NASA Astrophysics Data System (ADS)
Arambalza, Udane; Ibarrola, Irrintzi; Navarro, Enrique; Urrutxurtu, Iñaki; Urrutia, Miren B.
2018-04-01
As an approach to elucidating the "value" of detritus as a food source for bivalves, we analysed the capability of the common cockle (Cerastoderma edule) to modulate feeding and digestive rates during acclimation to low and high food rations of detrital diets with either low (Juncus maritimus) or high digestibility (Enteromorpha spp.). On acclimation day 3, feeding rates were similar in cockles fed different detrita; however, the absorption rate was higher in cockles fed Enteromorpha spp. With J. maritimus, rising food rations promoted an exponential decrease in absorption efficiency, whereas with Enteromorpha spp., absorption efficiency was only marginally reduced. During acclimation, cockles improved the rate at which both detritus were assimilated by means of increasing ingestion rates while maintaining absorption efficiency. When the time-course of digestive carbohydrase activities was monitored during acclimation to either detritus or phytoplankton (Isochrysis galbana), we found that only phytoplankton promoted the induction of cellulase activity in the digestive glands of cockles. This response in cockles fed phytoplankton promoted an increase in the digestibility of Enteromorpha spp., but had no effect on the digestibility of J. maritimus.
Carballal, María J; Díaz, Seila; Villalba, Antonio
2005-10-01
Cysts with spores showing different degree of maturity and a single plasmodium were observed in the connective tissue of the turbellarian Paravortex cardii located in the digestive lumen of the cockle Cerastoderma edule. The study of spore morphology by transmission electron microscopy revealed that they correspond to an haplosporidian belonging to the genus Urosporidium. Spore ornaments were similar to those described from Urosporidium spisuli, infecting a nematode parasite of the Atlantic surf clam, Spisula solidissima.
Mercury bioaccumulation and decontamination kinetics in the edible cockle Cerastoderma edule.
Cardoso, P G; Grilo, T F; Pereira, E; Duarte, A C; Pardal, M A
2013-02-01
Mercury bioaccumulation and decontamination kinetics in the edible cockle Cerastoderma edule were studied through a mesocosms experiment after a medium-term exposure to the metal. The results revealed that the bivalve presented distinct bioaccumulation kinetics according to the different tissues. While the gills showed a linear accumulation pattern, the digestive gland and the entire organism presented a saturation model, with higher accumulation during the first 7d of exposure and lower during the rest of the time. In addition, the bioaccumulation rate was not proportional to the Hg concentration, since the organisms under lower contamination presented higher bioconcentration factors than the ones under higher contamination. Gills were the tissues with higher mercury accumulation capability. Concerning the decontamination phase, C. edule lost approximately 80% of the mercury after 24h exposure in clean seawater. Nevertheless, never reached the original condition, showing in the final (20 d detox), Hg levels (>0.5 ppm) higher than those allowed by the legislation regulating human food consumption. This represents a matter of concern for Human health. Copyright © 2012 Elsevier Ltd. All rights reserved.
Gomez-Bautista, M.; Ortega-Mora, L. M.; Tabares, E.; Lopez-Rodas, V.; Costas, E.
2000-01-01
Infective Cryptosporidium parvum oocysts were detected in mussels (Mytilus galloprovincialis) and cockles (Cerastoderma edule) from a shellfish-producing region (Gallaecia, northwest Spain, bounded by the Atlantic Ocean) that accounts for the majority of European shellfish production. Shellfish were collected from bay sites with different degrees of organic pollution. Shellfish harboring C. parvum oocysts were recovered only from areas located near the mouths of rivers with a high density of grazing ruminants on their banks. An approximation of the parasite load of shellfish collected in positive sites indicated that each shellfish transported more than 103 oocysts. Recovered oocysts were infectious for neonatal mice, and PCR-restriction fragment length polymorphism analysis demonstrated a profile similar to that described for genotype C or 2 of the parasite. These results demonstrate that mussels and cockles could act as a reservoir of C. parvum infection for humans. Moreover, estuarine shellfish could be used as an indicator of river water contamination. PMID:10788352
Mass mortalities in bivalve populations: A review of the edible cockle Cerastoderma edule (L.)
NASA Astrophysics Data System (ADS)
Burdon, Daryl; Callaway, Ruth; Elliott, Michael; Smith, Tim; Wither, Andrew
2014-10-01
Mass mortalities in bivalve populations have long been of particular concern, especially when the species supports a commercial fishery or is of conservation interest. Here we consider the evidence of mass mortalities of the edible cockle, Cerastoderma edule (L.). Through the construction of a conceptual model eight potential factors (or groups of factors) which may cause mass mortalities are identified and reviewed. These include: food limitation; density; oxygen depletion and organic loadings; temperature and salinity; parasites, pathogens and commensals; toxicants and other persistent pollutants; predation, and changes in sediment, suspended solids, topography and bathymetry. The interplay between factors in recognized and discussed based on evidence mainly from the published literature relating to temperate edible cockle beds. Anecdotal evidence is also reported from a structured survey of site-specific evidence provided by fisheries managers in England and Wales. Case studies from the UK and Europe indicate that there is often no single, clear generic cause of mass mortalities in cockle populations. The importance of linked site-specific scientific investigations and laboratory-based experiments to fill the gaps in our current understanding of mass mortalities in bivalve species is highlighted as necessary to take account of both local extrinsic and intrinsic factors.
Ong, E Z; Briffa, M; Moens, T; Van Colen, C
2017-09-01
The combined effect of ocean acidification and warming on the common cockle Cerastoderma edule was investigated in a fully crossed laboratory experiment. Survival of the examined adult organisms remained high and was not affected by elevated temperature (+3 °C) or lowered pH (-0.3 units). However, the morphometric condition index of the cockles incubated under high pCO 2 conditions (i.e. combined warming and acidification) was significantly reduced after six weeks of incubation. Respiration rates increased significantly under low pH, with highest rates measured under combined warm and low pH conditions. Calcification decreased significantly under low pH while clearance rates increased significantly under warm conditions and were generally lower in low pH treatments. The observed physiological responses suggest that the reduced food intake under hypercapnia is insufficient to support the higher energy requirements to compensate for the higher costs for basal maintenance and growth in future high pCO 2 waters. Copyright © 2017 Elsevier Ltd. All rights reserved.
Ricardo, Fernando; Pimentel, Tânia; Moreira, Ana S. P.; Rey, Felisa; Coimbra, Manuel A.; Rosário Domingues, M.; Domingues, Pedro; Costa Leal, Miguel; Calado, Ricardo
2015-01-01
Geographic traceability of seafood is key for controlling its quality and safeguarding consumers’ interest. The present study assessed if the fatty acid (FA) profile of the adductor muscle (AM) of fresh cockles (Cerastoderma edule) can be used to discriminate the origin of specimens collected in different bivalve capture/production areas legally defined within a coastal lagoon. Results suggest that this biochemical approach holds the potential to trace sampling locations with a spatial resolution <10 Km, even for areas with identical classification for bivalve production. Cockles further away from the inlet, i.e. in areas exposed to a higher saline variation, exhibited lower levels of saturated fatty acids, which are key for stabilizing the bilayer structure of cell membranes, and a higher percentage of polyunsaturated fatty acids, which enhance bilayer fluidity. Results suggest that the structural nature of the lipids present in the AM provides a stable fatty acid signature and holds potential for tracing the origin of bivalves to their capture/production areas. PMID:26084395
Vidal, A; Correa, J; Blanco, J
2009-07-01
The effect of cooking on the concentration and burden of domoic acid in two bivalve molluscs was studied. The Manila clam (Ruditapes philippinarum) and cockle (Cerastoderma edule) were subjected to steaming and boiling, respectively. In both cases, factorial plans were used to evaluate the effects of common cooking methods and the variations likely to take place during the cooking procedure (cooking time and salt concentration in both species, in addition to ethanol percentage in Manila clam). The domoic acid concentration and toxin content were affected by cooking in very different ways in the two species studied. The cockle lost a significant part of its domoic acid content, while the clam did not. Since the weight of the soft tissues in cooked bivalves was lower than in the raw samples in both species, the toxin concentration decreased less than the toxin burden in the cockle, while it increased in the clam, where the toxin burden did not change significantly. Among the cooking variables tested, only cooking time had a noticeable effect on the domoic acid content in the clam and cockle, with the bivalves that were cooked for a longer time having smaller amounts of toxin. It is clear that cooking affects the toxin concentration in bivalves in a way that is species specific. This characteristic must be taken into account when evaluating epidemiological information, establishing allowable toxin levels and in cases where pre-processing treatments such as cooking or similar methods are used in monitoring systems.
