinogen [Fibα563-583, Fibα580-600, Fibβ36-52, Fibβ62-81a, Fibβ62-81b], enolase [Eno5-21], and type II collagen [CitCII355-378]) in serum samples from 4,089 RA patients (1,231 Malaysian and 2,858 Swedish) and 827 healthy control subjects (249 Malaysian and 578 Swedish). The positive reaction threshold for each peptide was set separately for each population based on a specificity of 98%. Distinct differences in the frequencies of 5 ACPA fine specificities (Vim60-75, Vim2-17, Fibβ62-81b, Eno5-21, and CitCII355-378) were found between the Malaysian and Swedish RA populations, despite a nearly identical percentage of patients in each population who were positive for anti-cyclic citrullinated peptide 2 antibodies. In Malaysian RA patients compared with Swedish RA patients, the frequencies of antibodies to Vim60-75 (54% versus 44%, corrected P [P corr ] = 1.06 × 10 -8 ) and CitCII355-378 (17% versus 13%, P corr  = 0.02) were significantly higher, while the frequencies of antibodies to Vim2-17 (25% versus 32%, P corr  = 1.91 × 10 -4 ), Fibβ62-81b (15% versus 30%, P corr  = 2.47 × 10 -22 ), and Eno5-21 (23% versus 50%, P corr  = 3.64 × 10 -57 ) were significantly lower. Serum ACPA fine specificities differ between RA patients in different populations, although the total proportions of individuals positive for ACPAs are similar. Differing patterns of ACPA fine specificity could be attributed to variations in genetic and/or environmental factors. © 2016 The Authors. Arthritis & Rheumatology published by Wiley Periodicals, Inc. on behalf of the American College of Rheumatology.

Methodology, and the Statistician’s Responsibility for BOTH Accuracy and Relevance

DTIC Science & Technology

1975-12-01

John W. Tukey is also Associate Executive Director- Research , Beel Telephone Laboratories . I ! u I». Ktv UBS fSSSi m m!mSi S5 i wtiwrii S...eoNmokkiNO erriet NAM AND ACOHCM Office of Naval Research (Code «»36) Arlington, VA 22217 Z^lp&wlliMCTioiii -./ r^ aCII>l«Mrt CATALÖO...558» ir SS3 mSSm ~~~’ level or change, least squares, fit PLUS residuals, Phillips curve, patch maps, standardization ■A AMTRACT

Building Air Bases in the Negev; The U.S. Army Corps of Engineers in Israel, 1979-1982

DTIC Science & Technology

1992-01-01

Burton Bernstein, Sinai: The Great and Terrible Wilderness ( New ,brk: The Viking Press, 1979), p. 35. 9 . L.esley Hazelton, Where Mountains Roar, . 4 ...Washington Post, 4 Nov 88 and 25 Mar 89. 5 . New York Times, 23 Mar 86. 6. Washington Post, 19 Nov 87. 7. Ibid. 8. Jimmy Carter, The Blood of Abraham... the itteattitg of shoin titles an1d other albhresiatiiins See thec Glossalsy. 4 . L t Get Pcetitett I.. Lewis (Ret.). commnnelts c)ii dtraft MS, 5 Feb

US Army Institute of Dental Research Annual Progress Report Fiscal Year 1981 (1 October 1980 - 30 September 1981)

DTIC Science & Technology

1981-10-01

Oral Biology) DA OF 6024 Identification and Control of Orofacial Infections 9 of Military Importance (Oral Biology) DA OG 8676 The Secondary Effect of...I. -SA h ImS-CII1 CIAN.IIIC..Ia CAR I 23. (U) Emiergency dental restorative work in the field often involves pulpal pain , inflamma~tion and infection...are being considered for field use. --. A D, ’-07-A49 PROJE1JT NUMBER 31161102BS10 IDENTIFICATION AND CDNTWOL OF OROFACIAL INFECfIONS OF MILITARY

Environmentally Safe and Effective Processes for Paint Removal (Les Procedes Efficaces et Ecologiques pour l’Enlevement des Peintures)

DTIC Science & Technology

1993-03-01

1992 sur tine coclule d’avion TRANSALL pointe A loexception des composites vner / dpoxy (inhtalla- avec In garame Airbus . don non robotisde, 2 buses...Los P.M.P. h AIRBUS INDUSTRIE page P.M.P, cii cabine (MATRASUR ct SCHLICK) pour l’onl~vormont des peinturos sur las 616ments md- Ril~ant suite h uno...dtudo sur las P.M.P. lancdo fin caziiquos (site do MARIGNANE) =* capacitd do iral. 1987, tine spcificatlun do pr ddwv Airbus Industrie tement : 1500 kg

VizieR Online Data Catalog: [CII], [OI] and [OIII] line emission from z~6 gal. (Olsen+, 2017)

NASA Astrophysics Data System (ADS)

Olsen, K.; Greve, T. R.; Narayanan, D.; Thompson, R.; Dave, R.; Rios, L. N.; Stawinski, S.

2018-05-01

We use cosmological zoom simulations of galaxies extracted from the MUFASA cosmological simulation (Dave+ 2016MNRAS.462.3265D, 2017MNRAS.467..115D); see section 2. For the purposes of this paper, we updated SIGAME from the version presented in Olsen+ (2015ApJ...814...76O); see section 3. Throughout, we adopt a flat cold dark matter (ΛCDM) cosmology with cosmological parameters ΩΛ=0.7, ΩM=0.3, and h=0.68. (1 data file).

Does RBC Storage Age Effect Inflammation, Immune Function and Susceptibility to Transfusion Associated Microchimerism in Critically Ill Patients? Adverse Effects of RBC Storage in Critically Ill Patients

DTIC Science & Technology

2015-05-01

EVs are known to be associated with increased risk of specific diseases and cancers, including lym phoma (26), lung (27), breast, gastric (28...CD148 as a potentially useful antigenic biomarker for mantle cell lymphoma diagnosis. J. Proteome Res 2009;8:3346–3354. 27. Fleitas T, Martınez-Sales... gastric cancer patients. Cancer Immunol Immunother CII 2010;59:841– 850. 29. Angelillo-Scherrer A. Leukocyte-derived microparticles in vascular

Search for breast cancer biomarkers in fractionated serum samples by protein profiling with SELDI-TOF MS.

PubMed

Opstal-van Winden, Annemieke W J; Beijnen, Jos H; Loof, Arnoud; van Heerde, Waander L; Vermeulen, Roel; Peeters, Petra H M; van Gils, Carla H

2012-01-01

Many high-abundant acute phase reactants have been previously detected as potential breast cancer biomar-kers. However, they are unlikely to be specific for breast cancer. Cancer-specific biomarkers are thought to be among the lower abundant proteins. We aimed to detect lower abundant discriminating proteins by performing serum fractionation by strong anion exchange chromatography preceding protein profiling with SELDI-TOF MS. In a pilot study, we tested the different fractions resulting from fractionation, on several array types. Fraction 3 on IMAC30 and Fraction 6 on Q10 yielded the most discriminative proteins and were used for serum protein profiling of 73 incident breast cancer cases and 73 matched controls. Eight peaks showed statistically significantly different intensities between cases and controls (P⧁0.05), and had less than 10% chance to be a false-positive finding. Seven of these were tentatively identified as apolipoprotein C-II (m/z 8,909), oxidized apolipoprotein C-II (m/z 8,925), apolipoprotein C-III (m/z 8,746), fragment of coagulation factor XIIIa (m/z 3,959), heterodimer of apolipoprotein A-I and apolipoprotein A-II (m/z 45,435), hemoglobin B-chain (m/z 15,915), and post-translational modified hemoglobin (m/z 15,346). By extensive serum fractionation, we detected many more proteins than in previous studies without fractionation. However, discriminating proteins were still high abundant. Results indicate that either lower abundant proteins are less distinctive, or more rigorous fractionation and selective protein depletion, or a more sensitive assay, are needed to detect lower abundant discriminative proteins. © 2012 Wiley Periodicals, Inc.

Curcumin attenuates inflammatory response in IL-1beta-induced human synovial fibroblasts and collagen-induced arthritis in mouse model.

PubMed

Moon, Dong-Oh; Kim, Mun-Ok; Choi, Yung Hyun; Park, Yung-Min; Kim, Gi-Young

2010-05-01

Curcumin, a major component of turmeric, has been shown to exhibit anti-oxidant and anti-inflammatory activities. The present study was performed to determine whether curcumin is efficacious against both collagen-induced arthritis (CIA) in mice and IL-1beta-induced activation in fibroblast-like synoviocytes (FLSs). DBA/1 mice were immunized with bovine type II collagen (CII) and treated with curcumin every other day for 2weeks after the initial immunization. For arthritis, we evaluated the incidence of disease and used an arthritis index based on paw thickness. In vitro proliferation of CII- or concanavalin A-induced splenic T cells was examined using IFN-gamma production. Pro-inflammatory cytokines TNF-alpha and IL-1beta were examined in the mouse ankle joint and serum IgG1 and IgG2a isotypes were analyzed. The expression levels of prostaglandin E(2) (PGE(2)), cyclooxygenase-2 (COX-2), and matrix metalloproteinases (MMPs) in human FLSs were also determined. The results showed that compared with untreated CIA mice, curcumin-treated mice downregulated clinical arthritis score, the proliferation of splenic T cells, expression levels of TNF-alpha and IL-1beta in the ankle joint, and expression levels of IgG2a in serum. Additionally, by altering nuclear factor (NF)-kappaB transcription activity in FLSs, curcumin inhibited PGE(2) production, COX-2 expression, and MMP secretion. These results suggest that curcumin can effectively suppress inflammatory response by inhibiting pro-inflammatory mediators and regulating humoral and cellular immune responses. Copyright 2010 Elsevier B.V. All rights reserved.

NBD-labelled phospholipid accelerates apolipoprotein C-II amyloid fibril formation but is not incorporated into mature fibrils

PubMed Central

Ryan, Timothy M.; Griffin, Michael D. W.; Bailey, Michael F.; Schuck, Peter; Howlett, Geoffrey J.

2014-01-01

Human apolipoprotein (apo) C-II is one of several lipid-binding proteins that self-assemble into fibrils and accumulate in disease-related amyloid deposits. A general characteristic of these amyloid deposits is the presence of lipids, known to modulate individual steps in amyloid fibril formation. ApoC-II fibril formation is activated by sub-micellar phospholipids but inhibited by micellar lipids. We examined the mechanism for the activation by sub-micellar lipids using the fluorescently-labelled, short-chain phospholipid, 1-dodecyl-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]-2-hydroxy-glycero-3-phosphocholine (NBD-lyso-12-PC). Addition of submicellar NBD-lyso-12-PC increased the rate of fibril formation by apoC-II approximately two-fold. Stopped flow kinetic analysis using fluorescence detection and low, non-fibril forming concentrations of apoC-II indicated NBD-Lyso-12-PC binds rapidly, in the millisecond timescale, followed by the slower formation of discrete apoC-II tetramers. Sedimentation velocity analysis showed NBD-Lyso-12-PC binds to both apoC-II monomers and tetramers at approximately 5 sites per monomer with an average dissociation constant of approximately 10 μM. Mature apoC-II fibrils formed in the presence of NBD-Lyso-12-PC were devoid of lipid indicating a purely catalytic role for sub-micellar lipids in the activation of apoC-II fibril formation. These studies demonstrate the catalytic potential of small amphiphilic molecules to control protein folding and fibril assembly pathways. PMID:21985034

Adoptive Cell Therapy of Induced Regulatory T Cells Expanded by Tolerogenic Dendritic Cells on Murine Autoimmune Arthritis.

PubMed

Yang, Jie; Liu, Lidong; Yang, Yiming; Kong, Ning; Jiang, Xueyu; Sun, Juan; Xie, Rufeng

2017-01-01

Tolerogenic dendritic cells (tDCs) can expand TGF- β -induced regulatory T cells (iTregs); however, the therapeutic utility of these expanded iTregs in autoimmune diseases remains unknown. We sought to determine the properties of iTregs expanded by mature tolerogenic dendritic cells (iTreg mtDC ) in vitro and explore their potential to ameliorate collagen-induced arthritis (CIA) in a mouse model. After induction by TGF- β and expansion by mature tDCs (mtDCs), the phenotype and proliferation of iTreg mtDC were assessed by flow cytometry. The ability of iTregs and iTreg mtDC to inhibit CD4 + T cell proliferation and suppress Th17 cell differentiation was compared. Following adoptive transfer of iTregs and iTreg mtDC to mice with CIA, the clinical and histopathologic scores, serum levels of IFN- γ , TNF- α , IL-17, IL-6, IL-10, TGF- β and anti-CII antibodies, and the distribution of the CD4 + Th subset were assessed. Compared with iTregs, iTreg mtDC expressed higher levels of Foxp3 and suppressed CD4 + T cell proliferation and Th17 cell differentiation to a greater extent. In vivo, iTreg mtDC reduced the severity and progression of CIA more significantly than iTregs, which was associated with a modulated inflammatory cytokine profile, reduced anti-CII IgG levels, and polarized Treg/Th17 balance. This study highlights the potential therapeutic utility of iTreg mtDC in autoimmune arthritis and should facilitate the future design of iTreg immunotherapeutic strategies.

Heat flux modeling using ion drift effects in DIII-D H-mode plasmas with resonant magnetic perturbations

DOE PAGES

Wingen, Andreas; Schmitz, Oliver; Evans, Todd E.; ...

2014-01-01

The heat flux patterns measured in low-collisionality DIII-D H-mode plasmas strongly deviate from simultaneously measured CII emission patterns, used as indicator of particle flux, during applied resonant magnetic perturbations. While the CII emission clearly shows typical striations, which are similar to magnetic footprint patterns obtained from vacuum field line tracing, the heat flux is usually dominated by one large peak at the strike point position. The vacuum approximation, which only considers applied magnetic fields and neglects plasma response and plasma effects, cannot explain the shape of the observed heat flux pattern. One possible explanation is the effect of particle drifts.more » This is included in the field line equations and the results are discussed with reference to the measurement. Electrons and ions show di fferent drift motions at thermal energy levels in a guiding center approximation. While electrons hardly deviate from the field lines, ions can drift several centimetres away from field line flux surfaces. A model is presented in which an ion heat flux, based on the ion drift motion from various kinetic energies as they contribute to a thermal Maxwellian distribution, is calculated. The simulated heat flux is directly compared to measurements with a varying edge safety factor q95. This analysis provides evidence for the dominate e ect of high-energy ions in carrying heat from the plasma inside the separatrix to the target. High-energy ions are deposited close to the unperturbed strike line while low-energy ions can travel into the striated magnetic topology.« less

Galactic Observations of Terahertz C+ (GOT C+): First Results: Inner Galaxy Survey

NASA Astrophysics Data System (ADS)

Langer, William; Velusamy, T.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

2010-05-01

To understand the lifecycle of the interstellar gas and star formation we need detailed information about the diffuse atomic and diffuse molecular gas cloud properties. The ionized carbon [CII] 1.9 THz fine structure line is an important tracer of the atomic gas in the diffuse regions and the interface regions of atomic gas to molecular clouds. Furthermore, C+ is a major ISM coolant and among the Galaxy's strongest far-IR emission lines, and thus controls the thermal conditions throughout large parts of the Galaxy. Until now our knowledge of interstellar gas has been limited to the diffuse atomic phase traced by HI and to the dense molecular H2 phase traced by CO. However, we are missing an important phase of the ISM called "dark gas” in which there is no or little, HI, and mostly molecular hydrogen but with insufficient shielding of UV to allow CO to form. C+ emission and absorption lines at 1.9 THz have the potential to trace this gas. Galactic Observations of the Terahertz C+ Line (GOT C+) is a Herschel Space Observatory Open Time Key Program to study the diffuse interstellar medium by sampling [CII] 1.9 THz line emission throughout the Galactic disk. We discuss the broader perspective of this survey and the first results of GOT C+ obtained during the Science Demonstration Phase (SDP) and Priority Science Phase (PSP) of HIFI, which focus on approximately 100 lines of sight in the inner galaxy. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration.

Adoptive Cell Therapy of Induced Regulatory T Cells Expanded by Tolerogenic Dendritic Cells on Murine Autoimmune Arthritis

PubMed Central

Liu, Lidong; Kong, Ning; Jiang, Xueyu; Sun, Juan; Xie, Rufeng

2017-01-01

Objective Tolerogenic dendritic cells (tDCs) can expand TGF-β-induced regulatory T cells (iTregs); however, the therapeutic utility of these expanded iTregs in autoimmune diseases remains unknown. We sought to determine the properties of iTregs expanded by mature tolerogenic dendritic cells (iTregmtDC) in vitro and explore their potential to ameliorate collagen-induced arthritis (CIA) in a mouse model. Methods After induction by TGF-β and expansion by mature tDCs (mtDCs), the phenotype and proliferation of iTregmtDC were assessed by flow cytometry. The ability of iTregs and iTregmtDC to inhibit CD4+ T cell proliferation and suppress Th17 cell differentiation was compared. Following adoptive transfer of iTregs and iTregmtDC to mice with CIA, the clinical and histopathologic scores, serum levels of IFN-γ, TNF-α, IL-17, IL-6, IL-10, TGF-β and anti-CII antibodies, and the distribution of the CD4+ Th subset were assessed. Results Compared with iTregs, iTregmtDC expressed higher levels of Foxp3 and suppressed CD4+ T cell proliferation and Th17 cell differentiation to a greater extent. In vivo, iTregmtDC reduced the severity and progression of CIA more significantly than iTregs, which was associated with a modulated inflammatory cytokine profile, reduced anti-CII IgG levels, and polarized Treg/Th17 balance. Conclusion This study highlights the potential therapeutic utility of iTregmtDC in autoimmune arthritis and should facilitate the future design of iTreg immunotherapeutic strategies. PMID:28702462

Progress Report, Grant AFOSR-79-0134, September 1, 1982 - April 30, 1983,

DTIC Science & Technology

1983-04-30

Lippmann, Professor of Physics, Emeritus, New York University; Kevin C. Nunan, Graduate Student; Michael I. Weinstein, Postdoctoral --J Fellow...iLipIIiani, Pro lessor of hscEirt:,NwYr University; R. Kevin C. Nunan, G1,aduaIZte Student; 9. Michacl1 1. Weinsteini, Postdoctoral Fellow, Stanf’ord Un...khIe 10 CIiI. 1 1u .1 1 ,kiibe;,1qIzcIItI Y mod Lf it’d by C (lorill t ŕ~ ;11( "n odl j, . i s j)1 ed U’ tm slil Iow~ waer eqtaL ions of Stokerx [4

Regular Inversion of the Divergence Operator with Dirichlet Boundary Conditions on a Polygon,

DTIC Science & Technology

1987-04-01

E c- xC 0 Czt C- -- &C -nC CL C~ E C - U U C U C0 V C ( C CC C L 6- - C C- 1 -CLL r = .c L C A C *C CCC F 4 C CC> C C 4D C3 1 ZC -’ c OC.LL fUC I...Iil Moreover by Lemmna 2.1, there is a single cons aiit C such that IIIIIPpV Chi 1 /, p e < CII, 1 2/P p. holds for all such 9. Thus / . af l( I-,0)1

Structure and physics of solar faculae

NASA Astrophysics Data System (ADS)

Pecker, J.-C.; Dumont, S.; Mouradian, Z.

1992-04-01

The optical depths of layers in the chromosphere-corona transition (CCT) zone, which is responsible for resolved structures in CII, CIII, OIV, and OVI lines, were determined using a new method that takes into account the effect of roughness (or local departures from sphericity) of the emitting layers in the CCT zone. The method allows determination of the angle alpha typical of the roughness (in case of availability of resolved data) and the two optical depths tau-1 and tau-2. It is shown that, even in unresolved cases, the new method gives a more realistic determination of the optical depths than previously determined.

OX40 signaling is involved in the autoactivation of CD4+CD28- T cells and contributes to the pathogenesis of autoimmune arthritis.

PubMed

Jiang, Juean; Liu, Cuiping; Liu, Mi; Shen, Yu; Hu, Xiaohan; Wang, Qin; Wu, Jian; Wu, Min; Fang, Qi; Zhang, Xueguang

2017-03-21

CD4 + CD28 - T cells exhibit autoreactive potential in autoimmune disorders, including rheumatoid arthritis (RA). It is not well known which costimulator functions as an alternative second signal in the activation of this subset after CD28 expression is downregulated. Tumor necrosis factor receptor superfamily member OX40 is a key costimulator in the activation of T cells. The aim of this study was to investigate the costimulatory effects of OX40 on CD4 + CD28 - T cells in autoimmune arthritis. Clinical samples were collected from patients with RA and control subjects. Collagen-induced arthritis (CIA) was induced with collagen type II (CII) in DBA/1 mice. The CD4 + CD28 - OX40 + T-cell subset and its cytokine production were detected by flow cytometry. After T-cell purification, adoptive transfer was performed in CIA mice. The regulatory role of OX40 was determined by blocking experiments in vitro and in vivo. OX40 and OX40L were abnormally expressed in patients with RA and CIA mice. Further analysis showed that CD4 + CD28 - OX40 + T cells accumulated in patients with RA and in animal models. These cells produced higher levels of proinflammatory cytokines and were closely correlated with the clinicopathological features of the affected individuals. Adoptive transfer of CII-specific CD4 + CD28 - OX40 + T cells remarkably aggravated arthritic development and joint pathology in CIA mice. Moreover, OX40 blockade significantly reduced the proinflammatory responses and ameliorated arthritis development. OX40 acts as an alternative costimulator of CD4 + CD28 - T cells and plays a pathogenic role in autoimmune arthritic development, suggesting that it is a potential target for immunomodulatory therapy of RA.

Apolipoprotein gene polymorphisms and plasma levels in healthy Tunisians and patients with coronary artery disease

PubMed Central

Bahri, Raoudha; Esteban, Esther; Moral, Pedro; Hassine, Mohsen; Hamda, Khaldoun Ben; Chaabani, Hassen

2008-01-01

Aim To analyze apolipoprotein gene polymorphisms in the Tunisian population and to check the relation of these polymorphisms and homocysteine, lipid and apolipoprotein levels to the coronary artery disease (CAD). Methods In healthy blood donors and in patients with CAD complicated by myocardial infarction (MI) four apolipoprotein gene polymorphisms [APO (a) PNR, APO E, APO CI and APO CII] were determined and plasma levels of total homocysteine, total cholesterol (TC), triglycerides (TG), HDL-cholesterol (HLD-C) and apolipoproteins (apo A-I, Apo B, Apo E) were measured. Results Analysis of the four apolipoprotein gene polymorphisms shows a relative genetic homogeneity between Tunisian population and those on the other side of Mediterranean basin. Compared to controls, CAD patients have significantly higher main concentrations of TC, TG, LDL-C, apo B and homocysteine, and significantly lower ones of HDL-C, apo A-I and apo E. The four apolipoprotein gene polymorphisms have not showed any significant differences between patients and controls. However, the APO E4 allele appears to be associated to the severity of CAD and to high levels of atherogenic parameters and low level of apo E, which has very likely an anti-atherogenic role. Conclusion Although APO (a) PNR, APO CI and APO CII genes are analyzed in only few populations, they show a frequency distribution, which is not at variance with that of APO E gene and other widely studied genetic markers. In the Tunisian population the APO E 4 appears to be only indirectly involved in the severity of CAD. In the routine practice, in addition of classic parameters, it will be useful to measure the concentration of apo E and that of Homocysteine and if possible to determine the APO E gene polymorphism. PMID:19014618

A structural model for apolipoprotein C-II amyloid fibrils: experimental characterization and molecular dynamics simulations.

PubMed

Teoh, Chai Lean; Pham, Chi L L; Todorova, Nevena; Hung, Andrew; Lincoln, Craig N; Lees, Emma; Lam, Yuen Han; Binger, Katrina J; Thomson, Neil H; Radford, Sheena E; Smith, Trevor A; Müller, Shirley A; Engel, Andreas; Griffin, Michael D W; Yarovsky, Irene; Gooley, Paul R; Howlett, Geoffrey J

2011-02-04

The self-assembly of specific proteins to form insoluble amyloid fibrils is a characteristic feature of a number of age-related and debilitating diseases. Lipid-free human apolipoprotein C-II (apoC-II) forms characteristic amyloid fibrils and is one of several apolipoproteins that accumulate in amyloid deposits located within atherosclerotic plaques. X-ray diffraction analysis of aligned apoC-II fibrils indicated a simple cross-β-structure composed of two parallel β-sheets. Examination of apoC-II fibrils using transmission electron microscopy, scanning transmission electron microscopy, and atomic force microscopy indicated that the fibrils are flat ribbons composed of one apoC-II molecule per 4.7-Å rise of the cross-β-structure. Cross-linking results using single-cysteine substitution mutants are consistent with a parallel in-register structural model for apoC-II fibrils. Fluorescence resonance energy transfer analysis of apoC-II fibrils labeled with specific fluorophores provided distance constraints for selected donor-acceptor pairs located within the fibrils. These findings were used to develop a simple 'letter-G-like' β-strand-loop-β-strand model for apoC-II fibrils. Fully solvated all-atom molecular dynamics (MD) simulations showed that the model contained a stable cross-β-core with a flexible connecting loop devoid of persistent secondary structure. The time course of the MD simulations revealed that charge clusters in the fibril rearrange to minimize the effects of same-charge interactions inherent in parallel in-register models. Our structural model for apoC-II fibrils suggests that apoC-II monomers fold and self-assemble to form a stable cross-β-scaffold containing relatively unstructured connecting loops. Copyright © 2010 Elsevier Ltd. All rights reserved.

Vibrio parahaemolyticus Inhibition of Rho Family GTPase Activation Requires a Functional Chromosome I Type III Secretion System▿

PubMed Central

Casselli, Timothy; Lynch, Tarah; Southward, Carolyn M.; Jones, Bryan W.; DeVinney, Rebekah

2008-01-01

Vibrio parahaemolyticus is a leading cause of seafood-borne gastroenteritis; however, its virulence mechanisms are not well understood. The identification of type III secreted proteins has provided candidate virulence factors whose functions are still being elucidated. Genotypic strain variability contributes a level of complexity to understanding the role of different virulence factors. The ability of V. parahaemolyticus to inhibit Rho family GTPases and cause cytoskeletal disruption was examined with HeLa cells. After HeLa cells were infected, intracellular Rho activation was inhibited in response to external stimuli. In vitro activation of Rho, Rac, and Cdc42 isolated from infected HeLa cell lysates was also inhibited, indicating that the bacteria were specifically targeting GTPase activation. The inhibition of Rho family GTPase activation was retained for clinical and environmental isolates of V. parahaemolyticus and was dependent on a functional chromosome I type III secretion system (CI-T3SS). GTPase inhibition was independent of hemolytic toxin genotype and the chromasome II (CII)-T3SS. Rho inhibition was accompanied by a shift in the total actin pool to its monomeric form. These phenotypes were abrogated in a mutant strain lacking the CI-T3S effector Vp1686, suggesting that the inhibiting actin polymerization may be a downstream effect of Vp1686-dependent GTPase inhibition. Although Vp1686 has been previously characterized as a potential virulence factor in macrophages, our findings reveal an effect on cultured HeLa cells. The ability to inhibit Rho family GTPases independently of the CII-T3SS and the hemolytic toxins may provide insight into the mechanisms of virulence used by strains lacking these virulence factors. PMID:18347050

Boronization in textor

NASA Astrophysics Data System (ADS)

Winter, J.; Esser, H. G.; Könen, L.; Philipps, V.; Reimer, H.; Seggern, J. v.; Schlüter, J.; Vietzke, E.; Waelbroeck, F.; Wienhold, P.; Banno, T.; Ringer, D.; Vepřek, S.

1989-04-01

The liner and limiters of TEXTOR have been coated in situ with a boron containing carbon film using a RG discharge in a throughflow of 0.8 He + 0.1 B 2H 6 +0.1 CH 4. The average film thickness was 30-50 nm, the ratio of boron and carbon in the layer was about 1:1 according to Auger Electron Spectroscopy. Subsequent tokamak discharges are characterized by a small fraction of radiated power (< 0.3) even during high power ICRF heating (2.6 MW, 1.6 s). A concomitant strong increase of the convective power loading of the limiters is observed. Values of Z eff lower than 1.2 are derived from conductivity measurements. The most prominent change in the impurity concentration compared to good conditions in a carbonized surrounding is measured for oxygen. The value OVI/ n¯e of the OVI intensity normalized to the averaged plasma density overlinene decreases by more than a factor of four. The decrease in the oxygen content manifests itself also as a reduction of the CO and CO 2 partial pressures measured during and after the discharge with a sniffer probe. The carbon levels are reduced by a factor of about two as measured by the normalized intensity CII/ overlinene of the CII line and via the ratio of the C fluxes and deuterium fluxes measured at the limiter (CI/D α). The wall shows a pronounced sorption of hydrogen from the plasma, easing the density control and the establishment of low recycling conditions. The beneficial conditions did not show a significant deterioration during more than 200 discharges, including numerous shots at ICRH power levels > 2 MW.

Galactic Observations of Terahertz C+ (GOT C+): Inner Galaxy Survey

NASA Astrophysics Data System (ADS)

Yorke, Harold; Langer, William; Velusamy, T.; Pineda, J. L.; Goldsmith, P. F.; Li, D.

To understand the lifecycle of the interstellar gas and star formation we need detailed information about the diffuse atomic and diffuse molecular gas cloud properties. The ionized carbon [CII] 1.9 THz fine structure line is an important tracer of the atomic gas in the diffuse regions and the interface regions of atomic gas to molecular clouds. Furthermore, C+ is a major ISM coolant and among the Galaxy's strongest far-IR emission lines, and thus controls the thermal conditions throughout large parts of the Galaxy. Until now our knowledge of interstellar gas has been limited to the diffuse atomic phase traced by HI and to the dense molecular H2 phase traced by CO. However, we are missing an important phase of the ISM, called "dark gas" in which there is no or little, HI, and mostly molecular hydrogen but with insufficient shielding of UV to allow CO to form. C+ emission and absorption lines at 1.9 THz have the potential to trace such cloud transitions and evolution. Galactic Observations of the Terahertz C+ Line (GOT C+) is a Herschel Space Observatory Open Time Key Program to study the diffuse interstellar medium by sampling [CII] 1.9 THz line emission throughout the Galactic disk. We discuss the broader perspective of this survey and the first results of GOT C+ obtained during the Science Demonstration Phase (SDP) and Priority Science Phase (PSP) of HIFI, which focus on approximately 100 lines of sight in the inner galaxy. These observations are being carried out with the Herschel Space Observatory, which is an ESA cornerstone mission, with contributions from NASA. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP is a Caltech-JPL Postdoctoral Associate.

Mechanical ventilation causes pulmonary mitochondrial dysfunction and delayed alveolarization in neonatal mice.

PubMed

Ratner, Veniamin; Sosunov, Sergey A; Niatsetskaya, Zoya V; Utkina-Sosunova, Irina V; Ten, Vadim S

2013-12-01

Hyperoxia inhibits pulmonary bioenergetics, causing delayed alveolarization in mice. We hypothesized that mechanical ventilation (MV) also causes a failure of bioenergetics to support alveolarization. To test this hypothesis, neonatal mice were ventilated with room air for 8 hours (prolonged) or for 2 hours (brief) with 15 μl/g (aggressive) tidal volume (Tv), or for 8 hours with 8 μl/g (gentle) Tv. After 24 hours or 10 days of recovery, lung mitochondria were examined for adenosine diphosphate (ADP)-phosphorylating respiration, using complex I (C-I)-dependent, complex II (C-II)-dependent, or cytochrome C oxidase (C-IV)-dependent substrates, ATP production rate, and the activity of C-I and C-II. A separate cohort of mice was exposed to 2,4-dinitrophenol (DNP), a known uncoupler of oxidative phosphorylation. At 10 days of recovery, pulmonary alveolarization and the expression of vascular endothelial growth factor (VEGF) were assessed. Sham-operated littermates were used as control mice. At 24 hours after aggressive MV, mitochondrial ATP production rates and the activity of C-I and C-II were significantly decreased compared with control mice. However, at 10 days of recovery, only mice exposed to prolonged-aggressive MV continued to exhibit significantly depressed mitochondrial respiration. This was associated with significantly poorer alveolarization and VEGF expression. In contrast, mice exposed to brief-aggressive or prolonged-gentle MV exhibited restored mitochondrial ADP-phosphorylation, normal alveolarization and pulmonary VEGF content. Exposure to DNP fully replicated the phenotype consistent with alveolar developmental arrest. Our data suggest that the failure of bioenergetics to support normal lung development caused by aggressive and prolonged ventilation should be considered a fundamental mechanism for the development of bronchopulmonary dysplasia in premature neonates.

Population inversions in ablation plasmas generated by intense electron beams. Final report, 1 November 1985-31 October 1988

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gilgenbach, R.M.; Kammash, T.; Brake, M.L.

1988-11-01

Experiments during the past three years have concerned the generation and spectroscopic study of electron beam-driven carbon plasmas in order to explore the production of optical and ultraviolet radiation from nonequilibrium populations. The output of MELBA (Michigan Electron Long Beam Accelerator), has been connected to an electron-beam diode consisting of an aluminum (or brass) cathode stalk and a carbon anode. Magnetic-field coils were designed, procured, and utilized to focus the electron beam. A side viewing port permitted spectroscopic diagnostics to view across the surface of the anode. Spectroscopic diagnosis was performed using a 1-m spectrograph capable of operation from themore » vacuum-ultraviolet through the visible. This spectrograph is coupled to a 1024-channel optical multichannel analyzer. Spectra taken during the initial 400-ns period of the e-beam pulse showed a low effective-charge plasma with primarily molecular components (C/sub 2/, CH) as well as atomic hydrogen and singly ionized carbon (CII). When the generator pulse was crowbarred after the first 400 ns, the spectra revealed a continuation of the low-charge-state plasma. At times greater than 400 ns in non-crowbarred shots, the spectra revealed a highly ionized plasma with a very large intensity line at 2530 Angstroms due to CIV (5g-4f), and lower-intensity lines due to CIII and CII. This CIV line emission increased with time, peaking sharply between 750 and 900 ns, and decayed rapidly in less than 100 ns. Emission from these high ionization states may be due to electron beam-plasma instabilities, as this emission was accompanied by high levels of radio frequency and microwave emission.« less

The CCAT-prime Extreme Field-of-View Submillimeter Telescope on Cerro Chajnantor

NASA Astrophysics Data System (ADS)

Koopman, Brian; Bertoldi, Frank; Chapman, Scott; Fich, Michel; Giovanelli, Riccardo; Haynes, Martha P.; Herter, Terry L.; Murray, Norman W.; Niemack, Michael D.; Riechers, Dominik; Schilke, Peter; Stacey, Gordon J.; Stutzki, Juergen; CCAT-prime Collaboration

2017-01-01

CCAT-prime is a six meter aperture off-axis submillimeter telescope that we plan to build at 5600m elevation on Cerro Chajnantor in Chile. The CCAT-prime optics are based on a cross-Dragone design with high throughput and a wide field-of-view optimized to increase the mapping speed of next generation cosmic microwave background (CMB) observations. These characteristics make CCAT-prime an excellent platform for a wide range of next generation millimeter and submillimeter science goals, and a potential platform for CMB stage-IV measurements. Here we present the telescope design for CCAT-prime and review the science goals.Taking advantage of the high elevation site, the first generation instrument for CCAT-prime will measure seven different frequency bands from 350um to 3mm. These seven bands will enable precise measurements of the Sunyaev-Zel’dovich effects (SZE) by separating contributions from CMB, thermal SZE, kinetic SZE, bright submm galaxies, and radio sources with a goal of extracting the peculiar velocities from a large number of galaxy clusters. Additional science priorities for CCAT-prime include: Galactic Ecology studies of the dynamic intersteller medium by mapping the fine structure lines [CI], [CII] and [NII] as well as high-excitation CO lines at the shortest wavelength bands; high redshift intensity mapping of [CII] emission from star-forming galaxies that likely dominates cosmic reionization at z~5-9 to probe the Epoch of Reionization; and next generation CMB polarization measurements to constrain inflation and cosmological models. The CCAT-prime facility will further our understanding of astrophysical processes from moments after the Big Bang to the present-day evolution of the Milky Way.

Requirements for a Device-Based Training and Testing Program for M1 Gunnery. Volume 2. Detailed Analyses and Results

DTIC Science & Technology

1988-03-01

Dtftntt A- 5 ACTIVITY J. ACQUIRE TAR6ET(S) A-» Part 3.1. SNI-CII For Ttrg«t(i) A-6 Option 3.1.1. Search Open Hatch-- 0 *y A-4 Option 3.1.2. Starch...gunner time in position 0 -10 D- 5 . Percent of engagements in which crew cuts were observed . . . 0 -11 0 -6. First-round performance of tank... 5 of VII IB are based on much smaller ns, i.e., usually less than 20. 0 -3 The Database The Grafenwöhr Table VIII data is implemented on an IBM

A study of (OI) 63.2 and 145.5 micron emission from M17 and SGR A from the Lear jet

NASA Technical Reports Server (NTRS)

Melnick, G. G.

1986-01-01

The Lear Jet Observatory was used to observe the 157.7 micron (C II) line from the galactic H II regions W3 and W51. These measurements established a lower limit in the 157.7 micron line for solar luminosity of 360 from W3, assuming adistance of 2 kpc, and a solar luminosity of 4100 from W51, assuming a distance of 7 kpc. The data indicated that the CII/far infrared continuum ratio for both W3 and W51 were within the range found for other galactic H II regions.

Lithographed spectrometers for tomographic line mapping of the Epoch of Reionization

NASA Astrophysics Data System (ADS)

O'Brient, R.; Bock, J. J.; Bradford, C. M.; Crites, A.; Duan, R.; Hailey-Dunsheath, S.; Hunacek, J.; LeDuc, R.; Shirokoff, E.; Staniszewski, Z.; Turner, A.; Zemcov, M.

2014-08-01

The Tomographic Ionized carbon Mapping Experiment (TIME) is a multi-phased experiment that will topographically map [CII] emission from the Epoch of Reionization. We are developing lithographed spectrometers that couple to TES bolometers in anticipation of the second generation instrument. Our design intentionally mirrors many features of the parallel SuperSpec project, inductively coupling power from a trunk-line microstrip onto half-wave resonators. The resonators couple to a rat-race hybrids that feeds TES bolometers. Our 25 channel prototype shows spectrally positioned lines roughly matching design with a receiver optical efficiency of 15-20%, a level that is dominated by loss in components outside the spectrometer.