Desclaux, Céline; Russell-Pinto, Fernanda; de Montaudouin, Xavier; Bachelet, Guy
2006-06-01
A new Himasthlinae species, Curtuteria arguinae, is described as metacercariae from the cockle Cerastoderma edule (L.), collected at Banc d'Arguin (southwestern France). These metacercariae encysted preferentially in the mantle and also in the foot of cockles. Encysted and chemically excysted metacercariae were studied by light microscopy and scanning electron microscopy, respectively. Excysted metacercariae were elongated and curved ventrally. They bore a 33-spine circumoral collar. Sensory papillae were arranged around the oral sucker and also symmetrically along the ventral surface body, from the collar to the acetabulum. The dorsal and ventral tegument surfaces were densely packed with similar pointed spines. The posterior end of the body was without any spines. Among the Curtuteria species described previously, only Curtuteria haematopodis Smogorjewskaja and Iskova, 1966 had the same number of circumoral collar spines. A 6-yr field survey showed that the cockle population at Banc d'Arguin was subjected to a summer infection of C. arguinae. Curtuteria arguinae phenology of infection is characterized by interannual variability and seasonality (beginning in July-August and maximum in autumn). The first intermediate and final hosts remain unknown.
Arambalza, U; Ibarrola, I; Navarro, E; Urrutia, M B
2014-02-01
We analyzed the capacity of the common cockle Cerastoderma edule to utilize detrital food particles obtained from three different macrophytes: the vascular plant Juncus maritimus and two green macroalgae (Ulva lactuca and Enteromorpha sp.). We measured feeding and digestive parameters at three concentrations of detritus (0.5, 1.0 and 3.0 mm(3) l(-1)), so that functional relationships between ingestive and digestive processes could be assessed. Increasing concentrations of detritus (food) resulted in a reduction in filtering activity (clearance rate l h(-1)), but an increase in ingestion rate. Consequently, gut content also increased with increasing food concentration, irrespective of food type. In contrast, the trend followed by absorption efficiency with increasing ingestion rate was determined by food type, being significantly reduced (from 0.63 to 0.11) with Juncus but remaining almost constant with the green macroalgae (0.58 ± 0.07 with Ulva) or only minimally reduced (from 0.66 to 0.48 with Enteromorpha). This differential response had clear consequences for energy uptake: absorption rate increased with increasing particulate organic matter with Enteromorpha but decreased with Juncus. We discuss the possible role of digestive parameters such as digestibility, gut content and gut-residence time in the differential utilization of detrital matter from different vegetal origins by cockles.
Aly, W; Williams, I D; Hudson, M D
2014-03-01
Poole Harbour is typical of many heavily anthropologically impacted semi-enclosed estuarine coastal areas under pressure from metal pollution across the world. This study examined the physiological significance of metal burdens within that sensitive area, and assessed the potential use of metallothionein (MT) concentrations in two organisms: the common cockle (Cerastoderma edule) and the Mermaid's glove sponge (Haliclona oculata) for mapping the spatial extent of the biological response to metal contamination. A spectrophotometric method was applied for detection of MT in the bivalve, and for the first time to detect MT in sponges. The results show that while some metal concentrations in cockle and sponge tissues and in their surrounding environment (water and sediment) could be related to sources of metal contamination, MT values in the soft tissue of cockles and whole tissue of sponges are not. No relation could be found between MT in both cockles and sponges, and any of the tested metals (As, Cd, Cr, Cu, Pb, Hg, Ni, Ag, Sn, Zn). Furthermore, some of the lowest MT concentrations were detected in heavily polluted areas, indicating that MT concentrations in tested organisms are not exclusively associated with metal concentrations, as other environmental factors could affect induction of this protein. Organisms probably have a high tolerance to metal contamination and chronic exposure to a high level of contamination resulted in developing a variety of detoxification mechanisms. Results indicate that further study of metal stress in this type of ecosystem may need to examine other indicator species and/or apply a different biomonitoring technique. Copyright © 2013 Elsevier B.V. All rights reserved.
NASA Astrophysics Data System (ADS)
Arambalza, U.; Urrutia, M. B.; Navarro, E.; Ibarrola, I.
2010-10-01
Ingestion, enzymatic digestion and absorption of particulate detrital matter derived from six different vegetal sources by the common cockle Cerastoderma edule was analyzed in a series of seasonal experiments performed in March, May and October 2005. Two green macroalgae: Ulva lactuca and Enteromorpha sp; two vascular plants: Spartina maritima and Juncus maritimus, the red macroalgae Gracilaria gracilis; and the microalgae Isochrysis galbana were used in experiments. Detrital matter was elaborated by freeze-drying, grinding and sieving (< 63 μm) vegetal tissues. Mono-specific detrital diets of similar organic content (≈ 60-70%) were elaborated by mixing detritus with ashed silt. We measured i) the biochemical composition of different detritus, ii) physiological components of the absorptive balance (i.e. clearance, ingestion, rejection and absorption rate and absorption efficiency), iii) the capability of the digestive gland to hydrolyze carbohydrates from different detritus (digestibility), as well as iv) glandular cellulase and xylanase activities. Detritus type, season and the interaction detritus-season exerted significant effects upon all the physiological components of absorptive balance. Effects were light at the pre-absorptive level, however, huge variations associated to absorption efficiency promoted large significant differences in absorption rates (AR) of different kind of detritus: irrespective of season, highest values corresponded to cockles fed the green macroalgae ( Ulva and Enteromorpha) and lowest to those fed the vascular plant Juncus maritimus. Recorded significant differences in enzymatic digestibility among detritus were found to explain ≈ 40% of differences recorded in AR, and the following regression could be fitted: AR = 0.232 (± 0.032) * Digestibility + 0,072 (± 0.015); r 2 = 0.415; F = 51.036; p < 0.001. Digestibility of Ulva and Enteromorpha was found to be significantly correlated with cellulase activity in the digestive gland
Cockle infection by Himasthla quissetensis - II. The theoretical effects of climate change
NASA Astrophysics Data System (ADS)
de Montaudouin, Xavier; Blanchet, Hugues; Desclaux-Marchand, Céline; Bazairi, Hocein; Alfeddy, Nazik; Bachelet, Guy
2016-07-01
Numerous marine populations experience parasite pressure. This is the case of the cockles Cerastoderma edule which are often highly infected by trematode macroparasites. These parasites display a complex life cycle, with a succession of free-living and parasitic stages. Climate, and in particular temperature, is an important modulator of the transmission dynamics of parasites. Consequently, global change is thought to have implications for the epidemiology of infectious diseases. Using Himasthla quissetensis, a dominant parasite of cockles as 2nd intermediate host in Arcachon Bay (France), we used mathematical models of parasite emergence (cercariae) and parasite infection (metacercariae) in cockles as a function of water temperature, in order to study different scenarios of temperature increases. Globally, with a + 0.5 °C to + 6.0 °C simulation, cumulated emergence of cercariae and accumulation of metacercariae tended to decrease or stagnate, respectively. This is the consequence of a trade-off between sooner (spring) and later (autumn) cercariae emergence/infestation on one hand, and a longer inhibition period of cercariae emergence/infestation during the hottest days in summer. Using sea water temperature in Oualidia (Morocco) where mean annual sea temperature is 3 °C higher than in Arcachon Bay, our model predicted infestation all year long (no seasonality). The model gave a correct estimation of the total number of parasites that was expected in cockles. Conversely, observed infestation in Oualidia followed a seasonal pattern like in Arcachon Bay. These results suggest that, if temperature is a strong driver of parasite transmission, extrapolation in the framework of climate change should be performed with caution.
Trematode infection modulates cockles biochemical response to climate change.
Magalhães, Luísa; de Montaudouin, Xavier; Figueira, Etelvina; Freitas, Rosa
2018-10-01
Resulting mainly from atmospheric carbon dioxide (CO 2 ) build-up, seawater temperature rise is among the most important climate change related factors affecting costal marine ecosystems. Global warming will have implications on the water cycle, increasing the risk of heavy rainfalls and consequent freshwater input into the oceans but also increasing the frequency of extreme drought periods with consequent salinity increase. For Europe, by the end of the century, projections describe an increase of CO 2 concentration up to 1120 ppm (corresponding to 0.5 pH unit decrease), an increase in the water temperature up to 4 °C and a higher frequency of heavy precipitation. These changes are likely to impact many biotic interactions, including host-parasite relationships which are particularly dependent on abiotic conditions. In the present study, we tested the hypothesis that the edible cockle, Cerastoderma edule, exposed to different salinity, temperature and pH levels as proxy for climate change, modify the infection success of the trematode parasite Himasthla elongata, with consequences to cockles biochemical performance. The results showed that the cercariae infection success increased with acidification but higher biochemical alterations were observed in infected cockles exposed to all abiotic experimental stressful conditions tested. The present study suggested that changes forecasted by many models may promote the proliferation of the parasites infective stages in many ecosystems leading to enhanced transmission, especially on temperate regions, that will influence the geographical distribution of some diseases and, probably, the survival capacity of infected bivalves. Copyright © 2018 Elsevier B.V. All rights reserved.
Memecylon edule leaf extract mediated green synthesis of silver and gold nanoparticles
Elavazhagan, Tamizhamudu; Arunachalam, Kantha D
2011-01-01
We used an aqueous leaf extract of Memecylon edule (Melastomataceae) to synthesize silver and gold nanoparticles. To our knowledge, this is the first report where M. edule leaf broth was found to be a suitable plant source for the green synthesis of silver and gold nanoparticles. On treatment of aqueous solutions of silver nitrate and chloroauric acid with M. edule leaf extract, stable silver and gold nanoparticles were rapidly formed. The gold nanoparticles were characterized by UV-visible spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), energy dispersive X-ray analysis (EDAX) and Fourier transform infra-red spectroscopy (FTIR). The kinetics of reduction of aqueous silver and gold ions during reaction with the M. edule leaf broth were easily analyzed by UV-visible spectroscopy. SEM analysis showed that aqueous gold ions, when exposed to M. edule leaf broth, were reduced and resulted in the biosynthesis of gold nanoparticles in the size range 20–50 nm. TEM analysis of gold nanoparticles showed formation of triangular, circular, and hexagonal shapes in the size range 10–45 nm. The resulting silver nanoparticles were predominantly square with uniform size range 50–90 nm. EDAX results confirmed the presence of triangular nanoparticles in the adsorption peak of 2.30 keV. Further FTIR analysis was also done to identify the functional groups in silver and gold nanoparticles. The characterized nanoparticles of M. edule have potential for various medical and industrial applications. Saponin presence in aqueous extract of M. edule is responsible for the mass production of silver and gold nanoparticles. PMID:21753878
Memecylon edule leaf extract mediated green synthesis of silver and gold nanoparticles.
Elavazhagan, Tamizhamudu; Arunachalam, Kantha D
2011-01-01
We used an aqueous leaf extract of Memecylon edule (Melastomataceae) to synthesize silver and gold nanoparticles. To our knowledge, this is the first report where M. edule leaf broth was found to be a suitable plant source for the green synthesis of silver and gold nanoparticles. On treatment of aqueous solutions of silver nitrate and chloroauric acid with M. edule leaf extract, stable silver and gold nanoparticles were rapidly formed. The gold nanoparticles were characterized by UV-visible spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), energy dispersive X-ray analysis (EDAX) and Fourier transform infra-red spectroscopy (FTIR). The kinetics of reduction of aqueous silver and gold ions during reaction with the M. edule leaf broth were easily analyzed by UV-visible spectroscopy. SEM analysis showed that aqueous gold ions, when exposed to M. edule leaf broth, were reduced and resulted in the biosynthesis of gold nanoparticles in the size range 20-50 nm. TEM analysis of gold nanoparticles showed formation of triangular, circular, and hexagonal shapes in the size range 10-45 nm. The resulting silver nanoparticles were predominantly square with uniform size range 50-90 nm. EDAX results confirmed the presence of triangular nanoparticles in the adsorption peak of 2.30 keV. Further FTIR analysis was also done to identify the functional groups in silver and gold nanoparticles. The characterized nanoparticles of M. edule have potential for various medical and industrial applications. Saponin presence in aqueous extract of M. edule is responsible for the mass production of silver and gold nanoparticles.
Reece, Kimberly S; Scott, Gail P; Dang, Cécile; Dungan, Christopher F
2017-09-01
A monoclonal Perkinsus chesapeaki isolate was established from 1 of 10 infected Australian Anadara trapezia cockles. Morphological features were similar to those of described P. chesapeaki isolates, and also included a unique vermiform schizont cell-type. Perkinsus olseni-specific PCR primers amplified DNAs from all 10 cockles. Perkinsus chesapeaki-specific primers also amplified DNAs from 4/10 cockles, including DNA from the isolate source cockle. Three different sets of DNA sequences from the monoclonal isolate grouped with the homologous, previously deposited, P. chesapeaki sequences in phylogenetic analyses. In situ hybridization assays detected both P. chesapeaki and P. olseni cells in histological sections from the source cockle for monoclonal isolate ATCC PRA-425. Copyright © 2017 Elsevier Inc. All rights reserved.
Preliminary investigations into the aetiology and treatment of cockle, a sheep pelt defect.
Heath, A C; Cole, D J; Bishop, D M; Pfeffer, A; Cooper, S M; Risdon, P
1995-01-01
A defect of sheep pelts known as cockle, detectable after depilation, but usually first noted only in the pickled pelt or tanned stage of processing, was studied to establish causal factor(s) and effective treatments. In addition, data on the histology and seasonal prevalence of the disease were obtained. Samples collected soon after slaughter from pelts identified at the pickled pelt stage as having cockle, had a superficial dermatitis with infiltration of eosinophils. This may represent an immediate hypersensitivity reaction of the sheep to lice. Treatments of sheep with either insecticides, disinfectants or shearing showed that where biting lice (Bovicola ovis) were removed, cockle lesions had either disappeared or regressed on pickled pelts. In Trial 1 diazinon reduced cockle prevalence and severity substantially; cypermethrin had a less pronounced effect. In Trial 2 diazinon, cypermethrin, Hibitane and Savlon were equally effective in reducing biting louse numbers as shown by counts of lice at 35 and 63 days post-treatment. Reduction of cockle on pelts from sheep slaughtered at 39 days post-treatment was achieved best by both diazinon and shearing. Examination of other pelts at 67 days post-treatment showed diazinon and Hibitane to be equally effective in reducing cockle. Furthermore, shearing in the absence of insecticides reduced the severity and extent of lesions on cockled pelts. The diazinon excipient and zinc sulphate were consistently poor at removing lice and reducing cockle prevalence and severity. The results have important implications for the leather industry in that shearing and good dipping practice with appropriate chemicals at the right time can lead to improved pelt quality. However, an incentive scheme for farmers, and a means of identifying individual pelts to the farms or origin, are both necessary before a marked improvement is likely to occur.
[The chayote, Sechium edule Swartz (Cucurbitaceae)].
Flores, E M
1989-06-01
Sechium edule (chayote) is a cucurbitaceus species. A fast transition from domestic crop to exportation product, made evident the lack of adequate information about the plant and the cultivation techniques. This work summarizes, reinterprets or describes comprehensively several aspects related to the taxonomy, origin, morphology, physiology, ecology and culture of the species.
NASA Astrophysics Data System (ADS)
Ekawati, ER; Yusmiati, S. N. H.
2018-01-01
Blood cockle (Anadara granosa) has high level of zinc and protein, which is beneficial for therapeutic function for malnourished particularly stunting case in children. Zinc in animal foods is more absorbable than that from vegetable food. Blood cockle (Anadara granosa) is rich in nutrient and an excellent environment for the growth of microorganisms. This research aimed to identify the contamination of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa). This was observation research with laboratory analysis. Salmonella sp. and Vibrio sp. were detected from blood cockle. Total plate count was determine of the total amount of the bacteria. Results detected from 20 samples of blood cockle showed that all samples were negative of Salmonella sp. and 1 sample positive Vibrio sp. The result of total plate count bacteria was < 5 x 105 colony/g sample.