Height formation of bright points observed by IRIS in Mg II line wings during flux emergence

NASA Astrophysics Data System (ADS)

Grubecka, M.; Schmieder, B.; Berlicki, A.; Heinzel, P.; Dalmasse, K.; Mein, P.

2016-09-01

Context. A flux emergence in the active region AR 111850 was observed on September 24, 2013 with the Interface Region Imaging Spectrograph (IRIS). Many bright points are associated with the new emerging flux and show enhancement brightening in the UV spectra. Aims: The aim of this work is to compute the altitude formation of the compact bright points (CBs) observed in Mg II lines in the context of searching Ellerman bombs (EBs). Methods: IRIS provided two large dense rasters of spectra in Mg II h and k lines, Mg II triplet, C II and Si IV lines covering all the active region and slit jaws in the two bandpasses (1400 Å and 2796 Å) starting at 11:44 UT and 15:39 UT, and lasting 20 min each. Synthetic profiles of Mg II and Hα lines are computed with non-local thermodynamic equlibrium (NLTE) radiative transfer treatment in 1D solar atmosphere model including a hotspot region defined by three parameters: temperature, altitude, and width. Results: Within the two IRIS rasters, 74 CBs are detected in the far wings of the Mg II lines (at +/-1 Å and 3.5 Å). Around 10% of CBs have a signature in Si IV and CII. NLTE models with a hotspot located in the low atmosphere were found to fit a sample of Mg II profiles in CBs. The Hα profiles computed with these Mg II CB models are consistent with typical EB profiles observed from ground based telescopes e.g. THEMIS. A 2D NLTE modelling of fibrils (canopy) demonstrates that the Mg II line centres can be significantly affected but not the peaks and the wings of Mg II lines. Conclusions: We conclude that the bright points observed in Mg II lines can be formed in an extended domain of altitudes in the photosphere and/or the chromosphere (400 to 750 km). Our results are consistent with the theory of heating by Joule dissipation in the atmosphere produced by magnetic field reconnection during flux emergence.

Erratum: ``Stellar Halo Parameters from 4588 Subdwarfs'' (ApJ, 583, 765 [2003])

NASA Astrophysics Data System (ADS)

Gould, Andrew

2004-06-01

An error has been discovered in the computer program that determined the stellar halo parameters using ~4500 halo stars drawn from the revised New Luyten Two-Tenths catalog. None of the major scientific conclusions of that paper are qualitatively altered. In particular, five of the nine velocity-ellipsoid parameters remain consistent with zero within their small errors. However, many individual parameters have changed their values by 1 or 2 σ and a few by more. I explain the nature of the error and give corrected values for the parameters. The ~4500 halo stars analyzed were selected from the revised New Luyten Two-Tenths catalog (A. Gould & S. Salim, ApJ, 583, 765 [2003]; S. Salim & A. Gould, ApJ, 583, 765 [2003]) by demanding that the reduced proper motion (RPM) discriminator,η≡V-5log(μ)-3.1(V-J)-1.47|sinb|-2.73,(1)lie within the secure halo range, 1<=η<=4.15. Here μ is the proper motion in arcsec per year and b is the Galactic latitude. A programming error inadvertently multiplied b by a factor 10, thereby scattering about 10% of the halo sample out of the selection interval and also scattering a roughly equal number of stars in the other direction, i.e., into the selection range (see Fig. 1). The error affected only the selection process and did not affect the analysis of the selected stars. After correcting this error, I find that the total sample is very slightly reduced to 4564 stars. The revised fit parameters typically differ from those in the original paper by 1 to 2 σ. Because the sample size does not significantly change, the error estimates also do not change. The new estimates of the parameters are as follows. The luminosity function (LF) in 1 mag intervals MV=3,4,...,15 is given by Φ(MV)=(0.03, 0.17, 0.49, 0.61, 0.64, 0.86, 2.24, 4.66, 4.50, 2.57, 2.07, 1.66, 1.53)×10-5 pc-3 (see Fig. 2). The bulk motion of the halo relative to the Sun is U1=8.5+/-2.2kms-1 and U3=-7.5+/-2.4kms-1 in the radial (outward) and vertical (upward) directions, respectively. The diagonal components of the velocity dispersion tensor are (cii+Δcii)1/2=(167.9+/-1.4,113.0+/-1.7,88.6+/-1.9)kms-1, where Δcii is defined by equation (12) of the original paper. The correlation coefficients of the velocity-ellipsoid tensor are(c12,c13,c23)=(0.008+/-0.014,0.014+/-0.023,-0.039+/-0.026).(2) The two parameters of the halo density profile, ρ~(R/R0)-νexp(-κ|z|), become ν=2.7+/-1.0 and κ=0.019+/-0.057kpc-1. Here R is Galactocentric distance, z is height above the Galactic plane, and R0=8kpc is the solar Galactocentric distance. The color-magnitude relation parameters are virtually unchanged, a=3.59 and b=0.69. Finally, the completeness function is expressed by a break at a virtually unchanged Vbreak=18.27, but with the completeness at this break point rising to 50%+/-6%. In particular, the motion of the local standard of rest (LSR) relative to the halo isV1=1.5+/-2.2kms-1,V3=0.3+/-2.4kms-1.(3)Hence, as originally claimed, all five velocity-ellipsoid parameters in equations (2) and (3) are consistent with zero. Thus, χ2=3.43 for 5 degrees of freedom, slightly less than the previous value (3.97). This implies that the limits on stellar-halo granularity derived in a subsequent paper from this statistic remain essentially unaltered, being about 2% tighter (see eq. [9] of A. Gould, ApJ, 583, 765 [2003]). Four of the 27 parameters do change by more than 2 σ. Both (c11+Δc11)1/2 and (c22+Δc22)1/2 increase by 4 σ. However, because the Δcii are poorly constrained, these parameter-combination measurements did not give any useful information about the halo, and this remains so with the new determinations. The LF bins at MV=10 and MV=11 each decline by 3 σ, which leaves a somewhat lower but still pronounced peak in the LF at these magnitudes (see Fig. 2). It seems strange at first sight that a 10% contamination of the sample would generally have such a small effect. The explanation lies in the conservative selection of the original sample. As shown by Figure 1, almost all of the contaminating stars came from the range 0<η<5.15, even at the edges of which the majority of stars are in the halo. Hence, the ``contaminants'' did not alter the basic character of the sample. I am very grateful to Juna Kollmeier, whose careful work uncovered the bug that is corrected here. This work was supported by JPL contract 1226901 and by grant AST 02-01266 from the NSF.

Random Choice Solutions for Weak Spherical Shock-Wave Transitions of N-Waves in Air with Vibrational Excitation.

DTIC Science & Technology

1983-07-01

ionalI relaxat in dii icons whe-re kricrw-i aitMSo~lli-l-ic cirrd it ions could efc-tes for spherical I\\ -svrmetric wave s . bc obitani rd - It will lit...of cibirat jona 1 nonequ iiib rium cont rihuteCs to tr univ for weak waves. The rise times for the ieI ciCUlatijun for cases A5 , 81l, Cl and DI real...I ibrium thle c;iI itid ma iuum oci-rpressiire t I pIm1 atid in) :ompairisoni with c-ase A5 . hi ile almxost the same the half diii t iou tdI

Far ultraviolet excitation processes in comets

NASA Technical Reports Server (NTRS)

Feldman, P. D.; Opal, C. B.; Meier, R. R.; Nicolas, K. R.

1976-01-01

Recent observations of atomic oxygen and carbon in the far ultraviolet spectrum of comet Kohoutek have demonstrated the existence of these atomic species in the cometary coma. However, in order to identify the source of their origin, it is necessary to relate the observed ultraviolet flux to the atomic production rate. Analyses of observed OI wavelength 1304 and CI wavelength 1657 A multiplets have been carried out using high resolution solar spectra. Also examined is the possibility of observing ultraviolet fluorescence from molecules such as CO and H2, as well as resonance scattering either from atomic ions for which there are strong corresponding solar lines (CII) or from atoms for which there is an accidental wavelength coincidence (SI).

Army Science Board (ASB) Report of the AD HOC Subgroup on Water Supply and Management on Army Installations in the Western United States

DTIC Science & Technology

1988-02-01

Operations and Maintenance ( O &M), Proving Grounds (PG), Research and Development (R&D), Surface Water (SW), Technical Manual (TM), Terms of Reference...presentation (Chair and HODA Staff Assistant o !y% 3 i. EXECUTIVE SUMMARY Water is a strategic resource for the Army. It is essential for industrial...GRANDE REGION lla qLL c5(5 eO e0€••oo ac’ 00 :42 t4 c4 ř m "- n "ciis M C4 00.4 -4. 00 0 . 𔃺 o ro o j • •" o 00’- total water withdrawn for

An Application of Quality Control Theory to Vendor-Supplied Parts at an Aerospace Manufacturing Company.

DTIC Science & Technology

1985-08-01

presently used on the ATF3-6, TFE731 -2, -3, TPE331, GTCP660 and TSCP700 engines. Substantiation Metallurgical V Testing Tnstructions Control Part Name Part... TFE731 -2, -3 Fan 3072162 Ti-6-4 5001 C1.-2 L’$S52458 1st Stg.Comp. 3072193 Ti-6-4 5001 C1.-l AF5395 2nd Stg.Comp. 3072191 Ti-6-4 5001 CI.-I AF5395 W...Control Part Nam~e Part No. material (STIT~eouirernents Specification TFE731 -2, -3 4th Stg.Conp. 3072.93 Ti-6-4 5001 C1.-1 AF5395 HP Comp. 3072639 Ti-6-2

An Empirically-derived non-LTE XUV-Visible Spectral Synthesis Model of the M1 V Exoplanet Host Star GJ832

NASA Astrophysics Data System (ADS)

Linsky, Jeffrey; Fontenla, Juan; Witbrod, Jesse; France, Kevin

2016-01-01

GJ832 (HD 204961) is a nearby M1 V host star with two exoplanets: a Jovian mass planet and a super-Earth. We have obtained near-UV and far-UV spectra of GJ832 with the STIS and COS instruments on HST as part of the Cycle 19 MUSCLES pilot program (France et al. 2013). Our objective is to obtain the first accurate physical model for a representative M-dwarf host star in order to understand the stellar radiative emission at all wavelengths and to infer the radiation environment of their exoplanets that drives their atmospheric photochemistry.We have calculated a full non-LTE model for GJ 832 including the photosphere, chromosphere, transition region, and corona to fit the observed emission lines formed over a wide range of temperatures and the X-ray flux. Our one-dimensional semi-empirical model uses the Solar-Stellar Physical Modelling tools that are an offspring of the tools used by Fontenla and collaborators for computing solar models. For this model of GJ832, we calculate the populations of 52 atoms and ions and 20 molecules with 2 million spectral lines. We find excellent agreement with the observed H-alpha, CaII, MgII, CII, SiIV, CIV, and NV lines. Our model for GJ832 has a temperature minimum in the lower chromosphere much cooler than the Sun and then a steep temperature rise different from the Sun. The different thermal structure of GJ832 compared to the Sun results in the formation regions of the emission lines being different for the two stars. We also compute theradiative cooling rates as a function of height and temperature in the atmosphere of GJ832.This work is supported by grants from STScI to the University of Colorado.

Approving cancer treatments based on endpoints other than overall survival: an analysis of historical data using the PACE Continuous Innovation Indicators™ (CII).

PubMed

Brooks, Neon; Campone, Mario; Paddock, Silvia; Shortenhaus, Scott; Grainger, David; Zummo, Jacqueline; Thomas, Samuel; Li, Rose

2017-01-01

There is an active debate about the role that endpoints other than overall survival (OS) should play in the drug approval process. Yet the term 'surrogate endpoint' implies that OS is the only critical metric for regulatory approval of cancer treatments. We systematically analyzed the relationship between U.S. Food and Drug Administration (FDA) approval and publication of OS evidence to understand better the risks and benefits of delaying approval until OS evidence is available. Using the PACE Continuous Innovation Indicators (CII) platform, we analyzed the effects of cancer type, treatment goal, and year of approval on the lag time between FDA approval and publication of first significant OS finding for 53 treatments approved between 1952 and 2016 for 10 cancer types (n = 71 approved indications). Greater than 59% of treatments were approved before significant OS data for the approved indication were published. Of the drugs in the sample, 31% had lags between approval and first published OS evidence of 4 years or longer. The average number of years between approval and first OS evidence varied by cancer type and did not reliably predict the eventual amount of OS evidence accumulated. Striking the right balance between early access and minimizing risk is a central challenge for regulators worldwide. We illustrate that endpoints other than OS have long helped to provide timely access to new medicines, including many current standards of care. We found that many critical drugs are approved many years before OS data are published, and that OS may not be the most appropriate endpoint in some treatment contexts. Our examination of approved treatments without significant OS data suggests contexts where OS may not be the most relevant endpoint and highlights the importance of using a wide variety of fit-for-purpose evidence types in the approval process.

Modulation of collagen-induced arthritis by adenovirus-mediated intra-articular expression of modified collagen type II.

PubMed

Tang, Bo; Cullins, David L; Zhou, Jing; Zawaski, Janice A; Park, Hyelee; Brand, David D; Hasty, Karen A; Gaber, M Waleed; Stuart, John M; Kang, Andrew H; Myers, Linda K

2010-01-01

Rheumatoid arthritis (RA) is a systemic disease manifested by chronic inflammation in multiple articular joints, including the knees and small joints of the hands and feet. We have developed a unique modification to a clinically accepted method for delivering therapies directly to the synovium. Our therapy is based on our previous discovery of an analog peptide (A9) with amino acid substitutions made at positions 260 (I to A), 261 (A to B), and 263 (F to N) that could profoundly suppress immunity to type II collagen (CII) and arthritis in the collagen-induced arthritis model (CIA). We engineered an adenoviral vector to contain the CB11 portion of recombinant type II collagen and used PCR to introduce point mutations at three sites within (CII124-402, 260A, 261B, 263D), (rCB11-A9) so that the resulting molecule contained the A9 sequence at the exact site of the wild-type sequence. We used this construct to target intra-articular tissues of mice and utilized the collagen-induced arthritis model to show that this treatment strategy provided a sustained, local therapy for individual arthritic joints, effective whether given to prevent arthritis or as a treatment. We also developed a novel system for in vivo bioimaging, using the firefly luciferase reporter gene to allow serial bioluminescence imaging to show that luciferase can be detected as late as 18 days post injection into the joint. Our therapy is unique in that we target synovial cells to ultimately shut down T cell-mediated inflammation. Its effectiveness is based on its ability to transform potential inflammatory T cells and/or bystander T cells into therapeutic (regulatory-like) T cells which secrete interleukin (IL)-4. We believe this approach has potential to effectively suppress RA with minimal side effects.

Modulation of collagen-induced arthritis by adenovirus-mediated intra-articular expression of modified collagen type II

PubMed Central

2010-01-01

Introduction Rheumatoid arthritis (RA) is a systemic disease manifested by chronic inflammation in multiple articular joints, including the knees and small joints of the hands and feet. We have developed a unique modification to a clinically accepted method for delivering therapies directly to the synovium. Our therapy is based on our previous discovery of an analog peptide (A9) with amino acid substitutions made at positions 260 (I to A), 261 (A to B), and 263 (F to N) that could profoundly suppress immunity to type II collagen (CII) and arthritis in the collagen-induced arthritis model (CIA). Methods We engineered an adenoviral vector to contain the CB11 portion of recombinant type II collagen and used PCR to introduce point mutations at three sites within (CII124-402, 260A, 261B, 263D), (rCB11-A9) so that the resulting molecule contained the A9 sequence at the exact site of the wild-type sequence. Results We used this construct to target intra-articular tissues of mice and utilized the collagen-induced arthritis model to show that this treatment strategy provided a sustained, local therapy for individual arthritic joints, effective whether given to prevent arthritis or as a treatment. We also developed a novel system for in vivo bioimaging, using the firefly luciferase reporter gene to allow serial bioluminescence imaging to show that luciferase can be detected as late as 18 days post injection into the joint. Conclusions Our therapy is unique in that we target synovial cells to ultimately shut down T cell-mediated inflammation. Its effectiveness is based on its ability to transform potential inflammatory T cells and/or bystander T cells into therapeutic (regulatory-like) T cells which secrete interleukin (IL)-4. We believe this approach has potential to effectively suppress RA with minimal side effects. PMID:20615221

Heterodyne Arrays for Terahertz/Sub-millimeter Astronomy

NASA Astrophysics Data System (ADS)

Kloosterman, Jenna; Walker, C. K.; SORAL; SRON; TU-Delft; JPL; APL; ASU; MIT

2014-01-01

The clouds of gas and dust that constitute the Interstellar Medium (ISM) within the Milky Way and other galaxies can be studied through the emission from atoms and molecules such as CO, [CI], [CII], [NII], and [OI]. Spectroscopic surveys of these tracers are necessary to disentangle large-scale structure and kinematics within the ISM. Each of these tracers has transitions in the Terahertz (THz) region of the electromagnetic spectrum, loosely defined as 0.3 - 3 THz, thus creating a need for large format THz heterodyne arrays. My dissertation research in radio instrumentation has focused on three main projects. The first, the Superheterodyne Camera (SuperCam), is a ground-based instrument for the Sub-millimeter Telescope (SMT) on Mt. Graham, Arizona. The receiver contains 64 heterodyne pixels designed to detect the J=3-2 rotational line of CO at 345 GHz. SuperCam had its first engineering run in Spring 2012 and its commissioning run in Spring 2013. The second project, the Stratospheric Terahertz Observatory (STO), is a balloon-borne, 0.8 m telescope, designed to observe the fine structure lines of [NII] and [CII] at 1.46 and 1.9 THz from an altitude of ~120,000 ft. STO had its first flight around Antarctica in January 2012 and is scheduled to have a second flight (as STO-2) in 2015. The last project is the building of a 4.74 THz heterodyne receiver to look for the fine structure line of the high density tracer [OI]. With an 815 K double sideband noise temperature (e.g. ~7 times the quantum noise limit), this is the most sensitive heterodyne receiver reported above 3 THz. It will be flown on STO-2 and was developed as part of the Galactic/extra-galactic Ultra-Long Duration Stratospheric Spectroscopic THz Observatory (GUSSTO) concept study. This dissertation talk will briefly cover the results of these instrumentation efforts and the science that drives them.

Estimating the effect of intimate partner violence on women's use of contraception: a systematic review and meta-analysis.

PubMed

Maxwell, Lauren; Devries, Karen; Zionts, Danielle; Alhusen, Jeanne L; Campbell, Jacquelyn

2015-01-01

Intimate partner violence (IPV) is an important global public health problem. While there is a growing literature on the association between IPV and women's reproductive health (RH) outcomes, most studies are cross-sectional-which weakens inference about the causal effect of IPV on women's RH. This systematic review synthesizes existing evidence from the strongest study designs to estimate the impact of IPV on women's use of contraception. We searched 11 electronic databases from January of 1980 to 3 December 2013 and reviewed reference lists from systematic reviews for studies examining IPV and contraceptive use. To be able to infer causality, we limited our review to studies that had longitudinal measures of either IPV or women's use of contraception. Of the 1,574 articles identified by the search, we included 179 articles in the full text review and extracted data from 12 studies that met our inclusion criteria. We limited the meta-analysis to seven studies that could be classified as subject to low or moderate levels of bias. Women's experience of IPV was associated with a significant reduction in the odds of using contraception (n = 14,866; OR: 0.47; 95% CI: 0.25, 0.85; I2 = 92%; 95% CII2: 87%, 96%). Restricting to studies that measured the effect of IPV on women's use of partner dependent contraceptive methods was associated with a reduction in the heterogeneity of the overall estimate. In the three studies that examined women's likelihood of using male condoms with their partners, experience of IPV was associated with a significant decrease in condom use (OR: 0.48; 95% CIOR: 0.32, 0.72; I2 = 51%; 95% CII2: 0%, 86%). IPV is associated with a reduction in women's use of contraception; women who experience IPV are less likely to report using condoms with their male partners. Family planning and HIV prevention programs should consider women's experiences of IPV.

Greater enrichment of triacylglycerol-rich lipoproteins with apolipoproteins E and C-III after meals rich in saturated fatty acids than after meals rich in unsaturated fatty acids.

PubMed

Jackson, Kim G; Wolstencroft, Emma J; Bateman, Paul A; Yaqoob, Parveen; Williams, Christine M

2005-01-01

Although there is considerable interest in the postprandial events involved in the absorption of dietary fats and the subsequent metabolism of diet-derived triacylglycerol-rich lipoproteins, little is known about the effects of meal fatty acids on the composition of these particles. We examined the effect of meal fatty acids on the lipid and apolipoprotein contents of triacylglycerol-rich lipoproteins. Ten normolipidemic men received in random order a mixed meal containing 50 g of a mixture of palm oil and cocoa butter [rich in saturated fatty acids (SFAs)], safflower oil [n-6 polyunsaturated fatty acids (PUFAs)], or olive oil [monounsaturated fatty acids (MUFAs)] on 3 occasions. Fasting and postprandial apolipoproteins B-48, B-100, E, C-II, and C-III and lipids (triacylglycerol and cholesterol) were measured in plasma fractions with Svedberg flotation rates (S(f)) >400, S(f) 60-400, and S(f) 20-60. Calculation of the composition of the triacylglycerol-rich lipoproteins (expressed per mole of apolipoprotein B) showed notable differences in the lipid and apolipoprotein contents of the SFA-enriched particles in the S(f) > 400 and S(f) 60-400 fractions. After the SFA meal, triacylglycerol-rich lipoproteins in these fractions showed significantly greater amounts of triacylglycerol and of apolipoproteins C-II (S(f) 60-400 fraction only), C-III, and E than were found after the MUFA meal (P < 0.02) and more cholesterol, apolipoprotein C-III (S(f) > 400 fraction only), and apolipoprotein E than after the PUFA meal (P < 0.02). Differences in the composition of S(f) > 400 and S(f) 60-400 triacylglycerol-rich lipoproteins formed after saturated compared with unsaturated fatty acid-rich meals may explain differences in the metabolic handling of dietary fats.

Herschel Extreme Lensing Line Observations: [CII] Variations in Galaxies at Redshifts z=1-3*

NASA Technical Reports Server (NTRS)

Malhotra, Sangeeta; Rhoads, James E.; Finkelstein, K.; Yang, Huan; Carilli, Chris; Combes, Francoise; Dassas, Karine; Finkelstein, Steven; Frye, Brenda; Gerin, Maryvonne;

Herschel Extreme Lensing Line Observations: [CII] Variations in Galaxies at Redshifts z=1-3

NASA Astrophysics Data System (ADS)

Malhotra, Sangeeta; Rhoads, James E.; Finkelstein, K.; Yang, Huan; Carilli, Chris; Combes, Françoise; Dassas, Karine; Finkelstein, Steven; Frye, Brenda; Gerin, Maryvonne; Guillard, Pierre; Nesvadba, Nicole; Rigby, Jane; Shin, Min-Su; Spaans, Marco; Strauss, Michael A.; Papovich, Casey

2017-01-01

We observed the [C II] line in 15 lensed galaxies at redshifts 1 < z < 3 using HIFI on the Herschel Space Observatory and detected 14/15 galaxies at 3σ or better. High magnifications enable even modestly luminous galaxies to be detected in [C II] with Herschel. The [C II] luminosity in this sample ranges from 8 × 107 L⊙ to 3.7 × 109 L⊙ (after correcting for magnification), confirming that [C II] is a strong tracer of the ISM at high redshifts. The ratio of the [C II] line to the total far-infrared (FIR) luminosity serves as a measure of the ratio of gas to dust cooling and thus the efficiency of the grain photoelectric heating process. It varies between 3.3% and 0.09%. We compare the [C II]/FIR ratio to that of galaxies at z = 0 and at high redshifts and find that they follow similar trends. The [C II]/FIR ratio is lower for galaxies with higher dust temperatures. This is best explained if increased UV intensity leads to higher FIR luminosity and dust temperatures, but gas heating does not rise due to lower photoelectric heating efficiency. The [C II]/FIR ratio shows weaker correlation with FIR luminosity. At low redshifts highly luminous galaxies tend to have warm dust, so the effects of dust temperature and luminosity are degenerate. Luminous galaxies at high redshifts show a range of dust temperatures, showing that [C II]/FIR correlates most strongly with dust temperature. The [C II] to mid-IR ratio for the HELLO sample is similar to the values seen for low-redshift galaxies, indicating that small grains and PAHs dominate the heating in the neutral ISM, although some of the high [CII]/FIR ratios may be due to turbulent heating. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Mitochondrial acclimation capacities to ocean warming and acidification are limited in the antarctic Nototheniid Fish, Notothenia rossii and Lepidonotothen squamifrons.

PubMed

Strobel, Anneli; Graeve, Martin; Poertner, Hans O; Mark, Felix C

2013-01-01

Antarctic notothenioid fish are characterized by their evolutionary adaptation to the cold, thermostable Southern Ocean, which is associated with unique physiological adaptations to withstand the cold and reduce energetic requirements but also entails limited compensation capacities to environmental change. This study compares the capacities of mitochondrial acclimation to ocean warming and acidification between the Antarctic nototheniid Notothenia rossii and the sub-Antarctic Lepidonotothen squamifrons, which share a similar ecology, but different habitat temperatures. After acclimation of L. squamifrons to 9°C and N. rossii to 7°C (normocapnic/hypercapnic, 0.2 kPa CO2/2000 ppm CO2) for 4-6 weeks, we compared the capacities of their mitochondrial respiratory complexes I (CI) and II (CII), their P/O ratios (phosphorylation efficiency), proton leak capacities and mitochondrial membrane fatty acid compositions. Our results reveal reduced CII respiration rates in warm-acclimated L. squamifrons and cold hypercapnia-acclimated N. rossii. Generally, L. squamifrons displayed a greater ability to increase CI contribution during acute warming and after warm-acclimation than N. rossii. Membrane unsaturation was not altered by warm or hypercapnia-acclimation in both species, but membrane fatty acids of warm-acclimated L. squamifrons were less saturated than in warm normocapnia-/hypercapnia-acclimated N. rossii. Proton leak capacities were not affected by warm or hypercapnia-acclimation of N. rossii. We conclude that an acclimatory response of mitochondrial capacities may include higher thermal plasticity of CI supported by enhanced utilization of anaplerotic substrates (via oxidative decarboxylation reactions) feeding into the citrate cycle. L. squamifrons possesses higher relative CI plasticities than N. rossii, which may facilitate the usage of energy efficient NADH-related substrates under conditions of elevated energy demand, possibly induced by ocean warming and acidification. The observed adjustments of electron transport system complexes with a higher flux through CI under warming and acidification suggest a metabolic acclimation potential of the sub-Antarctic L. squamifrons, but only limited acclimation capacities for N. rossii.

Provider Preferences and Experiences With a Countywide Centralized Collaborative Reminder/Recall for Childhood Immunizations.

PubMed

Saville, Alison W; Gurfinkel, Dennis; Sevick, Carter; Beaty, Brenda; Dickinson, L Miriam; Kempe, Allison

2016-01-01

To assess among providers in 7 Colorado counties where a collaborative centralized reminder/recall (CC-R/R) using the Colorado Immunization Information System (CIIS) was performed: 1) preferences about CC-R/R conducted by the public health department (PHD); 2) preferences for future CC-R/R for different vaccines with and without practice names; and 3) experiences with including their name on CC-R/R notices. A mailed survey was sent to all primary care sites where CC-R/R had been previously conducted. Respondents self-identified as the "the person in charge of immunization policy within the practice." Overall response rate was 69.9% (160 of 229). Twenty-one were removed because they did not provide immunizations to children. Among respondents, 65.0% were from family medicine and 26.3% from pediatric practices; 32.1% physicians or midlevel providers; 34.3% nurses or medical assistants; and 33.6% office managers. Taking into account all issues, 57.6% were "okay" with either the PHD or their practice conducting recall; 27.3% preferred the PHD; and 14.4% preferred their practice conduct R/R. Fifty-six percent of active CIIS practices (n = 95) included their practice's name on CC-R/R notices. Interest in future CC-R/R for different ages and vaccines was strongly related to whether reminders included the practice name: 77.8% for routine immunizations in 4- to 6-year-olds; 74.8% for immunizations for 0- to 3-year-olds; 73.3% for vaccines administered to adolescents; and 59.7% for influenza (P < .001). Most practices are accepting of the PHD centrally conducting R/R, but most prefer collaboration that includes their name. Given the success and support of this method, it should be more widely adopted. Copyright © 2016 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.

CryoEM and Molecular Dynamics of the Circadian KaiB-KaiC Complex Indicates That KaiB Monomers Interact with KaiC and Block ATP Binding Clefts

DOE Office of Scientific and Technical Information (OSTI.GOV)

Villarreal, Seth A.; Pattanayek, Rekha; Williams, Dewight R.

The circadian control of cellular processes in cyanobacteria is regulated by a posttranslational oscillator formed by three Kai proteins. During the oscillator cycle, KaiA serves to promote autophosphorylation of KaiC while KaiB counteracts this effect. Here, we present a crystallographic structure of the wild-type Synechococcus elongatus KaiB and a cryo-electron microscopy (cryoEM) structure of a KaiBC complex. The crystal structure shows the expected dimer core structure and significant conformational variations of the KaiB C-terminal region, which is functionally important in maintaining rhythmicity. The KaiBC sample was formed with a C-terminally truncated form of KaiC, KaiC-Δ489, which is persistently phosphorylated. Themore » KaiB–KaiC-Δ489 structure reveals that the KaiC hexamer can bind six monomers of KaiB, which form a continuous ring of density in the KaiBC complex. We performed cryoEM-guided molecular dynamics flexible fitting simulations with crystal structures of KaiB and KaiC to probe the KaiBC protein–protein interface. This analysis indicated a favorable binding mode for the KaiB monomer on the CII end of KaiC, involving two adjacent KaiC subunits and spanning an ATP binding cleft. A KaiC mutation, R468C, which has been shown to affect the affinity of KaiB for KaiC and lengthen the period in a bioluminescence rhythm assay, is found within the middle of the predicted KaiBC interface. The proposed KaiB binding mode blocks access to the ATP binding cleft in the CII ring of KaiC, which provides insight into how KaiB might influence the phosphorylation status of KaiC.« less

A Novel Apolipoprotein C-II Mimetic Peptide That Activates Lipoprotein Lipase and Decreases Serum Triglycerides in Apolipoprotein E–Knockout Mice

PubMed Central

Sakurai, Toshihiro; Sakurai-Ikuta, Akiko; Sviridov, Denis; Freeman, Lita; Ahsan, Lusana; Remaley, Alan T.

2015-01-01

Apolipoprotein A-I (apoA-I) mimetic peptides are currently being developed as possible new agents for the treatment of cardiovascular disease based on their ability to promote cholesterol efflux and their other beneficial antiatherogenic properties. Many of these peptides, however, have been reported to cause transient hypertriglyceridemia due to inhibition of lipolysis by lipoprotein lipase (LPL). We describe a novel bihelical amphipathic peptide (C-II-a) that contains an amphipathic helix (18A) for binding to lipoproteins and stimulating cholesterol efflux as well as a motif based on the last helix of apolipoprotein C-II (apoC-II) that activates lipolysis by LPL. The C-II-a peptide promoted cholesterol efflux from ATP-binding cassette transporter ABCA1-transfected BHK cells similar to apoA-I mimetic peptides. Furthermore, it was shown in vitro to be comparable to the full-length apoC-II protein in activating lipolysis by LPL. When added to serum from a patient with apoC-II deficiency, it restored normal levels of LPL-induced lipolysis and also enhanced lipolysis in serum from patients with type IV and V hypertriglyceridemia. Intravenous injection of C-II-a (30 mg/kg) in apolipoprotein E–knockout mice resulted in a significant reduction of plasma cholesterol and triglycerides of 38 ± 6% and 85 ± 7%, respectively, at 4 hours. When coinjected with the 5A peptide (60 mg/kg), the C-II-a (30 mg/kg) peptide was found to completely block the hypertriglyceridemic effect of the 5A peptide in C57Bl/6 mice. In summary, C-II-a is a novel peptide based on apoC-II, which promotes cholesterol efflux and lipolysis and may therefore be useful for the treatment of apoC-II deficiency and other forms of hypertriglyceridemia. PMID:25395590

Povidone-Iodine Has a Profound Effect on In Vitro Osteoblast Proliferation and Metabolic Function and Inhibits Their Ability to Mineralize and Form Bone.

PubMed

Newton Ede, Matthew P; Philp, Ashleigh M; Philp, Andrew; Richardson, Stephen M; Mohammad, Saeed; Jones, Simon W

2016-05-01

A study examining the clinical protocol of scoliosis wound irrigation, demonstrating povidone-iodine's (PVI) effect on human osteoblast cells. Primary and immortal cell line osteoblasts were treated with 0.35% PVI for 3 minutes, and analyzed for proliferation rate, oxidative capacity, and mineralization. To model spinal wound irrigation with dilute PVI in vitro, in order to investigate the effect of PVI on osteoblast proliferation, metabolism, and bone mineralization. Previously PVI irrigation has been proposed as a safe and effective practice to avoid bacterial growth after spinal surgery. However, recent evidence in multiple cell types suggests that PVI has a deleterious effect on cellular viability and cellular function. Primary and immortal human osteoblast cells were exposed to either phosphate buffered saline control or with 0.35% PVI for 3 minutes. Cellular proliferation was measured over the duration of 7 days by MTS assay. Oxygen consumption rate, extracellular acidification rate, and proton production rate were analyzed using a Seahorse XF24 Bioanalyzer. Protein expression of the electron transport chain subunits CII-SDHB, CIII-UQRCR2, and CV-ATP5A was measured via Western blotting. Mineralized bone nodules were stained with alizarin red. Expressed as a percentage of normal osteoblast proliferation, osteoblasts exposed to 0.35% PVI exhibited a significant 24% decrease in proliferation after 24 hours. This was a sustained response, resulting in a 72% decline in cellular proliferation at 1 week. There was a significant reduction in oxygen consumption rate, extracellular acidification rate, and proton production rate (P < 0.05), in osteoblasts that had been exposed to 0.35% PVI for 3 minutes, coupled with a marked reduction in the protein expression of CII-SDHB. Osteoblasts exposed to 0.35% PVI exhibited reduced bone nodule mineralization compared to control phosphate buffered saline exposed osteoblasts (P < 0.01). PVI has a rapid and detrimental effect on human osteoblast cellular proliferation, metabolic function, and bone nodule mineralization. NA.

OT1_nschneid_1: Pillars of creation: physical origin and connection to star formation

NASA Astrophysics Data System (ADS)

Schneider, N.

2010-07-01

Herschel SPIRE/PACS photometry observations performed within the HOBYS (Herschel imaging survey of OB Young Stellar objects) key program have revealed a wealth of interesting structures in high-mass star forming regions. The most spectacular of those are 'pillars' and 'globules'. These features -- partly known from Hubble Space telescope or Spitzer images -- are formed due to photoevaporation at the interface between a molecular cloud and an HII region, and are thus intimately linked to high-mass star formation. The process of how these pillars are created, and under which conditions low- or high-mass stars form within them, are not yet clear. Classical approaches (e.g. Rayleigh-Taylor) can not explain pillar formation, so we have embarked upon a dedicated project to fully simulate pillars and globules using the (magneto)-hydrodynamic code HERACLES that comprises gravity and ionization. The model is intended to be coupled with a radiative transfer photon dominated region code (KOSMA-tau). We propose here to make use of the Herschel spectroscopy capacities to map/make single pointings, in a number of atomic and molecular lines, of selected pillars and globules in three different regions (Rosette, Cygnus, M16), spanning a large range in UV intensity and density. We intend to observe the important cooling lines of [CII] at 158 micron and [OI] at 63 and 145 micron with PACS, the [CI] finestructure lines at 370 and 609 micron and the mid-to high-J CO and HCO+ ladder with the SPIRE FTS. Spectrally resolved [CII] mapping with HIFI is also required to derive the velocity information. These observations will be compared to the large existing complementary data set for each source, to study the physics of pillars and will additionally serve as input for the models, to ultimately explain pillar formation and star formation within them.

Tertiary structural changes and iron release from human serum transferrin.

PubMed

Mecklenburg, S L; Donohoe, R J; Olah, G A

1997-08-01

Iron release from human serum transferrin was investigated by comparison of the extent of bound iron, measured by charge transfer absorption band intensity (465 nm), with changes observed by small-angle solution X-ray scattering (SAXS) for a series of equilibrated samples between pH 5.69 and 7.77. The phosphate buffers used in this study promote iron release at relatively high pH values, with an empirical pK of 6.9 for the convolved release from the two sites. The spectral data reveal that the N-lobe release is nearly complete by pH 7.0, while the C-lobe remains primarily metal-laden. Conversely, the radius of gyration, Rg, determined from the SAXS data remains constant between pH 7.77 and 7.05, and the evolution of Rg between its value observed for the diferric protein at pH 7.77 (31.2+/-0.2 A) and that of the apo protein at pH 5.69 (33.9+/-0.4 A) exhibits an empirical pK of 6.6. While Rg is effectively constant in the pH range associated with iron release from the N-lobe, the radius of gyration of cross-section, Rc, increases from 16.9+/-0.2 A to 17.6+/-0.2 A. Model simulations suggest that two different rotations of the NII domain relative to the NI domain about a hinge deep in the iron-binding cleft of the N-lobe, one parallel with and one perpendicular to the plane of the iron-binding site, can be significantly advanced relative to their holo protein positions while yielding constant Rg and increased Rc values consistent with the scattering data. Rotation of the CII domain parallel with the C-lobe iron-binding site plane can partially account for the increased Rg values measured at low pH; however, no reasonable combined repositioning of the NII and CII domains yields the experimentally observed increase in Rg.

GOT C+: A Herschel Space Observatory Key Program to Study the Diffuse ISM

NASA Astrophysics Data System (ADS)

Langer, William; Goldsmith, P. F.; Li, D.; Velusamy, T.; Yorke, H. W.