Climate change impacts on potential recruitment in an ecosystem engineer
Morgan, Emer; O' Riordan, Ruth M; Culloty, Sarah C
2013-01-01
Climate variability and the rapid warming of seas undoubtedly have huge ramifications for biological processes such as reproduction. As such, gametogenesis and spawning were investigated at two sites over 200 km apart on the south coast of Ireland in an ecosystem engineer, the common cockle, Cerastoderma edule. Both sites are classed as Special Areas of Conservation (SACs), but are of different water quality. Cerastoderma edule plays a significant biological role by recycling nutrients and affecting sediment structure, with impacts upon assemblage biomass and functional diversity. It plays a key role in food webs, being a common foodstuff for a number of marine birds including the oystercatcher. Both before and during the study (early 2010–mid 2011), Ireland experienced its two coldest winters for 50 years. As the research demonstrated only slight variation in the spawning period between sites, despite site differences in water and environmental quality, temperature and variable climatic conditions were the dominant factor controlling gametogenesis. The most significant finding was that the spawning period in the cockle extended over a greater number of months compared with previous studies and that gametogenesis commenced over winter rather than in spring. Extremely cold winters may impact on the cockle by accelerating and extending the onset and development of gametogenesis. Whether this impact is positive or negative would depend on the associated events occurring on which the cockle depends, that is, presence of primary producers and spring blooms, which would facilitate conversion of this extended gametogenesis into successful recruitment. PMID:23532482
Senachai, Pachara; Chomvarin, Chariya; Namwat, Wises; Wongboot, Warawan; Wongwajana, Suwin; Tangkanakul, Waraluk
2013-03-01
A tetraplex PCR method was developed for simultaneous detection of Vibrio cholerae, V. parahaemolyticus, V. vulnificus and V. mimicus in cockle samples in comparison with conventional culture method. Specific primers targeting ompW of V. cholerae, tl of V. parahaemolyticus, hsp60 of V. vulnificus and sodB of V. mimicus were employed in the same PCR. Detection limit of the tetraplex PCR assay was 104 cfu/ml (400 cfu/PCR reaction) for pure cultures of all four species of Vibrio. In Vibrio spiked cockle samples, the limit of detection after 6 hours enrichment in alkaline peptone water was 1 cfu/10 g of cockle tissue for three Vibrio spp, except for V. mimicus that was 102 cfu/10 g of cockle tissue. When the tetraplex PCR and culture methods were applied to 100 cockle samples, V. parahaemolyticus, V. vulnificus, V. cholerae and V. mimicus were detected in 100, 98, 80 and 9% of the samples by tetraplex PCR and in 76, 42, 0 and 0% by the culture method, respectively. This developed tetraplex PCR method should be suitable for simultaneous and rapid detection of Vibrio species in food samples and for food safety assessment.
NASA Astrophysics Data System (ADS)
Mat Aris, S.; Muthusamy, K.; Uzer, A.; Ahmad, S. Wan
2018-04-01
Environmental pollution caused by the disposal of solid wastes generated from both palm oil industry and cockle shell trade has motivated researches to explore the potential of these wastes. Integrating these wastes in production of construction material is one of the ways to reduce amount of waste thrown at dumping area. Thus, the present investigation investigates the performance of palm oil fuel ash (POFA) cement sand brick containing pulverized cockle shell as partial fine aggregate replacement. All mixes used contain 20% of POFA as partial cement replacement. Total of six mixes were prepared by adding a range of pulverized cockle shell that is 0%, 10%, 20%, 30%, 40% and 50% as partial sand replacement. The mixes were prepared in form of brick. All the water cured samples were tested for compressive strength and flexural strength until 28 days. Findings show that brick produced using 20% pulverized cockle shell exhibit the highest compressive strength and flexural strength also the lowest water absorption value.
Mala, Wanida; Alam, Munirul; Angkititrakul, Sunpetch; Wongwajana, Suwin; Lulitanond, Viraphong; Huttayananont, Sriwanna; Kaewkes, Wanlop; Faksri, Kiatichai; Chomvarin, Chariya
2016-04-01
Vibrio parahaemolyticus is responsible for seafood-borne gastroenteritis worldwide. Isolates of V. parahaemolyticus from clinical samples (n=74) and cockles (Anadara granosa) (n=74) in Thailand were analyzed by serotyping, determination of virulence and related marker genes present, response to antimicrobial agents, and genetic relatedness. Serological analysis revealed 31 different serotypes, 10 of which occurred among both clinical and cockle samples. The clinical isolates commonly included the pandemic serogroup O3:K6, while a few of the cockle isolates exhibited likely pandemic serovariants such as O3:KUT and O4:KUT, but not O3:K6. The pandemic (orf8 gene-positive) strains were more frequently found among clinical isolates (78.4%) than cockle isolates (28.4%) (p<0.001). Likewise, the virulence and related marker genes were more commonly detected among clinical than cockle isolates; i.e., tdh gene (93.2% versus 29.7%), vcrD2 (97.3% versus 23.0%), vopB2 (89.2% versus 13.5%), vopT (98.6% versus 36.5%) (all p<0.001) and trh (10.8% versus 1.4%) (p<0.05). Pulsed-field gel electrophoresis of NotI-digested genomic DNA of 41 randomly selected V. parahaemolyticus isolates representing different serotypes produced 33 pulsotypes that formed 5 different clusters (clonal complexes) (A-E) in a dendrogram. Vibrio parahaemolyticus O3:K6 and likely related pandemic serotypes were especially common among the numerous clinical isolates in cluster C, suggesting a close clonal link among many of these isolates. Most clinical and cockle isolates were resistant to ampicillin. This study indicates that O3:K6 and its likely serovariants based on the PFGE clusters, are causative agents. Seafoods such as cockles potentially serve as a source of virulent V. parahaemolyticus, but further work is required to identify possible additional sources. Copyright © 2016. Published by Elsevier B.V.
Sudsandee, Suntorn; Tantrakarnapa, Kraichat; Tharnpoophasiam, Prapin; Limpanont, Yanin; Mingkhwan, Ratchaneekorn; Worakhunpiset, Suwalee
2017-06-01
There is global concern about heavy metal contamination in the environment. Adverse health effects can be caused by heavy metals in contaminated food and water. Therefore, environmental monitoring studies and risk assessments should be conducted periodically. In this study, we measured levels of Cd, Cr, Cu, Hg, Mn, Ni, Pb, and Zn in blood cockles (Anadara granosa) collected from three locations in the Upper Gulf of Thailand. Hazard quotients and hazard indices were calculated to evaluate the health risks posed by heavy metals in consumed blood cockles. Heavy metal concentrations in all of the blood cockle samples were lower than the relevant food standards. The hazard quotients and hazard indices were <1 in all three sampling areas, indicating that adverse health effects were not likely to be caused by exposure to heavy metals in blood cockles over a human lifetime.
NASA Astrophysics Data System (ADS)
Tiandho, Y.; Aldila, H.; Mustari; Megiyo; Afriani, F.
2018-05-01
Bangka Belitung Islands is the largest tin producer in Indonesia. The high activity of tin mining caused the environmental damage which had an impact on the emergence of clean water crisis in some areas in this province. In this paper, a simple water quality improvement method based on wasted cockle shell was developed. Based on x-ray diffraction analysis it is known that calcination of cockle shell powder at 700°C will decompose the powder into calcium oxide compound. The addition of calcined cockle shell powder into acidic water from Merawang Sub-district will increase the pH of water through the process of forming hydroxide groups in the water. The calcined cockle shell powder can also coagulate pollutants in some polluted water from Koba Sub-district. The coagulation results were analyzed using SEM/EDS.
NASA Astrophysics Data System (ADS)
Widyastuti, S.; Pramushinta, I. A.
2018-03-01
Prepared and characterized calcium carbonat calcite nanocrystals improves solubility. Calcium carbonat calcite nanocrystals were synthesized using precipitation method from the waste of blood clam cockle shells (Anadara granosa Linn). This study was conducted to analyze mineral composition of nanocrystals calcium carbonat calcite cockle (Anadara granosa) shell for calcium fortification of food applications and to evaluate the solubilities of Calsium and Phospor. The sample of nanocrystals from cockle shells was evaluated to determine the content of 11 macro-and micro-elements. These elements are Calcium (Ca), Magnesium (Mg), Sodium (Na), Phosphorus (P), Potassium (K), Ferrum (Fe), Copper (Cu), Nickel (Ni), Zink (Zn), Boron (B) and Silica (Si)). Cockleshell powders were found to contain toxic elements below detectable levels. The solubilities of Calcium and Phospor were p<0.05.
NASA Astrophysics Data System (ADS)
Asmi, D.; Zulfia, A.
2017-11-01
The prowess to reuse and recycle of blood cockle shells for raw material in bio-ceramics applications is an attractive component of integrated waste management program. In this paper an attempt is made to introduce a simple process to manufacture biogenic CaCO3 powder from blood cockle shells waste. The biogenic CaCO3 powder was produced from rinsing of blood cockle shells waste using deionised water and oxalic acid for cleaning the dirt and stain on the shells, then drying and grinding followed by heat treatment at 500 and 800 °C for 5 h. The powder obtained was characterised by XRF, DTA/TG, SEM, FTIR, and XRD analysis. The amount of 97.1 % CaO was obtained from XRF result. The thermal decomposition of CaCO3 become CaO due to mass loss was observed in the TG curve. The SEM result shows the needle-like aragonite morphology of blood cockle shells powder transformed to cubic-like calcite after heat treated at 500 °C. These results were consistent with FTIR and XRD results.
Rheological Characterization of Vegetal Pear (Sechium edule)
NASA Astrophysics Data System (ADS)
Castillo-Reyes, José A.; Luna-Solano, Guadalupe; Cantú-Lozano, Denis
2008-07-01
The national production of Mexican vegetal pear (Sechium edule) is located at the present time in more than 130,000 ton/year. The vegetal pear that produced in the center zone of the state of Veracruz is known in international markets; however it is a product that practically has not been studied. This work identifies the rheological behavior of vegetal pear (Sechium edule). A rheometer MCR301 of Anton Paar was utilized for viscosity and shear stress measurements. The objective of this experimental was modeling the rheological behavior of vegetal pear suspensions at three concentrations (1, 2 and 3% w/w), three particle size (1.00, 1.19 and 1.40 mm), at the same conditions of temperature (25, 40 and 70 °C). The results showed that all the suspensions there was a phenomenological behavior as a dilatants fluid (n>1) the performance of flow was represented by the Herschel-Bulkley model, and present values of "yield stress" between from 0.1 to 15 Pa for the different experiments. During evaluation of the activation energy of the suspensions of vegetal pear was found that decreases from 154.4039 kJ/mol to 9.1086 kJ/mol for a particle size of 1.00 mm to 1.4 mm, which implies that the effect of temperature is higher with smaller grains, in this case 1.00 mm. Furthermore, we assessed the effect of particle size by the Péclet number, showing an increase of the viscosity when the Péclet number also increases.
Kawasaki, Minami; Delamare-Deboutteville, Jerome; Dang, Cecile; Barnes, Andrew C
2013-12-01
In order to establish a successful relationship with their hosts, parasites must subvert or evade immune defences. Cockle Anadara trapezia and Sydney Rock oyster (SRO) Saccostrea glomerata live in the same location but only ark cockles are infected by sporocysts of hemiuroid trematode. This provides an opportunity to explore differing interactions between the parasite and the immune system of susceptible and refractive hosts. Rapid migration and encapsulation of sporocysts was observed by SRO hemocytes but not by cockle hemocytes. This migration/encapsulation was inhibited by N-acetylglucosamine or N-acetylgalactosamine but not by the other sugars, implicating specific surface carbohydrates in immune detection. Effector responses of hemocytes were investigated in vitro in terms of production of reactive oxygen production (ROS). Hemocytes of both species strongly reacted to Zymosan, but only SRO hemocytes responded to live sporocysts. Neither species' hemocytes produced ROS in the presence of dead/fixed sporocysts, and there was no suppression of Zymosan-induced respiratory burst by sporocysts. This suggests that immune escape is mediated by avoiding encapsulation, perhaps through molecular mimicry. Membrane-shaving with proteases indicated that sporocyst surface proteins are not a key factors in hemocytic detection. Surface carbohydrates of SRO and cockle hemocytes and of sporocysts were profiled with a panel of biotinylated lectins. This revealed substantial differences between cockle and SRO hemocytes, but greater similarity between cockle hemocytes and sporocysts. Results suggest that surface carbohydrates play an integral role in hemocyte immunorecognition and that surface carbohydrate molecular mimicry is a potential strategy for immune evasion in cockles by hemiuroid trematode sporocysts. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.
Navarro, Enrique; Méndez, Soco; Urrutia, Miren Begoñe; Arambalza, Udane; Ibarrola, Irrintzi
2016-09-01
Differential utilization of phytoplankton and detrital particles present in natural sediments of mud-flats was studied in a series of experiments performed on the infaunal bivalve Cerastoderma edule. In order to assess digestive selection, parameters of food processing (organic ingestion rate: OIR, gross absorption efficiency: GAE and gut passage time: GPT) were recorded for each organic component in different combinations of food particles radio-labelled with (14)C. Experimental design included the use of both labelled diets of a sole organic component and cross-labelled diets; i.e., mixed suspensions presenting alternatively labelled one of the various components tested: phytoplankton cells, sedimentary organic particles and particulate detritus from vascular salt-marsh plants. Preferential absorption of phytoplankton was accounted for by absorption efficiency values that were two-fold those for sedimentary detritus when recorded with mixed diets of both organic components. Two factors contributed to this difference: a) higher digestibility of microalgae, measured as the ratio of GAE to GPT, and b) faster gut passage of detrital particles that results from digestive selection likely involving the preferential incorporation of phytoplankton into the digestive gland. However, when diets based on a sole organic component (either phytoplankton or detritus) were compared, larger GPT were recorded for detrital particles that enabled improving GAE of this rather refractory food. Overall results of these experiments are consistent with most studies in trophic ecology based on stable isotopes enrichment, concerning both the diversity of trophic sources used by marine bivalves and its preferential utilization of phytoplankton over phyto-detritus. Copyright © 2016 Elsevier Ltd. All rights reserved.
Yingkajorn, Mingkwan; Sermwitayawong, Natthawan; Palittapongarnpimp, Prasit; Nishibuchi, Mitsuaki; Robins, William P; Mekalanos, John J; Vuddhakul, Varaporn
2014-05-01
Correlation between the numbers of Vibrio parahaemolyticus and its specific bacteriophages in cockles was investigated from June 2009 to May 2010 in Hat Yai, Songkhla, Thailand. Cockles obtained monthly from a local market were sampled to determine the numbers of V. parahaemolyticus and bacteriophages that could form plaques on ten strains of pandemic and nonpandemic V. parahaemolyticus. In addition, V. parahaemolyticus isolates from clinical samples from Hat Yai hospital over the same period were investigated. All 139 cockles sampled were positive for V. parahaemolyticus. However, only 76 of them were positive for bacteriophages. During the testing period, the number of bacteriophages was not significantly correlated with the incidence of V. parahaemolyticus-infected patients, but the numbers of V. parahaemolyticus isolates from the cockle samples were closely related to the number of infected patients. The bacteriophages isolated from V. parahaemolyticus also infected Vibrio alginolyticus and Vibrio mimicus, suggesting that the broad host range of phages may be a factor of providing the possibility of their participation in the processes of genetic exchange between V. parahaemolyticus and closely related Vibrio spp. In conclusion, this study indicated that the number of V. parahaemolyticus in cockles may be a useful tool for predicting the relative risk of infection by V. parahaemolyticus in this area of Thailand.
NASA Astrophysics Data System (ADS)
Leopold, M. F.; Swennen, C.; De Bruijn, L. L. M.
Oystercatchers, Haematopus ostralegus, were tested for size selection in two prey species, cockles ( Cerastoderma edule) and mussels ( Mytilus edulis), under semi-natural, but strictly experimental, conditions that allowed recovery of all shells of prey items eaten. Within any patch of cockles offered, size was not an important selection criterion for the birds. The mean length of cockles consumed always differed less than 1 mm (the measuring accuracy) from the mean length of the cockles presented. When given a choice between patches of different prey quality, the birds tended to select patches according to their relative dominance status, with the most dominant bird feeding mainly in the patch where the prey items had the largest flesh contents. Less dominant birds were forced out of the preferred patch and obtained most of theif food from a patch of presumedly lower quality. One of these birds adapted its prey-handling method and its bill shape for efficient feeding in such a low quality pathc, and it continued feeding in that patch, even after the dominant conspecifics had been removed. In experiments with mussels as prey, the test bird did not select primarily on the basis of size but tended to eat those mussels that were easiest to open. It is concluded that size selection in oystercatchers that eat either cockles or mussels ends with the choice of a certain foraging patch. Within a patch of cockles of one year-class, which is the field condition for the majority of oystercatchers in the Wadden Sea, no selection for size occurs, because this would take too much extra searching time to be profitable.