2009-01-01

Galactic Observations of the Terahertz C+ Line (GOT C+) is a Herschel Space Observatory (HSO) Key Program to study the diffuse interstellar medium by sampling the C+ fine structure line emission at 1.9 THz (158 microns) in the Galactic disk. Star formation activity is regulated by pressures in the interstellar medium, which in turn depend on heating and cooling rates, modulated by the gravitational potential, and shock and turbulent pressures. To understand these processes we need information about properties of the diffuse atomic and diffuse molecular gas clouds. The 158-micron CII line is an important tracer of diffuse regions, and C+ is a major ISM coolant, the Galaxy's strongest emission line virtually unobscured by dust, with a total luminosity about a 1000 times that of CO J=1-0. The GOT C+ program will obtain high spectral resolution CII spectra using the Heterodyne Instrument for the Far Infrared (HIFI) receiver. It will employ deep integrations, wide velocity coverage (350 km/s) with 0.22 km/s resolution, and systematic sparse sampling of the Galactic disk together with observations of selected targets, of over 900 lines of sight. It will be a resource to determine the properties of the atomic gas, in the (a) overall Galactic disk, (b) central 300pc of the Galactic center, (c) Galactic warp, (d) high latitude HI clouds, and (e) Photon Dominated Regions (PDRs). These spectra will provide the astronomical community with a rich statistical database of diffuse cloud properties, especially those of the atomic gas, sampled throughout the Galaxy for understanding the role of barometric pressure and turbulence in cloud evolution in the Galactic ISM and, by extension, other galaxies. The GOT C+ project will provide a template for future even larger-scale Galactic C+ surveys. This research was conducted at the Jet Propulsion Laboratory and is supported by a NASA grant.

Determining electrically evoked compound action potential thresholds: a comparison of computer versus human analysis methods.

PubMed

Glassman, E Katelyn; Hughes, Michelle L

2013-01-01

Current cochlear implants (CIs) have telemetry capabilities for measuring the electrically evoked compound action potential (ECAP). Neural Response Telemetry (Cochlear) and Neural Response Imaging (Advanced Bionics [AB]) can measure ECAP responses across a range of stimulus levels to obtain an amplitude growth function. Software-specific algorithms automatically mark the leading negative peak, N1, and the following positive peak/plateau, P2, and apply linear regression to estimate ECAP threshold. Alternatively, clinicians may apply expert judgments to modify the peak markers placed by the software algorithms, or use visual detection to identify the lowest level yielding a measurable ECAP response. The goals of this study were to: (1) assess the variability between human and computer decisions for (a) marking N1 and P2 and (b) determining linear-regression threshold (LRT) and visual-detection threshold (VDT); and (2) compare LRT and VDT methods within and across human- and computer-decision methods. ECAP amplitude-growth functions were measured for three electrodes in each of 20 ears (10 Cochlear Nucleus® 24RE/CI512, and 10 AB CII/90K). LRT, defined as the current level yielding an ECAP with zero amplitude, was calculated for both computer- (C-LRT) and human-picked peaks (H-LRT). VDT, defined as the lowest level resulting in a measurable ECAP response, was also calculated for both computer- (C-VDT) and human-picked peaks (H-VDT). Because Neural Response Imaging assigns peak markers to all waveforms but does not include waveforms with amplitudes less than 20 μV in its regression calculation, C-VDT for AB subjects was defined as the lowest current level yielding an amplitude of 20 μV or more. Overall, there were significant correlations between human and computer decisions for peak-marker placement, LRT, and VDT for both manufacturers (r = 0.78-1.00, p < 0.001). For Cochlear devices, LRT and VDT correlated equally well for both computer- and human-picked peaks (r = 0.98-0.99, p < 0.001), which likely reflects the well-defined Neural Response Telemetry algorithm and the lower noise floor in the 24RE and CI512 devices. For AB devices, correlations between LRT and VDT for both peak-picker methods were weaker than for Cochlear devices (r = 0.69-0.85, p < 0.001), which likely reflect the higher noise floor of the system. Disagreement between computer and human decisions regarding the presence of an ECAP response occurred for 5 % of traces for Cochlear devices and 2.1 % of traces for AB devices. Results indicate that human and computer peak-picking methods can be used with similar accuracy for both Cochlear and AB devices. Either C-VDT or C-LRT can be used with equal confidence for Cochlear 24RE and CI512 recipients because both methods are strongly correlated with human decisions. However, for AB devices, greater variability exists between different threshold-determination methods. This finding should be considered in the context of using ECAP measures to assist with programming CIs.

Local Oscillator Sub-Systems for Array Receivers in the 1-3 THz Range

NASA Technical Reports Server (NTRS)

Mehdi, Imran; Siles, Jose V.; Maestrini, Alain; Lin, Robert; Lee, Choonsup; Schlecht, Erich; Chattopadhyay, Goutam

2012-01-01

Recent results from the Heterodyne Instrument for the Far-Infrared (HIFI) on the Herschel Space Telescope have confirmed the usefulness of high resolution spectroscopic data for a better understanding of our Universe. This paper will explore the current status of tunable local oscillator sources with emphasis on building a multi-pixel LO subsystem for the scientifically important CII line around 1908 GHz. Recent results have shown that over 50 microwatts of output power at 1.9 THz are possible with an optimized single pixel LO chain. These power levels are now sufficient to pump array receivers in this frequency range. Further power enhancement can be obtained by cooling the chain to 120 K or by utilizing in-phase power combining technology.

Accelerating Energy Efficiency in Indian Data Centers. Final Report for Phase I Activities

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ganguly, Suprotim; Raje, Sanyukta; Kumar, Satish

This report documents Phase 1 of the “Accelerating Energy Efficiency in Indian Data Centers” initiative to support the development of an energy efficiency policy framework for Indian data centers. The initiative is being led by the Confederation of Indian Industry (CII), in collaboration with Lawrence Berkeley National Laboratory (LBNL)-U.S. Department of Energy’s Office of Energy Efficiency and Renewable Energy, and under the guidance of Bureau of Energy Efficiency (BEE). It is also part of the larger Power and Energy Efficiency Working Group of the US-India Bilateral Energy Dialogue. The initiative consists of two phases: Phase 1 (November 2014 – Septembermore » 2015) and Phase 2 (October 2015 – September 2016).« less

Symmetry conditions of a nodal superconductor for generating robust flat-band Andreev bound states at its dirty surface

NASA Astrophysics Data System (ADS)

Ikegaya, Satoshi; Kobayashi, Shingo; Asano, Yasuhiro

2018-05-01

We discuss the symmetry property of a nodal superconductor that hosts robust flat-band zero-energy states at its surface under potential disorder. Such robust zero-energy states are known to induce the anomalous proximity effect in a dirty normal metal attached to a superconductor. A recent study has shown that a topological index NZES describes the number of zero-energy states at the dirty surface of a p -wave superconductor. We generalize the theory to clarify the conditions required for a superconductor that enables NZES≠0 . Our results show that NZES≠0 is realized in a topological material that belongs to either the BDI or CII class. We also present two realistic Hamiltonians that result in NZES≠0 .

Abuse-deterrent formulations approval reform: Will clinical correctness or real-world results be used to address the nation's opioid crisis: "Noninterference" as a new approval standard.

PubMed

Cohen, Dan

To further the public policy objectives of Congress and the country, legislators should now insist that abuse-deterrent formulations (ADFs) be deployed for every C-II opioid and stimulant. The need for these innovative technologies has never been greater. And to most efficiently incentivize innovators to develop and deploy the most effective and modern deterrents, a new and simpler regulatory approval standard for ADF should be adopted by the U.S. Food and Drug Administration. That standard, based on a concept of "Noninterference" increases the potential for a much earlier deployment of ADFs in a broad range of products and allows deterrence to play its most effective role in combatting the national opioid crisis.

GASPS—A Herschel Survey of Gas and Dust in Protoplanetary Disks: Summary and Initial Statistics

NASA Astrophysics Data System (ADS)

Dent, W. R. F.; Thi, W. F.; Kamp, I.; Williams, J. P.; Menard, F.; Andrews, S.; Ardila, D.; Aresu, G.; Augereau, J.-C.; Barrado y Navascues, D.; Brittain, S.; Carmona, A.; Ciardi, D.; Danchi, W.; Donaldson, J.; Duchene, G.; Eiroa, C.; Fedele, D.; Grady, C.; de Gregorio-Molsalvo, I.; Howard, C.; Huélamo, N.; Krivov, A.; Lebreton, J.; Liseau, R.; Martin-Zaidi, C.; Mathews, G.; Meeus, G.; Mendigutía, I.; Montesinos, B.; Morales-Calderon, M.; Mora, A.; Nomura, H.; Pantin, E.; Pascucci, I.; Phillips, N.; Pinte, C.; Podio, L.; Ramsay, S. K.; Riaz, B.; Riviere-Marichalar, P.; Roberge, A.; Sandell, G.; Solano, E.; Tilling, I.; Torrelles, J. M.; Vandenbusche, B.; Vicente, S.; White, G. J.; Woitke, P.

2013-05-01

We describe a large-scale far-infrared line and continuum survey of protoplanetary disk through to young debris disk systems carried out using the ACS instrument on the Herschel Space Observatory. This Open Time Key program, known as GASPS (Gas Survey of Protoplanetary Systems), targeted ~250 young stars in narrow wavelength regions covering the [OI] fine structure line at 63 μm the brightest far-infrared line in such objects. A subset of the brightest targets were also surveyed in [OI]145 μm, [CII] at 157 μm, as well as several transitions of H2O and high-excitation CO lines at selected wavelengths between 78 and 180 μm. Additionally, GASPS included continuum photometry at 70, 100 and 160 μm, around the peak of the dust emission. The targets were SED Class II-III T Tauri stars and debris disks from seven nearby young associations, along with a comparable sample of isolated Herbig AeBe stars. The aim was to study the global gas and dust content in a wide sample of circumstellar disks, combining the results with models in a systematic way. In this overview paper we review the scientific aims, target selection and observing strategy of the program. We summarise some of the initial results, showing line identifications, listing the detections, and giving a first statistical study of line detectability. The [OI] line at 63 μm was the brightest line seen in almost all objects, by a factor of ~10. Overall [OI]63 μm detection rates were 49%, with 100% of HAeBe stars and 43% of T Tauri stars detected. A comparison with published disk dust masses (derived mainly from sub-mm continuum, assuming standard values of the mm mass opacity) shows a dust mass threshold for [OI]63 μm detection of ~10-5 Msolar. Normalising to a distance of 140 pc, 84% of objects with dust masses >=10-5 Msolar can be detected in this line in the present survey; 32% of those of mass 10-6-10-5 Msolar, and only a very small number of unusual objects with lower masses can be detected. This is consistent with models with a moderate UV excess and disk flaring. For a given disk mass, [OI] detectability is lower for M stars compared with earlier spectral types. Both the continuum and line emission was, in most systems, spatially and spectrally unresolved and centred on the star, suggesting that emission in most cases was from the disk. Approximately 10 objects showed resolved emission, most likely from outflows. In the GASPS sample, [OI] detection rates in T Tauri associations in the 0.3-4 Myr age range were ~50%. For each association in the 5-20 Myr age range, ~2 stars remain detectable in [OI]63 μm, and no systems were detected in associations with age >20 Myr. Comparing with the total number of young stars in each association, and assuming a ISM-like gas/dust ratio, this indicates that ~18% of stars retain a gas-rich disk of total mass ~1 MJupiter for 1-4 Myr, 1-7% keep such disks for 5-10 Myr, but none are detected beyond 10-20 Myr. The brightest [OI] objects from GASPS were also observed in [OI]145 μm, [CII]157 μm and CO J = 18 - 17, with detection rates of 20-40%. Detection of the [CII] line was not correlated with disk mass, suggesting it arises more commonly from a compact remnant envelope.

Apolipoprotein C-II Is a Potential Serum Biomarker as a Prognostic Factor of Locally Advanced Cervical Cancer After Chemoradiation Therapy

DOE Office of Scientific and Technical Information (OSTI.GOV)

Harima, Yoko, E-mail: harima@takii.kmu.ac.jp; Ikeda, Koshi; Utsunomiya, Keita

Purpose: To determine pretreatment serum protein levels for generally applicable measurement to predict chemoradiation treatment outcomes in patients with locally advanced squamous cell cervical carcinoma (CC). Methods and Materials: In a screening study, measurements were conducted twice. At first, 6 serum samples from CC patients (3 with no evidence of disease [NED] and 3 with cancer-caused death [CD]) and 2 from healthy controls were tested. Next, 12 serum samples from different CC patients (8 NED, 4 CD) and 4 from healthy controls were examined. Subsequently, 28 different CC patients (18 NED, 10 CD) and 9 controls were analyzed in themore » validation study. Protein chips were treated with the sample sera, and the serum protein pattern was detected by surface-enhanced laser desorption and ionization–time-of-flight mass spectrometry (SELDI-TOF MS). Then, single MS-based peptide mass fingerprinting (PMF) and tandem MS (MS/MS)-based peptide/protein identification methods, were used to identify protein corresponding to the detected peak. And then, turbidimetric assay was used to measure the levels of a protein that indicated the best match with this peptide peak. Results: The same peak 8918 m/z was identified in both screening studies. Neither the screening study nor the validation study had significant differences in the appearance of this peak in the controls and NED. However, the intensity of the peak in CD was significantly lower than that of controls and NED in both pilot studies (P=.02, P=.04) and validation study (P=.01, P=.001). The protein indicated the best match with this peptide peak at 8918 m/z was identified as apolipoprotein C-II (ApoC-II) using PMF and MS/MS methods. Turbidimetric assay showed that the mean serum levels of ApoC-II tended to decrease in CD group when compared with NED group (P=.078). Conclusion: ApoC-II could be used as a biomarker for detection in predicting and estimating the radiation treatment outcome of patients with CC.« less

Progression of Chronic Kidney Disease Affects HDL Impact on Lipoprotein Lipase (LPL)-Mediated VLDL Lipolysis Efficiency.

PubMed

Ćwiklińska, Agnieska; Cackowska, Monika; Wieczorek, Ewa; Król, Ewa; Kowalski, Robert; Kuchta, Agnieszka; Kortas-Stempak, Barbara; Gliwińska, Anna; Dąbkowski, Kamil; Zielińska, Justyna; Dębska-Ślizień, Alicja; Jankowski, Maciej

2018-06-15

Hypertriglyceridaemia (HTG) and reduction and dysfunction of high density lipoprotein (HDL) are common lipid disturbances in chronic kidney disease (CKD). HTG in CKD is caused mainly by the decreased efficiency of lipoprotein lipase (LPL)-mediated very low density lipoprotein triglyceride (VLDL-TG) lipolysis. It has not been clarified whether HDL dysfunction in CKD contributes directly to HTG development; thus, the aim of this study was to assess the impact of CKD progression on the ability of HDL to enhance LPL-mediated VLDL-TG lipolysis efficiency. VLDL was isolated from non-dialysis patients in CKD stages 3 and 4 and from non-CKD patients. The VLDL was incubated with LPL at the constant LPL:VLDL-TG ratio, in the absence or presence of HDL. After incubation, the VLDL was separated and the percentage (%) of hydrolyzed TG was calculated. HDL presence increased the lipolysis efficiency of VLDL isolated from CKD and non-CKD patients, for the VLDL-TG> 50 mg/dl. Its effect was dependent on the VLDL-TG and HDL-cholesterol concentrations in the reaction mixtures: the higher the concentrations of VLDL-TG and HDL-cholesterol, the greater the effect. The positive impact of HDL on VLDL lipolysis was modified by CKD progression: the percentage of lipolyzed VLDL-TG in the presence of HDL decreased with a reduction in eGFR (r=0.43, p=0.009), and for patients with stage 4 CKD, no positive impact of HDL on lipolysis was observed. The percentage of lipolyzed TG correlated negatively with apoE and apoCs content in VLDL, and positively with HDL-apoCII, as well as with VLDL and HDL apoCII/ apoCIII ratios. The progression of CKD was associated with unfavourable changes in VLDL and HDL composition; apoE and apoCs levels increased in VLDL with a decrease in eGFR whereas the HDL-cholesterol level decreased. The progression of CKD affects lipoprotein composition and properties, and modulates the positive impact of HDL on VLDL lipolysis efficiency. In CKD patients, HDL deficiency and dysfunction can directly affect hypertriglyceridaemia development. © 2018 The Author(s). Published by S. Karger AG, Basel.

OT1_kcoppin_1: A Herschel Survey of [OI]63um in 1

NASA Astrophysics Data System (ADS)

Coppin, K.

2010-07-01

Luminous obscured galaxies likely dominate the total bolometric emission from star-formation at the early epochs of z~2-3, and are most efficiently identified through their (sub)millimetre emission and are so-called submillimetre galaxies (SMGs). The intense starbursts in SMGs are fuelled by their large observed H2 gas reservoirs, as traced by CO interferometric surveys, although the details of how their immense luminosities (L_fir>5x10^12 Lsun) and star-formation rates (~100-1000 Msun/yr) are powered are not well understood: Are SMGs just scaled up ULIRGs with star-formation occurring in a highly-obscured nuclear region (with perhaps some contribution from an AGN)? Or does the star-formation occur in a more extended, cooler component, such as in "normal" star-forming galaxies. One route to tackling this question is to construct a data set of the brightest fine-structure ISM emission lines ([CII] and [OI]) in a well-defined sample of SMGs, which with ancillary CO data, will allow us to study the physics of the ISM and its interplay with the heating source. Similar benchmark data sets are being compiled by several Herschel programs for local LIRGs and ULIRGs, which will act as a link to help interpret the high-redshift SMG observations. Here we propose a timely and systematic study with the PACS spectrometer of [OI]63um in a flux-limited sample of SMGs with secure spectroscopic redshifts between 0.7

Photodissociation Regions in the Interstellar Medium of Galaxies

NASA Technical Reports Server (NTRS)

Hollenbach, David J.; Tielens, A. G. G. M.; DeVincenzi, Donald L. (Technical Monitor)

1999-01-01

The interstellar medium of galaxies is the reservoir out of which stars are born and into which stars inject newly created elements as they age. The physical properties of the interstellar medium are governed in part by the radiation emitted by these stars. Far-ultraviolet (6 eV less than h(nu) less than 13.6 eV) photons from massive stars dominate the heating and influence the chemistry of the neutral atomic gas and much of the molecular gas in galaxies. Predominantly neutral regions of the interstellar medium in which the heating and chemistry are regulated by far ultraviolet photons are termed Photo-Dissociation Regions (PDRs). These regions are the origin of most of the non-stellar infrared (IR) and the millimeter and submillimeter CO emission from galaxies. The importance of PDRs has become increasingly apparent with advances in IR and submillimeter astronomy. The IR emission from PDRs includes fine structure lines of C, C+, and O; rovibrational lines of H2, rotational lines of CO; broad middle features of polycyclic aromatic hydrocarbons; and a luminous underlying IR continuum from interstellar dust. The transition of H to H2 and C+ to CO occurs within PDRs. Comparison of observations with theoretical models of PDRs enables one to determine the density and temperature structure, the elemental abundances, the level of ionization, and the radiation field. PDR models have been applied to interstellar clouds near massive stars, planetary nebulae, red giant outflows, photoevaporating planetary disks around newly formed stars, diffuse clouds, the neutral intercloud medium, and molecular clouds in the interstellar radiation field-in summary, much of the interstellar medium in galaxies. Theoretical PDR models explain the observed correlations of the [CII] 158 microns with the COJ = 1-0 emission, the COJ = 1-0 luminosity with the interstellar molecular mass, and the [CII] 158 microns plus [OI] 63 microns luminosity with the IR continuum luminosity. On a more global scale, MR models predict the existence of two stable neutral phases of the interstellar medium, elucidate the formation and destruction of star-forming molecular clouds, and suggest radiation-induced feedback mechanisms that may regulate star formation rates and the column density of gas through giant molecular clouds.

Estimating the Effect of Intimate Partner Violence on Women’s Use of Contraception: A Systematic Review and Meta-Analysis

PubMed Central

Maxwell, Lauren; Devries, Karen; Zionts, Danielle; Alhusen, Jeanne L.; Campbell, Jacquelyn

2015-01-01

Background Intimate partner violence (IPV) is an important global public health problem. While there is a growing literature on the association between IPV and women’s reproductive health (RH) outcomes, most studies are cross-sectional—which weakens inference about the causal effect of IPV on women’s RH. This systematic review synthesizes existing evidence from the strongest study designs to estimate the impact of IPV on women’s use of contraception. Methods We searched 11 electronic databases from January of 1980 to 3 December 2013 and reviewed reference lists from systematic reviews for studies examining IPV and contraceptive use. To be able to infer causality, we limited our review to studies that had longitudinal measures of either IPV or women’s use of contraception. Results Of the 1,574 articles identified by the search, we included 179 articles in the full text review and extracted data from 12 studies that met our inclusion criteria. We limited the meta-analysis to seven studies that could be classified as subject to low or moderate levels of bias. Women’s experience of IPV was associated with a significant reduction in the odds of using contraception (n = 14,866; OR: 0.47; 95% CI: 0.25, 0.85; I2 = 92%; 95% CII2: 87%, 96%). Restricting to studies that measured the effect of IPV on women’s use of partner dependent contraceptive methods was associated with a reduction in the heterogeneity of the overall estimate. In the three studies that examined women’s likelihood of using male condoms with their partners, experience of IPV was associated with a significant decrease in condom use (OR: 0.48; 95% CIOR: 0.32, 0.72; I2 = 51%; 95% CII2: 0%, 86%). Conclusions IPV is associated with a reduction in women’s use of contraception; women who experience IPV are less likely to report using condoms with their male partners. Family planning and HIV prevention programs should consider women’s experiences of IPV. PMID:25693056

Intensity distribution and isoseismal maps for the Nisqually, Washington, earthquake of 28 February 2001

USGS Publications Warehouse

Dewey, James W.; Hopper, Margaret G.; Wald, David J.; Quitoriano, Vincent; Adams, Elizabeth R.

2002-01-01

We present isoseismal maps, macroseismic intensities, and community summaries of damage for the MW=6.8 Nisqually, Washington, earthquake of 28 February, 2001. For many communities, two types of macroseismic intensity are assigned, the traditional U.S. Geological Survey Modified Mercalli Intensities (USGS MMI) and a type of intensity newly introduced with this paper, the USGS Reviewed Community Internet Intensity (RCII). For most communities, the RCII is a reviewed version of the Community Internet Intensity (CII) of Wald and others (1999). For some communities, RCII is assigned from such non-CII sources as press reports, engineering reports, and field reconnaissance observations. We summarize differences between procedures used to assign RCII and USGS MMI, and we show that the two types of intensity are nonetheless very similar for the Nisqually earthquake. We do not see evidence for systematic differences between RCII and USGS MMI that would approach one intensity unit, at any level of shaking, but we document a tendency for the RCII to be slightly lower than MMI in regions of low intensity and slightly higher than MMI in regions of high intensity. The highest RCII calculated for the Nisqually earthquake is 7.6, calculated for zip code 98134, which includes the ?south of downtown? (Sodo) area of Seattle and Harbor Island. By comparison, we assigned a traditional USGS MMI 8 to the Sodo area of Seattle. In all, RCII of 6.5 and higher were assigned to 58 zip-code regions. At the lowest intensities, the Nisqually earthquake was felt over an area of approximately 350,000 square km (approximately 135,000 square miles) in Washington, Oregon, Idaho, Montana, and southern British Columbia, Canada. On the basis of macroseismic effects, we infer that shaking in the southern Puget Sound region was somewhat less for the 2001 Nisqually earthquake than for the Puget Sound earthquake of April 13, 1949, which had nearly the same hypocenter and magnitude. Allowing for differences in hypocenter, shaking in the 2001 earthquake was very similar to that produced by the Puget Sound earthquake of April 25, 1965. First-person accounts of the effects of the 2001 earthquake on individual households are given for some communities.

Non-radial pulsation, rotation and outburst in the Be star omega Orionis from the MuSiCoS 1998 campaign

NASA Astrophysics Data System (ADS)

Neiner, C.; Hubert, A.-M.; Floquet, M.; Jankov, S.; Henrichs, H. F.; Foing, B.; Oliveira, J.; Orlando, S.; Abbott, J.; Baldry, I. K.; Bedding, T. R.; Cami, J.; Cao, H.; Catala, C.; Cheng, K. P.; Domiciano de Souza, A., Jr.; Janot-Pacheco, E.; Hao, J. X.; Kaper, L.; Kaufer, A.; Leister, N. V.; Neff, J. E.; O'Toole, S. J.; Schäfer, D.; Smartt, S. J.; Stahl, O.; Telting, J.; Tubbesing, S.; Zorec, J.

2002-06-01

omega Ori (HD 37490, HR 1934) is a Be star known to have presented variations. In order to investigate the nature and origin of its short-term and mid-term variability, a study is performed of several spectral lines (Hα , Hdelta , ion {He}i 4471, 4713, 4921, 5876, 6678, ion {C}{ii} 4267, 6578, 6583, ion {Mg}{ii} 4481, ion {Si}{iii} 4553 and ion {Si}{ii} 6347), based on 249 high signal-to-noise high-resolution spectra taken with 8 telescopes over 22 consecutive nights during the MuSiCoS (Multi SIte COntinuous Spectroscopy) campaign in November-December 1998. The stellar parameters are revisited and the projected rotational velocity (vsin i = 179 km s-1) is redetermined using several methods. With the MuSiCoS 98 dataset, a time series analysis of line-profile variations (LPVs) is performed using the Restricted Local Cleanest (RLC) algorithm and a least squares method. The behaviour of the velocity of the centroid of the lines, the equivalent widths and the apparent vsini for several lines, as well as Violet and Red components of photospheric lines affected by emission (red ion {He}i lines, ion {Si}{ii} 6347, ion {C}{ii} 6578, 6583) are analyzed. The non-radial pulsation (NRP) model is examined using phase diagrams and the Fourier-Doppler Imaging (FDI) method. The LPVs are consistent with a NRP mode with l = 2 or 3, |m| = 2 with frequency 1.03 c d-1. It is shown that an emission line outburst occurred in the middle of the campaign. Two scenarios are proposed to explain the behaviour of a dense cloud, temporarily orbiting around the star with a frequency 0.46 c d-1, in relation to the outburst. Based on observations taken during the MuSiCoS 98 campaign at OHP (France), La Silla (ESO, Chile, ID 62.H-0270), Mount Stromlo (Australia), Xinglong Station (China), Kitt Peak (USA), MCT/LNA (Brazil) and INT (Isaac Newton Group, La Palma Island).

CNO Abundances in Metal-Rich Environments: Infrared Space Observatory Spectroscopy of Ionized Gas in M51

NASA Astrophysics Data System (ADS)

Garnett, Donald R.; Edmunds, Michael G.; Henry, Richard B. C.; Pagel, Bernard E. J.; Skillman, Evan D.

2004-12-01

We present Infrared Space Observatory (ISO) Long Wavelength Spectrograph observations centered on the H II region CCM 10 in the spiral galaxy M51. We detect several emission lines in this spectrum, including [O I] 63 and 145 μm, [C II] 158 μm, [O III] 88 μm, and [N II] 122 μm, with a significant upper limit on [N III] 57 μm. We use these measurements to estimate abundances for C, N, and O in the interstellar medium in M51. We compare our [O III] 88 μm flux with the flux for [O III] λ5007 obtained from narrowband imaging. The derived 5007Å/88μm ratio yields an electron temperature Te=5300+/-300 K. This temperature agrees with estimates of T[O III] based on photoionization models of CCM 10 with logO/H=-3.2, an abundance that is about a factor of 2 smaller than earlier results for this object derived from photoionization modeling of the visible spectrum. A possible cause for the discrepancy is that the older photoionization models based on CLOUDY predict significantly larger optical emission-line strengths than the current version of CLOUDY at the same metallicity; models with the more recent version are more consistent with the observed spectra of M51 H II region with reduced O/H. Assuming N/O=N+2/O+2, the upper limit for [NIII]/[OIII] yields logN/O<-0.5, which is consistent with the trend of N/O versus O/H seen in other spiral galaxies. C/O is estimated from the [CII]/[OI] ratio using photodissociation region models constrained by published CO line ratios, [CI]/CO, and [OI]63μm/145μm. With these various constraints on ne and G0, the observed [CII]/[OI] intensity ratio is in good agreeement with that predicted by photodissociation region models with approximately solar abundances. We infer from this that C/O in M51 is consistent with the solar neighborhood value.

Vitamin D prevents articular cartilage erosion by regulating collagen II turnover through TGF-β1 in ovariectomized rats.

PubMed

Li, S; Niu, G; Wu, Y; Du, G; Huang, C; Yin, X; Liu, Z; Song, C; Leng, H

2016-02-01

To explore the effect of vitamin D on turnover of articular cartilage with ovariectomy (OVX) induced OA, and to investigate transforming growth factor-β1 (TGF-β1) as a possible underlying mechanism mediated by 1α,25(OH)2D3. Sixty-six rats were randomly allocated into seven groups: sham plus control diet (SHAM+CTL), OVX+CTL diet, sham plus vitamin D-deficient (VDD) diet, OVX+VDD diet, and three groups of ovariectomized rats treated with different doses of 1α,25(OH)2D3. The cartilage erosion and the levels of serum 17β-estradiol, 1α,25(OH)2D3 and C-telopeptide of type II collagen (CTX-II) were measured. TGF-β1, type II Collagen (CII), matrix metalloproteinases (MMP)-9,-13 in articular cartilage were assessed by immunohistochemistry. TGF-β1 and CTX-II expression were measured in articular cartilage chondrocytes treated with/without tumor necrosis factor (TNF-α), 1α,25(OH)2D3, and TGF-β receptor inhibitor (SB505124) in vitro. Cartilage erosion due to OVX was significantly reduced in a dose-dependent manner by 1α,25(OH)2D3 supplementation, and exacerbated by VDD. The expressions of TGF-β1 and CII in articular cartilage were suppressed by OVX and VDD, and rescued by 1α,25(OH)2D3 supplementation. The expression of MMP-9,-13 in articular cartilage increased with OVX and VDD, and decreased with 1α,25(OH)2D3 supplementation. In vitro experiments showed that 1α,25(OH)2D3 increased the TGF-β1 expression of TNF-α stimulated chondrocytes in a dose-dependent manner. 1α,25(OH)2D3 significantly counteracted the increased CTX-II release due to TNF-α stimulation, and this effect was significantly suppressed by SB505124. VDD aggravated cartilage erosion, and 1α,25(OH)2D3 supplementation showed protective effects in OVX-induced OA partly through the TGF-β1 pathway. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

Chemical evolution of the gas in C-type shocks in dark clouds

NASA Astrophysics Data System (ADS)

Nesterenok, A. V.

2018-07-01

A magnetohydrodynamic model of a steady, transverse C-type shock in a dense molecular cloud is presented. A complete gas-grain chemical network is taken into account: the gas-phase chemistry, the adsorption of gas species on dust grains, various desorption mechanisms, the grain surface chemistry, the ion neutralization on dust grains, the sputtering of grain mantles. The population densities of energy levels of ions CI, CII and OI and molecules H2, CO, H2O are computed in parallel with the dynamical and chemical rate equations. The large velocity gradient approximation is used in the line radiative transfer calculations. The simulations consist of two steps: (i) modelling of the chemical and thermal evolution of a static molecular cloud and (ii) shock simulations. A comparison is made with the results of publicly available models of similar physical systems. The focus of the paper is on the chemical processing of gas material and ice mantles of dust grains by the shock. Sputtering of ice mantles takes place in the shock region close to the temperature peak of the neutral gas. At high shock speeds, molecules ejected from ice mantles are effectively destroyed in hot gas, and their survival time is low—of the order of dozens of years. After a passage of high-speed C-type shock, a zone of high abundance of atomic hydrogen appears in the cooling postshock gas that triggers formation of complex organic species such as methanol. It is shown that abundances of some complex organic molecules (COMs) in the postshock region can be much higher than in the preshock gas. These results are important for interpretation of observations of COMs in protostellar outflows.

The Atomic to Molecular Transition in the Interstellar Medium

NASA Technical Reports Server (NTRS)

Goldsmith, Paul F.

2012-01-01

Study of H2 in UV and IR continues to surprise us with complexity of excitation state, OPR, and role in astrochemistry. Atomic H in molecular clouds is a very powerful tool suggesting that they are not "young" but that it takes millions of years to convert primarily atomic hydrogen clouds to 99.9% molecular form. Laboratory data suggests that H2 formation is efficient over broader range of temperatures than thought to be the case a few years ago, but range is still limited. Issues of complex grain morphology and surface structure make this a very difficult field in which to obtain definitively meaningful results. Ongoing and future observations of CI and CII will improve our understanding of the structure of clouds, their total mass, and how they have evolved and will continue to do so.

Dollar Summary of Prime Contract Awards by State, County, Contractor and Place. Part 2 (Alachua-Menominee)

DTIC Science & Technology

1990-01-01

0c -4 -40)4- * L Iit m * 40 404 CD to I 4 0)0m (a 04) a~ CV -1*c 𔃾 I4 C)II tun I nco -4 0V) C) m 0 01~~~~~e CO I ON N000 N0l I2I4 N 0 CO In 40) - 0 0...WO a.I-1W z o -0z zw1- " WWM4- oo mx04C’)4Ua Ŕ(1~f 0004-NBaN’a004’N004-4-0Z flC’ Wa K- ) II= 0 I N a N(𔃻P- zAw ~ 0 -aQfl4-4N 0 a -00(’)0t7- N ofa a0

VizieR Online Data Catalog: Warm ISM in the Sagittarius A Complex (Garcia+, 2016)

NASA Astrophysics Data System (ADS)

Garcia, P.; Simon, R.; Stutzki, J.; Gusten, R.; Requena-Torres, M. A.; Higgins, R.

2016-03-01

Files contain the observations of CI 1-0 and CI 2-1, NII 1-0, and CII 3/2-1/2 observed with Herschel-HIFI and 12CO 4-3 observed with NANTEN2/SMART telescope of the SgrA Complex in the GC. The data analysis was done via GILDAS-CLASS, where raw data are processed to obtain regularly sampled data. ************************* IMPORTANT NOTE ************************ These data sets will be blocked until 31.12.16 as agreed on with the A&A Editor. Access to channel maps of all observed transitions is immediately available in electronic format in the link provided in the paper, https://www.astro.uni-koeln.de/online-data/GarciaPSgrA_AA588/. For contact information refer to Dr. Pablo Garcia e-mail: pgarcia@iram.es ******************************************************************* (1 data file).

World Weather Extremes. Revision,

DTIC Science & Technology

1985-12-01

year i’irf D4 Africa Wart, Ha//a Sudm 3r9ri yr.’.ipr ortd C.8 Nitl Arriric,t 8Bataqorus Al,, 14 year period B.3 A- si Adir Siritl Yroreri 50 vot...3 s’-reitor/rr 719/() 83 6 6!orat Srr~iru/i//miiiiits y )4 Pi-irr Nirth firrii.i Si /vrr Li)r Cii/rai/ii 14 awi /5 Al III 19? 1 B3 I’) /"I, f~psrrux F...cx 31 "-CL W- AJ 4- Z-’ Un MD .tq *r- 0 co Cr C5 ( 0 1I * -0 0 C’ -j P’’ 1 -- .- A Aj 0 0 w c WL. Si - ’C J11 u I-’ m1 I= C rZ- .- 1 3I- w t * C 0 o

Nearby Supernova Factory Observations of SN 2006D: On SporadicCarbon Signatures in Early Type Ia Supernova Spectra

DOE Office of Scientific and Technical Information (OSTI.GOV)

Thomas, R.C.; Aldering, G.; Antilogus, P.

2006-10-12

We present four spectra of the Type Ia supernova SN Ia 2006Dextending from -7 to +13 days with respect to B-band maximum. The spectrainclude the strongest signature of unburned material at photosphericvelocities observed in a SN Ia to date. The earliest spectrum exhibits CII absorption features below 14,000 km/s, including a distinctive C IIlambda 6580 absorption feature. The carbon signatures dissipate as the SNapproaches peak brightness. In addition to discussing implications ofphotospheric-velocity carbon for white dwarf explosion models, we outlinesome factors that may influence the frequency of its detection before andaround peak brightness. Two effects are explored in this regard,includingmore » depopulation of the C II optical levels by non-LTE effects, andline-of-sight effects resulting from a clumpy distribution of unburnedmaterial with low volume-filling factor.« less

Feature and contrast enhancement of mammographic image based on multiscale analysis and morphology.

PubMed

Wu, Shibin; Yu, Shaode; Yang, Yuhan; Xie, Yaoqin

2013-01-01

A new algorithm for feature and contrast enhancement of mammographic images is proposed in this paper. The approach bases on multiscale transform and mathematical morphology. First of all, the Laplacian Gaussian pyramid operator is applied to transform the mammography into different scale subband images. In addition, the detail or high frequency subimages are equalized by contrast limited adaptive histogram equalization (CLAHE) and low-pass subimages are processed by mathematical morphology. Finally, the enhanced image of feature and contrast is reconstructed from the Laplacian Gaussian pyramid coefficients modified at one or more levels by contrast limited adaptive histogram equalization and mathematical morphology, respectively. The enhanced image is processed by global nonlinear operator. The experimental results show that the presented algorithm is effective for feature and contrast enhancement of mammogram. The performance evaluation of the proposed algorithm is measured by contrast evaluation criterion for image, signal-noise-ratio (SNR), and contrast improvement index (CII).

Feature and Contrast Enhancement of Mammographic Image Based on Multiscale Analysis and Morphology

PubMed Central

Wu, Shibin; Xie, Yaoqin

2013-01-01

A new algorithm for feature and contrast enhancement of mammographic images is proposed in this paper. The approach bases on multiscale transform and mathematical morphology. First of all, the Laplacian Gaussian pyramid operator is applied to transform the mammography into different scale subband images. In addition, the detail or high frequency subimages are equalized by contrast limited adaptive histogram equalization (CLAHE) and low-pass subimages are processed by mathematical morphology. Finally, the enhanced image of feature and contrast is reconstructed from the Laplacian Gaussian pyramid coefficients modified at one or more levels by contrast limited adaptive histogram equalization and mathematical morphology, respectively. The enhanced image is processed by global nonlinear operator. The experimental results show that the presented algorithm is effective for feature and contrast enhancement of mammogram. The performance evaluation of the proposed algorithm is measured by contrast evaluation criterion for image, signal-noise-ratio (SNR), and contrast improvement index (CII). PMID:24416072

Cloning and sequence analysis of complementary DNA encoding an aberrantly rearranged human T-cell gamma chain.