Mohd Abd Ghafar, Syairah Liyana; Hussein, Mohd Zobir; Rukayadi, Yaya; Abu Bakar Zakaria, Md Zuki
2017-01-01
Calcium carbonate aragonite polymorph nanoparticles derived from cockle shells were prepared using surface functionalization method followed by purification steps. Size, morphology, and surface properties of the nanoparticles were characterized using transmission electron microscopy, field emission scanning electron microscopy, dynamic light scattering, zetasizer, X-ray powder diffraction, and Fourier transform infrared spectrometry techniques. The potential of surface-functionalized calcium carbonate aragonite polymorph nanoparticle as a drug-delivery agent were assessed through in vitro drug-loading test and drug-release test. Transmission electron microscopy, field emission scanning electron microscopy, and particle size distribution analyses revealed that size, morphology, and surface characterization had been improved after surface functionalization process. Zeta potential of the nanoparticles was found to be increased, thereby demonstrating better dispersion among the nanoparticles. Purification techniques showed a further improvement in the overall distribution of nanoparticles toward more refined size ranges <100 nm, which specifically favored drug-delivery applications. The purity of the aragonite phase and their chemical analyses were verified by X-ray powder diffraction and Fourier transform infrared spectrometry studies. In vitro biological response of hFOB 1.19 osteoblast cells showed that surface functionalization could improve the cytotoxicity of cockle shell–based calcium carbonate aragonite nanocarrier. The sample was also sensitive to pH changes and demonstrated good abilities to load and sustain in vitro drug. This study thus indicates that calcium carbonate aragonite polymorph nanoparticles derived from cockle shells, a natural biomaterial, with modified surface characteristics are promising and can be applied as efficient carriers for drug delivery. PMID:28572724
Tavakoly Sany, Seyedeh Belin; Hashim, Rosli; Rezayi, Majid; Salleh, Aishah; Rahman, Mohammad Azizur; Safari, Omid; Sasekumar, A
2014-07-15
The concentration of carcinogenic poly aromatic hydrocarbons (c-PAHs) present in water and sediment of Klang Strait as well as in the edible tissue of blood cockle (Anadara granosa) was investigated. The human health risk of c-PAHs was assessed in accordance with the standards of the United States Environmental Protection Agency (US EPA). The cancer risks of c-PAHs to human are expected to occur through the consumption of blood cockles or via gastrointestinal exposure to polluted sediments and water in Kalng Strait. The non-carcinogenic risks that are associated with multiple pathways based on ingestion rate and contact rates with water were higher than the US EPA safe level at almost all stations, but the non-carcinogenic risks for eating blood cockle was below the level of US EPA concern. A high correlation between concentrations of c-PAHs in different matrices showed that the bioaccumulation of c-PAHs by blood cockles could be regarded as a potential health hazard for the consumers. Copyright © 2014 Elsevier Ltd. All rights reserved.
Kittigul, Leera; Thamjaroen, Anyarat; Chiawchan, Suwat; Chavalitshewinkoon-Petmitr, Porntip; Pombubpa, Kannika; Diraphat, Pornphan
2016-06-01
Noroviruses are the most common cause of acute gastroenteritis associated with bivalve shellfish consumption. This study aimed to detect and characterize noroviruses in three bivalve shellfish species: oysters (Saccostrea forskali), cockles (Anadara nodifera), and mussels (Perna viridis). The virus concentration procedure (adsorption-twice elution-extraction) and a molecular method were employed to identify noroviruses in shellfish. RT-nested PCR was able to detect known norovirus GII.4 of 8.8 × 10(-2) genome copies/g of digestive tissues from oyster and cockle concentrates, whereas in mussel concentrates, the positive result was seen at 8.8 × 10(2) copies/g of digestive tissues. From August 2011 to July 2012, a total of 300 shellfish samples, including each of 100 samples from oysters, cockles, and mussels were collected and tested for noroviruses. Norovirus RNA was detected in 12.3 % of shellfish samples. Of the noroviruses, 7.7 % were of the genogroup (G) I, 2.6 % GII, and 2.0 % were mixed GI and GII. The detection rate of norovirus GI was 2.1 times higher than GII. With regards to the different shellfish species, 17 % of the oyster samples were positive, while 14.0 and 6.0 % were positive for noroviruses found in mussels and cockles, respectively. Norovirus contamination in the shellfish occurred throughout the year with the highest peak in September. Seventeen norovirus-positive PCR products were characterized upon a partial sequence analysis of the capsid gene. Based on phylogenetic analysis, five different genotypes of norovirus GI (GI.2, GI.3, GI.4, GI.5, and GI.9) and four different genotypes of GII (GII.1, GII.2, GII.3, and GII.4) were identified. These findings indicate the prevalence and distribution of noroviruses in three shellfish species. The high prevalence of noroviruses in oysters contributes to the optimization of monitoring plans to improve the preventive strategies of acute gastroenteritis.
NASA Astrophysics Data System (ADS)
Ng, Cher Siang; Low, Lai Kim; Chia, Lawrence H. L.
Live cockles were incubated in atmospheres containing different concentrations of carbon monoxide. Since CO combines more readily with myoglobin and haemoglobin than oxygen, the formation of in vivo deoxygenated haemoglobins and post mortem formation of methaemoglobin were retarded by the more stable carboxyhaemoglobin (HbCO). The bright red colour of the stable HbCO is retained during storage, giving the desired colour to the cockles. The colour of normal, chilled cockle meat deteriorated after 3 days ice storage while those treated with 50 and 100% CO retained the bright deep orange colour up to 10 days storage. Irradiation caused faster colour deterioration in both CO and non-CO treated samples. Vacuum packing influenced the colour of the cockles with irradiation and with CO treatments. In non-CO treated, irradiated samples, the effect of vacuum packing was not obvious. In CO treated, irradiated samples, vacuum packing retarded the deterioration of colour. Odour developments were influenced by irradiation, vacuum packing and storage temperature, and were not influenced by CO treatments. Irradiation suppressed the development of odour for the first 11 days storage (0°C) while vacuum packing depressed the odour by lowering its intensity instead. Odour development was slowed down by lowering the storage temperature. The odour of shucked cockles was rejected within one day at room temperature (26-28°C) while at 0°C the odour of the shucked cockles was still acceptable after 10 days. Suitable chemical indices for quality are K value and TVBN. Treatment with CO did not influence the K value development. Vacuum packing produced the highest K values after 19 days storage (0°C), while irradiated samples had higher K values than non-irradiated samples. The TVBN increased with storage and is an indicator of the odour development. The use of CO treatment extended the shelflife of the cockles based on appearance. A combination of CO treatment, vacuum packing, ice storage
Spatial heterogeneity in parasite infections at different spatial scales in an intertidal bivalve.
Thieltges, David W; Reise, Karsten
2007-01-01
Spatial heterogeneities in the abundance of free-living organisms as well as in infection levels of their parasites are a common phenomenon, but knowledge on parasitism in invertebrate intermediate hosts in this respect is scarce. We investigated the spatial pattern of four dominant trematode species which utilize a common intertidal bivalve, the cockle Cerastoderma edule, as second intermediate host in their life cycles. Sampling of cockles from the same cohort at 15 sites in the northern Wadden Sea (North Sea) over a distance of 50 km revealed a conspicuous spatial heterogeneity in infection levels in all four species over the total sample as well as among and within sampling sites. Whereas multiple regression analyses indicated the density of first intermediate upstream hosts to be the strongest determinant of infection levels in cockles, the situation within sites was more complex with no single strong predictor variable. However, host size was positively and host density negatively correlated with infection levels and there was an indication of differential susceptibility of cockle hosts. Small-scale differences in physical properties of the habitat in the form of residual water at low tide resulted in increased infection levels of cockles which we experimentally transferred into pools. A complex interplay of these factors may be responsible for within-site heterogeneities. At larger spatial scales, these factors may be overridden by the strong effect of upstream hosts. In contrast to first intermediate trematode hosts, there was no indication for inter-specific interactions. In other terms, the recruitment of trematodes in second intermediate hosts seems to be largely controlled by pre-settlement processes both among and within host populations.
USDA-ARS?s Scientific Manuscript database
In this study, cellulose (C) and cellulose nanocrystals (CN) were blended with chayote tuber (Sechium edule Sw.) starch (CS) in formulations cast into films. The films were conditioned at different storage temperatures and relative humidity (RH), and analyzed by mechanical tests, X-ray diffraction, ...
2014-01-01
Background Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. Methods The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005 - 5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. Result GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Conclusion Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative. PMID:24885234
Omoruyi, Beauty E; Afolayan, Anthony J; Bradley, Graeme
2014-05-23
Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005-5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative.
Determination of physiochemical properties of palm oil methyl ester catalyzed by waste cockle shells
NASA Astrophysics Data System (ADS)
Nasir, Nurul Fitriah; Latif, Noradila Abdul; Bakar, Sharifah Adzila Syed Abu; Rahman, Mohd Nasrull Abdul; Selamat, Siti Norhidayah; Nasharudin, Nurul Nadirah
2017-04-01
Waste cockle shell can be used as a source of calcium oxide (CaO) in catalyzing a transesterification reaction to produce biodiesel or fatty acid methyl ester (FAME). This aim of this paper is to determine the physicochemical properties of (FAME) which utilize waste cockle shells in the transesterification reaction process. In this study, the catalyst was prepared using high temperature furnace (700°C) for 4 h. The molar ratio of methanol to oil was fixed at 9:1 and the reaction temperature and catalyst concentration were varied from 65 -70 °C, and 10-30 wt. %, respectively for transesterification reaction. The reaction time was also fixed at 3 h. The analyzed physicochemical properties were density, viscosity, flash point and net heat of combustion. The results obtained from the analysis found that reaction temperature 65°C with 30% of catalyst concentration has produced the physical properties of FAME that comply the biodiesel standards. The results suggest that reaction temperature and catalyst concentration have influence on the value of physicochemical properties of FAME produced.
NASA Astrophysics Data System (ADS)
Widyastuti, Sri; Intan Ayu Kusuma, P.
2017-06-01
Calcium supplements can reduce the risk of osteoporosis, but they are not automatically absorbed in the gastrointestinal tract. Nanotechnology is presumed to have a capacity in resolving this problem. The preparation and characterization of calcium carbonate nano particle to improve the solubility was performed. Calcium carbonate nano particles were synthesized using precipitation method from cockle shells (Anadara granosa Linn). Samples of the cockle shells were dried in an oven at temperature of 50°C for 7 (seven) days and subsequently they were crushed and blended into fine powder that was sieved through 125-μm sieve. The synthesis of calcium carbonate nanocrystals was done by extracting using hydro chloride acid and various concentrations of sodium hydroxide were used to precipitate the calcium carbonate nano particles. The size of the nano particles was determined by SEM, XRD data, and Fourier transform infrared spectroscopy (FT-IR). The results of XRD indicated that the overall crystalline structure and phase purity of the typical calcite phase CaCO3 particles were approximately 300 nm in size. The method to find potential applications in industry to yield the large scale synthesis of aragonite nano particles by a low cost but abundant natural resource such as cockle shells is required.
Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero Del Mar; Cadena-Iñiguez, Jorge; Soto-Hernández, Marcos; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco
2017-07-25
The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC 50 1.85 µg·mL -1 ), but the lymphocytes were affected by the extract (IC 50 30.04 µg·mL -1 ). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL -1 . Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.
Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero del Mar; Cadena-Iñiguez, Jorge; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco
2017-01-01
The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC50 1.85 µg·mL−1), but the lymphocytes were affected by the extract (IC50 30.04 µg·mL−1). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL−1. Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents. PMID:28757593
NASA Astrophysics Data System (ADS)
Li, Jiaqi; Jiang, Zengjie; Zhang, Jihong; Mao, Yuze; Bian, Dapeng; Fang, Jianguang
2014-11-01
We evaluated the effect of pH on larval development in larval Pacific oyster ( Crassostrea gigas) and blood cockle ( Arca inflata Reeve). The larvae were reared at pH 8.2 (control), 7.9, 7.6, or 7.3 beginning 30 min or 24 h post fertilization. Exposure to lower pH during early embryonic development inhibited larval shell formation in both species. Compared with the control, larvae took longer to reach the D-veliger stage when reared under pH 7.6 and 7.3. Exposure to lower pH immediately after fertilization resulted in significantly delayed shell formation in the Pacific oyster larvae at pH 7.3 and blood cockle larvae at pH 7.6 and 7.3. However, when exposure was delayed until 24 h post fertilization, shell formation was only inhibited in blood cockle larvae reared at pH 7.3. Thus, the early embryonic stages were more sensitive to acidified conditions. Our results suggest that ocean acidification will have an adverse effect on embryonic development in bivalves. Although the effects appear subtle, they may accumulate and lead to subsequent issues during later larval development.
Srinivasan, R; Natarajan, D; Shivakumar, M S
2017-03-01
Memecylon edule Roxb. (Melastamataceae family) is a small evergreen tree reported as having ethnobotanical and pharmacological properties. The present study was aimed to investigate the spectral characterization and antibacterial activity of isolated pure compound (3β-hydroxyurs-12-en-28-oic acid (ursolic acid)) from Memecylon edule leaves by performing bioassay guided isolation method. The structure derivation of isolated compound was done by different spectral studies like UV, FT-IR, LC-MS, CHNS analysis, 1D ( 1 H, 13 C and DEPT-135) and 2D-NMR (HSQC and HMBC), respectively. About 99.29% purity of the compound was found in LC analysis. 1 H NMR spectrum results of compound shown 48 protons appear at different shielded region and most of the protons were present in aliphatic region. Whereas, 13 C NMR spectral data resulted seven methyl carbons (CH3), nine methylene carbons (CH2), seven methine carbons (CH) and six non-hydrogenated carbons (C) which are characteristic of pentacyclic triterpene. The isolated pure compound was tested for its antibacterial properties against targeted human pathogens by performing agar well diffusion, MIC and MBC assays and the result exhibits better growth inhibitory effects against S. epidermidis and S. pneumoniae, with the MIC values of 1.56 and 3.15μg/ml. The outcome of this study suggests that the bioactive compound is used for development of plant based drugs in pharmaceutical industry for combating microbial mediated diseases. Copyright © 2017 Elsevier B.V. All rights reserved.
Rahayu, Rachmawati Noviana; Irawan, Bambang; Soegianto, Agoes
2016-01-01
This study measured the levels of total mercury (tHg) in the whole tissues of cockles (Anadara granosa and A. antiquata) harvested from three estuaries of Western Lombok Island (WLI), Indonesia. This paper also evaluated the hazard level posed by the mercury in relation to the maximum residual limit for human consumption and to estimate the weekly intake and compare it with the provisional tolerable weekly intake (PTWI). The tHg concentrations in A. granosa ranged from 0.020 to 0.070 mg kg(-1), and those in A. antiquata were between 0.032 and 0.077 mg kg(-1) at all locations. All samples of cockles harvested from WLI contain tHg below the permissible limit for human consumption. The maximum weekly intakes for total mercury by coastal people range from 0.28 to 1.08 µg kg(-1) b.w., and they are below the recommended values of PTWI (5.6 µg kg(-1) b.w.). If it is assumed that 100% of the Hg in cockles is methyl mercury (MeHg), consumption of the indicated amounts at the measured values wouldn't exceed the MeHg PTWI (1.6 µg kg(-1) b.w.).