PubMed Central

Dialynas, D P; Murre, C; Quertermous, T; Boss, J M; Leiden, J M; Seidman, J G; Strominger, J L

1986-01-01

Complementary DNA (cDNA) encoding a human T-cell gamma chain has been cloned and sequenced. At the junction of the variable and joining regions, there is an apparent deletion of two nucleotides in the human cDNA sequence relative to the murine gamma-chain cDNA sequence, resulting simultaneously in the generation of an in-frame stop codon and in a translational frameshift. For this reason, the sequence presented here encodes an aberrantly rearranged human T-cell gamma chain. There are several surprising differences between the deduced human and murine gamma-chain amino acid sequences. These include poor homology in the variable region, poor homology in a discrete segment of the constant region precisely bounded by the expected junctions of exon CII, and the presence in the human sequence of five potential sites for N-linked glycosylation. Images PMID:3458221

Report on Quality Control Review of Grant Thornton, LLP FY 2009 Single Audit of Concurrent Technologies Corporation

DTIC Science & Technology

2011-12-05

F t:deral Aw:uds IJ󈧏it. Jl~r fllllfifM> /Jltfoi7J/I’Ii ,md/1 pwmfttt’!J Jr/.tf••tf Jo / ht tul’lliTitf otlll/ tVJIIJj>/eknW nf //Ito rtft•du/t 1/J(J...1111/. f ht ll lld/111!’> IWI~<II’Cd !4 .t l/bt/1/~Jirb I~ •~>tfrlllll ( fi/11’(1/7>/d I rrllwnlt~gitJ’ omtrl/011 lf•.JIIII~fi!IIJI/1 ciiMI’il )iotJ...fiJI> tt’l’l<ll’ C1\\IHI T/JqmMIIti»Y/’fttl (i,mllrmti ’l’t~lllml.>~m · •ll•rtfilltl "’"’ "" mb,mwTit we;r ;Udtln 111 tvu, 6m ’,,m/ tl,tlrjlllr

Exploring the dusty star-formation in the early Universe using intensity mapping

NASA Astrophysics Data System (ADS)

Lagache, Guilaine

2018-05-01

In the last decade, it has become clear that the dust-enshrouded star formation contributes significantly to early galaxy evolution. Detection of dust is therefore essential in determining the properties of galaxies in the high-redshift universe. This requires observations at the (sub-)millimeter wavelengths. Unfortunately, sensitivity and background confusion of single dish observations on the one hand, and mapping efficiency of interferometers on the other hand, pose unique challenges to observers. One promising route to overcome these difficulties is intensity mapping of fluctuations which exploits the confusion-limited regime and measures the collective light emission from all sources, including unresolved faint galaxies. We discuss in this contribution how 2D and 3D intensity mapping can measure the dusty star formation at high redshift, through the Cosmic Infrared Background (2D) and [CII] fine structure transition (3D) anisotropies.

Older adults' home- and community-based care service use and residential transitions: a longitudinal study.

PubMed

Chen, Ya-Mei; Berkowitz, Bobbie

2012-08-10

As Home-and Community-Based Services (HCBS), such as skilled nursing services or personal care services, have become increasingly available, it has become clear that older adults transit through different residential statuses over time. Older adults may transit through different residential statuses as the various services meet their needs. The purpose of this exploratory study was to better understand the interplay between community-dwelling older adults' use of home- and community-based services and their residential transitions. The study compared HCBS service-use patterns and residential transitions of 3,085 older adults from the Second Longitudinal Study of Aging. Based on older adults' residential status at the three follow-up interviews, four residential transitions were tracked: (1) Community-Community-Community (CCC: Resided in community during the entire study period); (2) Community-Institution-Community (CIC: Resided in community at T1, had lived in an institution at some time between T1 and T2, then had returned to community by T3); (3) Community-Community-Institution (CCI: Resided in community between at T1, and betweenT1 and T2, including at T2, but had used institutional services between T2 and T3); (4) Community-Institution-Institution (CII: Resided in community at T1 but in an institution at some time between T1 and T2, and at some time between T2 and T3.). Older adults' use of nondiscretionary and discretionary services differed significantly among the four groups, and the patterns of HCBS use among these groups were also different. Older adults' use of nondiscretionary services, such as skilled nursing care, may help them to return to communities from institutions. Personal care services (PCS) and senior center services may be the key to either support elders to stay in communities longer or help elders to return to their communities from institutions. Different combinations of PCS with other services, such as senior center services or meal services, were associated with different directions in residential transition, such as CIC and CII respectively. Older adults' differing HCBS use patterns may be the key to explaining older adults' transitions. Attention to older adults' HCBS use patterns is recommended for future practice. However, this was an exploratory study and the analyses cannot establish causal relationships.

Extent of Integration of Priority Interventions into General Health Systems: A Case Study of Neglected Tropical Diseases Programme in the Western Region of Ghana

PubMed Central

Mensah, Ernest O.; Aikins, Moses K.; Gyapong, Margaret; Anto, Francis; Bockarie, Moses J.; Gyapong, John O.

2016-01-01

Background The global health system has a large arsenal of interventions, medical products and technologies to address current global health challenges. However, identifying the most effective and efficient strategies to deliver these resources to where they are most needed has been a challenge. Targeted and integrated interventions have been the main delivery strategies. However, the health system discourse increasingly favours integrated strategies in the context of functionally merging targeted interventions with multifunctional health care delivery systems with a focus on strengthening country health systems to deliver needed interventions. Neglected Tropical Diseases (NTD) have been identified to promote and perpetuate poverty hence there has been global effort to combat these diseases. The Neglected Tropical Diseases Programme (NTDP) in Ghana has a national programme team and office, however, it depends on the multifunctional health delivery system at the regional and district level to implement interventions. The NTDP seeks further health system integration to accelerate achievement of coverage targets. The study estimated the extent of integration of the NTDP at the national, regional and district levels to provide evidence to guide further integration. Methodology/Principal Findings The research design was a descriptive case study that interviewed key persons involved in the programme at the three levels of the health system as well as extensive document review. Integration was assessed on two planes—across health system functions–stewardship and governance, financing, planning, service delivery, monitoring and evaluation and demand generation; and across three administrative levels of the health system–national, regional and district. A composite measure of integration designated Cumulative Integration Index (CII) with a range of 0.00–1.00 was used to estimate extent of integration at the three levels of the health system. Service delivery was most integrated while financing and planning were least integrated. Extent of integration was partial at all levels of the health system with a CII of 0.48–0.68; however it was higher at the district compared to the national and regional levels. Conclusions/Significance To ensure further integration of the NTDP, planning and finance management activities must be decentralized to involve regional and district levels of the health system. The study provides an empirical measure of extent of integration and indicators to guide further integration. PMID:27203854

Older adults’ home- and community-based care service use and residential transitions: a longitudinal study

PubMed Central

2012-01-01

Background As Home-and Community-Based Services (HCBS), such as skilled nursing services or personal care services, have become increasingly available, it has become clear that older adults transit through different residential statuses over time. Older adults may transit through different residential statuses as the various services meet their needs. The purpose of this exploratory study was to better understand the interplay between community-dwelling older adults’ use of home- and community-based services and their residential transitions. Methods The study compared HCBS service-use patterns and residential transitions of 3,085 older adults from the Second Longitudinal Study of Aging. Based on older adults’ residential status at the three follow-up interviews, four residential transitions were tracked: (1) Community-Community-Community (CCC: Resided in community during the entire study period); (2) Community-Institution-Community (CIC: Resided in community at T1, had lived in an institution at some time between T1 and T2, then had returned to community by T3); (3) Community-Community-Institution (CCI: Resided in community between at T1, and betweenT1 and T2, including at T2, but had used institutional services between T2 and T3); (4) Community-Institution-Institution (CII: Resided in community at T1 but in an institution at some time between T1 and T2, and at some time between T2 and T3.). Results Older adults’ use of nondiscretionary and discretionary services differed significantly among the four groups, and the patterns of HCBS use among these groups were also different. Older adults’ use of nondiscretionary services, such as skilled nursing care, may help them to return to communities from institutions. Personal care services (PCS) and senior center services may be the key to either support elders to stay in communities longer or help elders to return to their communities from institutions. Different combinations of PCS with other services, such as senior center services or meal services, were associated with different directions in residential transition, such as CIC and CII respectively. Conclusions Older adults’ differing HCBS use patterns may be the key to explaining older adults’ transitions. Attention to older adults’ HCBS use patterns is recommended for future practice. However, this was an exploratory study and the analyses cannot establish causal relationships. PMID:22877416

Extent of Integration of Priority Interventions into General Health Systems: A Case Study of Neglected Tropical Diseases Programme in the Western Region of Ghana.

PubMed

Mensah, Ernest O; Aikins, Moses K; Gyapong, Margaret; Anto, Francis; Bockarie, Moses J; Gyapong, John O

2016-05-01

The global health system has a large arsenal of interventions, medical products and technologies to address current global health challenges. However, identifying the most effective and efficient strategies to deliver these resources to where they are most needed has been a challenge. Targeted and integrated interventions have been the main delivery strategies. However, the health system discourse increasingly favours integrated strategies in the context of functionally merging targeted interventions with multifunctional health care delivery systems with a focus on strengthening country health systems to deliver needed interventions. Neglected Tropical Diseases (NTD) have been identified to promote and perpetuate poverty hence there has been global effort to combat these diseases. The Neglected Tropical Diseases Programme (NTDP) in Ghana has a national programme team and office, however, it depends on the multifunctional health delivery system at the regional and district level to implement interventions. The NTDP seeks further health system integration to accelerate achievement of coverage targets. The study estimated the extent of integration of the NTDP at the national, regional and district levels to provide evidence to guide further integration. The research design was a descriptive case study that interviewed key persons involved in the programme at the three levels of the health system as well as extensive document review. Integration was assessed on two planes-across health system functions-stewardship and governance, financing, planning, service delivery, monitoring and evaluation and demand generation; and across three administrative levels of the health system-national, regional and district. A composite measure of integration designated Cumulative Integration Index (CII) with a range of 0.00-1.00 was used to estimate extent of integration at the three levels of the health system. Service delivery was most integrated while financing and planning were least integrated. Extent of integration was partial at all levels of the health system with a CII of 0.48-0.68; however it was higher at the district compared to the national and regional levels. To ensure further integration of the NTDP, planning and finance management activities must be decentralized to involve regional and district levels of the health system. The study provides an empirical measure of extent of integration and indicators to guide further integration.

GASPS--A Herschel Survey of Gas and Dust in Protoplanetary Disks: Summary and Initial Statistics

NASA Technical Reports Server (NTRS)

Dent, W.R.F.; Thi, W. F.; Kamp, I.; Williams, J. P.; Menard, F.; Andrews, S.; Ardila, D.; Aresu, G.; Augereau, J.-C.; Barrado y Navascues, D.;

Herschel survey and modelling of externally-illuminated photoevaporating protoplanetary disks.

PubMed

Champion, J; Berné, O; Vicente, S; Kamp, I; Le Petit, F; Gusdorf, A; Joblin, C; Goicoechea, J R

2017-08-01

Protoplanetary disks undergo substantial mass-loss by photoevaporation, a mechanism which is crucial to their dynamical evolution. However, the processes regulating the gas energetics have not been well constrained by observations so far. We aim at studying the processes involved in disk photoevaporation when it is driven by far-UV photons (i.e. 6 < E < 13.6 eV). We present a unique Herschel survey and new ALMA observations of four externally-illuminated photoevaporating disks (a.k.a. proplyds). For the analysis of these data, we developed a 1D model of the photodissociation region (PDR) of a proplyd, based on the Meudon PDR code and we computed the far infrared line emission. With this model, we successfully reproduce most of the observations and derive key physical parameters, i.e. densities at the disk surface of about 10 6 cm -3 and local gas temperatures of about 1000 K. Our modelling suggests that all studied disks are found in a transitional regime resulting from the interplay between several heating and cooling processes that we identify. These differ from those dominating in classical PDRs i.e. grain photo-electric effect and cooling by [OI] and [CII] FIR lines. This specific energetic regime is associated to an equilibrium dynamical point of the photoevaporation flow: the mass-loss rate is self-regulated to keep the envelope column density at a value that maintains the temperature at the disk surface around 1000 K. From the physical parameters derived from our best-fit models, we estimate mass-loss rates - of the order of 10 -7 M ⊙ /yr - that are in agreement with earlier spectroscopic observation of ionised gas tracers. This holds only if we assume photoevaporation in the supercritical regime where the evaporation flow is launched from the disk surface at sound speed. We have identified the energetic regime regulating FUV-photoevaporation in proplyds. This regime could be implemented into models of the dynamical evolution of protoplanetary disks.

The Interstellar Medium

NASA Technical Reports Server (NTRS)

Tielens, Alexander G. G. M.

1995-01-01

The Interstellar Medium (ISM) forms an integral part of the lifecycle of stars and the galaxy. Stars are formed by gravitational contraction of interstellar clouds. Over their life, stars return much of their mass to the ISM through winds and supernova explosions, resulting in a slow enrichment in heavy elements. Understanding the origin and evolution of the ISM is a key problem within astrophysics. The KAO has made many important contributions to studies of the interstellar medium both on the macro and on the micro scale. In this overview, I will concentrate on two breakthroughs in the last decade in which KAO observations have played a major role: (1) the importance of large Polycyclic Aromatic Hydrocarbon (PAH) molecules for the ISM (section 3) and (2) the study of Photodissociation Regions (PDRs) as an analog for the diffuse ISM at large (section 4). Appropriately, the micro and macro problem are intricately interwoven in these problems. Finally, section 5 reviews the origin of the (CII) emission observed by COBE.

ZEUS-2: a second generation submillimeter grating spectrometer for exploring distant galaxies

NASA Astrophysics Data System (ADS)

Ferkinhoff, Carl; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Irwin, Kent D.; Cho, Hsiao-Mei; Halpern, Mark

2010-07-01

ZEUS-2, the second generation (z)Redshift and Early Universe Spectrometer, like its predecessor is a moderate resolution (R~1000) long-slit, echelle grating spectrometer optimized for the detection of faint, broad lines from distant galaxies. It is designed for studying star-formation across cosmic time. ZEUS-2 employs three TES bolometer arrays (555 pixels total) to deliver simultaneous, multi-beam spectra in up to 4 submillimeter windows. The NIST Boulder-built arrays operate at ~100mK and are readout via SQUID multiplexers and the Multi-Channel Electronics from the University of British Columbia. The instrument is cooled via a pulse-tube cooler and two-stage ADR. Various filter configurations give ZEUS-2 access to 7 different telluric windows from 200 to 850 micron enabling the simultaneous mapping of lines from extended sources or the simultaneous detection of the 158 micron [CII] line and the [NII] 122 or 205 micron lines from z = 1-2 galaxies. ZEUS-2 is designed for use on the CSO, APEX and possibly JCMT.

Separation and purification of γ-aminobutyric acid from fermentation broth by flocculation and chromatographic methodologies.

PubMed

Gao, Qiang; Duan, Qiang; Wang, Depei; Zhang, Yunze; Zheng, Chunyang

2013-02-27

To date, the multifunctional γ-aminobutyric acid (GABA) is mainly produced by microbial fermentation in industry. The purpose of this study was to find an effective method for separation and purification of 31.2 g/L initial GABA from the fermentation broth of Enterococcus raffinosus TCCC11660. To remove the impurities from fermentation broth, flocculation pretreatment using chitosan and sodium alginate was first implemented to facilitate subsequent filtration. Ultrafiltration followed two discontinuous diafiltration steps to effectively remove proteins and macromolecular pigments, and the resulting permeate was further decolored by DA201-CII resin at a high decoloration ratio and GABA recovery. Subsequently, ion exchange chromatography (IEC) with Amberlite 200C resin and gradient elution were applied for GABA separation from glutamate and arginine. Finally, GABA crystals of 99.1% purity were prepared via warm ethanol precipitation twice. Overall, our results reveal that the successive process including flocculation, filtration, ultrafiltration, decoloration, IEC, and crystallization is promising for scale-up GABA extraction from fermentation broth.

Air Force Office of Scientific Research Technical Report Summaries: October - December 1990

DTIC Science & Technology

1990-12-01

0 LOU L.4-OC) -C @ LO -cc 0t 00rz @ < w4 MO0). LI £41- a.) @ CCw ULf f> <. 03 :-3 f3 - - -I CU -- (c IL (P C a 0- . 4~-C i0L C w PA 0.V a)V 3T a - 0 0...u40) u 0 4, th-- E Uw)Z IX 0 CL W L E tw>-’I> C - u Li L (U Q)0 (0 00. L W C Z h 0 Z - 4-+ - .n W 0)Cf04 V 4- ) C <ZOZ 0 I 4- L u’,’m W 3-- ACCa )- >4...0).---0cC) E ZZ- 3 0- C -’ a) 0--)4- C4 W 0> f3 L ML >,U - O0in 3: CID Lu L r C L. (ALiIA 4- w oWM--- U Mw I X I- >- 11 Z M U LA- u a) m mm a)4) cii

Geographic List of Prime Contract Awards. Oct 1992-Sep 1993. FY 1993. (Alachua, Florida-DeKalb, Georgia). Part 4

DTIC Science & Technology

1994-03-01

z z zM z zz z z z MM u 0 en 4 41 41 4 < 0 4 -C 4c 4c < -C luccu NO 0 o< 0 Oil 04 0 0 0 I Uc- : >- >- )I- >- z 2z z >- >- >- >- >- 1 00-4(4) Ln in W...CDCJ 1-i 1- 1-1 cII oON 1I ee ow 1- 1- I.-H CDO HZ W = U Z -4 0 >- z Z cc cc z 1-- ) -- I el 00 w I 11 u 00 s- - W s- 0 01 U 0 (A 1,- 0 > Oil 100 IIl I0...MM MM M* V qtC n 0 W M rCOW CO M M M Oil 0-4 -’ it -I1 0-0 II i N4 I 0001 11 ~zzzxm ZZZZZ=ZZZZEZZZZZZZZZZZxzZzzzzxzZZEZZZZZZr Wg 0(D If ZZ ZZ ZZ ZZ Z

The tumor suppressor cybL, a component of the respiratory chain, mediates apoptosis induction.

PubMed

Albayrak, Timur; Scherhammer, Volker; Schoenfeld, Nicole; Braziulis, Erik; Mund, Thomas; Bauer, Manuel K A; Scheffler, Immo E; Grimm, Stefan

2003-08-01

A genetic screen was established to clone apoptosis-inducing genes in a high-throughput format. It led to the isolation of several proapoptotic genes whose proteins are localized to mitochondria. One of the isolated genes is cytochrome bL (cybL also known as SDHC, CII-3, or QPs-1), a component of the respiratory chain complex II. It was further investigated because both cybL and another component of complex II, cybS, have recently been identified as tumor suppressor proteins, some of which act by controlling apoptosis. Our studies reveal that cell death induction by cybL expression is concomitant with a transient inhibition of complex II and the generation of reactive oxygen species. Importantly, cells that are constitutively deficient in cybL are resistant to a variety of proapoptotic cytostatic drugs and to the effects of the Fas receptor. Our results therefore identify complex II as a sensor for apoptosis induction and could explain the unexpected observation that complex II is inactivated in tumors.

The Tumor Suppressor cybL, a Component of the Respiratory Chain, Mediates Apoptosis Induction

PubMed Central

Albayrak, Timur; Scherhammer, Volker; Schoenfeld, Nicole; Braziulis, Erik; Mund, Thomas; Bauer, Manuel K.A.; Scheffler, Immo E.; Grimm, Stefan

2003-01-01

A genetic screen was established to clone apoptosis-inducing genes in a high-throughput format. It led to the isolation of several proapoptotic genes whose proteins are localized to mitochondria. One of the isolated genes is cytochrome bL (cybL also known as SDHC, CII-3, or QPs-1), a component of the respiratory chain complex II. It was further investigated because both cybL and another component of complex II, cybS, have recently been identified as tumor suppressor proteins, some of which act by controlling apoptosis. Our studies reveal that cell death induction by cybL expression is concomitant with a transient inhibition of complex II and the generation of reactive oxygen species. Importantly, cells that are constitutively deficient in cybL are resistant to a variety of proapoptotic cytostatic drugs and to the effects of the Fas receptor. Our results therefore identify complex II as a sensor for apoptosis induction and could explain the unexpected observation that complex II is inactivated in tumors. PMID:12925748

Effects of High-Rate Pulse Trains on Electrode Discrimination in Cochlear Implant Users

PubMed Central

Runge-Samuelson, Christina L.

2009-01-01

Overcoming issues related to abnormally high neural synchrony in response to electrical stimulation is one aspect in improving hearing with a cochlear implant. Desynchronization of electrical stimuli have shown benefits in neural encoding of electrical signals and improvements in psychophysical tasks. In the present study, 10 participants with either CII or HiRes 90k Advanced Bionics devices were tested for the effects of desynchronizing constant-amplitude high-rate (5,000 Hz) pulse trains on electrode discrimination of sinusoidal stimuli (1,000 Hz). When averaged across the sinusoidal dynamic range, overall improvements in electrode discrimination with high-rate pulses were found for 8 of 10 participants. This effect was significant for the group (p = .003). Nonmonotonic patterns of electrode discrimination as a function of sinusoidal stimulation level were observed. By providing additional spectral channels, it is possible that clinical implementation of constant-amplitude high-rate pulse trains in a signal processing strategy may improve performance with the device. PMID:19447763

An Archival COS Study of Multi-phase Galactic Outflows and Their Dependence on Host Galaxy Properties

NASA Astrophysics Data System (ADS)

Chisholm, John

2013-10-01

Galactic outflows have become vital for understanding galaxy evolution. Outflows have been used to explain the mass-metallicity relation, the star formation history of the universe, and the shape of the baryonic mass function. However, few studies have focused on the basic question of how outflow velocities depend upon the physical properties of their host galaxies. Here we propose an archival project utilizing 52 COS spectra of local star-forming galaxies spanning four decades of star formation rate, and stellar mass. We will preform a self-consistent analysis of trends between galactic properties {star formation rate, stellar mass, specific star formation rate and star formation rate surface density} and outflow velocities measured from interstellar metal absorption lines {e.g., CII 1335}. We will extend this analysis to different gas phases - cold, warm, and hot - to gain a more comprehensive understanding of the physics of multi-phase outflows. The trends we observe will provide insights into the feedback process and will be crucial new benchmarks for simulations.

A new exact method for line radiative transfer

NASA Astrophysics Data System (ADS)

Elitzur, Moshe; Asensio Ramos, Andrés

2006-01-01

We present a new method, the coupled escape probability (CEP), for exact calculation of line emission from multi-level systems, solving only algebraic equations for the level populations. The CEP formulation of the classical two-level problem is a set of linear equations, and we uncover an exact analytic expression for the emission from two-level optically thick sources that holds as long as they are in the `effectively thin' regime. In a comparative study of a number of standard problems, the CEP method outperformed the leading line transfer methods by substantial margins. The algebraic equations employed by our new method are already incorporated in numerous codes based on the escape probability approximation. All that is required for an exact solution with these existing codes is to augment the expression for the escape probability with simple zone-coupling terms. As an application, we find that standard escape probability calculations generally produce the correct cooling emission by the CII 158-μm line but not by the 3P lines of OI.

Clinical features and genetic analysis of three patients with severe hypertriglyceridaemia.

PubMed

Hooper, Amanda J; Kurtkoti, Jagadeesh; Hamilton-Craig, Ian; Burnett, John R

2014-07-01

Hypertriglyceridaemia is a common biochemical abnormality that can be due to primary causes or, more commonly, secondary causes. Moderate hypertriglyceridaemia is a risk factor for cardiovascular disease and can develop into severe hypertriglyceridaemia which is a risk factor for acute pancreatitis. Familial chylomicronaemia is a rare autosomal recessive disorder, usually diagnosed in childhood and is characterized by marked hypertriglyceridaemia and biochemical deficiency of lipoprotein lipase (LPL), apolipoprotein (apo) C-II, homozygous (or compound heterozygous) gene mutations in LPL or more rarely, APOC2. Recently, loss-of-function mutations in the APOA5 gene have been reported in patients with severe hypertriglyceridaemia in whom LPL or APOC2 mutations were not found. We describe the clinical features and genetic analysis of three patients with severe hypertriglyceridaemia including novel mutations LPL c.464T>C (p.Leu155Pro) and APOA5 c.823C>T (p.Gln275*). © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Observations of Herbig Ae/Be Stars with Herschel/PACS: The Atomic and Molecular Contents of Their Protoplanetary Discs

NASA Technical Reports Server (NTRS)

Meeus, G.; Montesinos, B.; Mendigutia, I.; Kamp, I.; Thi, W. F.; Eiroa, C.; Grady, C. A.; Mathews, G.; Sandell, G.; Martin-Zaidi, C.;

TANK OPERATIONS CONTRACT CONSTRUCTION MANAGEMENT METHODOLOGY UTILIZING THE AGENCY METHOD OF CONSTRUCTION MANAGEMENT

DOE Office of Scientific and Technical Information (OSTI.GOV)

LESKO KF; BERRIOCHOA MV

2010-02-26

Washington River Protection Solutions, LLC (WRPS) has faced significant project management challenges in managing Davis-Bacon construction work that meets contractually required small business goals. The unique challenge is to provide contracting opportunities to multiple small business constructioin subcontractors while performing high hazard work in a safe and productive manner. Previous to the WRPS contract, construction work at the Hanford Tank Farms was contracted to large companies, while current Department of Energy (DOE) Contracts typically emphasize small business awards. As an integral part of Nuclear Project Management at Hanford Tank Farms, construction involves removal of old equipment and structures and installationmore » of new infrastructure to support waste retrieval and waste feed delivery to the Waste Treatment Plant. Utilizing the optimum construction approach ensures that the contractors responsible for this work are successful in meeting safety, quality, cost and schedule objectives while working in a very hazardous environment. This paper descirbes the successful transition from a traditional project delivery method that utilized a large business general contractor and subcontractors to a new project construction management model that is more oriented to small businesses. Construction has selected the Agency Construction Management Method (John E Schaufelberger, Len Holm, "Management of Construction Projects, A Constructor's Perspective", University of Washington, Prentice Hall 2002). This method was implemented in the first quarter of Fiscal Year 2009 (FY2009), where Construction Management is performed by substantially home office resources from the URS Northwest Office in Richland, Washington. The Agency Method has allowed WRPS to provide proven Construction Managers and Field Leads to mentor and direct small business contractors, thus providing expertise and assurance of a successful project. Construction execution contracts are subcontracted directly by WRPS to small or disadvantaged contractors that are mentored and supported by URS personnel. Each small contractor is mentored and supported utilizing the principles of the Construction Industry Institute (CII) Partnering process. Some of the key mentoring and partnering areas that are explored in this paper are, internal and external safety professional support, subcontractor safety teams and the interface with project and site safety teams, quality assurance program support to facilitate compliance with NQA-1, construction, team roles and responsibilities, work definition for successful fixed price contracts, scheduling and interface with project schedules and cost projection/accruals. The practical application of the CII Partnering principles, with the Construction Management expertise of URS, has led to a highly successful construction model that also meets small business contracting goals.« less

TANK OPERATIONS CONTRACT CONSTRUCTION MANAGEMENT METHODOLOGY UTILIZING THE AGENCY METHOD OF CONSTRUCTION MANAGEMENT TO SAFELY AND EFFECTIVELY COMPLETE NUCLEAR CONSTRUCTION WORK

DOE Office of Scientific and Technical Information (OSTI.GOV)

LESO KF; HAMILTON HM; FARNER M

Washington River Protection Solutions, LLC (WRPS) has faced significant project management challenges in managing Davis-Bacon construction work that meets contractually required small business goals. The unique challenge is to provide contracting opportunities to multiple small business construction subcontractors while performing high hazard work in a safe and productive manner. Previous to the Washington River Protection Solutions, LLC contract, Construction work at the Hanford Tank Farms was contracted to large companies, while current Department of Energy (DOE) Contracts typically emphasize small business awards. As an integral part of Nuclear Project Management at Hanford Tank Farms, construction involves removal of old equipmentmore » and structures and installation of new infrastructure to support waste retrieval and waste feed delivery to the Waste Treatment Plant. Utilizing the optimum construction approach ensures that the contractors responsible for this work are successful in meeting safety, quality, cost and schedule objectives while working in a very hazardous environment. This paper describes the successful transition from a traditional project delivery method that utilized a large business general contractor and subcontractors to a new project construction management model that is more oriented to small businesses. Construction has selected the Agency Construction Management Method. This method was implemented in the first quarter of Fiscal Year (FY) 2009, where Construction Management is performed by substantially home office resources from the URS Northwest Office in Richland, Washington. The Agency Method has allowed WRPS to provide proven Construction Managers and Field Leads to mentor and direct small business contractors, thus providing expertise and assurance of a successful project. Construction execution contracts are subcontracted directly by WRPS to small or disadvantaged contractors that are mentored and supported by DRS personnel. Each small contractor is mentored and supported utilizing the principles of the Construction Industry Institute (CII) Partnering process. Some of the key mentoring and partnering areas that are explored in this paper are, internal and external safety professional support, subcontractor safety teams and the interface with project and site safety teams, quality assurance program support to facilitate compliance with NQA-1, construction, team roles and responsibilities, work definition for successful fixed price contracts, scheduling and interface with project schedules and cost projection/accruals. The practical application of the CII Partnering principles, with the Construction Management expertise of URS, has led to a highly successful construction model that also meets small business contracting goals.« less

Processing and Distribution of STO2 Data

NASA Astrophysics Data System (ADS)

Goldsmith, Paul

We propose in this ADAP to reduce the data obtained in the December 2016 flight of the STO2 Antarctic Balloon observatory. In just over 20 days of taking data, STO2 observed over 2.5 square degrees of the inner Milky Way in the 1900 GHz (158 m) fine structure line of ionized carbon ([CII]). This includes over 320,000 spectra with velocity resolution of 0.16 km/s and angular resolution 1 . In common with the higher bands of the Herschel HIFI instrument that also employed hot electron bolometer (HEB) mixers, there are significant baseline issues with the data that make reduction a significant challenge. Due to the year’s postponement of STO2 launch due to weather in 2015/16 season, funds for data analysis were largely redirected to support the team who enabled the successful launch and flight. A supplementary focused effort is thus needed to make STO2 data readily usable by the astronomical community, which is what we propose here. This ADAP will be a two-year program, including the following steps:: (1) Refine and optimize algorithms for excision of bad channels, correction for receiver gain changes, removal of variable bad baselines, final baseline adjustment, and verification of calibration. (2) Develop and integrated pipeline incorporating the optimized algorithms; process entire STO2 data set using the pipeline, and make an initial release of the data (DR1) to the public. (3) Refine data calibration including ancillary data sets coincident with the STO2 fields, make the data VO-compliant. (4) Write documentation for the pipeline and publish in appropriate journal; release final second data release (DR2) to the public, and hand off to permanent data repositories the NASA/IPAC IRSA database and the Harvard University Dataverse, and Cyverse, led by the University of Arizona. Members of the STO2 data reduction team have extensive experience with HIFI data, and particularly with the HEB fine structure spectra. We are thus confident that we can build on this experience, and preliminary steps already taken suggest that there is a clear path forward to obtaining well-calibrated data from STO2 that will be of enormous interest to the scientific community. The experience gained in careful and thorough reduction of the STO2 data will have a very positive impact on system and software design for GUSTO, a more capable follow-on Mission of Opportunity, just selected to fly in December 2021. The work will be coordinated and managed by Paul Goldsmith, the PI. Key individuals supported by this ADAP who will be implementing the software routines and developing the pipeline are STO2 Science Team members Dr. Volker Tolls (Center for Astrophysics), Dr. Youngmin Seo (JPL), Dr. Jorge Pineda (JPL). They will be supported by Dr. Craig Kulesa the STO2 Deputy PI (Arizona), Dr. Gary Melnick (CfA), and Dr. Russ Shipman (SRON). Graduate students at different institutions will also be involved. Work will be coordinated by use of appropriate tools such as Google Hangouts, telecoms, and face-to-face meetings. The STO2 data represent the first large-scale velocity-resolved images of the interstellar medium (ISM) in the inner portion of the Milky Way, including many regions with extensive high-mass star formation (such as Eta Carina), as well as more quiescent regions. It will thus be used for many studies of molecular cloud structure and evolution, disentangling complex stages in the life cycle of the ISM. Data will be compared with spectral line images of CO and HI, as well as of radio recombination lines, to assess the relationship of the [CII] emission to molecular, atomic, and ionized components of the ISM. Comparison with Herschel HiGal images of dust emission and determination of the [CII] emission to total gas column will be another rich area enabled by the work to be carried out as part of this ADAP. The STO2 data directly support the NASA Strategic Goal discovering how the universe works.

More Constraints on the Physical Conditions of the Kinematically Complex, Multiphase Absorption Line System at z=0.93 toward PG1206+459

NASA Astrophysics Data System (ADS)

Rosenwasser, Ben; Muzahid, Sowgat; Norris, Jackson; Charlton, Jane C.

2015-01-01

We present the results of photo- and collisional ionization modeling of the strong MgII absorption system at redshift z~0.93 towards the quasar PG1206+459. This system has been extensively studied over the last two decades (Churchill & Charlton 1999; Ding et al. 2003; Tripp et al. 2011) using a combination of spectra from Keck/HIRES, HST/FOS, HST/STIS, and HST/COS. Here we present newconstraints using the most complete spectral coverage including more recent observations of OVI and the Lyman series from HST/COS. Numerous absorption components are seen over a large velocity spread (~1500km/s), and multiple ionization phases are required to account for the detected transitions, which include MgI, MgII, FeII, SiII, SiIII, SiIV, CII, CIII, CIV, SIII, SIV, SV, SVI, NIII, NIV, NV, OIII, OIV, OV, OVI, and NeVIII. Considering the new constraints, we revisit the question of the physical nature of the structures that produce this absorber.

Hafnium Films and Magnetic Shielding for TIME, A mm-Wavelength Spectrometer Array

NASA Astrophysics Data System (ADS)

Hunacek, J.; Bock, J.; Bradford, C. M.; Butler, V.; Chang, T.-C.; Cheng, Y.-T.; Cooray, A.; Crites, A.; Frez, C.; Hailey-Dunsheath, S.; Hoscheit, B.; Kim, D. W.; Li, C.-T.; Marrone, D.; Moncelsi, L.; Shirokoff, E.; Steinbach, B.; Sun, G.; Trumper, I.; Turner, A.; Uzgil, B.; Weber, A.; Zemcov, M.

2018-04-01

TIME is a mm-wavelength grating spectrometer array that will map fluctuations of the 157.7-μm emission line of singly ionized carbon ([CII]) during the epoch of reionization (redshift z ˜ 5-9). Sixty transition-edge sensor (TES) bolometers populate the output arc of each of the 32 spectrometers, for a total of 1920 detectors. Each bolometer consists of gold absorber on a ˜ 3 × 3 mm silicon nitride micro-mesh suspended near the corners by 1 × 1 × 500 μm silicon nitride legs targeting a photon-noise-dominated NEP ˜ 1 × 10^{-17} W/√{Hz} . Hafnium films are explored as a lower-T_c alternative to Ti (500 mK) for TIME TESs, allowing thicker support legs for improved yield. Hf T_c is shown to vary between 250 and 450 mK when varying the resident Ar pressure during deposition. Magnetic shielding designs and simulations are presented for the TIME first-stage SQUIDs. Total axial field suppression is predicted to be 5 × 10^7.

Ionization of Local Interstellar Gas Based on STIS and FUSE spectra of Nearby Stars

NASA Astrophysics Data System (ADS)

Redfield, Seth; Linsky, J. L.

2009-01-01

The ultraviolet contains many resonance line transitions that are sensitive to a range of ionization stages of ions present in the local interstellar medium (LISM). We couple observations of high resolution ultraviolet spectrographs, STIS and GHRS on the Hubble Space Telescope (HST) and the Far-Ultraviolet Spectroscopic Explorer (FUSE) in order to make a comprehensive survey of the ionization structure of the local interstellar medium. In particular, we focus on the sight line toward G191-B2B, a nearby (69 pc) white dwarf. We present interstellar detections of highly ionized elements (e.g., SiIII, CIII, CIV, etc) and compare them directly to neutral or singly ionized LISM detections (e.g., SiII, CII, etc). The extensive observations of G191-B2B provides an opportunity for a broad study of ionization stages of several elements, while a survey of several sight lines provides a comprehensive look at the ionization structure of the LISM. We acknowledge support for this project through NASA FUSE Grant NNX06AD33G.

The ZEUS 1 & 2 INvestigated Galaxy Reference Sample (ZINGRS): A window into galaxies in the early Universe.

NASA Astrophysics Data System (ADS)

Ferkinhoff, Carl; Hershey, Deborah; Scrabeck, Alex; Higdon, Sarah; Higdon, James L.; Tidwell, Hannah; Lamarche, Cody; Vishwas, Amit; Nikola, Thomas; Stacey, Gordon J.; Brisbin, Drew

2018-06-01

Galaxies have evolved significantly from the early Universe until today. Star formation rates, stellar and molecular gas masses, sizes and metal enrichment of galaxies have all changed significantly from early epochs until the present. Probing the physical conditions of galaxy at high redshift is vital to understanding this evolution. ZINGRS, the ZEUS 1 and 2 INvestigated Galaxy Reference Sample, provides a unique and powerful window for this work. The sample consists of more than ~30 galaxies from z ~ 1 - 4.5 for which the far-IR fine-structure lines (e.g. [CII] 158 micron, [NII] 122micron, [OIII] 88 micron) have been observed with the ZEUS-1 and 2 instruments. These lines are ideal for studying high-z systems since they require low energies for excitation, are typically optically thin, and are not susceptible to extinction from dust. ZINGRS is the largest collection of far-IR fine-structure line detections at high-z. Here we describe the sample, including extensive multifrequency supporting observations like CO & radio continuum, and summarize what we have learned so far.

Parathyroid hormone is not an inhibitor of lipoprotein lipase activity.

PubMed

Arnadottir, M; Nilsson-Ehle, P

1994-01-01

The reduced lipoprotein lipase (LPL) activities in uraemia are reflected by increased serum triglyceride concentrations and reduced HDL cholesterol concentrations. Both hyperparathyroidism and circulating inhibitor(s) of LPL have been associated with the disturbances of lipid metabolism in uraemia. The aim of the present study was to investigate if parathyroid hormone (PTH) had an inhibitory effect on LPL activity. Plasma post-heparin LPL activities, plasma LPL inhibitory activities, serum PTHintact and serum PTHC-terminal concentrations were analysed in 20 patients on haemodialysis and 20 healthy controls. The effects of purified, human PTHintact and a carboxyterminal fragment of PTH (PTH39-84) on LPL activities in post-heparin plasma from healthy individuals and on the enzyme activity of purified, bovine milk LPL, activated with apolipoprotein CII, were studied. Patients had significantly higher plasma LPL inhibitory activities than controls, but there was no correlation between plasma LPL inhibitory activities and serum PTH concentrations. Neither PTHintact nor PTH39-84 had a significant effect on LPL activities in vitro. Thus there was no evidence of a direct inhibition of LPL activity by PTH under the present in-vivo or in-vitro conditions.

Prime Contract Awards by State or Country, Place and Contractor. Part 4 (Salinas, California - Lompoc Valley, California), FY1991

DTIC Science & Technology

1991-01-01

1 L)if I M4’) 100 < of ICO 1a" 0..( crI of ) " i X I- H 011 WCN I(A z EfmE 1 3 I4 o 0f mIi I mcON I’ ~0L4C0L0O)0AIC)0’N𔃾LN-C.4)-4CCLC)4)00~C ofI z...00n Inn~~U~f Gn)fUU U o LU L) NLL a 00 4N N m oo---444444--.4- COO- - -4 4 4 4- - - - 0.o0 04o- 4M 100 NO moo0 0 j IX N11- 10000c N 4 0000 4 -ON -0)000...2j O il to N I ciI- $._ I 1-4_ J ZN 100 N13 U 11 wo x IN4 0 Na (0, 21 - 4co()0r na >c4r-I 0- o ni 7 .- - 4ɘ . D 0 0 $_r 044 81 CN NfC)0 Y o - * 4r 0

Infrared Spectroscopy of Black Hole Candidates

NASA Technical Reports Server (NTRS)

Colgan, Sean W.; Cotera, A. S.; Maloney, P. R.; Hollenbach, D. J.; DeVincenzi, Donald L. (Technical Monitor)

2000-01-01

ISO LWS and SWS observations of the approx. solar mass black hole candidates 1E1740.7-2942 and GRS1758-258 are presented. For 1E1740.7-2942, it has been suggested that the luminosity is provided in whole or part by Bondi-Hoyle accretion from a surrounding black hole (Bally & Leventhal 1991, Nat, 353,234). Maloney et al. (1997, ApJ482, L41) have predicted that detectable far-infrared line emission from [0I] (63 microns), [CII] (158 microns), [SiII] (35 microns) and other lines will arise from black holes which are embedded in molecular clouds. No strong line emission associated with either 1E1740.7-2942 or GRS1758-258 was detected, implying either that 1) these sources are not embedded in dense molecular clouds, or 2) that their average X-ray luminosity over the past 100 years is significantly lower than its current value. The measured upper limits to the line fluxes are compared with the models of Maloney et al.to constrain the properties of the ISM in the vicinity of these X-ray sources.

GAS in Protoplanetary Systems (GASPS). I. First results

NASA Astrophysics Data System (ADS)

Mathews, G. S.; Dent, W. R. F.; Williams, J. P.; Howard, C. D.; Meeus, G.; Riaz, B.; Roberge, A.; Sandell, G.; Vandenbussche, B.; Duchêne, G.; Kamp, I.; Ménard, F.; Montesinos, B.; Pinte, C.; Thi, W. F.; Woitke, P.; Alacid, J. M.; Andrews, S. M.; Ardila, D. R.; Aresu, G.; Augereau, J. C.; Barrado, D.; Brittain, S.; Ciardi, D. R.; Danchi, W.; Eiroa, C.; Fedele, D.; Grady, C. A.; de Gregorio-Monsalvo, I.; Heras, A.; Huelamo, N.; Krivov, A.; Lebreton, J.; Liseau, R.; Martin-Zaidi, C.; Mendigutía, I.; Mora, A.; Morales-Calderon, M.; Nomura, H.; Pantin, E.; Pascucci, I.; Phillips, N.; Podio, L.; Poelman, D. R.; Ramsay, S.; Rice, K.; Riviere-Marichalar, P.; Solano, E.; Tilling, I.; Walker, H.; White, G. J.; Wright, G.

2010-07-01

Context. Circumstellar discs are ubiquitous around young stars, but rapidly dissipate their gas and dust on timescales of a few Myr. The Herschel Space Observatory allows for the study of the warm disc atmosphere, using far-infrared spectroscopy to measure gas content and excitation conditions, and far-IR photometry to constrain the dust distribution. Aims: We aim to detect and characterize the gas content of circumstellar discs in four targets as part of the Herschel science demonstration phase. Methods: We carried out sensitive medium resolution spectroscopy and high sensitivity photometry at λ ~ 60-190 μm using the Photodetector Array Camera and Spectrometer instrument on the Herschel Space Observatory. Results: We detect [OI] 63 μm emission from the young stars HD 169142, TW Hydrae, and RECX 15, but not HD 181327. No other lines, including [CII] 158 and [OI] 145, are significantly detected. All four stars are detected in photometry at 70 and 160 μm. Extensive models are presented in associated papers. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Line Intensity Mapping during the Epoch of Reionization

NASA Astrophysics Data System (ADS)

Silva, Marta B.; Zaroubi, Saleem

2018-05-01

Characterizing the properties and the evolution of the first stars and galaxies is a challenging task for traditional galaxy surveys since they are sensitivity limited and can only detect the brightest light sources. Three-dimensional intensity mapping (IM) of transition lines can be a valuable alternative to study the high redshift Universe given that this technique avoids sensitivity limitation problems by measuring the overall emission of a line, with a low resolution, without resolving its sources. While 21cm line IM surveys probe neutral hydrogen gas and can, therefore, be used to probe the state of the IGM and the evolution of the ionization field during the Epoch of Reionization (EoR). IM surveys of other lines, such as CO, CII, Ly-alpha or H-alpha, can be used to probe the galaxies which emitted most of the ionizing radiation responsible for the EoR. These lines will trace the different ISM gas phases, the excitation state of this gas, its metallicity, etc. This study addresses IM of multiple transition lines and how it can be used to probe the EoR and to constrain the redshift evolution of galaxy properties.

Continuum and Line Emission Simulation of Star-Forming Galaxies and Development of a New Sub-mm Inte

NASA Astrophysics Data System (ADS)

Lagache, Guilaine

2018-01-01

Nowadays, most of the constraints on the dusty star formation at high z comes from deep continuum surveys. We developed a new simulation of the dusty extragalactic sky with a realistic clustering. The comparison between single-dish and interferometric data showed that the clustering inside the beam of a single-dish instrument can seriously bias their measurements. Fortunately, these simulations also show that the beam of a >30-meter dish in the mm should not be affected by serious multiplicity effects. We will give predictions for important characteristics of future AtLAST surveys (as confusion limit, number of detections, properties of detected galaxies). These simulations can also include line emission to prepare a future sub-mm low-resolution spectroscopic survey at high z with AtLAST. Such a survey could be built on the legacy of the CONCERTO survey, that will map the fluctuations of the CII line intensity in the reionisation and post-reionisation epoch. A "super-CONCERTO" instrument on AtLAST would be a perfect first-light instrument to unveil the gigantic potential of this telescope.

Smoking habits in a sample of young Italian soldiers.

PubMed

Di Nicola, Marta; Occhiolini, Lucius; Di Mascio, Rocco; Vellante, Piero; Colagrande, Vittorio; Ballone, Enzo

2006-01-01

The aim of this cross-sectional study was to determine the attitudes and characteristics of smoking patterns in a sample of 450 young, Italian, military men. Data were collected using a self-administered questionnaire. The prevalence of military smokers was 54.4%; 45.7% of military men were smokers before enrollment, whereas 8.7% initiated smoking after enrollment. In multiple logistic regression analysis, the risk of becoming a smoker was associated with "high" cultural class of the family of origin (odds ratio [OR], 1.99; 95% confidence interval [CII, 1.05-4.23), non-nuclear family types (OR, 2.56; 95% CI, 1.25-5.25), parent (OR, 1.73; 95% CI, 1.04-2.90) and sibling/partner (OR, 2.25; 95% CI, 1.45-3.50) smokers, and >12 months of service (OR, 1.39; 95% CI, 1.07-5.43). None of the other variables relative to military status was significantly associated with smoking. Because the prevalence of military smokers was very high, we think that special programs aimed at decreasing the prevalence, with the long-term goal of smoking cessation, are needed.

Evaluation of a cochlear-implant processing strategy incorporating phantom stimulation and asymmetric pulses

PubMed Central

Monstrey, Jolijn; Deeks, John M.; Macherey, Olivier

2014-01-01

Objective To evaluate a speech-processing strategy in which the lowest frequency channel is conveyed using an asymmetric pulse shape and “phantom stimulation”, where current is injected into one intra-cochlear electrode and where the return current is shared between an intra-cochlear and an extra-cochlear electrode. This strategy is expected to provide more selective excitation of the cochlear apex, compared to a standard strategy where the lowest-frequency channel is conveyed by symmetric pulses in monopolar mode. In both strategies all other channels were conveyed by monopolar stimulation. Design Within-subjects comparison between the two strategies. Four experiments: (1) discrimination between the strategies, controlling for loudness differences, (2) consonant identification, (3) recognition of lowpass-filtered sentences in quiet, (4) sentence recognition in the presence of a competing speaker. Study sample Eight users of the Advanced Bionics CII/Hi-Res 90k cochlear implant. Results Listeners could easily discriminate between the two strategies but no consistent differences in performance were observed. Conclusions The proposed method does not improve speech perception, at least in the short term. PMID:25358027

Evaluation of a cochlear-implant processing strategy incorporating phantom stimulation and asymmetric pulses.

PubMed

Carlyon, Robert P; Monstrey, Jolijn; Deeks, John M; Macherey, Olivier

2014-12-01

To evaluate a speech-processing strategy in which the lowest frequency channel is conveyed using an asymmetric pulse shape and "phantom stimulation", where current is injected into one intra-cochlear electrode and where the return current is shared between an intra-cochlear and an extra-cochlear electrode. This strategy is expected to provide more selective excitation of the cochlear apex, compared to a standard strategy where the lowest-frequency channel is conveyed by symmetric pulses in monopolar mode. In both strategies all other channels were conveyed by monopolar stimulation. Within-subjects comparison between the two strategies. Four experiments: (1) discrimination between the strategies, controlling for loudness differences, (2) consonant identification, (3) recognition of lowpass-filtered sentences in quiet, (4) sentence recognition in the presence of a competing speaker. Eight users of the Advanced Bionics CII/Hi-Res 90k cochlear implant. Listeners could easily discriminate between the two strategies but no consistent differences in performance were observed. The proposed method does not improve speech perception, at least in the short term.

The Chajnantor Sub/Millimeter Survey Telescope

NASA Astrophysics Data System (ADS)

Golwala, Sunil

2018-01-01

We are developing the Chajnantor Sub/millimeter Survey Telescope, a project to build a 30-m telescope operating at wavelengths as short as 850 µm with 1 degree field of view for imaging and multi-object spectroscopic surveys. This project will provide massive new data sets for studying star formation at high redshift and in the local universe, feedback mechanisms in galaxy evolution, the structure of galaxy clusters, and the cosmological peculiar velocity field. We will highlight CSST's capabilities for studying galaxy evolution, where it will: trace the evolution of dusty, star-forming galaxies from high redshift to the z ≍ 1-3 epoch when they dominate the cosmic star formation rate; connect this population to the high-redshift rest-frame UV/optical galaxy population; use these dusty galaxies, the most biased overdensities, to guide ultra-deep followup at z > 3.5 and possibly z > 7; measure the brightness of important submm/FIR spectral lines like [CII]; search for molecular and atomic outflows; and do calorimetry of the CGM via the thermal SZ effect. We will describe the expected surveys addressing these science goals, the novel telescope design, and the planned survey instrumentation.

Obtención de perfiles teóricos de elementos metálicos con velocidades macroscópicas

NASA Astrophysics Data System (ADS)

Cirigliano, D.; Costa, A.; Rovira, M.

El propósito de este trabajo es poder establecer -a partir de la modelización de perfiles de distintas especies- patrones de comparación observacional que permitan caracterizar los fenómenos físicos que están presentes en las estructuras que se observan. Para ello se resuelven las ecuaciones de equilibrio de ionización para un determinado átomo y una atmósfera de parámetros determinados. A partir de ello se definen las poblaciones para los distintos grados de ionización. Considerando distintas configuraciones e intensidades de flujos de masa se deducen la función fuente, el espesor óptico y se calculan los perfiles de las distintas líneas. Se obtuvieron perfiles teóricos de líneas del CII, CIV y del OIV para flujos entrante, saliente y pasante. La forma del perfil, las intensidades relativas entre los distintos flujos y el corrimiento Doppler da cuenta de una caracterización teórica a partir de la cual se comparará con observaciones.

Mechanisms of triglyceride metabolism in patients with bile acid diarrhea

PubMed Central

Sagar, Nidhi Midhu; McFarlane, Michael; Nwokolo, Chuka; Bardhan, Karna Dev; Arasaradnam, Ramesh Pulendran

2016-01-01

Bile acids (BAs) are essential for the absorption of lipids. BA synthesis is inhibited through intestinal farnesoid X receptor (FXR) activity. BA sequestration is known to influence BA metabolism and control serum lipid concentrations. Animal data has demonstrated a regulatory role for the FXR in triglyceride metabolism. FXR inhibits hepatic lipogenesis by inhibiting the expression of sterol regulatory element binding protein 1c via small heterodimer primer activity. Conversely, FXR promotes free fatty acids oxidation by inducing the expression of peroxisome proliferator-activated receptor α. FXR can reduce the expression of microsomal triglyceride transfer protein, which regulates the assembly of very low-density lipoproteins (VLDL). FXR activation in turn promotes the clearance of circulating triglycerides by inducing apolipoprotein C-II, very low-density lipoproteins receptor (VLDL-R) and the expression of Syndecan-1 together with the repression of apolipoprotein C-III, which increases lipoprotein lipase activity. There is currently minimal clinical data on triglyceride metabolism in patients with bile acid diarrhoea (BAD). Emerging data suggests that a third of patients with BAD have hypertriglyceridemia. Further research is required to establish the risk of hypertriglyceridaemia in patients with BAD and elicit the mechanisms behind this, allowing for targeted treatment. PMID:27570415

Dyslipidemia in PCOS.

PubMed

Wild, Robert A

2012-03-10

Life-long apolipoprotein lipid metabolic dysfunction in women with PCOS exaggerates the risk for cardiovascular disease (CVD) with aging. The dysfunction has involved insulin resistance (IR), which occurs in most women with PCOS. Women with PCOS have androgen excess, IR, variable amounts of estrogen exposure, and many environmental factors, all of which can influence lipid metabolism. On average, women with PCOS were higher triglyceride [26.39 95% CI (17.24, 35.54)], lower HDL-cholesterol [6.41 95% CI (3.69, 9.14)], and higher non HDL cholesterol levels [18.82 95% CI (15.53, 22.11)] than their non-PCOS counterparts. They have higher ApoCIII/ApoCII ratios and higher ApoCI even if they are not obese. ApoC1 elevation in women with PCOS needs to be further evaluated as a marker of dysfunction and potential CVD risk. ApoB measurements track with non-HDL cholesterol as a surrogate for increased atherogenic circulating small LDL particles. Elevated triglycerides and waist circumference predict CVD risk and women with PCOS often have these phenotypes. Diet and exercise interventions followed by selective lipid lowering medications are encouraged to normalize the dyslipidemia. Copyright © 2012 Elsevier Inc. All rights reserved.

Expelling Stress for Primary School Teachers: Self-Affirmation Increases Positive Emotions in Teaching and Emotion Reappraisal

PubMed Central

Morgan, James; Atkin, Lisa

2016-01-01

The aim of the present pilot study was to assess the effect of a brief work-related self-affirming implementation intention (WS-AII) on the well-being of primary school teachers. Participants were randomly allocated to one of two conditions: one in which they were asked to create a WS-AII or one in which they were asked to create a control implementation intention (C-II). State anxiety was measured pre- and post-manipulation, self-efficacy at post-manipulation only, and emotions in teaching and emotion regulation at baseline and at a two-week follow-up. There were statistically significant differences between the WS-AII condition and the control. Teachers who created work-related self-affirming implementation intentions reported an immediate reduction in state anxiety. Positive effects extended over the two-week period, with teachers in the WS-AII condition also reporting more positive emotions in teaching and the use of reappraisal emotion regulation strategies rather than emotion suppression. Results suggest that the integration of the WS-AII into existing organisational practice may be of benefit to the well-being of teachers and other highly stressed workers. PMID:27187437

Development of Aluminum LEKIDs for Balloon-Borne Far-IR Spectroscopy

NASA Astrophysics Data System (ADS)

Hailey-Dunsheath, S.; Barlis, A. C. M.; Aguirre, J. E.; Bradford, C. M.; Redford, J. G.; Billings, T. S.; LeDuc, H. G.; McKenney, C. M.; Hollister, M. I.

2018-04-01

We are developing lumped-element kinetic inductance detectors (LEKIDs) designed to achieve background-limited sensitivity for far-infrared (FIR) spectroscopy on a stratospheric balloon. The spectroscopic terahertz airborne receiver for far-infrared exploration will study the evolution of dusty galaxies with observations of the [CII] 158 μm and other atomic fine-structure transitions at z=0.5 -1.5, both through direct observations of individual luminous infrared galaxies, and in blind surveys using the technique of line intensity mapping. The spectrometer will require large format (˜ 1800 detectors) arrays of dual-polarization sensitive detectors with NEPs of 1 × 10^{-17} W Hz^{-1/2} . The low-volume LEKIDs are fabricated with a single layer of aluminum (20-nm-thick) deposited on a crystalline silicon wafer, with resonance frequencies of 100-250 MHz. The inductor is a single meander with a linewidth of 0.4 μm , patterned in a grid to absorb optical power in both polarizations. The meander is coupled to a circular waveguide, fed by a conical feedhorn. Initial testing of a small array prototype has demonstrated good yield and a median NEP of 4 × 10^{-18} W Hz^{-1/2}.

Use of transgenic and mutant animal models in the study of heterocyclic amine-induced mutagenesis and carcinogenesis.

PubMed

Dashwood, Roderick H

2003-01-31

Heterocyclic amines (HCAs) are potent mutagens generated during the cooking of meat and fish, and several of these compounds produce tumors in conventional experimental animals. During the past 5 years or so, HCAs have been tested in a number of novel in vivo murine models, including the following: lacZ, lacI, cII, c-myc/lacZ, rpsL, and gptDelta. transgenics, XPA-/-, XPC-/-, Msh2+/-, Msh2-/- and p53+/- knock-outs, Apc mutant mice (ApcDelta716, Apc1638N, Apcmin), and A33DeltaNbeta-cat knock-in mice. Several of these models have provided insights into the mutation spectra induced in vivo by HCAs in target and non-target organs for tumorigenesis, as well as demonstrating enhanced susceptibility to HCA-induced tumors and preneoplastic lesions. This review describes several of the more recent reports in which novel animal models were used to examine HCA-induced mutagenesis and carcinogenesis in vivo, including a number of studies which assessed the inhibitory activities of chemopreventive agents such as 1,2-dithiole-3-thione, conjugated linoleic acids, tea, curcumin, chlorophyllin-chitosan, and sulindac.

Contagem de fontes de radio na direção de aglomerados ricos de galaxias

NASA Astrophysics Data System (ADS)

Andreazza, C. M.; Andernach, H.

A contagem de fontes de rádio, na direção de aglomerados ricos de galáxias, deve fornecer uma distribuçãto acima da média do campo devido aos efeitos do meio. No entanto, a distribução de radiofontes de alguns aglomerados, investigada por vários autores no passado, mostrou, em alguns casos, uma deficência de fontes fracas. Neste trabalho, analisamos os levantamentos em 2.7 GHz (Reuter e Andernach 1990, 1990A&AS...82..279R; Loiseau et al. 1988, 1988A&AS...75...67L) e o catálogo 6CII em 151 MHz (Hales et al. 1988, 1988MNRAS.234..919H). Nosso estudio da distribução de radiofontes, na direção de aglomerados ricos de galáxias, nestas duas frequências, mostra um excesso de fontes fortes somente nas regiões centrais dos aglomerados. Este resultado pode ser explicado devido à evidência de confinamento das radiofontes pelo gás, do meio intra-aglomerado, e devido aos processos de colisão, coalescência e canibalismo de galáxias.

Expelling Stress for Primary School Teachers: Self-Affirmation Increases Positive Emotions in Teaching and Emotion Reappraisal.

PubMed

Morgan, James; Atkin, Lisa

2016-05-13

The aim of the present pilot study was to assess the effect of a brief work-related self-affirming implementation intention (WS-AII) on the well-being of primary school teachers. Participants were randomly allocated to one of two conditions: one in which they were asked to create a WS-AII or one in which they were asked to create a control implementation intention (C-II). State anxiety was measured pre- and post-manipulation, self-efficacy at post-manipulation only, and emotions in teaching and emotion regulation at baseline and at a two-week follow-up. There were statistically significant differences between the WS-AII condition and the control. Teachers who created work-related self-affirming implementation intentions reported an immediate reduction in state anxiety. Positive effects extended over the two-week period, with teachers in the WS-AII condition also reporting more positive emotions in teaching and the use of reappraisal emotion regulation strategies rather than emotion suppression. Results suggest that the integration of the WS-AII into existing organisational practice may be of benefit to the well-being of teachers and other highly stressed workers.

Serum proteomic analysis reveals potential serum biomarkers for occupational medicamentosa-like dermatitis caused by trichloroethylene.

PubMed

Huang, Peiwu; Ren, Xiaohu; Huang, Zhijun; Yang, Xifei; Hong, Wenxu; Zhang, Yanfang; Zhang, Hang; Liu, Wei; Huang, Haiyan; Huang, Xinfeng; Wu, Desheng; Yang, Linqing; Tang, Haiyan; Zhou, Li; Li, Xuan; Liu, Jianjun

2014-08-17

Trichloroethylene (TCE) is an industrial solvent with widespread occupational exposure and also a major environmental contaminant. Occupational medicamentosa-like dermatitis induced by trichloroethylene (OMLDT) is an autoimmune disease and it has become one major hazard in China. In this study, sera from 3 healthy controls and 3 OMLDT patients at different disease stages were used for a screening study by 2D-DIGE and MALDI-TOF-MS/MS. Eight proteins including transthyretin (TTR), retinol binding protein 4 (RBP4), haptoglobin, clusterin, serum amyloid A protein (SAA), apolipoprotein A-I, apolipoprotein C-III and apolipoprotein C-II were found to be significantly altered among the healthy, acute-stage, healing-stage and healed-stage groups. Specifically, the altered expression of TTR, RBP4 and haptoglobin were further validated by Western blot analysis and ELISA. Our data not only suggested that TTR, RBP4 and haptoglobin could serve as potential serum biomarkers of OMLDT, but also indicated that measurement of TTR, RBP4 and haptoglobin or their combination could help aid in the diagnosis, monitoring the progression and therapy of the disease. Copyright © 2014. Published by Elsevier Ireland Ltd.

High Molecular Weight Forms of Mammalian Respiratory Chain Complex II

PubMed Central

Nůsková, Hana; Holzerová, Eliška; Vrbacký, Marek; Pecina, Petr; Hejzlarová, Kateřina; Kľučková, Katarína; Rohlena, Jakub; Neuzil, Jiri; Houštěk, Josef

2013-01-01

Mitochondrial respiratory chain is organised into supramolecular structures that can be preserved in mild detergent solubilisates and resolved by native electrophoretic systems. Supercomplexes of respiratory complexes I, III and IV as well as multimeric forms of ATP synthase are well established. However, the involvement of complex II, linking respiratory chain with tricarboxylic acid cycle, in mitochondrial supercomplexes is questionable. Here we show that digitonin-solubilised complex II quantitatively forms high molecular weight structures (CIIhmw) that can be resolved by clear native electrophoresis. CIIhmw structures are enzymatically active and differ in electrophoretic mobility between tissues (500 – over 1000 kDa) and cultured cells (400–670 kDa). While their formation is unaffected by isolated defects in other respiratory chain complexes, they are destabilised in mtDNA-depleted, rho0 cells. Molecular interactions responsible for the assembly of CIIhmw are rather weak with the complexes being more stable in tissues than in cultured cells. While electrophoretic studies and immunoprecipitation experiments of CIIhmw do not indicate specific interactions with the respiratory chain complexes I, III or IV or enzymes of the tricarboxylic acid cycle, they point out to a specific interaction between CII and ATP synthase. PMID:23967256

Pitch ranking, electrode discrimination, and physiological spread of excitation using current steering in cochlear implants

PubMed Central

Goehring, Jenny L.; Neff, Donna L.; Baudhuin, Jacquelyn L.; Hughes, Michelle L.

2014-01-01

The first objective of this study was to determine whether adaptive pitch-ranking and electrode-discrimination tasks with cochlear-implant (CI) recipients produce similar results for perceiving intermediate “virtual-channel” pitch percepts using current steering. Previous studies have not examined both behavioral tasks in the same subjects with current steering. A second objective was to determine whether a physiological metric of spatial separation using the electrically evoked compound action potential spread-of-excitation (ECAP SOE) function could predict performance in the behavioral tasks. The metric was the separation index (Σ), defined as the difference in normalized amplitudes between two adjacent ECAP SOE functions, summed across all masker electrodes. Eleven CII or 90 K Advanced Bionics (Valencia, CA) recipients were tested using pairs of electrodes from the basal, middle, and apical portions of the electrode array. The behavioral results, expressed as d′, showed no significant differences across tasks. There was also no significant effect of electrode region for either task. ECAP Σ was not significantly correlated with pitch ranking or electrode discrimination for any of the electrode regions. Therefore, the ECAP separation index is not sensitive enough to predict perceptual resolution of virtual channels. PMID:25480063

Measuring the Outflows from Massive Young Stellar Objects in the Large Magellanic Cloud (LMC)

NASA Astrophysics Data System (ADS)

Meixner, Margaret

2015-10-01

The formation of massive stars has been difficult to study because they evolve quickly and evolutionary phases are short-lived. Using the GREAT instrument, we propose to measure the molecular gas outflows in 4 massive young stellar objects (YSOs) that we discovered in the Large Magellanic Cloud (LMC) with our Herschel and Spitzer surveys. We have in hand ALMA observations of the CO J=2-1 for all 4 targets. Three of these YSOs mark active young star formation sites in N159W that is the most intense and concentrated molecular cloud in the LMC. The fourth YSO, located in N79, is the most massive/luminous YSO in the LMC. One of the N159W YSOs has been detected with an outflow in the CO J=2-1 line. We will observe the CO J=11-10 line in these 4 YSOs because the shock excited outflows are very bright in this line and it can be used to quantify the mass loss rate. We will also map the most massive YSO in the [CII] 158 micron line to probe the physical conditions of the region.

Severe hypertriglyceridemia-related acute pancreatitis.

PubMed

Stefanutti, Claudia; Labbadia, Giancarlo; Morozzi, Claudia

2013-04-01

Acute pancreatitis is a potentially life-threatening complication of severe hypertriglyceridemia. In some cases, inborn errors of metabolism such as lipoprotein lipase deficiency, apoprotein C-II deficiency, and familial hypertriglyceridemia have been reported as causes of severe hypertriglyceridemia. More often, severe hypertriglyceridemia describes various clinical conditions characterized by high plasma levels of triglycerides (>1000 mg/dL), chylomicron remnants, or intermediate density lipoprotein like particles, and/or chylomicrons. International guidelines on the management of acute pancreatitis are currently available. Standard therapeutic measures are based on the use of lipid-lowering agents (fenofibrate, gemfibrozil, niacin, Ω-3 fatty acids), low molecular weight heparin, and insulin in diabetic patients. However, when standard medical therapies have failed, non-pharmacological approaches based upon the removal of triglycerides with therapeutic plasma exchange can also provide benefit to patients with severe hypertriglyceridemia and acute pancreatitis. Plasma exchange could be very helpful in reducing triglycerides levels during the acute phase of hyperlipidemic pancreatitis, and in the prevention of recurrence. The current evidence on management of acute pancreatitis and severe hypertriglyceridemia, focusing on symptoms, treatment and potential complications is reviewed herein. © 2013 The Authors. Therapeutic Apheresis and Dialysis © 2013 International Society for Apheresis.

Proteoform profiling of peripheral blood serum proteins from pregnant women provides a molecular IUGR signature.

PubMed

Wölter, M; Röwer, C; Koy, C; Rath, W; Pecks, U; Glocker, M O

2016-10-21

Intrauterine growth restriction (IUGR) is an important cause of perinatal morbidity and mortality and contributes substantially to medically indicated preterm birth; preventing fetal death. Molecular profiling of the mothers' peripheral blood was desired to monitor the health conditions of the fetuses. To develop such a minimally invasive assay, we applied a protein affinity fractionation method to peripheral blood serum samples from pregnant women belonging to either the IUGR or to the control group. Proof-of-principle was shown by relative quantitation analysis of mixtures of intact proteoforms using MALDI-ToF mass spectrometry. The two best differentiating proteins and proteoforms, respectively, were apolipoprotein C-II and apolipoprotein C-III 0 . Together with three robustly expressed protein proteoforms proapolipoprotein C-II, apolipoprotein C-III 1 , and apolipoprotein C-III 2 , which served as landmarks for relative quantitation analysis, they constituted the maternal IUGR proteome signature. Separation confidence of our IUGR proteoform signature reached a sensitivity of 0.73 and a specificity of 0.87 with an area under curve of 0.86 in receiver operator characteristics. Identification of IUGR newborns in the case room is required as children are severely diseased and need specialized care during infancy. Yet, at time of birth there is no readily applicable clinical test available. Hence, a molecular profiling assay is highly desired. It needs to be mentioned that current clinical definitions and recommendations for IUGR are unfortunately misleading and are not universally applicable. The most commonly adopted definition is an abdominal circumference (AC) or estimated fetal weight measurement <10th percentile. Although both, the American College of Obstetricians and Gynecologists (ACOG) and the Royal College of Obstetricians and Gynecologists (RCOG) agree that at this cut-off the risk of perinatal morbidity and mortality increases, this definition does not take into account the individualized growth potential of each fetus. In particular its sole use fails to identify larger fetuses that have not achieved their growth potential and may be at risk of adverse outcomes. Also, this definition, when solely applied, will result in the misdiagnosis of IUGR for some constitutionally small fetuses. It needs to be pointed out that the above mentioned criteria can only be determined during pregnancy in case mothers report from early on during pregnancy. We have developed a test that relies on mass spectrometric analysis of the mother's serum protein composition (IUGR signature) which can be determined just ahead of delivery and at date of delivery, respectively using a minimal invasive blood sampling approach. With this manuscript we describe the use of a mass spectrometric profiling method of 30 peripheral blood samples from pregnant women prior to giving birth of either unsuspicious newborns or IUGR-affected infants. We report for the first time that maternal blood sample analysis via affinity mass spectrometry differentiates IUGR infants from controls with high confidence. Copyright © 2016 Elsevier B.V. All rights reserved.

ALMA reveals a warm and compact starburst around a heavily obscured supermassive black hole at z = 4.75

NASA Astrophysics Data System (ADS)

Gilli, R.; Norman, C.; Vignali, C.; Vanzella, E.; Calura, F.; Pozzi, F.; Massardi, M.; Mignano, A.; Casasola, V.; Daddi, E.; Elbaz, D.; Dickinson, M.; Iwasawa, K.; Maiolino, R.; Brusa, M.; Vito, F.; Fritz, J.; Feltre, A.; Cresci, G.; Mignoli, M.; Comastri, A.; Zamorani, G.

2014-02-01

We report ALMA Cycle 0 observations at 1.3 mm of LESS J033229.4-275619 (XID403), an ultraluminous infrared galaxy at z = 4.75 in the Chandra Deep Field South hosting a Compton-thick QSO. The source is not resolved in our data at a resolution of ~0.75 arcsec, placing an upper-limit of 2.5 kpc to the half-light radius of the continuum emission from heated-dust. After deconvolving for the beam size, however, we found a ~3σ indication of an intrinsic source size of 0.27 ± 0.08 arcsec (Gaussian FWHM), which would correspond to rhalf ~ 0.9 ± 0.3 kpc. We build the far-infrared SED of XID403 by combining datapoints from both ALMA and Herschel and fit it with a modified blackbody spectrum. For the first time, we measure the dust temperature Td = 58.5 ± 5.3 K in this system, which is comparable to what has been observed in other high-z submillimeter galaxies. The measured star formation rate is SFR = 1020 ± 150 M⊙ yr-1, in agreement with previous estimates at lower S/N. Based on the measured SFR and source size, we constrain the SFR surface density to be ΣSFR > 26M⊙ yr-1 kpc-2 (~200M⊙ yr-1 kpc-2 for rhalf ~ 0.9 kpc). The compactness of this starburst is comparable to what has been observed in other local and high-z starburst galaxies. If the gas mass measured from previous [CII] and CO(2-1) observations at low resolution is confined within the same dust region, assuming rhalf ~ 0.9 ± 0.3 kpc, this would produce a column density of NH ~ 0.3-1.1 × 1024 cm-2 towards the central SMBH, similar to the column density of ≈1.4 × 1024 cm-2 measured from the X-rays. Then, in principle, if both gas and dust were confined on sub-kpc scales, this would be sufficient to produce the observed X-ray column density without any need of a pc-scale absorber (e.g. the torus postulated by Unified Models). We speculate that the high compactness of star formation, together with the presence of a powerful AGN, likely produce an outflowing wind. This would be consistent with the ~350 km s-1 velocity shift observed between the Lyα emission and the submm lines ([CII], CO(2-1), [NII]) and with the highly-ionized Fe emission line at ~6.9 keV rest-frame tentatively observed in the X-ray spectrum. Finally, our observations show that, besides the mass, star formation rate and gas depletion timescale, XID403 has also the right size to be one of the progenitors of the compact quiescent massive galaxies seen at z ~ 3.

An Icy Kuiper-Belt Around the Young Solar-Type Star HD 181327

NASA Technical Reports Server (NTRS)

Lebreton, J.; Augereau, J.-C.; Thi, W.-F.; Roberge, A.; Donaldson, J.; Schneider, G.; Maddison, S. T.; Menard, F.; Riviere-Marichalar, P.; Mathews, G. S.;

Herschel survey and modelling of externally-illuminated photoevaporating protoplanetary disks

NASA Astrophysics Data System (ADS)

Champion, J.; Berné, O.; Vicente, S.; Kamp, I.; Le Petit, F.; Gusdorf, A.; Joblin, C.; Goicoechea, J. R.

2017-08-01

Context. Protoplanetary disks undergo substantial mass-loss by photoevaporation, a mechanism that is crucial to their dynamical evolution. However, the processes regulating the gas energetics have not so far been well constrained by observations. Aims: We aim to study the processes involved in disk photoevaporation when it is driven by far-UV photons (I.e. 6 < E < 13.6 eV). Methods: We present a unique Herschel survey and new ALMA observations of four externally-illuminated photoevaporating disks (a.k.a. proplyds). To analyse these data, we developed a 1D model of the photodissociation region (PDR) of a proplyd, based on the Meudon PDR code. Using this model, we computed the far infrared line emission. Results: With this model, we successfully reproduce most of the observations and derive key physical parameters, that is, the densities at the disk surface of about 106 cm-3 and local gas temperatures of about 1000 K. Our modelling suggests that all studied disks are found in a transitional regime resulting from the interplay between several heating and cooling processes that we identify. These differ from those dominating in classical PDRs, meaning the grain photo-electric effect and cooling by [OI] and [CII] FIR lines. This specific energetic regime is associated to an equilibrium dynamical point of the photoevaporation flow: the mass-loss rate is self-regulated to keep the envelope column density at a value that maintains the temperature at the disk surface around 1000 K. From the physical parameters derived from our best-fit models, we estimate mass-loss rates - of the order of 10-7M⊙/yr - that are in agreement with earlier spectroscopic observation of ionised gas tracers. This holds only if we assume photoevaporation in the supercritical regime where the evaporation flow is launched from the disk surface at sound speed. Conclusions: We have identified the energetic regime regulating FUV-photoevaporation in proplyds. This regime could be implemented into models of the dynamical evolution of protoplanetary disks. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.Tables of observational data are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/604/A69

New insights into nonradiative heating in late A star chromospheres

NASA Technical Reports Server (NTRS)

Walter, Frederick M.; Matthews, Lynn D.; Linsky, Jeffrey L.

1995-01-01

Using new and archival spectra from the Goddard High Resolution Spectrograph, we have searched for evidence of chromospheric and transition region emission in six stars of mid to late A spectral type. Two of the stars, alpha Aq1 (A7 IV-V) and alpha Cep (A7 IV-V), show emission in the C II 1335 A doublet, confirming the presence of hot plasma with temperatures comparable to that of the solar transition region. Using radiative equilibrium photospheric models, we estimate the net surface fluxes in the CII emission line to be 9.4 x 10(exp 4) ergs/sq cm/s for alpha Aq1 and 6.5 x 10(exp 4)ergs/sq cm/s for alpha Cep. These are comparable to fluxes observed in stars as hot as approximately 8000 K (B-V = 0.22). We find no evidence for the blueshifted emission reported by Simon et al. (1994). We estimate the basal flux level to be about 30% of that seen in early F stars, and that the bulk of the emission is not basal in origin. We conclude that the basal flux level drops rapidly for B-V approximately less than 0.3, but that magnetic activity may persist to B-v as small as 0.22.

Effect of regulated deficit irrigation on quality parameters, carotenoids and phenolics of diverse tomato varieties (Solanum lycopersicum L.).

PubMed

Coyago-Cruz, Elena; Corell, Mireia; Stinco, Carla M; Hernanz, Dolores; Moriana, Alfonso; Meléndez-Martínez, Antonio J

2017-06-01

This study aims to evaluate the effects of regulated deficit irrigation (RDI) and of cluster position (CI: first and second cluster; CII: third and fourth cluster; CIII: fifth and sixth cluster) on fruit quality parameters, carotenoids and phenolics in tomatoes. Three common ('Tigerella', 'Palamós' and 'Byelsa') and two cherry varieties ('Lazarino' and 'Summerbrix') were studied. The results showed that the regulated deficit irrigation with reduction of 40 and 50% in the leaf water potential in common and cherry tomatoes did not affect greatly the organoleptic quality of common tomatoes and 'Summerbrix', while cherry varieties were significantly affected with the cluster position. In most case, significant changes in the levels of carotenoids were observed depending on the treatment and the cluster position in all varieties. Significant changes with the treatment and no change with the cluster position were observed in phenolic compounds. Thus, in general, increased total carotenoid levels and reduced the content of phenolic compounds were observed. Considering the significance of changes in the levels of these groups of compounds it was concluded that 'Lazarino' was more susceptible to water deficit, whereas 'Summerbrix' and 'Palamós' were more resistant. On the other hand, the organoleptic and functional quality changed with the variety. Copyright © 2017 Elsevier Ltd. All rights reserved.

Synthesis of novel stable compounds in the phosphorous-nitrogen system under pressure

NASA Astrophysics Data System (ADS)

Stavrou, Elissaios; Batyrev, Iskander; Ciezak-Jenkins, Jennifer; Grivickas, Paulius; Zaug, Joseph; Greenberg, Eran; Kunz, Martin

2017-06-01

We explore the possible formation of stable, and metastable at ambient conditions, polynitrogen compounds in the P-N system under pressure using in situ X-ray diffraction and Raman spectroscopy in synergy with first-principles evolutionary structural search algorithms (USPEX). We have performed numerous synthesis experiments at pressures from near ambient up to +50 GPa using both a mixture of elemental P and N2 and relevant precursors such as P3N5. Calculation of P-N extended structures at 10, 30, and 50 GPa was done using USPEX based on density functional theory (DFT) plane-waves calculations (VASP) with ultrasoft pseudopotentials. Full convex plot was found for N rich concentrations of P-N binary system. Variable content calculations were complemented by fixed concentration calculations at certain nitrogen rich concentration. Stable structures refined by DFT calculations using norm-concerning pseudopotentials. A comparison between our results and previous studies in the same system will be also given. Part of this work was performed under the auspices of the U. S. DoE by LLNS, LLC under Contract DE-AC52-07NA27344. We thank the Joint DoD/DOE Munitions Technology Development Program and the HE science C-II program at LLNL for supporting this study.

Towards adaptive, streaming analysis of x-ray tomography data

DOE Office of Scientific and Technical Information (OSTI.GOV)

Thomas, Mathew; Kleese van Dam, Kerstin; Marshall, Matthew J.

2015-03-04

Temporal and spatial resolution of chemical imaging methodologies such as x-ray tomography are rapidly increasing, leading to more complex experimental procedures and fast growing data volumes. Automated analysis pipelines and big data analytics are becoming essential to effectively evaluate the results of such experiments. Offering those data techniques in an adaptive, streaming environment can further substantially improve the scientific discovery process, by enabling experimental control and steering based on the evaluation of emerging phenomena as they are observed by the experiment. Pacific Northwest National Laboratory (PNNL)’ Chemical Imaging Initiative (CII - http://imaging.pnnl.gov/ ) has worked since 2011 towards developing amore » framework that allows users to rapidly compose and customize high throughput experimental analysis pipelines for multiple instrument types. The framework, named ‘Rapid Experimental Analysis’ (REXAN) Framework [1], is based on the idea of reusable component libraries and utilizes the PNNL developed collaborative data management and analysis environment ‘Velo’, to provide a user friendly analysis and data management environment for experimental facilities. This article will, discuss the capabilities established for X-Ray tomography, discuss lessons learned, and provide an overview of our more recent work in the Analysis in Motion Initiative (AIM - http://aim.pnnl.gov/ ) at PNNL to provide REXAN capabilities in a streaming environment.« less

Effect of extracorporeal shock wave lithotripsy on bacterial viability. Relationship to the treatment of struvite stones.

PubMed

Reid, G; Jewett, M A; Nickel, J C; McLean, R J; Bruce, A W

1990-01-01

The aim of this study was to determine whether extracorporeal shock wave lithotripsy (ESWL) affected the viability of the infecting bacteria within a simulated struvite stone matrix. A strain, Proteus mirabilis 28cii, was prepared in three forms: (1) suspended in saline and urine, (2) artificially encapsulated by suspending in agar beads and (3) artificially encapsulated and mineralised by suspending in agar beads with calcium carbonate crystals. The preparations were placed in capped vials partially immersed in degassed water and held in the focal point of the Siemens Lithostar and given 1,000 shocks. Subsequent viability testing showed that bacteria suspended in urine were greatly affected by shock treatments (55% loss in viability), but incorporation into agar beads negated this effect (even if the cells were exposed to 2000 shocks). Mineralisation of the beads with calcium carbonate crystals caused a decrease in viability of 82% that was significantly different from controls. However, this still left 2.3 X 10(8) viable organisms (82% of 2.8 X 10(8], easily enough to form the focus for further infections. A series of control experiments carried out using an ultrasonic cell sonicator probe gave comparable results to those obtained with ESWL. These results demonstrate the ESWL treatment of infected stones must be accompanied by antimicrobial coverage.

Direct measurements of intramolecular electron transfer rates between cytochrome c and cytochrome c peroxidase: effects of exothermicity and primary sequence on rate

DOE Office of Scientific and Technical Information (OSTI.GOV)

Cheung, E.; Taylor, K.; Kornblatt, J.A.

1986-03-01

Rapid mixing of ferrocytochrome c peroxidase (cyt c peroxidase(II)) and ferricytochrome c (cyt c(III)) results in the reduction of cyt c(III) by cyt c peroxidase(II). In 10 mM phosphate, pH 7.0, the rate of decay of cyt c peroxidase(II) and the rate of accumulation of cyt c(II) give equal first-order rate constants. Equivalent results are obtained by pulse radiolysis using isopropanol radical as the reducing agent. This rate is independent of the initial cyt c(III):cyt c peroxidase(II) ratios. These results are consistent with unimolecular electron transfer occurring within a cyt c(III)-cyt c peroxidase(II) complex. When cyt c is replaced bymore » porphyrin cyt c (iron-free cyt c), a complex still forms with cyt c peroxidase. On radiolysis intracomplex electron transfer occurs from the porphyrin cyt c anion radical to cyt c peroxidase(III). This large rate increase suggest that the barrier for intracomplex electron transfer is large. Finally, the authors have briefly investigated how the cyt c peroxidase(II) ..-->.. cyt c(III) rate depends on the primary structure of cyt c(III). They find the reactivity order to be as follows: yeast > horse > tuna.« less

Lipoprotein profile, diet and body composition in athletes practicing mixed an anaerobic activities.

PubMed

Giada, F; Zuliani, G; Baldo-Enzi, G; Palmieri, E; Volpato, S; Vitale, E; Magnanini, P; Colozzi, A; Vecchiet, L; Fellin, R

1996-09-01

To compare lipoprotein profile, body composition and diet in a sample of athletes practicing mixed and anaerobic sports activities, and in a group of sedentary controls. Cross selectional study. Twenty professional soccer players (mixed trained), twenty body builders (anaerobic trained) and twenty sedentary subjects, all males and matched for age were studied. No significant differences in total serum cholesterol, triglycerides, HDL-C, LDL-C, apolipoprotein A-I, A-II, B, C-II, C-III, and E levels were found when the three groups were compared. Bioelectrical impendance analysis disclosed significantly lower body fat percentages in both groups of athletes, and increased fat free mass only in body builders. Daily calorie intake was higher, and alcohol intake was lower in the athletes, compared with controls. Body builders had lower carbohydrate, and higher protein and cholesterol intakes, while soccer players had a lower polyunsaturated to saturated fat ratio. None of the apolipoproteins examined was correlated with any body composition of diet parameters. No correlations between lipid parameters and anthropometric or dietary variables were found by multivariate analysis when the subjects were considered as a whole. Our data suggest that in healthy lean normolipemic males, the lipoprotein profile is not modified by mixed or anaerobic sport activities and the respective modifications in body composition and diet.

Conceptual Study of A Hetrodyne Receiver for the Origins Space Telescope

NASA Astrophysics Data System (ADS)

Wiedner, Martina

2018-01-01

The Origins Space Telescope (OST) is a mission concept of an extremely versatile observatory with 5 science instruments, of which the HEterodyne Receivers for OST (HERO) is one. HERO's main targets are high spectral resolution observations (Δλ/λ up to 107 or Δv = 0.03km/s) of water to follow its trail from cores to YSOs as well as H2O and HDO observations on comets. HERO will probe all neutral ISM phases using cooling lines ([CII], [OI]) and hydrides as probes of CO-dark H2 (CH, HF). HERO will reveal how molecular clouds and filaments form in the local ISM up to nearby galaxies. In order to achieve these observational goals, HERO will cover an extremely wide frequency range from 468 to 2700 GHz and a window around the OI line at 4563 to 4752GHz. It will consist of very large focal plane arrays of 128 pixels between 900 - 2700 GHz and at 4.7 THz, and 32 pixels for the 468 to 900 GHz range. The instrument is exploiting Herschel/HIFI heritage. HERO's large arrays require low dissipation and low power components. The HERO concept makes use of the latest cryogenic SiGe amplifier technology, as well as CMOS technology for the backends with 2 orders of magnitude lower power.

Health disparities among wage workers driven by employment instability in the Republic of Korea.

PubMed

Jung, Minsoo

2013-01-01

Even though labor market flexibility continues to be a source of grave concern in terms of employment instability, as evidenced by temporary employment, only a few longitudinal studies have examined the effects of employment instability on the health status of wage workers. Against this backdrop, this study assesses the manner in which changes in employment type affect the health status of wage workers. The data originate from the Korean Labor and Income Panel Study's health-related surveys for the first through fourth years (n = 1,789; 1998 to 2001). This study estimates potential damage to self-rated health through the application of a generalized estimating equation, according to specific levels of employment instability. While controlling for age, socioeconomic position, marital status, health behavior, and access to health care, the study analysis confirms that changes in employment type exert significant and adverse effects on health status for a given year (OR = 1.47; 95% CII 1.10-1.96), to an extent comparable to the marked effects of smoking on human health (OR = 1.47; 95% CI 1.05-2.04). Given the global prevalence of labor flexibility, policy interventions must be implemented if employment instability triggers broad discrepancies not only in social standing, wage, and welfare benefits, but also in health status.

Can Network Linkage Effects Determine Return? Evidence from Chinese Stock Market

PubMed Central

Qiao, Haishu; Xia, Yue; Li, Ying

2016-01-01

This study used the dynamic conditional correlations (DCC) method to identify the linkage effects of Chinese stock market, and further detected the influence of network linkage effects on magnitude of security returns across different industries. Applying two physics-derived techniques, the minimum spanning tree and the hierarchical tree, we analyzed the stock interdependence within the network of the China Securities Index (CSI) industry index basket. We observed that that obvious linkage effects existed among stock networks. CII and CCE, CAG and ITH as well as COU, CHA and REI were confirmed as the core nodes in the three different networks respectively. We also investigated the stability of linkage effects by estimating the mean correlations and mean distances, as well as the normalized tree length of these indices. In addition, using the GMM model approach, we found inter-node influence within the stock network had a pronounced effect on stock returns. Our results generally suggested that there appeared to be greater clustering effect among the indexes belonging to related industrial sectors than those of diverse sectors, and network comovement was significantly affected by impactive financial events in the reality. Besides, stocks that were more central within the network of stock market usually had higher returns for compensation because they endured greater exposure to correlation risk. PMID:27257816

Rotational modulation of hydrogen Lyman alpha flux from 44ii Bootis

NASA Technical Reports Server (NTRS)

Vilhu, O.; Neff, J. E.; Rahunen, T.

1988-01-01

Observations with IUE that cover the entire 6.4 hr orbital cycle of the late-type contact binary 44i Bootis are presented. Intrinsic stellar hydrogen Lyman alpha emission flux was determined from low-resolution IUE spectra, compensating for geocoronal emission and for interstellar absorption. The variation of the stellar Lyman alpha emission flux correlates well with the variation of the C II and C IV emission fluxes, and shows orbital modulation in phase with the visual light curve. The ratio of Lyman alpha to CII flux (15 to 20) is similar to that observed in solar active regions. Hydrogen Lyman alpha emission is thus one of the most important cooling channels in the outer atmosphere of 44i Boo. A high-resolution spectrum of the Lyman alpha line was obtained between orbital phases 0.0 and 0.6. The integrated flux in the observed high-resolution Lyman alpha profile is consistent with the fluxes determined using low-resolution spectra, and the composite profile indicates that both components of this binary have equally active chromospheres and transition regions. The uncertainty in the interstellar hydrogen column density cannot mimic the observed variation in the integrated Lyman alpha flux, because the stellar line is very much broader than the interstellar absorption.

Increased serum cholesterol esterification rates predict coronary heart disease and sudden death in a general population.

PubMed

Tanaka, Shin-ichiro; Yasuda, Tomoyuki; Ishida, Tatsuro; Fujioka, Yoshio; Tsujino, Takeshi; Miki, Tetsuo; Hirata, Ken-ichi

2013-05-01

Lecithin:cholesterol acyltransferase (LCAT) is thought to be important in reverse cholesterol transport. However, its association with coronary heart disease (CHD) and sudden death is controversial. We prospectively studied 1927 individuals from the general population. Serum concentrations of apolipoprotein A-I, A-II, B, C-II, C-III, E, and LCAT activity measured as a serum cholesterol esterification rate were evaluated. We documented 61 events of CHD and sudden death during 10.9 years of follow-up. After adjustment for age and sex, LCAT activity was significantly associated with the risk of CHD and sudden death (hazard ratio, 3.02; 95% confidence interval, 1.49-6.12; P=0.002). In multivariate analysis adjusted for age, sex, current smoking status, history of diabetes mellitus, body mass index, systolic blood pressure, serum total cholesterol, and serum high-density lipoprotein cholesterol concentrations, the hazard ratio of LCAT activity for the risk of CHD and sudden death remained significant (hazard ratio, 3.07; 95% confidence interval, 1.35-7.01; P=0.008). However, when it was analyzed for men and women separately, this association remained significant only in women. Increased LCAT activity measured as a serum cholesterol esterification rate was a risk for CHD and sudden death in a Japanese general population.

The Genesis Project: Science Cases for a Large Submm Telescope

NASA Astrophysics Data System (ADS)

Schneider, Nicola

2018-01-01

The formation of stars is intimately linked to the structure and evolution of molecular clouds in the interstellar medium. In the context of the ANR/DFG project GENESIS (GENeration and Evolution of Structures in the Ism, http://www.astro.uni-koeln.de/node/965), we explore this link with a new approach by combining far-infrared maps and surveys of dust (Herschel) and cooling lines (CII, CI, CO, OI with SOFIA), with molecular line maps. Dedicated analysis tools are used to characterise molecular cloud structure, and we explore the coupling of turbulence with heating- and cooling processes. The project gathers a large observational data set, from molecular line maps at (sub)-mm wavelengths from ground-based telescopes (e.g. IRAM) up to high-frequency airborne spectroscopic and continuum observations (SOFIA). Nevertheless, we identified the need for a large single-dish submm telescope, operating in the southern hemisphere at high frequencies. Only such an instrument is able to observe important ISM cooling lines, like the CI lines at 490 and 810 GHz or high-J CO lines, shock tracers, or probes of turbulence dissipation with high angular resolution in Galactic and extragalactic sources. We will discuss possible science cases and demonstrate how those are addressed within GENESIS, and the science done with the new 6m Cologne-Cornell CCAT-prime submm telescope.

Osteoarticular Expression of Musashi-1 in an Experimental Model of Arthritis

PubMed Central

O'Valle, Francisco; Peregrina, Magdalena; Crespo-Lora, Vicente; Galindo-Moreno, Pablo; Roman, Maria; Aneiros-Fernandez, Jose; Aguilar, David; Gonzalez-Rey, Elena; Delgado, Mario; Hernandez-Cortes, Pedro

2015-01-01

Background. Collagen-induced arthritis (CIA), a murine experimental disease model induced by immunization with type II collagen (CII), is used to evaluate novel therapeutic strategies for rheumatoid arthritis. Adult stem cell marker Musashi-1 (Msi1) plays an important role in regulating the maintenance and differentiation of stem/precursor cells. The objectives of this investigation were to perform a morphological study of the experimental CIA model, evaluate the effect of TNFα-blocker (etanercept) treatment, and determine the immunohistochemical expression of Msi1 protein. Methods. CIA was induced in 50 male DBA1/J mice for analyses of tissue and serum cytokine; clinical and morphological lesions in limbs; and immunohistochemical expression of Msi1. Results. Clinically, TNFα-blocker treatment attenuated CIA on day 32 after immunization (P < 0.001). Msi1 protein expression was significantly higher in joints damaged by CIA than in those with no lesions (P < 0.0001) and was related to the severity of the lesions (Spearman's rho = 0.775, P = 0.0001). Conclusions. Treatment with etanercept attenuates osteoarticular lesions in the murine CIA model. Osteoarticular expression of Msi1 protein is increased in joints with CIA-induced lesion and absent in nonlesioned joints, suggesting that this protein is expressed when the lesion is produced in order to favor tissue repair. PMID:26064941

Spectroscopic imaging of limiter heat and particle fluxes and the resulting impurity sources during Wendelstein 7-X startup plasmas.

PubMed

Stephey, L; Wurden, G A; Schmitz, O; Frerichs, H; Effenberg, F; Biedermann, C; Harris, J; König, R; Kornejew, P; Krychowiak, M; Unterberg, E A

2016-11-01

A combined IR and visible camera system [G. A. Wurden et al., "A high resolution IR/visible imaging system for the W7-X limiter," Rev. Sci. Instrum. (these proceedings)] and a filterscope system [R. J. Colchin et al., Rev. Sci. Instrum. 74, 2068 (2003)] were implemented together to obtain spectroscopic data of limiter and first wall recycling and impurity sources during Wendelstein 7-X startup plasmas. Both systems together provided excellent temporal and spatial spectroscopic resolution of limiter 3. Narrowband interference filters in front of the camera yielded C-III and H α photon flux, and the filterscope system provided H α , H β , He-I, He-II, C-II, and visible bremsstrahlung data. The filterscopes made additional measurements of several points on the W7-X vacuum vessel to yield wall recycling fluxes. The resulting photon flux from both the visible camera and filterscopes can then be compared to an EMC3-EIRENE synthetic diagnostic [H. Frerichs et al., "Synthetic plasma edge diagnostics for EMC3-EIRENE, highlighted for Wendelstein 7-X," Rev. Sci. Instrum. (these proceedings)] to infer both a limiter particle flux and wall particle flux, both of which will ultimately be used to infer the complete particle balance and particle confinement time τ P .

Can Network Linkage Effects Determine Return? Evidence from Chinese Stock Market.

PubMed

Qiao, Haishu; Xia, Yue; Li, Ying

2016-01-01

This study used the dynamic conditional correlations (DCC) method to identify the linkage effects of Chinese stock market, and further detected the influence of network linkage effects on magnitude of security returns across different industries. Applying two physics-derived techniques, the minimum spanning tree and the hierarchical tree, we analyzed the stock interdependence within the network of the China Securities Index (CSI) industry index basket. We observed that that obvious linkage effects existed among stock networks. CII and CCE, CAG and ITH as well as COU, CHA and REI were confirmed as the core nodes in the three different networks respectively. We also investigated the stability of linkage effects by estimating the mean correlations and mean distances, as well as the normalized tree length of these indices. In addition, using the GMM model approach, we found inter-node influence within the stock network had a pronounced effect on stock returns. Our results generally suggested that there appeared to be greater clustering effect among the indexes belonging to related industrial sectors than those of diverse sectors, and network comovement was significantly affected by impactive financial events in the reality. Besides, stocks that were more central within the network of stock market usually had higher returns for compensation because they endured greater exposure to correlation risk.

GOT C+ Survey of Transition Clouds in the Inner Galaxy

NASA Astrophysics Data System (ADS)

Velusamy, Thangasamy; Langer, W. D.; Pineda, J. L.; Goldsmith, P. F.; Li, D.; Yorke, H. W.

2010-05-01

To understand star formation and the lifecycle of the interstellar gas we need detailed information about the transition of diffuse atomic to molecular clouds. The C+ line at 1.9 THz traces a so-far poorly studied stage in cloud evolution - the transitional clouds going from atomic HI to molecular H2 The transition cloud phase, which is difficult to observe in HI and CO alone, may be best characterized via CII emission or absorption. Here we present the first results on transition clouds along a few representative lines of sight in the inner Galaxy from longitude 325 degrees to 10 degrees, observed under the GOT C+ program, a HIFI Herschel Key Project to study the diffuse ISM. We can separate out the different ISM components along each line of sight by comparisons of the high spectral resolution ( 1 km/s) and high sensitivity (rms 0.1 K to 0.2 K) HIFI data on C+ with HI, 12CO, and 13CO spectra. These observations are being carried out with the Herschel Space Observatory. This research was conducted at the Jet Propulsion Laboratory, California Institute of Technology under contract with the National Aeronautics and Space Administration. JLP is supported under the NASA Postdoctoral Program at JPL, Caltech, administered by Oak Ridge Associated Universities through a contract with NASA.

Targeting the Replication Initiator of the Second Vibrio Chromosome: Towards Generation of Vibrionaceae-Specific Antimicrobial Agents

PubMed Central

Yamaichi, Yoshiharu; Duigou, Stéphane; Shakhnovich, Elizabeth A.; Waldor, Matthew K.

2009-01-01

The Vibrionaceae is comprised of numerous aquatic species and includes several human pathogens, such as Vibrio cholerae, the cause of cholera. All organisms in this family have two chromosomes, and replication of the smaller one depends on rctB, a gene that is restricted to the Vibrionaceae. Given the increasing prevalence of multi-drug resistance in pathogenic vibrios, there is a need for new targets and drugs to combat these pathogens. Here, we carried out a high throughput cell-based screen to find small molecule inhibitors of RctB. We identified a compound that blocked growth of an E. coli strain bearing an rctB-dependent plasmid but did not influence growth of E. coli lacking this plasmid. This compound, designated vibrepin, had potent cidal activity against V. cholerae and inhibited the growth of all vibrio species tested. Vibrepin blocked RctB oriCII unwinding, apparently by promoting formation of large non-functional RctB complexes. Although vibrepin also appears to have targets other than RctB, our findings suggest that RctB is an attractive target for generation of novel antibiotics that only block growth of vibrios. Vibrio-specific agents, unlike antibiotics currently used in clinical practice, will not engender resistance in the normal human flora or in non-vibrio environmental microorganisms. PMID:19936046

ZINGRS: Understanding Hot DOGs via the resolved radio continuum of W2246-0526

NASA Astrophysics Data System (ADS)

Hershey, Deborah; Ferkinhoff, Carl; Higdon, Sarah; Higdon, James L.; Tidwell, Hannah; Brisbin, Drew; Lamarche, Cody; Vishwas, Amit; Nikola, Thomas; Stacey, Gordon J.

2018-06-01

We present new high-resolution (~0.5”) radio-continuum images of the high-redshift galaxy W2246-0526 obtained with the Jansky Very Large Array. W2246 at z~4.6 is a hot dust obscured galaxy (Hot DOG) that have extreme luminosities, LIR > 1014 L⊙ produced by hot T~450 K dust. It hosts both an active galactic nucleus and significant star formation. Having observed the [OIII] 88 micron line from W2246 with our ZEUS spectrometer, the source is part of our ZEUS INvestigate Galaxy Reference Sample (ZINGRS). The radio images are initial observations from the ZINGRS Radio Survey where we observe the free-free and non-thermal emissions of high-z galaxies. Combining the radio emission with ALMA and ZEUS observations of the [CII] 158 micron, [OIII] 88 micron and [NII] 122 micron lines we probe the metallicity, age of stellar population, and ionization parameter. For W2246 we pay special attention to gradients of the stellar age and metallicity to determine the impact of the AGN on the host galaxy. Our work here is our initial analysis. When complete for all of ZINGRS ours findings will improve our understanding of early galaxies, including helping to explain Hot DOGs like W2246.

Mapping Gas Flows from the Disk to the Circumgalactic Medium

NASA Astrophysics Data System (ADS)

Zheng, Yong

2017-08-01

The feedback efficiency in galaxies remains a crucial component in simulations that is not well constrained by observations. To understand how effectively feedback drives metals into the circumgalactic medium (CGM), we propose to map the metal flows from the disk to the CGM of the nearby dwarf irregular galaxy IC 1613. This will be the first spatial and kinematic map of gas flows from the disk to the halo of a dwarf galaxy. In archival COS spectra of two IC 1613 stars we detect blue-shifted SiII, CII, and SiIV absorption lines, indicative of the existence of multiphase outflows from the disk. We propose to observe two more UV bright stars in IC 1613's disk to assess the covering fraction and strength of the outflow in relation to the galaxy's resolved star formation. We will also observe three QSO sightlines at 0.1, 0.3, and 0.5 Rvir to measure the ionization profile of the gas and the extent of the outflows. We will relate our measurements to the detailed observed star formation history of IC 1613 to directly determine the mass loading factor and feedback efficiency. The proposal will provide critical information on how galaxies evolve and how metals circulate between the disk and the CGM.

Synergistic suppression of autoimmune arthritis through concurrent treatment with tolerogenic DC and MSC

PubMed Central

Li, Rong; Zhang, Yujuan; Zheng, Xiufen; Peng, Shanshan; Yuan, Keng; Zhang, Xusheng; Min, Weiping

2017-01-01

Rheumatoid arthritis (RA) is an autoimmune disease characterized by progressive immune-mediated joint deterioration. Current treatments are not antigen specific and are associated with various adverse. We have previously demonstrated that tolerogenic dendritic cells (Tol-DC) are potent antigen-specific immune regulators, which hold great promise in immunotherapy of autoimmune diseases. In this study, we aimed to develop new immunotherapy by combining Tol-DC and mesenchymal stem cells (MSC). We demonstrated that RelB gene silencing resulted in generation of Tol-DC that suppressed T cell responses and selectively promoted Treg generation. The combination of MSC synergized the tolerogenic capacity of Tol-DC in inhibition of T cell responses. In murine collagen-induced arthritis (CIA) model, we demonstrated that progression of arthritis was inhibited with administration of RelB gene-silenced Tol-DC or MSC. This therapeutic effect was remarkably enhanced with concurrent treatment of combination Tol-DC and MSC as demonstrated by improved clinical symptoms, decreased clinical scores and attenuated joint damage. These therapeutic effects were associated with suppression of CII-specific T cell responses, polarization of Th and inhibition of proinflammatory cytokines, and reduced cartilage degeneration. This study for the first time demonstrates a new approach to treat autoimmune inflammatory joint disease with concurrent treatment of RelB gene-silenced Tol-DC and MSC. PMID:28230210

[Analysis of optimal plan of multiple acupuncture manipulations for shoulder pain after stroke at different stages].

PubMed

Chen, Dachun; Gao, Jianyu; Chen, Lu; Hao, Zhuanzhuan; Fan, Gangqi

2015-12-01

To observe the effects between acupuncture combined with rehabilitation and simple rehabilitation for shoulder pain after stroke, and to select the best plan of acupuncture manipulations at different stages by orthogonal design. Ninety patients were treated with comprehensive rehabilitation, and nine cases without acupuncture were arranged into a control group. Eighty-one patients of orthogonal design were applied by acupuncture with the same acupoints and course. The VAS score and its weighted value were regarded as the observation indices,and the effects between the acupuncture group and the control group were compared. The optimal plans of acupuncture manipulations of the early stage and the later stage were chosen after the first course treatment and the third course treatment separately. The acupuncture depth (factor A:A: shallow depth less than 25 mm, A(II): modest depth 25-40 mm, A(III): deep depth 40-50 mm), the acupuncture angle (factor B:B(I): perpendicular insertion, B(II): horizontal insertion, B(III): oblique insertion), needle manipulated frequency (factor C: C(I): zero time, C(II): one time, C(III): three times) and needle retained time(factor D:D(I):20 min, D(II): 30 min, D(III): 60 min) were studied. The differences among all factors and the diversity among major factors at different stages were analyzed. (1) Acupuncture combined with rehabilitation at the early and the later stage acquired better improvement than simple rehabilitation (all P < 0.01). (2) The optimal acupuncture manipulation plan at the early stage was A(III) B(III) C(I) D(I), which was deep acupuncture and oblique insertion for 20 min with zero-time manipulation; the optimal acupuncture manipulation plan at the later stage was A(III) B(III) C(III) D(I), which was deep acupuncture and oblique insertion for 20 min with three-time manipulation. (3) There was significance for acupuncture depth and angle at the early stage (both P < 0.01) and there was significance for insertion depth, acupuncture angle and manipulating frequency at the later stage (all P < 0.05). (4) At the early stage, the insertion depth was statistically significant between A(I) and A(II), A(I) and A(III), A(II) and A(III) (P < 0.05, P < 0.01), and the statistical significance was existed between B(I) and B(III) (P < 0.01). At the later stage, the insertion depth was statistically significant between A(I) and A(III), A(III) and A(II), A(I) and A(II) (P < 0.05, P < 0.01), and the statistical significance was existed between C(I) and C(III), C(II) and C(III) (P < 0.05). Acupuncture combined with rehabilitation acquire apparent effect for shoulder pain after stroke. At the early stage,the optimal plan is deep and oblique insertion for 20 min with zero-time manipulation. At the later stage, the best plan is deep and oblique insertion for 20 min with 3-time manipulation.

Mitochondrial Biogenesis in Diverse Cauliflower Cultivars under Mild and Severe Drought. Impaired Coordination of Selected Transcript and Proteomic Responses, and Regulation of Various Multifunctional Proteins

PubMed Central

Rurek, Michał; Czołpińska, Magdalena; Staszak, Aleksandra Maria; Nowak, Witold; Krzesiński, Włodzimierz; Spiżewski, Tomasz

2018-01-01

Mitochondrial responses under drought within Brassica genus are poorly understood. The main goal of this study was to investigate mitochondrial biogenesis of three cauliflower (Brassica oleracea var. botrytis) cultivars with varying drought tolerance. Diverse quantitative changes (decreases in abundance mostly) in the mitochondrial proteome were assessed by two-dimensional gel electrophoresis (2D PAGE) coupled with liquid chromatography-tandem mass spectrometry (LC-MS/MS). Respiratory (e.g., complex II, IV (CII, CIV) and ATP synthase subunits), transporter (including diverse porin isoforms) and matrix multifunctional proteins (e.g., components of RNA editing machinery) were diversely affected in their abundance under two drought levels. Western immunoassays showed additional cultivar-specific responses of selected mitochondrial proteins. Dehydrin-related tryptic peptides (found in several 2D spots) immunopositive with dehydrin-specific antisera highlighted the relevance of mitochondrial dehydrin-like proteins for the drought response. The abundance of selected mRNAs participating in drought response was also determined. We conclude that mitochondrial biogenesis was strongly, but diversely affected in various cauliflower cultivars, and associated with drought tolerance at the proteomic and functional levels. However, discussed alternative oxidase (AOX) regulation at the RNA and protein level were largely uncoordinated due to the altered availability of transcripts for translation, mRNA/ribosome interactions, and/or miRNA impact on transcript abundance and translation. PMID:29642585

Characterization of chemical sputtering using the Mark II DiMES porous plug injector in attached and semi-detached divertor plasmas of DIII-D

NASA Astrophysics Data System (ADS)

McLean, A. G.; Davis, J. W.; Stangeby, P. C.; Allen, S. L.; Boedo, J. A.; Bray, B. D.; Brezinsek, S.; Brooks, N. H.; Fenstermacher, M. E.; Groth, M.; Haasz, A. A.; Hollmann, E. M.; Isler, R. C.; Lasnier, C. J.; Mu, Y.; Petrie, T. W.; Rudakov, D. L.; Watkins, J. G.; West, W. P.; Whyte, D. G.; Wong, C. P. C.

2009-06-01

An improved, self-contained gas injection system for the divertor material evaluation system (DiMES) on DIII-D has been employed for in situ study of chemical erosion in the tokamak divertor environment. To minimize perturbation to local plasma, the Mark II porous plug injector (PPI) releases methane through a porous graphite surface at the outer strike point at a rate precisely controlled by a micro-orifice flow restrictor to be approximately equal as that predicted for intrinsic chemical sputtering. Effective photon efficiencies resulting from CH 4 are found to be 58 ± 12 in an attached divertor ( ne ˜ 1.5 × 10 13/cm 3, Te ˜ 25 eV, Tsurf ˜ 450 K), and 94 ± 20 in a semi-detached cold divertor ( ne ˜ 6.0 × 10 13/cm 3, Te ˜ 2-3 eV, Tsurf ˜ 350 K). These values are significantly more than previous measurements in similar plasma conditions, indicating the importance of the injection rate and local re-erosion for the integrity of this analysis. The contribution of chemical versus physical sputtering to the source of C + at the target is assessed through simultaneous measurement of CII line, and CD plus CH-band emissions during release of CH 4 from the PPI, then compared with that seen in intrinsic sputtering.

Small heat-shock proteins and leaf cooling capacity account for the unusual heat tolerance of the central spike leaves in Agave tequilana var. Weber.

PubMed

Luján, Rosario; Lledías, Fernando; Martínez, Luz María; Barreto, Rita; Cassab, Gladys I; Nieto-Sotelo, Jorge

2009-12-01

Agaves are perennial crassulacean acid metabolism (CAM) plants distributed in tropical and subtropical arid environments, features that are attractive for studying the heat-shock response. In agaves, the stress response can be analysed easily during leaf development, as they form a spirally shaped rosette, having the meristem surrounded by folded leaves in the centre (spike) and the unfolded and more mature leaves in the periphery. Here, we report that the spike of Agave tequilana is the most thermotolerant part of the rosette withstanding shocks of up to 55 degrees C. This finding was inconsistent with the patterns of heat-shock protein (Hsp) gene expression, as maximal accumulation of Hsp transcripts was at 44 degrees C in all sectors (spike, inner, middle and outer). However, levels of small HSP (sHSP)-CI and sHSP-CII proteins were conspicuously higher in spike leaves at all temperatures correlating with their thermotolerance. In addition, spike leaves showed a higher stomatal density and abated more efficiently their temperature several degrees below that of air. We propose that the greater capacity for leaf cooling during the day in response to heat stress, and the elevated levels of sHSPs, constitute part of a set of strategies that protect the SAM and folded leaves of A. tequilana from high temperatures.

Interstellar Deuterium, Nitrogen and Oxygen Towards HZ43A: Results from the Far Ultraviolet Spectroscopic Explorer (FUSE) Mission

NASA Technical Reports Server (NTRS)

Kruk, J. W.; Howk, J. C.; Andre, M.; Moos, H. W.; Oegerle, William R.; Oliveira, C.; Sembach, K. R.; Chayer, P.; Linsky, J. L.; Wood, B. E.

2002-01-01

We present an analysis of interstellar absorption along the line of sight to the nearby white dwarf star HZ43A. The distance to this star is 68+/-13 pc, and the line of sight extends toward the north Galactic pole. Column densities of O(I), N(I), and N(II) were derived from spectra obtained by the Far Ultraviolet Spectroscopic Explorer (FUSE), the column density of D(I) was derived from a combination of our FUSE spectra and an archival HST GARDENS spectrum, and the column density of H(I) was derived from a combination of the GARDENS spectrum and values derived from EUVE data obtained from the literature. We find the following abundance ratios (with 2 sigma uncertainties): D(I)/H(I)=(1.66+/-0.28)x10(exp -5), O(I)/H(I)=(3.63+/-0.84)x10(exp -4), and N(I)/H(I)=(3.80+/-0.74)x10(exp -5). The N(II) column density was slightly greater than that of N(I), indicating that ionization corrections are important when deriving nitrogen abundances. Other interstellar species detected along the line of sight were C(II), C(III), O(VI), Si(II), Ar(I), Mg(II) and Fe(II); an upper limit was determined for N(III). No elements other than H(I) were detected in the stellar photosphere.

Measurement of limiter particle fluxes and carbon erosion in the helical scrape-off layer of startup plasmas at W7-X

NASA Astrophysics Data System (ADS)

Winters, V.; Biedermann, C.; Brezinsek, S.; Effenberg, F.; Frerichs, H.; Harris, J.; Schmitz, O.; Stephey, L.; Unterberg, E.; Wurden, G.; W7-X Team

2016-10-01

Measurement of the 2D recycling flux and calculations of the carbon erosion from the limiter in startup plasmas of W7-X provides a first insight into neutral particle release and impurity inflow into the helical scrape-off layer. H-alpha, C-II (514.5nm) and C-III (465.1nm) line emissions were collected with filter-scopes and a visible camera aimed at limiter 3 of W7-X. Local plasma parameters are considered to estimate physical and chemical sputtering contributions. The analytical model for chemical sputtering by Roth is used to convert the measured particle flux into a chemically eroded C flux. The particle flux as well as the extracted C erosion pattern deviates from the measured heat flux distribution and also from the predicted particle flux distribution from EMC3-EIRENE. Candidates to resolve this discrepancy are measurement uncertainties and physics related (e.g. asymmetry in the last closed flux surface position). Post-mortem analysis of the limiter will be taken into account and compared to these in-situ measurements to gather first detailed insight on the net C erosion distribution and the impurity sourcing into the helical scrape-off layer. This work was funded by DE-SC0014210, DE-AC5206NA25396, DE-AC05-00OR22725 and by EUROfusion under Grant No 633053.

Dermal fibroblasts from long-lived Ames dwarf mice maintain their in vivo resistance to mitochondrial generated reactive oxygen species (ROS)

PubMed Central

Hsieh, Ching-Chyuan; Papaconstantinou, John

2009-01-01

Activation of p38 MAPK by ROS involves dissociation of an inactive, reduced thioredoxin-ASK1 complex [(SH)2Trx-ASK1]. Release of ASK1 activates its kinase activity thus stimulating the p38 MAPK pathway. The level of p38 MAPK activity is, therefore, regulated by the balance of free vs. bound ASK1. Longevity of Ames dwarf mice is attributed to their resistance to oxidative stress. The levels of (SH)2 Trx-ASK1 are more abundant in young and old dwarf mice compared to their age-matched controls suggesting that the levels of this complex may play a role in their resistance to oxidative stress. In these studies we demonstrate that dermal fibroblasts from these long-lived mice exhibit (a) higher levels of (SH)2Trx-ASK1 that correlate with their resistance to ROS generated by inhibitors of electron transport chain complexes CI (rotenone), CII (3-nitropropionic acid), CIII, (antimycin A), and H2O2-mediated activation of p38 MAPK, and (b) maintain their in vivo resistance to ROS generated by 3NPA. We propose that elevated levels of (SH)2Trx-ASK1 play a role in conferring resistance to mitochondrial generated oxidative stress and decreased endogenous ROS which are characteristics of longevity determination. PMID:20157567

UV Spectroscopy of Star-Grazing Comets Within the 49 Ceti Debris Disk

NASA Technical Reports Server (NTRS)

Miles, Brittany E.; Roberge, Aki; Welsh, Barry

2016-01-01

We present the analysis of time-variable Doppler-shifted absorption features in far-UV spectra of the unusual 49 Ceti debris disk. This nearly edge-on disk is one of the brightest known and is one of the very few containing detectable amounts of circumstellar (CS) gas as well as dust. In our two visits of Hubble Space Telescope STIS spectra, variable absorption features are seen on the wings of lines arising from CII and CIV but not for any of the other CS absorption lines. Similar variable features have long been seen in spectra of the well-studied Beta Pictoris debris disk and attributed to the transits of star-grazing comets. We calculated the velocity ranges and apparent column densities of the 49 Cet variable gas, which appears to have been moving at velocities of tens to hundreds of kms(-1) relative to the central star. The velocities in the redshifted variable event seen in the second visit show that the maximum distances of the in falling gas at the time of transit were about 0.050.2 au from the central star. A preliminary attempt at a composition analysis of the redshifted event suggests that the C/O ratio in the in falling gas is super-solar, as it is in the bulk of the stable disk gas.

Curcumin inhibits interferon-γ signaling in colonic epithelial cells

PubMed Central

Midura-Kiela, Monica T.; Radhakrishnan, Vijayababu M.; Larmonier, Claire B.; Laubitz, Daniel; Ghishan, Fayez K.

2012-01-01

Curcumin (diferulolylmethane) is an anti-inflammatory phenolic compound found effective in preclinical models of inflammatory bowel diseases (IBD) and in ulcerative colitis patients. Pharmacokinetics of curcumin and its poor systemic bioavailability suggest that it targets preferentially intestinal epithelial cells. The intestinal epithelium, an essential component of the gut innate defense mechanisms, is profoundly affected by IFN-γ, which can disrupt the epithelial barrier function, prevent epithelial cell migration and wound healing, and prime epithelial cells to express major histocompatibility complex class II (MHC-II) molecules and to serve as nonprofessional antigen-presenting cells. In this report we demonstrate that curcumin inhibits IFN-γ signaling in human and mouse colonocytes. Curcumin inhibited IFN-γ-induced gene transcription, including CII-TA, MHC-II genes (HLA-DRα, HLA-DPα1, HLA-DRβ1), and T cell chemokines (CXCL9, 10, and 11). Acutely, curcumin inhibited Stat1 binding to the GAS cis-element, prevented Stat1 nuclear translocation, and reduced Jak1 phosphorylation and phosphorylation of Stat1 at Tyr701. Longer exposure to curcumin led to endocytic internalization of IFNγRα followed by lysosomal fusion and degradation. In summary, curcumin acts as an IFN-γ signaling inhibitor in colonocytes with biphasic mechanisms of action, a phenomenon that may partially account for the beneficial effects of curcumin in experimental colitis and in human IBD. PMID:22038826

Assessment of the mutagenic potential of hexavalent chromium in the duodenum of big blue® rats.

PubMed

Thompson, Chad M; Young, Robert R; Dinesdurage, Harshini; Suh, Mina; Harris, Mark A; Rohr, Annette C; Proctor, Deborah M

2017-09-01

A cancer bioassay on hexavalent chromium Cr(VI) in drinking water reported increased incidences of duodenal tumors in B6C3F1 mice at exposures of 30-180ppm, and oral cavity tumors in F344 rats at 180ppm. A subsequent transgenic rodent (TGR) in vivo mutation assay in Big Blue® TgF344 rats found that exposure to 180ppm Cr(VI) in drinking water for 28days did not increase cII transgene mutant frequency (MF) in the oral cavity (Thompson et al., 2015). Herein, we extend our analysis to the duodenum of these same TgF344 rats. At study termination, duodenum chromium levels were below either the limit of detection or quantification in control rats, but were 24.6±3.8μg/g in Cr(VI)-treated rats. The MF in control (23.2×10 -6 ) and Cr(VI)-treated rats (22.7×10 -6 ) were nearly identical. In contrast, the MF in the duodenum of rats exposed to 1-ethyl-1-nitrosourea for six days (study days 1, 2, 3, 12, 19, 26) increased 24-fold to 557×10 -6 . These findings indicate that mutagenicity is unlikely an early initiating event in Cr(VI)-induced intestinal carcinogenesis. Copyright © 2017 Elsevier Inc. All rights reserved.

Rapid repair of UVA-induced oxidized purines and persistence of UVB-induced dipyrimidine lesions determine the mutagenicity of sunlight in mouse cells

PubMed Central

Besaratinia, Ahmad; Kim, Sang-in; Pfeifer, Gerd P.

2009-01-01

Despite the predominance of UVA relative to UVB in terrestrial sunlight, solar mutagenesis in humans and rodents is characterized by mutations specific for UVB. We have investigated the kinetics of repair of UVA- and UVB-induced DNA lesions in relation to mutagenicity in transgenic mouse fibroblasts irradiated with equilethal doses of UVA and UVB in comparison to SSL. We have also analyzed mutagenesis-derived carcinogenesis in sunlight-associated human skin cancers by compiling the published data on mutation types found in crucial genes in non-melanoma and melanoma skin cancers. Here, we demonstrate a resistance to repair of UVB-induced CPDs together with rapid removal of UVA-induced oxidized purines in the genome overall and in the cII transgene of SSL-irradiated cells. The spectra of mutation induced by both UVB- and SSL-irradiation in this experimental system are characterized by significant increases in relative frequency of C to T transitions at dipyrimidines, which are the established signature mutation of CPDs. This type of mutation is also the predominant mutation found in human non-melanoma and melanoma tumor samples in the TP53, CDKN2, PTCH, and protein kinase genes. The prevailing role of UVB over UVA in solar mutagenesis in our test system can be ascribed to different kinetics of repair for lesions induced by the respective UV-irradiation. PMID:18326785

Spectroscopic imaging of limiter heat and particle fluxes and the resulting impurity sources during Wendelstein 7-X startup plasmas

DOE PAGES

Stephey, L.; Wurden, G. A.; Schmitz, O.; ...

2016-08-08

A combined IR and visible camera system [G. A. Wurden et al., “A high resolution IR/visible imaging system for the W7-X limiter,” Rev. Sci. Instrum. (these proceedings)] and a filterscope system [R. J. Colchin et al., Rev. Sci. Instrum. 74, 2068 (2003)] were implemented together to obtain spectroscopic data of limiter and first wall recycling and impurity sources during Wendelstein 7-X startup plasmas. Both systems together provided excellent temporal and spatial spectroscopic resolution of limiter 3. Narrowband interference filters in front of the camera yielded C-III and Hα photon flux, and the filterscope system provided H α, H β, He-I,more » He-II, C-II, and visible bremsstrahlung data. The filterscopes made additional measurements of several points on the W7-X vacuum vessel to yield wall recycling fluxes. Finally, the resulting photon flux from both the visible camera and filterscopes can then be compared to an EMC3-EIRENE synthetic diagnostic [H. Frerichs et al., “Synthetic plasma edge diagnostics for EMC3-EIRENE, highlighted for Wendelstein 7-X,” Rev. Sci. Instrum. (these proceedings)] to infer both a limiter particle flux and wall particle flux, both of which will ultimately be used to infer the complete particle balance and particle confinement time τ P.« less

Direct targeting of human plasma for matrix-assisted laser desorption/ionization and analysis of plasma proteins by time of flight-mass spectrometry.

PubMed

Jin, Ya; Manabe, Takashi

2005-07-01

A method to analyze human plasma proteins without fractionation, directly applying a plasma-matrix mixture on the target plate of a matrix-assisted laser desorption/ionization-time of flight-mass spectrometer (MALDI-TOF-MS), has been described. Peaks of ionized plasma proteins could not be detected applying a mixture of an undiluted plasma sample and a matrix solution, but they appeared when the plasma was diluted before mixing with the matrix. Tenfold diluted plasma provided well-resolved protein peaks in the m/z range from 4000 to 30,000. The addition of a simple post-crystallization washing procedure performed on the target plate further improved the quality of mass spectra. We numbered 58 peaks in the range of 4-160 kDa and 32 out of which were assigned to the plasma protein species which have been reported. Especially high sensitivity and resolution were obtained in the region < 30 kDa, where multiple isoforms of apolipoprotein A-I, apolipoprotein A-II, apolipoprotein C-I, apolipoprotein C-II, apolipoprotein C-III, and transthyretin could be assigned. Various post-translational modifications are involved in the isoforms, e.g., proteolytic cleavage, glycosylation and chemical modifications. This method will become complementary with the present electrophoretic techniques, especially for the analysis of low-molecular-mass proteins.

Analysis of the role of the two flagella of Bradyrhizobium japonicum in competition for nodulation of soybean.

PubMed

Althabegoiti, Maria Julia; Covelli, Julieta M; Pérez-Giménez, Julieta; Quelas, Juan Ignacio; Mongiardini, Elías J; López, Maria Florencia; López-García, Silvina L; Lodeiro, Aníbal R

2011-06-01

Bradyrhizobium japonicum has two types of flagella. One has thin filaments consisting of the 33-kDa flagellins FliCI and FliCII (FliCI-II) and the other has thick filaments consisting of the 65-kDa flagellins FliC1, FliC2, FliC3, and FliC4 (FliC1-4). To investigate the roles of each flagellum in competition for nodulation, we obtained mutants deleted in fliCI-II and/or fliC1-4 in the genomic backgrounds of two derivatives from the reference strain USDA 110: the streptomycin-resistant derivative LP 3004 and its more motile derivative LP 3008. All mutations diminished swimming motility. When each mutant was co-inoculated with the parental strain on soybean plants cultivated in vermiculite either at field capacity or flooded, their competitiveness differed according to the flagellin altered. ΔfliCI-II mutants were more competitive, occupying 64-80% of the nodules, while ΔfliC1-4 mutants occupied 45-49% of the nodules. Occupation by the nonmotile double mutant decreased from 55% to 11% as the water content of the vermiculite increased from 85% to 95% field capacity to flooding. These results indicate that the influence of motility on competitiveness depended on the water status of the rooting substrate. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

Apolipoproteins C-II and C-III as nutritional markers unaffected by inflammation.

PubMed

Isshiki, Miwa; Hirayama, Satoshi; Ueno, Tsuyoshi; Ito, Masayuki; Furuta, Ayaka; Yano, Kouji; Yamatani, Kotoko; Sugihara, Masami; Idei, Mayumi; Miida, Takashi

2018-06-01

Rapid turnover proteins (RTPs), such as transthyretin (TTR), retinol binding protein (RBP), and transferrin (Tf), provide an accurate assessment of nutritional status but are susceptible to inflammation. Lipid-related markers, which have short half-lives in serum, may be better suited for nutritional assessment. We sought to identify sensitive nutritional markers unaffected by inflammation. Fasting serum samples were collected from 30 malnourished inpatients and 25 healthy volunteers. Malnourished inpatients were divided into 2 groups: a low-C-reactive protein (CRP) group (CRP < 20 mg/l, n = 15) and a high-CRP group (CRP ≥ 20 mg/l, n = 15). Lipid-related markers, traditional nutritional markers, RTPs, micronutrients, and ketone bodies were measured and compared among the groups. Apolipoprotein (Apo)C-II and ApoC-III concentrations were lower in malnourished inpatients than in the control group. There was no significant difference in ApoC-II and ApoC-III between the low- and high-CRP groups. Carnitine transporters and ketone bodies did not show a significant difference among the three groups. Albumin, TTR, RBP, and Tf concentrations were lowest in the high-CRP group, intermediate in the low-CRP group, and highest in the control group. These results indicate that ApoC-II and ApoC-III are appropriate nutritional biomarkers unaffected by inflammation. Copyright © 2018 Elsevier B.V. All rights reserved.

Modeling the optical radiation of the precataclysmic variable SDSS J212531-010745

NASA Astrophysics Data System (ADS)

Shimansky, V. V.; Borisov, N. V.; Nurtdinova, D. N.; Solovyeva, Yu. N.; Sakhibullin, N. A.; Spiridonova, O. I.

2015-03-01

Optical observations are analyzed to derive a set of basic parameters for the precataclysmic variable star SDSS J212531-010745, whose primary is a PG1159-type star. Spectroscopic and multiband photometric observations of the star were performed in 2008-2011 with the 6-m telescope and the Zeiss-1000 telescope of the Special Astrophysical Observatory. The shape of the binary's orbital light curves is nearly sinusoidal, with the amplitude increasing with wavelength from Δ m = 0.40 m in the B band to Δ m = 0.73 m in the R band. The spectra contain absorption lines of HeII and neutral atoms, along with HI, HeI, CII, MgII, FeII emission lines, whose intensity increases synchronously with the brightness of the system. The optical radiation from SDSS J212531-010745 has a composite nature, corresponding to a model for a pre-cataclysmic variable with strong reflection effects. Cross-correlation techniques are used to measure the radial velocities and derive the component masses. Numerical modeling of the binary's light curves, radial velocities, and spectra is performed, and a complete set of parameters determined. Considerable abundance anomalies (to 1 dex) were detected for the secondary. The primary's characteristics correspond to the evolutionary predictions for DAO dwarfs with masses M ≈ 0.5 M ⊙, and the secondary's characteristics to low-mass, main-sequence stars with the solar metallicity.

Crystalline structure analysis of cellulose treated with sodium hydroxide and carbon dioxide by means of X-ray diffraction and FTIR spectroscopy.

PubMed

Oh, Sang Youn; Yoo, Dong Il; Shin, Younsook; Kim, Hwan Chul; Kim, Hak Yong; Chung, Yong Sik; Park, Won Ho; Youk, Ji Ho

2005-10-31

Crystalline structures of cellulose (named as Cell 1), NaOH-treated cellulose (Cell 2), and subsequent CO2-treated cellulose (Cell 2-C) were analyzed by wide-angle X-ray diffraction and FTIR spectroscopy. Transformation from cellulose I to cellulose II was observed by X-ray diffraction for Cell 2 treated with 15-20 wt% NaOH. Subsequent treatment with CO2 also transformed the Cell 2-C treated with 5-10 wt% NaOH. Many of the FTIR bands including 2901, 1431, 1282, 1236, 1202, 1165, 1032, and 897 cm(-1) were shifted to higher wave number (by 2-13 cm(-1)). However, the bands at 3352, 1373, and 983 cm(-1) were shifted to lower wave number (by 3-95 cm(-1)). In contrast to the bands at 1337, 1114, and 1058 cm(-1), the absorbances measured at 1263, 993, 897, and 668 cm(-1) were increased. The FTIR spectra of hydrogen-bonded OH stretching vibrations at around 3352 cm(-1) were resolved into three bands for cellulose I and four bands for cellulose II, assuming that all the vibration modes follow Gaussian distribution. The bands of 1 (3518 cm(-1)), 2 (3349 cm(-1)), and 3 (3195 cm(-1)) were related to the sum of valence vibration of an H-bonded OH group and an intramolecular hydrogen bond of 2-OH ...O-6, intramolecular hydrogen bond of 3-OH...O-5 and the intermolecular hydrogen bond of 6-O...HO-3', respectively. Compared with the bands of cellulose I, a new band of 4 (3115 cm(-1)) related to intermolecular hydrogen bond of 2-OH...O-2' and/or intermolecular hydrogen bond of 6-OH...O-2' in cellulose II appeared. The crystallinity index (CI) was obtained by X-ray diffraction [CI(XD)] and FTIR spectroscopy [CI(IR)]. Including absorbance ratios such as A1431,1419/A897,894 and A1263/A1202,1200, the CI(IR) was evaluated by the absorbance ratios using all the characteristic absorbances of cellulose. The CI(XD) was calculated by the method of Jayme and Knolle. In addition, X-ray diffraction curves, with and without amorphous halo correction, were resolved into portions of cellulose I and cellulose II lattice. From the ratio of the peak area, that is, peak area of cellulose I (or cellulose II)/total peak area, CI(XD) were divided into CI(XD-CI) for cellulose I and CI(XD-CII) for cellulose II. The correlation between CI(XD-CI) (or CI(XD-CII)) and CI(IR) was evaluated, and the bands at 2901 (2802), 1373 (1376), 897 (894), 1263, 668 cm(-1) were good for the internal standard (or denominator) of CI(IR), which increased the correlation coefficient. Both fraction of the absorbances showing peak shift were assigned as the alternate components of CI(IR). The crystallite size was decreased to constant value for Cell 2 treated at >or= 15 wt% NaOH. The crystallite size of Cell 2-C (cellulose II) was smaller than that of Cell 2 (cellulose I) treated at 5-10 wt% NaOH. But the crystallite size of Cell 2-C (cellulose II) was larger than that of Cell 2 (cellulose II) treated at 15-20 wt% NaOH.

Herschel GASPS spectral observations of T Tauri stars in Taurus. Unraveling far-infrared line emission from jets and discs

NASA Astrophysics Data System (ADS)

Alonso-Martínez, M.; Riviere-Marichalar, P.; Meeus, G.; Kamp, I.; Fang, M.; Podio, L.; Dent, W. R. F.; Eiroa, C.

2017-07-01

Context. At early stages of stellar evolution young stars show powerful jets and/or outflows that interact with protoplanetary discs and their surroundings. Despite the scarce knowledge about the interaction of jets and/or outflows with discs, spectroscopic studies based on Herschel and ISO data suggests that gas shocked by jets and/or outflows can be traced by far-IR (FIR) emission in certain sources. Aims: We want to provide a consistent catalogue of selected atomic ([OI] and [CII]) and molecular (CO, H2O, and OH) line fluxes observed in the FIR, separate and characterize the contribution from the jet and the disc to the observed line emission, and place the observations in an evolutionary picture. Methods: The atomic and molecular FIR (60-190 μm) line emission of protoplanetary discs around 76 T Tauri stars located in Taurus are analysed. The observations were carried out within the Herschel key programme Gas in Protoplanetary Systems (GASPS). The spectra were obtained with the Photodetector Array Camera and Spectrometer (PACS). The sample is first divided in outflow and non-outflow sources according to literature tabulations. With the aid of archival stellar/disc and jet/outflow tracers and model predictions (PDRs and shocks), correlations are explored to constrain the physical mechanisms behind the observed line emission. Results: Outflow sources exhibit brighter atomic and molecular emission lines and higher detection rates than non-outflow sources. The line detection fractions decrease with SED evolutionary status (from Class I to Class III). We find correlations between [OI] 63.18 μm and [OI] 6300 Å, o-H2O 78.74 μm, CO 144.78 μm, OH 79.12+79.18 μm, and the continuum flux at 24 μm. The atomic line ratios can be explain either by fast (Vshock > 50 km s-1) dissociative J-shocks at low densities (n 103 cm-3) occurring along the jet and/or PDR emission (G0 > 102, n 103-106 cm-3). To account for the [CII] absolute fluxes, PDR emission or UV irradiation of shocks is needed. In comparison, the molecular emission is more compact and the line ratios are better explained with slow (Vshock < 40 km s-1) C-type shocks with high pre-shock densities (104-106 cm-3), with the exception of OH lines, that are better described by J-type shocks. Disc models alone fail to reproduce the observed molecular line fluxes, but a contribution to the line fluxes from UV-illuminated discs and/or outflow cavities is expected. Far-IR lines dominate disc cooling at early stages and weaken as the star+disc system evolves from Class I to Class III, with an increasing relative disc contribution to the line fluxes. Conclusions: Models which take into account jets, discs, and their mutual interaction are needed to disentangle the different components and study their evolution. The much higher detection rate of emission lines in outflow sources and the compatibility of line ratios with shock model predictions supports the idea of a dominant contribution from the jet/outflow to the line emission, in particular at earlier stages of the stellar evolution as the brightness of FIR lines depends in large part on the specific evolutionary stage. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

Genetic Loci Influencing C-reactive Protein Levels and Risk of Coronary Heart Disease

PubMed Central

Elliott, Paul; Chambers, John C.; Zhang, Weihua; Clarke, Robert; Hopewell, Jemma C.; Peden, John F.; Erdmann, Jeanette; Braund, Peter; Engert, James C.; Bennett, Derrick; Coin, Lachlan; Ashby, Deborah; Tzoulaki, Ioanna; Brown, Ian J.; Mt-Isa, Shahrul; McCarthy, Mark I.; Peltonen, Leena; Freimer, Nelson B.; Farrall, Martin; Ruokonen, Aimo; Hamsten, Anders; Lim, Noha; Froguel, Philippe; Waterworth, Dawn M.; Vollenweider, Peter; Waeber, Gerard; Jarvelin, Marjo-Riitta; Mooser, Vincent; Scott, James; Hall, Alistair S.; Schunkert, Heribert; Anand, Sonia S.; Collins, Rory; Samani, Nilesh J.; Watkins, Hugh; Kooner, Jaspal S.

2009-01-01

Context: Plasma levels of C-reactive protein (CRP) are independently associated with risk of coronary heart disease, but whether CRP is causally associated with coronary heart disease or merely a marker of underlying atherosclerosis is uncertain. Objective: To investigate association of genetic loci with CRP levels and risk of coronary heart disease. Design, setting and participants: We first carried out a genome-wide association (n=17,967) and replication study (n=14,747) to identify genetic loci associated with plasma CRP concentrations. Data collection took place between 1989 and 2008 and genotyping between 2003 and 2008. We carried out a Mendelian randomisation study of the most closely associated SNP in the CRP locus and published data on other CRP variants involving a total of 28,112 cases and 100,823 controls, to investigate the association of CRP variants with coronary heart disease. We compared our finding with that predicted from meta-analysis of observational studies of CRP levels and risk of coronary heart disease. For the other loci associated with CRP levels, we selected the most closely associated SNP for testing against coronary heart disease among 14,365 cases and 32,069 controls. Main outcome measure: Risk of coronary heart disease. Results: Polymorphisms in five genetic loci were strongly associated with CRP levels (% difference per minor allele): SNP rs6700896 in LEPR (−14.7% [95% Confidence Interval {CI}], −17.5 – −11.9, P=1.6×10−21), rs4537545 in IL6R (−10.8% [95% CI, −13.8 – −7.7], P=5.1×10−11), rs7553007 in CRP locus (−20.7% [95% CI, −23.5 – −17.9], P=3.3×10−38), rs1183910 in HNF1A (−13.6% [95% CI, −16.4 – −10.6], P=1.2×10−17) and rs4420638 in APOE-CI-CII (−21.8% [95% CI, −25.4 – −18.1], P=2.1×10−25). Association of SNP rs7553007 in the CRP locus with coronary heart disease gave odds ratio (OR) 0.98 (95% CI, 0.94 – 1.01) per 20% lower CRP. Our Mendelian randomisation study of variants in the CRP locus showed no association with coronary heart disease: OR 1.00 (95% CI, 0.97 – 1.02) per 20% lower CRP, compared with OR 0.94 (95% CI, 0.94 – 0.95) predicted from meta-analysis of the observational studies of CRP levels and coronary heart disease (Z-score −3.45, P<.001). SNPs rs6700896 in LEPR (OR 1.06 [95% CI, 1.02 – 1.09] per minor allele), rs4537545 in IL6R (OR 0.94 [95% CI, 0.91 – 0.97]) and rs4420638 in the APOE-CI-CII cluster (OR 1.16 [95% CI, 1.12 – 1.21]) were all associated with risk of coronary heart disease. Conclusions: The lack of concordance between the effect on coronary heart disease risk of CRP genotypes and CRP levels argues against a causal association of CRP with coronary heart disease. PMID:19567438

Quasars at the High Redshift Frontier

NASA Astrophysics Data System (ADS)

Bosman, Sarah E. I.

2017-11-01

In recent years the formation of primordial galaxies, cosmic metal enrichment, and hydrogen reionisation have been studied using both refined observations and powerful numerical simulations. High-redshift quasars have become a ubiquitous tool in the study of this era with more than 115 quasars now spectroscopically confirmed at z>6.0. In this thesis, I use spectra of high-redshift quasars to provide improved observational constraints through a mixture of existing and new techniques. I first investigate the claim of neutral gas around the most distant known quasar, ULASJ1120+0641(J1120), with a cosmological redshift of z=7.1. Its spectrum shows a relatively weak Lyman-α emission line, which has been interpreted as evidence of absorption by neutral gas. Attributing this to a Gunn-Peterson damping wing has led to claims that the intergalactic medium is at least 10% neutral at that redshift. However, these claims rely on a reconstruction of the unabsorbed quasar emission. Initial attempts using composite spectra of lower-redshift quasars mismatched the CIV emission line of J1120, a feature known to correlate with Lyman-α and which is strongly blueshifted in J1120. I attempt to establish whether this mismatch could explain the apparently weak Lyman-α emission line. I find that among a C IV-matched sample the Lyman-α line of J1120 is not anomalous. This raises doubts as to the interpretation of absorbed Lyman-α emission lines in the context of reionisation. I then use a high quality X-Shooter spectrum of the same z=7 quasar to measure the abundances of diffuse metals within one billion years of the Big Bang. I measure the occurrence rates of CIV, CII, SiII, FeII and MgII, producing the first measurement at z>6 for many of these ions. I find that the incidence of CIV systems is consistent with a continuing decline in the total mass density of highly ionized metals, a trend seen at lower redshifts. The ratio CII/CIV, however, seems to remain constant or increase with redshift, in line with predictions from models which include a decline of the ionising ultraviolet background. The evolution in MgII appears somewhat more complex; while the number density of strong systems continues to decline at high redshift,the number density of weak systems remains high and may even increase. This could signal an increase with redshift in the cross-section of low-ionisation metals. Large numbers of weak MgII systems are also seen at z˜2, suggesting they were already in place when reionisation was ending. I use this X-Shooter spectrum to study metal absorbers associated with the z=7 quasar itself. I find that one such absorber shows signs of only partially covering the line-of-sight, and investigate the possible implications for the quasar's environment. Finally, I investigate the evolution of the intergalactic medium's Lyman-α opacity using spectra of quasars at 5.7

ALMA Examines a Distant Quasar Host

NASA Astrophysics Data System (ADS)

Kohler, Susanna

2017-04-01

The dust continuum (top) and the [CII] emission (bottom) maps for the region around J1120+0641. [Adapted from Venemans et al. 2017]A team of scientists has used the Atacama Large Millimeter/submillimeter Array (ALMA) to explore the host galaxy of the most distant quasar known. Their observations may help us to build a picture of how the first supermassive black holes in the universe formed and evolved.Faraway Monsters and Their GalaxiesWe know that quasars the incredibly luminous and active centers of some distant galaxies are powered by accreting, supermassive black holes. These monstrous powerhouses have been detected out to redshifts of z 7, when the universe was younger than a billion years old.Though weve observed over a hundred quasars at high redshift, we still dont understand how these early supermassive black holes formed, or whether the black holes and the galaxies that host them co-evolved. In order to answer questions like these, however, we first need to gather information about the properties and behavior of various supermassive black holes and their host galaxies.A team of scientists led by Bram Venemans (Max-Planck Institute for Astronomy, Germany) recently used the unprecedented sensitivity and angular resolution of ALMA as well as the Very Large Array and the IRAM Plateau de Bure Interferometer to examine the most distant quasar currently known, J1120+0641, located at a redshift of z = 7.1.A High-Resolution LookThe teams observations of the dust and gas emission from the quasars host galaxy revealed a number of intriguing things:The red and blue sides of the [CII] emission line are shown here as contours, demonstrating that theres no ordered rotational motion of the gas on kpc scales. [Adapted from Venemans et al. 2017]The majority of the galaxys emission is very compact. Around 80% of the observed flux came from a region of only 11.5 kpc in diameter.Despite the fact that the 2.4-billion-solar-mass black hole at the galaxys center is accreting at a high rate, the heating in the galaxy is dominated not by the black holes accretion, but by star formation.Theres no sign of the expected structure of a rotating disk on kpc scales.The authors estimate a dynamical mass of the host galaxy of 43 billion solar masses and the black hole at the galaxys center makes up 6% of that. This ratio is roughly 10x higher than the black-hole-to-bulge mass ratio in local early-type galaxies.In the very central region, the black hole accounts for around 20% of the galaxys dynamical mass, and gas and dust likely accounts for most of the remainder. This doesnt leave much room for massive stars in the center of the galaxy.ALMAs capabilities have enabled these first efforts to spatially resolve the host galaxy of the most distant quasar known, resulting new and unexpected information. The authors now look hopefully to the future, when even longer baselines of ALMA may allow us a still-higher-resolution look at this distant quasar, possibly providing answers to some of the questions it has raised.CitationBram P. Venemans et al 2017 ApJ 837 146. doi:10.3847/1538-4357/aa62ac

An Icy Kuiper Belt Around the Young Solar-type Star HD 181327

NASA Technical Reports Server (NTRS)

Lebreton, J.; Augereau, J.-C.; Thi, W.-F.; Roberge, A.; Donaldson, J; Schneider, G.; Maddison, S. T.; Menard, F.; Riviere-Marichalar, P.; Matthews, G. S.;

The HIFI spectral survey of AFGL 2591 (CHESS). II. Summary of the survey

NASA Astrophysics Data System (ADS)

Kaźmierczak-Barthel, M.; van der Tak, F. F. S.; Helmich, F. P.; Chavarría, L.; Wang, K.-S.; Ceccarelli, C.

2014-07-01

Aims: This paper presents the richness of submillimeter spectral features in the high-mass star forming region AFGL 2591. Methods: As part of the Chemical Herschel Survey of Star Forming Regions (CHESS) key programme, AFGL 2591 was observed by the Herschel (HIFI) instrument. The spectral survey covered a frequency range from 480 to 1240 GHz as well as single lines from 1267 to 1901 GHz (i.e. CO, HCl, NH3, OH, and [CII]). Rotational and population diagram methods were used to calculate column densities, excitation temperatures, and the emission extents of the observed molecules associated with AFGL 2591. The analysis was supplemented with several lines from ground-based JCMT spectra. Results: From the HIFI spectral survey analysis a total of 32 species were identified (including isotopologues). Although the lines are mostly quite weak (∫TmbdV ~ few K km s-1), 268 emission and 16 absorption lines were found (excluding blends). Molecular column densities range from 6 × 1011 to 1 × 1019 cm-2 and excitation temperatures from 19 to 175 K. Cold (e.g. HCN, H2S, and NH3 with temperatures below 70 K) and warm species (e.g. CH3OH, SO2) in the protostellar envelope can be distinguished. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.Appendix A is available in electronic form at http://www.aanda.org

The ZINGRS Radio Survey: Probing metallicities at high-z with far-IR fine-structure lines and the radio continuum

NASA Astrophysics Data System (ADS)

Ferkinhoff, Carl; Higdon, Sarah; Higdon, James L.; Tidwell, Hannah; Rangel, Miguel; Vishwas, Amit; Nikola, Thomas; Stacey, Gordon J.; Brisbin, Drew

2017-01-01

The present day Universe is rich in metals that enable efficient cooling of gas in the ISM in order to form stars, create planets and make the building blocks of life as we know it. The Universe did not start in this state - we know that metals had to build up over time with successive generations of stars. Revealing the details of this evolution, however, is challenging and requires probes of metallicity that are not susceptible to dust extinction nor exhibit the degeneracies common to tracers in the visible regime. One possible indicator combines the far-IR fine structure lines with the radio continuum. Recently we have undertaken a multi-band radio continuum survey with the JVLA of high-z galaxies from ZINGRS. These observations will constrain the galaxies’ thermal and nonthermal radio emissions and demonstrate the use of far-IR lines together with radio continuum as a metallicity indicator. ZINGRS, the ZEUS 1 and 2 INvestigated Galaxy Reference Sample, includes ~30 galaxies from z ~ 1 - 4.5 for which the far-IR fine-structure lines (e.g. [CII] 158, [NII] 122, [OIII] 88) have been observed with the ZEUS-1 and 2 instruments. This is the largest collection of far-IR fine-structure line detections at high-z and is ideal for demonstrating the use of this new indicator. Here we describe the theory behind the new indicator, give an overview of ZINGRS, and report on the status of our radio survey.

Mutations That Improve the pRE Promoter of Coliphage Lambda

PubMed Central

Mahoney, Michael E.; Wulff, Daniel L.

1987-01-01

The dya5 mutation, a C→T change at position -43 of the λ pRE promoter, results in a twofold increase in pRE activity in vivo. Smaller increases in pRE activity are found for the dya2 mutation, a T→C change at position -1 of pRE, and the dya3 mutation, an A→G change at +5 of pRE. The mutant p RE promoters retain complete dependence on cII protein for activity. These observations argue, at least for pRE-like promoters, that promoter activities are influenced by nucleotide sequences at least eight nucleotides to the 5'-side of the conventional -35 region consensus sequence, and by nucleotide sequences near the start-site of transcription. Although Hawley and McClure (1983) found A·T pairs more frequently than G·TC pairs in the region of -40 to -45 of prokaryotic promoters, other mutations that change a G·TC pair to an A·T pair at positions -41, -44 and -45 of pRE do not result in increased promoter activity. We also found that a T→C change at position -42 results in a mild decrease in promoter activity. These observations argue that Ts at positions -42 and -43 of pRE are required for maximum promoter activity, but do not support the hypothesis that As and Ts in the -40 to -45 region generally lead to higher promoter activities. PMID:2953648

Chiral zero energy modes in two-dimensional disordered Dirac semimetals

NASA Astrophysics Data System (ADS)

Liu, Lei; Yu, Yan; Wu, Hai-Bin; Zhang, Yan-Yang; Liu, Jian-Jun; Li, Shu-Shen

2018-04-01

The vacancy-induced chiral zero energy modes (CZEMs) of chiral-unitary-class (AIII) and chiral-symplectic-class (CII) two-dimensional (2 D ) disordered Dirac semimetals realized on a square bipartite lattice are investigated numerically by using the Kubo-Greenwood formula with the kernel polynomial method. The results show that, for both systems, the CZEMs exhibit the critical delocalization. The CZEM conductivity remains a robust constant (i.e., σ CZEM≈1.05 e2/h ), which is insensitive to the sample sizes, the vacancy concentrations, and the numbers of moments of Chebyshev polynomials, i.e., the dephasing strength. For both kinds of chiral systems, the CZEM conductivities are almost identical. However, they are not equal to that of graphene (i.e., 4 e2/π h ), which belongs to the chiral orthogonal class (BDI) semimetal on a 2 D hexagonal bipartite lattice. In addition, for the case that the vacancy concentrations are different in the two sublattices, the CZEM conductivity vanishes, and thus both systems exhibit localization at the Dirac point. Moreover, a band gap and a mobility gap open around zero energy. The widths of the energy gaps and mobility gaps are increasing with larger vacancy concentration difference. The width of the mobility gap is greater than that of the band gap, and a δ -function-like peak of density of states emerges at the Dirac point within the band gap, implying the existence of numerous localized states.

Lipid and lipoprotein abnormalities in acute lymphoblastic leukemia survivors.

PubMed

Morel, Sophia; Leahy, Jade; Fournier, Maryse; Lamarche, Benoit; Garofalo, Carole; Grimard, Guy; Poulain, Floriane; Delvin, Edgard; Laverdière, Caroline; Krajinovic, Maja; Drouin, Simon; Sinnett, Daniel; Marcil, Valérie; Levy, Emile

2017-05-01

Survivors of acute lymphoblastic leukemia (ALL), the most common cancer in children, are at increased risk of developing late cardiometabolic conditions. However, the mechanisms are not fully understood. This study aimed to characterize the plasma lipid profile, Apo distribution, and lipoprotein composition of 80 childhood ALL survivors compared with 22 healthy controls. Our results show that, despite their young age, 50% of the ALL survivors displayed dyslipidemia, characterized by increased plasma triglyceride (TG) and LDL-cholesterol, as well as decreased HDL-cholesterol. ALL survivors exhibited lower plasma Apo A-I and higher Apo B-100 and C-II levels, along with elevated Apo C-II/C-III and B-100/A-I ratios. VLDL fractions of dyslipidemic ALL survivors contained more TG, free cholesterol, and phospholipid moieties, but less protein. Differences in Apo content were found between ALL survivors and controls for all lipoprotein fractions except HDL 3 HDL 2 , especially, showed reduced Apo A-I and raised Apo A-II, leading to a depressed Apo A-I/A-II ratio. Analysis of VLDL-Apo Cs disclosed a trend for higher Apo C-III 1 content in dyslipidemic ALL survivors. In conclusion, this thorough investigation demonstrates a high prevalence of dyslipidemia in ALL survivors, while highlighting significant abnormalities in their plasma lipid profile and lipoprotein composition. Special attention must, therefore, be paid to these subjects given the atherosclerotic potency of lipid and lipoprotein disorders. Copyright © 2017 by the American Society for Biochemistry and Molecular Biology, Inc.

Molecular and morphological surface analysis: effect of filling pastes and cleaning agents on root dentin.

PubMed

Dainezi, Vanessa Benetello; Iwamoto, Alexsandra Shizue; Martin, Airton Abrahão; Soares, Luís Eduardo Silva; Hosoya, Yumiko; Pascon, Fernanda Miori; Puppin-Rontani, Regina Maria

2017-01-01

This study evaluated the effect of different filling pastes and cleaning agents on the root dentin of primary teeth using Fourier-transformed Raman spectroscopy (FT-Raman), micro energy-dispersive X-ray fluorescence (µ-EDXRF) and scanning electron microscopic (SEM) analysis. Eighty roots of primary teeth were endodontically prepared and distributed into 4 groups and filled according to the following filling pastes: Control-no filling (CP), Calen®+zinc oxide (CZ), Calcipex II® (CII), Vitapex® (V). After seven days, filling paste groups were distributed to 4 subgroups according to cleaning agents (n=5): Control-no cleaning (C), Ethanol (E), Tergenform® (T), 35% Phosphoric acid (PA). Then, the roots were sectioned and the dentin root sections were internally evaluated by FT-Raman, µ-EDXRF and SEM. Data was submitted to two-way ANOVA and Tukey tests (α=0.05). Regarding filling pastes, there was no significant difference in organic content. CP provided the lowest calcium values and, calcium/phosphoric ratio (Ca/P), and the highest phosphoric values. For cleaning agents there was no difference in organic content when compared to the C; however, T showed significantly higher calcium and Ca/P than PA. All groups showed similar results for phosphorus. The dentin smear layer was present after use of the cleaning agents, except PA. The filling pastes changed the inorganic content, however they did not change the organic content. Cleaning agents did not alter the inorganic and organic content. PA cleaned and opened dentin tubules.

Screening and identification of potential protein biomarkers for evaluating the efficacy of intensive therapy in pulmonary tuberculosis.

PubMed

Jiang, Ting-Ting; Shi, Li-Ying; Chen, Jing; Wei, Li-Liang; Li, Meng; Hu, Yu-Ting; Gan, Lin; Liu, Chang-Ming; Tu, Hui-Hui; Li, Zhi-Bin; Yi, Wen-Jing; Li, Ji-Cheng

2018-06-27

This research aimed to discover potential biomarkers for evaluating the therapeutic efficacy of intensive therapy in pulmonary tuberculosis (TB). Protein profiles in 2-months intensively treated TB patients, untreated TB patients, and healthy controls were investigated with iTRAQ-2DLC-MS/MS technique. 71 differential proteins were identified in 2-months intensively treated TB patients. Significant differences in complement component C7 (CO7), apolipoprotein A-IV (APOA4), apolipoprotein C-II (APOC2), and angiotensinogen (ANGT) were found by ELISA validation. CO7 and ANGT were also found significantly different in sputum negative patients, compared with sputum positive patients after intensive treatment. Clinical analysis showed that after 2-months intensive treatment several indicators were significantly changed, and the one-year cure rate of sputum negative patients were significantly higher than sputum positive patients. Diagnostic models consisting of APOC2, CO7 and APOA4 were established to distinguish intensively treated TB patients from untreated TB patients and healthy controls with the AUC value of 0.910 and 0.935. Meanwhile, ANGT and CO7 were combined to identify sputum negative and sputum positive TB patients after intensive treatment with 89.36% sensitivity, 71.43% specificity, and the AUC value of 0.853. The results showed that APOC2, CO7, APOA4, and ANGT may be potential biomarkers for evaluating the efficacy of intensive anti-TB therapy. Copyright © 2018. Published by Elsevier Inc.

ARCADE 2 Observations of Galactic Radio Emission

NASA Technical Reports Server (NTRS)

Kogut, A.; Fixsen, D. J.; Levin, S. M.; Limon, M.; Lubin, P. M.; Mirel, P.; Seiffert, M.; Singal, J.; Villela, T.; Wollack, E.;

Observations of O VI Emission from the Diffuse Interstellar Medium

NASA Technical Reports Server (NTRS)

Shelton, R. L.; Kruk, J. W.; Murphy, E. M.; Andersson, B. G.; Blair, W. P.; Dixon, W. V.; Edelstein, J.; Fullerton, A. W.; Gry, C.; Howk, J. C.;

Differing patterns of genetic instability in mice deficient in the mismatch repair genes Pms2, Mlh1, Msh2, Msh3 and Msh6.

PubMed

Hegan, Denise Campisi; Narayanan, Latha; Jirik, Frank R; Edelmann, Winfried; Liskay, R Michael; Glazer, Peter M

2006-12-01

Defects in genes associated with DNA mismatch repair (MMR) have been linked to hereditary colon cancer. Because the MMR pathway includes multiple factors with both overlapping and divergent functions, we sought to compare the impact of deficiencies in each of several MMR genes on genetic instability using a collection of knock-out mouse models. We investigated mutation frequencies and patterns in MMR-deficient mice using two transgenic reporter genes, supFG1 and cII, in the context of mice deficient for Pms2, Mlh1, Msh2, Msh3 or Msh6 or both Msh2 and Msh3 or both Msh3 and Msh6. We found that the mean mutation frequencies of all of the MMR-deficient mice were significantly higher than the mean mutation frequencies of wild-type mice. Mlh1-deficient mice and Msh2-deficient mice had the highest mutation frequencies in a comparison of the single nullizygous mice. Of all the mice studied, mice nullizygous for both Msh2 and Msh3 and those nullizygous for both Msh3 and Msh6 displayed the greatest overall increases in mutation frequencies compared with wild-type mice. Sequence analysis of the mutated reporter genes revealed significant differences between the individual groups of MMR-deficient mice. Taken together, our results further characterize the functions of the MMR factors in mutation avoidance and provide in vivo correlation to biochemical models of the MMR pathway.

A chemical model for the interstellar medium in galaxies

NASA Astrophysics Data System (ADS)

Bovino, S.; Grassi, T.; Capelo, Pedro R.; Schleicher, D. R. G.; Banerjee, R.

2016-05-01

Aims: We present and test chemical models for three-dimensional hydrodynamical simulations of galaxies. We explore the effect of changing key parameters such as metallicity, radiation, and non-equilibrium versus equilibrium metal cooling approximations on the transition between the gas phases in the interstellar medium. Methods: The microphysics was modelled by employing the public chemistry package KROME, and the chemical networks were tested to work in a wide range of densities and temperatures. We describe a simple H/He network following the formation of H2 and a more sophisticated network that includes metals. Photochemistry, thermal processes, and different prescriptions for the H2 catalysis on dust are presented and tested within a one-zone framework. The resulting network is made publicly available on the KROME webpage. Results: We find that employing an accurate treatment of the dust-related processes induces a faster HI-H2 transition. In addition, we show when the equilibrium assumption for metal cooling holds and how a non-equilibrium approach affects the thermal evolution of the gas and the HII-HI transition. Conclusions: These models can be employed in any hydrodynamical code via an interface to KROME and can be applied to different problems including isolated galaxies, cosmological simulations of galaxy formation and evolution, supernova explosions in molecular clouds, and the modelling of star-forming regions. The metal network can be used for a comparison with observational data of CII 158 μm emission both for high-redshift and for local galaxies.

Evaluation of the 'Fitting to Outcomes eXpert' (FOX®) with established cochlear implant users.

PubMed

Buechner, Andreas; Vaerenberg, Bart; Gazibegovic, Dzemal; Brendel, Martina; De Ceulaer, Geert; Govaerts, Paul; Lenarz, Thomas

2015-01-01

To evaluate the possible impact of 'Fitting to Outcomes eXpert (FOX(®))' on cochlear implant (CI) fitting in a clinic with extensive experience of fitting a range of CI systems, as a way to assess whether a software tool such as FOX is able to complement standard clinical procedures. Ten adult post-lingually deafened and unilateral long-term users of the Advanced Bionics(TM) CI system (Clarion CII or HiRes 90K(TM)) underwent speech perception assessment with their current clinical program. One cycle 'iteration' of FOX optimization was performed and the program adjusted accordingly. After a month of using both clinical and FOX programs, a second iteration of FOX optimization was performed. Following this, the assessments were repeated without further acclimatization. FOX prescribed programming modifications in all subjects. Soundfield-aided thresholds were significantly lower for FOX than the clinical program. Group speech scores in noise were not significantly different between the two programs but three individual subjects had improved speech scores with the FOX MAP, two had worse speech scores, and five were the same. FOX provided a standardized approach to fitting based on outcome measures rather than comfort alone. The results indicated that for this group of well-fitted patients, FOX improved outcomes in some individuals. There were significant changes, both better and worse, in individual speech perception scores but median scores remained unchanged. Soundfield-aided thresholds were significantly improved for the FOX group.

Statins Affect Skeletal Muscle Performance: Evidence for Disturbances in Energy Metabolism.

PubMed

Allard, Neeltje A E; Schirris, Tom J J; Verheggen, Rebecca J; Russel, Frans G M; Rodenburg, Richard J; Smeitink, Jan A M; Thompson, Paul D; Hopman, Maria T E; Timmers, Silvie

2018-01-01

Statin myopathy is linked to disturbances in mitochondrial function and exercise intolerance. To determine whether differences exist in exercise performance, muscle function, and muscle mitochondrial oxidative capacity and content between symptomatic and asymptomatic statin users, and control subjects. Cross-sectional study. Department of Physiology, Radboud University Medical Center. Long-term symptomatic and asymptomatic statin users, and control subjects (n = 10 per group). Maximal incremental cycling tests, involuntary electrically stimulated isometric quadriceps-muscle contractions, and biopsy of vastus lateralis muscle. Maximal exercise capacity, substrate use during exercise, muscle function, and mitochondrial energy metabolism. Peak oxygen uptake, maximal work load, and ventilatory efficiency were comparable between groups, but both statin groups had a depressed anaerobic threshold compared with the control group (P = 0.01). Muscle relaxation time was prolonged in both statin groups compared with the control group and rate of maximal force rise was decreased (Ptime×group < 0.001 for both measures). Mitochondrial activity of complexes II and IV was lower in symptomatic statin users than control subjects and tended to be lower for complex (C) III (CII: P = 0.03; CIII: P = 0.05; CIV: P = 0.04). Mitochondrial content tended to be lower in both statin groups than in control subjects. Statin use attenuated substrate use during maximal exercise performance, induced muscle fatigue during repeated muscle contractions, and decreased muscle mitochondrial oxidative capacity. This suggests disturbances in mitochondrial oxidative capacity occur with statin use even in patients without statin-induced muscle complaints. Copyright © 2017 Endocrine Society

[C ii] 158 μm line detection of the warm ionized medium in the Scutum-Crux spiral arm tangency

NASA Astrophysics Data System (ADS)

Velusamy, T.; Langer, W. D.; Pineda, J. L.; Goldsmith, P. F.

2012-05-01

Context. The Herschel HIFI GOT C+ Galactic plane [C ii] spectral survey has detected strong emission at the spiral arm tangencies. Aims: We use the unique viewing geometry of the Scutum-Crux (S-C) tangency nearl = 30° to detect the warm ionized medium (WIM) component traced by [CII] and to study the effects of spiral density waves on Interstellar Medium (ISM) gas. Methods: We compare [C ii] velocity features with ancillary H i, 12CO and 13CO data near tangent velocities at each longitude to separate the cold neutral medium and the warm neutral + ionized components in the S-C tangency, then we identify [C ii] emission at the highest velocities without any contribution from 12CO clouds, as WIM. Results: We present the GOT C+ results for the S-C tangency. We interpret the diffuse and extended excess [C ii] emission at and above the tangent velocities as arising in the electron-dominated warm ionized gas in the WIM. We derive an electron density in the range of 0.2-0.9 cm-3 at each longitude, a factor of several higher than the average value from Hα and pulsar dispersion. Conclusions: We interpret the excess [C ii] in S-C tangency as shock compression of the WIM induced by the spiral density waves. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

SuperSpec, The On-Chip Spectrometer: Improved NEP and Antenna Performance

NASA Astrophysics Data System (ADS)

Wheeler, Jordan; Hailey-Dunsheath, S.; Shirokoff, E.; Barry, P. S.; Bradford, C. M.; Chapman, S.; Che, G.; Doyle, S.; Glenn, J.; Gordon, S.; Hollister, M.; Kovács, A.; LeDuc, H. G.; Mauskopf, P.; McGeehan, R.; McKenney, C.; Reck, T.; Redford, J.; Ross, C.; Shiu, C.; Tucker, C.; Turner, J.; Walker, S.; Zmuidzinas, J.

2018-05-01

SuperSpec is a new technology for mm and sub-mm spectroscopy. It is an on-chip spectrometer being developed for multi-object, moderate-resolution (R˜ 300 ), large bandwidth survey spectroscopy of high-redshift galaxies for the 1 mm atmospheric window. This band accesses the CO ladder in the redshift range of z = 0-4 and the [CII] 158 μm line from redshift z = 5-9. SuperSpec employs a novel architecture in which detectors are coupled to a series of resonant filters along a single microwave feedline instead of using dispersive optics. This construction allows for the creation of a full spectrometer occupying only ˜ 10 cm^2 of silicon, a reduction in size of several orders of magnitude when compared to standard grating spectrometers. This small profile enables the production of future multi-beam spectroscopic instruments envisioned for the millimeter band to measure the redshifts of dusty galaxies efficiently. The SuperSpec collaboration is currently pushing toward the deployment of a SuperSpec demonstration instrument in fall of 2018. The progress with the latest SuperSpec prototype devices is presented; reporting increased responsivity via a reduced inductor volume (2.6 μm^3 ) and the incorporation of a new broadband antenna. A detector NEP of 3-4 × 10^{-18} W/Hz^{0.5} is obtained, sufficient for background-limited observation on mountaintop sites. In addition, beam maps and efficiency measurements of a new wide-band dual bow-tie slot antenna are shown.

Resveratrol Rescues Kidney Mitochondrial Function Following Hemorrhagic Shock

PubMed Central

Wang, Hao; Guan, Yuxia; Karamercan, Mehmet Akif; Ye, Lan; Bhatti, Tricia; Becker, Lance B.; Baur, Joseph A.; Sims, Carrie A.

2015-01-01

Objective Hemorrhagic shock may contribute to acute kidney injury by profoundly altering renal mitochondrial function. Resveratrol (RSV), a naturally occurring sirtuin-1 (SIRT1) activator, has been shown to promote mitochondrial function and reduce oxidative damage in a variety of aging-related disease states. We hypothesized that RSV treatment during resuscitation would ameliorate kidney mitochondrial dysfunction and decrease oxidative damage following hemorrhagic shock. Method Using a decompensated hemorrhagic shock model, male Long-Evans rats (n=6 per group) were sacrificed prior to hemorrhage (Sham), at severe shock, and following either lactated Ringer’s (LR) Resuscitation or LR+RSV Resuscitation (RSV: 30mg/kg). At each time point, blood samples were assayed for arterial blood gases, lactate, blood urea nitrogen (BUN) and serum creatinine. Mitochondria were also isolated from kidney samples in order to assess individual electron transport complexes (CI, CII, and CIV) using high-resolution respirometry. Total mitochondria reactive oxygen species (ROS) were measured using fluorometry and lipid peroxidation was assessed by measuring 4-hydroxynonenal by Western blot. qPCR was used quantify mRNA from PGC1-α, SIRT1, and proteins known to mitigate oxidative damage and promote mitochondrial biogenesis. Results RSV supplementation during resuscitation restored mitochondrial respiratory capacity, decreased mitochondrial ROS and lipid peroxidation. Compared to standard LR resuscitation, RSV treatment significantly increased SIRT1 and PGC1-α expression and significantly increased both SOD2 and catalase expression. Although RSV was associated with decreased lactate production, pH, BUN and serum creatinine values did not differ between resuscitation strategies. Conclusions Resuscitation with RSV significantly restored renal mitochondrial function and decreased oxidative damage following hemorrhagic shock. PMID:25895148

Defective Generation of a Humoral Immune Response Is Associated with a Reduced Incidence and Severity of Collagen-Induced Arthritis in Microsomal Prostaglandin E Synthase-1 Null Mice1

PubMed Central

Kojima, Fumiaki; Kapoor, Mohit; Yang, Lihua; Fleishaker, Erica L.; Ward, Martin R.; Monrad, Seetha U.; Kottangada, Ponnappa C.; Pace, Charles Q.; Clark, James A.; Woodward, Jerold G.; Crofford, Leslie J.

2008-01-01

Microsomal PGE synthase-1 (mPGES-1) is an inducible enzyme that acts downstream of cyclooxygenase and specifically catalyzes the conversion of PGH2 to PGE2. The present study demonstrates the effect of genetic deletion of mPGES-1 on the developing immunologic responses and its impact on the clinical model of bovine collagen-induced arthritis. mPGES-1 null and heterozygous mice exhibited decreased incidence and severity of arthritis compared with wild-type mice in a gene dose-dependent manner. Histopathological examination revealed significant reduction in lining hyperplasia and tissue destruction in mPGES-1 null mice compared with their wild-type littermates. mPGES-1 deficient mice also exhibited attenuation of mechanical nociception in a gene dose-dependent manner. In addition, mPGES-1 null and heterozygous mice showed a marked reduction of serum IgG against type II collagen (CII), including subclasses IgG1, IgG2a, IgG2b, IgG2c, and IgG3, compared with wild-type mice, which correlated with the reduction in observed inflammatory features. These results demonstrate for the first time that deficiency of mPGES-1 inhibits the development of collagen-induced arthritis, at least in part, by blocking the development of a humoral immune response against type II collagen. Pharmacologic inhibition of mPGES-1 may therefore impact both the inflammation and the autoimmunity associated with human diseases such as rheumatoid arthritis. PMID:18523303

GUSTO: Gal/Xgal U/LDB Spectroscopic-Stratospheric TeraHertz Observatory

NASA Astrophysics Data System (ADS)

Kidd Walker, Christopher; Kulesa, Craig; Goldsmith, Paul; Groppi, Christopher; Helmich, Frank; Hollenbach, David; Kawamura, Jonathan; Langer, William; Melnick, Gary; Neufeld, David; Pineda, Jorge; Stacey, Gordon; Stark, Antony; Tielens, Alexander; Wolfire, Mark; Yorke, Harold; Young, Erick

2018-01-01

GUSTO is a recently selected NASA Explorer mission that will map in unprecedented detail the structure, dynamics, energy balance, and evolution of the interstellar medium within the Milky Way and Large Magellanic Cloud. GUSTO is a balloon-borne, 0.85-m on-axis telescope that will observe in three important interstellar lines: [CII], [OI], and [NII] at 158, 63, and 205 microns, respectively. With its 60" angular resolution, high-velocity resolution, and efficient “On-The-Fly” mapping strategy, GUSTO will address key unanswered questions about the stellar life cycle and provide new insights into the birth and evolution of stars and galaxies. From its Ultra-Long-Duration Balloon (ULDB) platform at an altitude of 33 km, GUSTO will survey ~100 deg2 of the Milky Way and 24 deg2 of the LMC at 60" angular resolution using three 8-pixel heterodyne array receivers. The GUSTO receivers provide sub-km/s velocity resolution and bandwidths sufficiently wide to track all clouds orbiting in the Milky Way and LMC. GUSTO will detect and locate in three dimensions every important interstellar cloud (AV > 0.5–1) in the surveyed regions. The baseline mission of 100 days can be completed in one ULDB Antarctic balloon flight, and an extended mission of up to 169 days is possible. GUSTO’s observing campaign comprises three distinct surveys: GPS: A Galactic Plane Survey (42 days); LMCS: An LMC Survey (36 days); TDS: Targeted Deep Surveys of selected regions in the Galaxy and LMC (18 days). In our presentation we will discuss both the science goals of GUSTO and the mission implementation.

High-level expression and deuteration of sperm whale myoglobin: A study of its solvent structure by X-ray and neutron diffraction methods

DOE Office of Scientific and Technical Information (OSTI.GOV)

Shu, F.; Ramakrishnan, V.; Schoenborn, B.P.

1994-12-31

Neutron diffraction has become one of the best ways to study light atoms, such as hydrogens. Hydrogen however has a negative coherent scattering factor, and a large incoherent scattering factor, while deuterium has virtually no incoherent scattering, but a large positive coherent scattering factor. Beside causing high background due to its incoherent scattering, the negative coherent scattering of hydrogen tends to cancel out the positive contribution from other atoms in a neutron density map. Therefore a fully deuterated sample will yield better diffraction data with stronger density in the hydrogen position. On this basis, a sperm whale myoglobin gene modifiedmore » to include part of the A cII protein gene has been cloned into the T7 expression system. Milligram amounts of fully deuterated holo-myoglobin have been obtained and used for crystallization. The synthetic sperm whale myoglobin crystallized in P2{sub 1} space group isomorphous with the native protein crystal. A complete X-ray diffraction dataset at 1.5{Angstrom} has been collected. This X-ray dataset, and a neutron data set collected previously on a protonated carbon-monoxymyoglobin crystal have been used for solvent structure studies. Both X-ray and neutron data have shown that there are ordered hydration layers around the protein surface. Solvent shell analysis on the neutron data further has shown that the first hydration layer behaves differently around polar and apolar regions of the protein surface. Finally, the structure of per-deuterated myoglobin has been refined using all reflections to a R factor of 17%.« less

Error field measurement, correction and heat flux balancing on Wendelstein 7-X

DOE PAGES

Lazerson, Samuel A.; Otte, Matthias; Jakubowski, Marcin; ...

2017-03-10

The measurement and correction of error fields in Wendelstein 7-X (W7-X) is critical to long pulse high beta operation, as small error fields may cause overloading of divertor plates in some configurations. Accordingly, as part of a broad collaborative effort, the detection and correction of error fields on the W7-X experiment has been performed using the trim coil system in conjunction with the flux surface mapping diagnostic and high resolution infrared camera. In the early commissioning phase of the experiment, the trim coils were used to open an n/m = 1/2 island chain in a specially designed magnetic configuration. Themore » flux surfacing mapping diagnostic was then able to directly image the magnetic topology of the experiment, allowing the inference of a small similar to 4 cm intrinsic island chain. The suspected main sources of the error field, slight misalignment and deformations of the superconducting coils, are then confirmed through experimental modeling using the detailed measurements of the coil positions. Observations of the limiters temperatures in module 5 shows a clear dependence of the limiter heat flux pattern as the perturbing fields are rotated. Plasma experiments without applied correcting fields show a significant asymmetry in neutral pressure (centered in module 4) and light emission (visible, H-alpha, CII, and CIII). Such pressure asymmetry is associated with plasma-wall (limiter) interaction asymmetries between the modules. Application of trim coil fields with n = 1 waveform correct the imbalance. Confirmation of the error fields allows the assessment of magnetic fields which resonate with the n/m = 5/5 island chain.« less

Inventoring Gas in Debris Disks: UV Spectroscopy of Eta Tel

NASA Astrophysics Data System (ADS)

Roberge, Aki

2015-10-01

Debris disks stand between gas-rich protoplanetary disks and mature planetary systems, shedding light on the late stages of planet formation. Their dust component has been extensively studied, yet has provided little information about disk chemical composition. More information can be provided by their gas content, but astonishingly little is known about it. Only two debris disks have measurements of their gas composition, which is shockingly carbon-rich (Beta Pictoris and 49 Ceti). Basic questions remain unanswered. What are the typical gas-to-dust ratios in debris disks? What is the chemical composition of debris gas and its parent material? The answers to these questions have profound implications for terrestrial planet assembly and the origins of planetary atmospheres.Most detections of debris gas to date were achieved with line of sight UV/optical absorption spectroscopy of edge-on disks, using the central star as the background source. This technique is far more sensitive to small amounts of gas than emission line studies. The UV bandpass is particularly important, since strong transitions of numerous atomic and molecular species lie there. We propose extending our intriguing studies of debris gas with STIS UV spectroscopy of a highly promising debris disk system, Eta Tel. This disk is edge-on and contains circumstellar atomic gas (CII). We will measure column densities of the most important gas species, find the relative elemental gas abundances, and determine the gas mass using a powerful gas disk modeling code. We will also divide our observations into two visits, to search for signs of star-grazing exocomets, which are seen in both Beta Pic and 49 Cet.

Effect of Stimulation Rate on Cochlear Implant Users’ Phoneme, Word and Sentence Recognition in Quiet and in Noise

PubMed Central

Shannon, Robert V.; Cruz, Rachel J.; Galvin, John J.

2011-01-01

High stimulation rates in cochlear implants (CI) offer better temporal sampling, can induce stochastic-like firing of auditory neurons and can increase the electric dynamic range, all of which could improve CI speech performance. While commercial CI have employed increasingly high stimulation rates, no clear or consistent advantage has been shown for high rates. In this study, speech recognition was acutely measured with experimental processors in 7 CI subjects (Clarion CII users). The stimulation rate varied between (approx.) 600 and 4800 pulses per second per electrode (ppse) and the number of active electrodes varied between 4 and 16. Vowel, consonant, consonant-nucleus-consonant word and IEEE sentence recognition was acutely measured in quiet and in steady noise (+10 dB signal-to-noise ratio). Subjective quality ratings were obtained for each of the experimental processors in quiet and in noise. Except for a small difference for vowel recognition in quiet, there were no significant differences in performance among the experimental stimulation rates for any of the speech measures. There was also a small but significant increase in subjective quality rating as stimulation rates increased from 1200 to 2400 ppse in noise. Consistent with previous studies, performance significantly improved as the number of electrodes was increased from 4 to 8, but no significant difference showed between 8, 12 and 16 electrodes. Altogether, there was little-to-no advantage of high stimulation rates in quiet or in noise, at least for the present speech tests and conditions. PMID:20639631

Hot interstellar gas and ionization of embedded clouds

NASA Technical Reports Server (NTRS)

Cheng, K.-P.; Bruhweiler, F.

1990-01-01

Researchers present detailed photoionization calculations for the instellar cloud in which the Sun is embedded. They consider the EUV radiation field with contribution from discrete stellar sources and from a thermal bremsstrahlung-radiative recombination spectrum emitted from the surrounding 10 to the 6th power k coronal substrate. They establish lower limits to the fractional ionization of hydrogen and helium of 0.17 and 0.29 respectively. The high He ionization fraction results primarily from very strong line emission below 500 A originating in the surrounding coronal substrate while the H ionization is dominated by the EUV radiation from the discrete stellar sources. The dual effects of thermal conduction and the EUV spectrum of the 10 to the 6th k plasma on ionization in the cloud skin are explored. The EUV radiation field and Auger ionization have insignificant effects on the resulting ionic column densities of Si IV, C IV, N V and O VI through the cloud skin. Calculations show that the abundances of these species are dominated by collisional ionization in the thermal conduction front. Because of a low charge exchange rate with hydrogen, the ionic column density ratios of N (CIII)/N (CII) and N (NII)/N (NI) are dominated by the EUV radiation field in the local interstellar medium. These ratios should be important diagnostics for the EUV radiation field and serve as surrogate indicators of the interstellar He and H ionization fraction respectively. Spacecraft such as Lyman which is designed to obtain high resolution spectral data down to the Lyman limit at 912 A could sample interstellar lines of these ions.

Probing individual star-forming regions in maximal starburst galaxiesat redshifts z=2-4 with the SMA (and other major facilities): Planck's Dusty GEMS.

NASA Astrophysics Data System (ADS)

Nesvadba, Nicole

2018-01-01

Strongly gravitationally lensed galaxies are veritable gems for our understanding of high-redshift galaxy evolution, allowing us to study dust, gas, and star formation even in the most intense starbursts on scales of individual star-forming regions. On these scales, below one to few 100 pc in the source plane, kpc-scale rotational support no longer dominates, and star formation is regulated by the local gas and stellar mass surface densities and energy injection from turbulence and winds driven by star formation and AGN. I will report on our on-going follow-up of Planck's Dusty GEMS, a small sample of 11 of the brightest, gravitationally lensed high-redshift galaxies on the extragalactic sub-mm sky. SMA 850-micron imaging is playing a critical role in identifying and characterizing the dusty starburst regions, their star-formation properties, and the gravitational lens modeling, and has been paving the way towards a rich multi-wavelength program, which would not have been possible without. This includes VLT, HST and ALMA high-resolution studies of the gas and stellar populations, amongst others. These observations enabled us, e.g., to study theinterplay between gravity and turbulence in an Eddington-limited starburst for the first time, and to detect the first absorption line of [CII] from diffuse gas outside the Milky Way. I will also discussthe first direct lensing estimate of a (bottom-heavy) initial mass function in the early Universe and outline how these and similar observations would benefit from increased bandwidth.

An ALMA view of the interstellar medium of the z = 4.77 lensed starburst SPT-S J213242-5802.9

NASA Astrophysics Data System (ADS)

Béthermin, M.; De Breuck, C.; Gullberg, B.; Aravena, M.; Bothwell, M. S.; Chapman, S. C.; Gonzalez, A. H.; Greve, T. R.; Litke, K.; Ma, J.; Malkan, M.; Marrone, D. P.; Murphy, E. J.; Spilker, J. S.; Stark, A. A.; Strandet, M.; Vieira, J. D.; Weiß, A.; Welikala, N.

2016-02-01

We present ALMA detections of the [NII] 205 μm and CO(12-11) emission lines, and the tentative detection of [CI] - for the strongly lensed (μ = 5.7 ± 0.5) dusty, star-forming galaxy SPT-S J213242-5802.9 (hereafter SPT2132-58) at z = 4.77. The [NII] and CO(12-11) lines are detected at 11.5 and 8.5σ levels, respectively, by our band 6 observations. The [CI] line is detected at 3.2σ after a reanalysis of existing band 3 data. The [CI] luminosity implies a gas mass of (3.8 ± 1.2) × 1010M⊙, and, consequently, a very short depletion timescale of 34 ± 13 Myr and a CO luminosity to gas mass conversion factor αCO of 1.0 ± 0.3 M⊙ (K km s-1 pc2)-1. SPT2132-58 is an extreme starburst with an intrinsic star formation rate of 1100 ± 200 M⊙/yr. We find a [CII]/[NII] ratio of 26 ± 6, which is the highest ratio reported at z > 4. This suggests that SPT2132-58 hosts an evolved interstellar medium (0.5 Z⊙< Z < 1.5 Z⊙), which may be dominated by photodissociation regions. The CO(2-1) and CO(5-4) transitions have lower CO to far-infrared ratios than local and high-redshift samples, while CO(12-11) is similar to these samples, suggesting the presence of an additional very excited component or an active galactic nucleus.

Severe hypertriglyceridemia in Japan: Differences in causes and therapeutic responses.

PubMed

Murase, Toshio; Okubo, Minoru; Ebara, Tetsu; Mori, Yasumichi

Severe hypertriglyceridemia (>1000 mg/dL) has a variety of causes and frequently leads to life-threating acute pancreatitis. However, the origins of this disorder are unclear for many patients. We aimed to characterize the causes of and responses to therapy in rare cases of severe hypertriglyceridemia in a group of Japanese patients. We enrolled 121 patients from a series of case studies that spanned 30 years. Subjects were divided into 3 groups: (1) primary (genetic causes); (2) secondary (acquired); and (3) disorders of uncertain causes. In the last group, we focused on 3 possible risks factors for hypertriglyceridemia: obesity, diabetes mellitus, and heavy alcohol intake. Group A (n = 20) included 13 patients with familial lipoprotein lipase deficiency, 3 patients with apolipoprotein CII deficiency, and other genetic disorders in the rest of the group. Group B patients (n = 15) had various metabolic and endocrine diseases. In Group C (uncertain causes; n = 86), there was conspicuous gender imbalance (79 males, 3 females) and most male subjects were heavy alcohol drinkers. In addition, 18 of 105 adult patients (17%) had histories of acute pancreatitis. The cause of severe hypertriglyceridemia is uncertain in many patients. In primary genetic forms of severe hypertriglyceridemia, genetic diversity between populations is unknown. In the acquired forms, we found fewer cases of estrogen-induced hypertriglyceridemia than in Western countries. In our clinical experience, the cause of most hypertriglyceridemia is uncertain. Our work suggests that genetic factors for plasma triglyceride sensitivity to alcohol should be explored. Copyright © 2017 National Lipid Association. Published by Elsevier Inc. All rights reserved.

Neuropsychological functioning and brain energetics of drug resistant mesial temporal lobe epilepsy patients.

PubMed

Osório, Camila Moreira; Latini, Alexandra; Leal, Rodrigo Bainy; de Oliveira Thais, Maria Emília Rodrigues; Vascouto, Helena Dresch; Remor, Aline Pertile; Lopes, Mark William; Linhares, Marcelo Neves; Ben, Juliana; de Paula Martins, Roberta; Prediger, Rui Daniel; Hoeller, Alexandre Ademar; Markowitsch, Hans Joachim; Wolf, Peter; Lin, Kátia; Walz, Roger

2017-12-01

Interictal hypometabolism is commonly measured by 18-fluoro-deoxyglucose Positron Emission Tomography (FDG-PET) in the temporal lobe of patients with mesial temporal lobe epilepsy (MTLE-HS). Left temporal lobe interictal FDG-PET hypometabolism has been associated with verbal memory impairment, while right temporal lobe FDG-PET hypometabolism is associated with nonverbal memory impairment. The biochemical mechanisms involved in these findings remain unknown. In comparison to healthy controls (n=21), surgically treated patients with MTLE-HS (n=32, left side=17) had significant lower scores in the Rey Auditory Verbal Learning Test (RAVLT retention and delayed), Logical Memory II (LMII), Boston Naming test (BNT), Letter Fluency and Category Fluency. We investigated whether enzymatic activities of the mitochondrial enzymes Complex I (C I), Complex II (C II), Complex IV (C IV) and Succinate Dehydrogenase (SDH) from the resected samples of the middle temporal neocortex (mTCx), amygdala (AMY) and hippocampus (HIP) were associated with performance in the RAVLT, LMII, BNT and fluency tests of our patients. After controlling for the side of hippocampus sclerosis, years of education, disease duration, antiepileptic treatment and seizure outcome after surgery, no independent associations were observed between the cognitive test scores and the analyzed mitochondrial enzymatic activities (p>0.37). Results indicate that memory and language impairment observed in MTLE-HS patients are not strongly associated with the levels of mitochondrial CI, CII, SDH and C IV enzymatic activities in the temporal lobe structures ipsilateral to the HS lesion. Copyright © 2017 Elsevier B.V. All rights reserved.

Korean Red Ginseng Saponin Fraction Rich in Ginsenoside-Rb1, Rc and Rb2 Attenuates the Severity of Mouse Collagen-Induced Arthritis

PubMed Central

Endale, Mehari; Im, Eun Ju; Lee, Joo Young; Kim, Sung Dae; Song, Yong-Bum; Kwak, Yi-Seong; Kim, Chaekyun; Kim, Seung-Hyung; Roh, Seong-Soo; Rhee, Man Hee

2014-01-01

Despite a multitude of reports on anti-inflammatory properties of ginseng extracts or individual ginsenosides, data on antiarthritic effect of ginseng saponin preparation with mixed ginsenosides is limited. On the other hand, a combined therapy of safe and inexpensive plant-derived natural products such as ginsenosides can be considered as an alternative to treat arthritis. Our previous in vitro data displayed a strong anti-inflammatory action of red ginseng saponin fraction-A (RGSF-A). We, herein, report a marked antiarthritic property of RGSF-A rich in ginsenoside Rb1, Rc, and Rb2. Collagen-induced arthritic (CIA) mice were treated with RGSF-A or methotrexate (MTX) for 5 weeks. Joint pathology, serum antibody production and leukocye activation, cytokine production in the circulation, lymph nodes, and joints were examined. RGSF-A markedly reduced severity of arthritis, cellular infiltration, and cartilage damage. It suppressed CD3+/CD69+, CD4+/CD25+, CD8+ T-cell, CD19+, B220/CD23+ B-cell, MHCII+/CD11c+, and Gr-1+/CD11b+ cell activations. It further suppressed anti-CII- or anti-RF-IgG/IgM, TNF-α, IL-1β, IL-17, and IL-6 secretions but stimulated IL-10 levels in the serum, joint, or splenocyte. RGSF-A attenuated arthritis severity, modified leukocyte activations, and restored cytokine imbalances, suggesting that it can be considered as an antiarthritic agent with the capacity to ameliorate the immune and inflammatory responses in CIA mice. PMID:24833816

Effect of the combination of methyltestosterone and esterified estrogens compared with esterified estrogens alone on apolipoprotein CIII and other apolipoproteins in very low density, low density, and high density lipoproteins in surgically postmenopausal women.

PubMed

Chiuve, Stephanie E; Martin, Lisa A; Campos, Hannia; Sacks, Frank M

2004-05-01

Androgens are known to lower plasma triglycerides, an independent risk factor for coronary heart disease (CHD). Triglycerides are carried in plasma on very low density (VLDL) and low density (LDL) lipoprotein particles. Apolipoprotein CIII (apoCIII), a strong predictor of CHD, impairs the metabolism of VLDL and LDL, contributing to increased triglycerides. The objective of this study was to assess the effect of oral methyltestosterone (2.5 mg/d), added to esterified estrogens (1.25 mg/d), on concentrations of apolipoproteins and lipoproteins, specifically those containing apoCIII, compared with esterified estrogens alone in surgically postmenopausal women. The women in the methyltestosterone plus esterified estrogen group had significant decreases in total triglycerides, apoCI, apoCII, apoCIII, apoE, and high density lipoprotein (HDL) cholesterol compared with those in the esterified estrogen group. The decreases in apoCIII concentrations occurred in VLDL (62%; P = 0.02), LDL (35%; P = 0.001), and HDL (17%; P < 0.0001). There were also decreases in cholesterol and triglycerides concentrations of apoCIII containing LDL, and apoCI concentration of apoCIII containing VLDL. There was no effect on VLDL and LDL particles that did not contain apoCIII or on apoB concentrations. In conclusion, methyltestosterone, when administered to surgically postmenopausal women taking esterified estrogen, has a selective effect to reduce the apoCIII concentration in VLDL and LDL, a predictor of CHD. Methyltestosterone may lower plasma triglycerides through a reduction in apoCIII.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zotti, G. De; Negrello, M.; Castex, G.

We review aspects of Cosmic Microwave Background (CMB) spectral distortions which do not appear to have been fully explored in the literature. In particular, implications of recent evidences of heating of the intergalactic medium (IGM) by feedback from active galactic nuclei are investigated. Taking also into account the IGM heating associated to structure formation, we argue that values of the y parameter of several × 10{sup −6}, i.e. a factor of a few below the COBE/FIRAS upper limit, are to be expected. The Compton scattering by the re-ionized plasma also re-processes primordial distortions, adding a y-type contribution. Hence no pure Bose-Einstein-likemore » distortions are to be expected. An assessment of Galactic and extragalactic foregrounds, taking into account the latest results from the Planck satellite as well as the contributions from the strong CII and CO lines from star-forming galaxies, demonstrates that a foreground subtraction accurate enough to fully exploit the PIXIE sensitivity will be extremely challenging. Motivated by this fact we also discuss methods to detect spectral distortions not requiring absolute measurements and show that accurate determinations of the frequency spectrum of the CMB dipole amplitude may substantially improve over COBE/FIRAS limits on distortion parameters. Such improvements may be at reach of next generation CMB anisotropy experiments. The estimated amplitude of the Cosmic Infrared Background (CIB) dipole might be detectable by careful analyses of Planck maps at the highest frequencies. Thus Planck might provide interesting constraints on the CIB intensity, currently known with a ≅ 30% uncertainty.« less

Overexpression of the DNA mismatch repair factor, PMS2, confers hypermutability and DNA damage tolerance.

PubMed

Gibson, Shannon L; Narayanan, Latha; Hegan, Denise Campisi; Buermeyer, Andrew B; Liskay, R Michael; Glazer, Peter M

2006-12-08

Inherited defects in genes associated with DNA mismatch repair (MMR) have been linked to familial colorectal cancer. Cells deficient in MMR are genetically unstable and demonstrate a tolerance phenotype in response to certain classes of DNA damage. Some sporadic human cancers also show abnormalities in MMR gene function, typically due to diminished expression of one of the MutL homologs, MLH1. Here, we report that overexpression of the MutL homolog, human PMS2, can also cause a disruption of the MMR pathway in mammalian cells, resulting in hypermutability and DNA damage tolerance. A mouse fibroblast cell line carrying a recoverable lambda phage shuttle vector for mutation detection was transfected with either a vector designed to express hPMS2 or with an empty vector control. Cells overexpressing hPMS2 were found to have elevated spontaneous mutation frequencies at the cII reporter gene locus. They also showed an increase in the level of mutations induced by the alkylating agent, methynitrosourea (MNU). Clonogenic survival assays demonstrated increased survival of the PMS2-overexpressing cells following exposure to MNU, consistent with the induction of a damage tolerance phenotype. Similar results were seen in cells expressing a mutant PMS2 gene, containing a premature stop codon at position 134 and representing a variant found in an individual with familial colon cancer. These results show that dysregulation of PMS2 gene expression can disrupt MMR function in mammalian cells and establish an additional carcinogenic mechanism by which cells can develop genetic instability and acquire resistance to cytotoxic cancer therapies.