Aguiñiga-Sánchez, Itzen; Cadena-Íñiguez, Jorge; Santiago-Osorio, Edelmiro; Gómez-García, Guadalupe; Mendoza-Núñez, Víctor Manuel; Rosado-Pérez, Juana; Ruíz-Ramos, Mirna; Cisneros-Solano, Víctor Manuel; Ledesma-Martínez, Edgar; Delgado-Bordonave, Angel de Jesus; Soto-Hernández, Ramón Marcos
2017-12-01
Sechium edule (Jacq.) Sw. (Cucurbitaceae) is used in ethnomedicine, but the diversity of the varietal groups of this species has not often been considered. This is important because we previously reported that different variety of species exhibit different activities across different tumor cell lines. This study investigates the chemical composition and biological activities of extracts obtained from S. edule var. nigrum spinosum. The leukemia P388 cell line and mononuclear bone marrow cells (MNCBMs) were treated with the extract at a concentration ranging from 40 to 2370 μg/mL for cytotoxicity and viability assays. CD-1 mice were treated with 8-5000 mg/kg extract and monitored every hour for the first 24 h and subsequently for seven days for signs of toxicity (LD 50 ). In addition, the chromatographic profile of the extract was determined by HPLC. The extract inhibits the proliferation of both P388 cells and MNCBMs, with IC 50 values of 927 and 1911 μg/mL, respectively, but reduced the viability and induced the apoptosis of only leukemia cells. The LD 50 was higher than 5000 mg/kg, and this concentration did not alter the blood chemistry or cell count but doubled the mitotic index in the bone marrow. The HPLC showed the presence of cucurbitacins, phloridzin, naringenin, phloretin, apigenin, and gallic, chlorogenic, vanillic, p-hydroxybenzoic, caffeic, and p-coumaric acids. Sechium edule var. nigrum spinosum contains bioactive compounds that explain the antiproliferative and nutraceutical activities, and its lack of physiological side effects constitutes an added value to a widely consumed vegetable.
Mirsadeghi, Seiedeh Aghileh; Zakari, Mohamad Pauzi; Yap, Chee Kong; Shahbazi, Azadeh
2011-01-01
The concentration of carcinogenic polycyclic aromatic hydrocarbons (c-PAHs) present in the sediment and water of Peninsular Malaysia as well as in the cockle Anadara granosa was investigated. Samples were extracted and analysed with gas chromatography-mass spectrometry. The concentrations of total carcinogenic polycyclic aromatic hydrocarbons (t-PAHs) were measured between 0.80 +/- 0.04 to 162.96 +/- 14.74 ng/g wet weight (ww) in sediment, between 21.85 +/- 2.18 to 76.2 +/- 10.82 ng/L in water samples and between 3.34 +/- 0.77 to 46.85 +/- 5.50 ng/g ww in the cockle tissue. The risk assessment of probable human carcinogens in the Group B2 PAHs was calculated and assessed in accordance with the standards of the United States Environmental Protection Agency (US EPA). Case I in the toxicity assessment analysed the cancer risk to consumers of Malaysian blood cockle. Case II assessed the risk of cancer from exposure to PAHs from multiple pathways. The average cancer risk of case I and case II were found to be classifiable as unsafe according to the US EPA standard. The cancer risk due to c-PAHs acquired by the ingestion of blood cockle was (8.82 +/- 0.54) x 10-6 to (2.67 +/- 0.06) x 10(-2), higher than the US EPA risk management criterion. The non-cancer risks associated with multiple pathways in Kuala Gula, Kuala Juru and Kuala Perlis were higher than the U.S. EPA safe level, but the non-cancer risk for eating blood cockle was below the level of U.S. EPA concern.
Trejo-Moreno, Celeste; Castro-Martínez, Gabriela; Méndez-Martínez, Marisol; Jiménez-Ferrer, Jesús Enrique; Pedraza-Chaverri, José; Arrellín, Gerardo; Zamilpa, Alejandro; Medina-Campos, Omar Noel; Lombardo-Earl, Galia; Barrita-Cruz, Gerardo Joel; Hernández, Beatriz; Ramírez, Christian Carlos; Santana, María Angélica; Fragoso, Gladis; Rosas, Gabriela
2018-06-28
A recent ethnomedical survey on medicinal plants grown in Mexico revealed that Sechium edule (Jacq.) Sw. (Cucurbitaceae) is one of the most valued plant species to treat cardiovascular diseases, including hypertension. Fruits, young leaves, buds, stems, and tuberous roots of the plant are edible. Considering that endothelial dysfunction induced by Angiotensin II plays an important role in the pathogenesis of hypertension and is accompanied by a prooxidative condition, which in turn induces an inflammatory state, vascular remodeling, and tissue damage, and that S. edule has been reported to possess antioxidant, anti-inflammatory and antihypertensive activity, its capability to control endothelial dysfunction was also assessed. To assess in vivo the anti-endothelial dysfunction activity of the acetone fraction (rSe-ACE) of the hydroalcoholic extract from S. edule roots. Endothelial dysfunction was induced in female C57BL/6 J mice by a daily intraperitoneal injection of angiotensin II for 10 weeks. Either rSe-ACE or losartan (as a control) were co-administered with angiotensin II for the same period. Blood pressure was measured at weeks 0, 5, and 10. Kidney extracts were prepared to determine IL1β, IL4, IL6, IL10, IL17, IFNγ, TNFα, and TGFβ levels by ELISA, along with the prooxidative status as assessed by the activity of antioxidant enzymes. The expression of ICAM-1 was evaluated by immunohistochemistry in kidney histological sections. Kidney and hepatic damage, as well as vascular tissue remodeling, were studied. The rSe-ACE fraction administered at a dose of 10 mg/kg was able to control hypertension, as well as the prooxidative and proinflammatory status in kidney as efficiently as losartan, returning mice to normotensive levels. Additionally, the fraction was more efficient than losartan to prevent liver and kidney damage. Phytochemical characterization identified cinnamic acid as a major compound, and linoleic, palmitic, and myristic acids as the most
Growth chronology of Greenland Cockles (Serripes groenlandicus) from Bear Island, Svalbard, Norway
NASA Astrophysics Data System (ADS)
Carroll, Michael; Ambrose, William; Locke, William; Wanamaker, Alan
2017-04-01
Climate change is occurring rapidly in the Arctic, and observing the links between environmental drivers and biological effects can provide key information on the ecosystem consequences of climate change. Analysis of shell-based records of mollusks (sclerochronology) provides an effective and expanding approach to reconstructing environmental-ecological linkages. In particular, annually resolved archives can be key indicators of how climate change manifests in the marine ecosystem. We developed a master growth chronology of the Greenland Cockle (Serripes groenlandicus) from Bear Island (Bjørnøya), Svalbard, Norway (74°41'N, 18°56'E) from analysis of annual shell increments. The chronology was developed from 20 individuals ranging in age from 24 to 45 years old (the oldest known individuals of this species to date). The chronology, expressed as a standardized growth index (SGI), extended from 1968 to 2012 and exhibited a cyclical pattern, with decadal periods of high growth, alternating with slower growth intervals. We also identified significant relationships between large-scale climate regimes (e.g. NAO, AMO), local environmental conditions (e.g. sea temperature, sea ice), and shell growth. Additionally, growth chronologies, and environmental linkages were compared from this, near the southern extent of the Barents Sea polar front, with other Arctic locations influenced by different water masses to examine the nature of the environmental regulation on shell growth of this species in the Barents Sea and Arctic Ocean. We conclude that the Greenland Cockle is quite sensitive to environmental changes over annual to decadal scales and therefore can serve as a proxy of climate change effects on ecosystem processes in the Arctic.
Rahman, M M; Zamri, M; Fadilla, N
2012-06-15
This study was conducted to determine the proximate composition and four micronutrients (Cd, Cu, Mn and Zn) of Indian Mackerel (Rastrelliger kanagurta), Eel (Monopterus albus) and Cockle (Anadara granosa). All fish and shellfish were purchased from local fish market in Kuantan city. All samples of each species were mixed and divided into two groups based on random selection. Each group were again divided into 3 sub-groups which were considered as replications. The first group were kept uncooked. The second group were fried in a beaker of 400 mL palm cooking oil capacity at a temperature approximately of 180 degrees C for a 15 min period. Both raw and fried samples were analysed following standard methods to determine protein, lipid, ash, moisture, carbohydrate, Cd, Cu, Mn and Zn contents. Results showed that protein content was higher in Indian mackerel and eel than cockle while overall Cd, Cu, Mn and Zn contents were higher in cockle than Indian mackerel and eel. Therefore, fish is better than shellfish in the nutritional point of view. Fried fish and shellfish had very high fat content. Therefore, frying cannot be recommended to prepare a healthy diet. More research is needed including all cooking methods of fish to know the nutritional changes by each cooking method. Fish contains many important fatty acids and amino acids which might be lost during frying. Therefore, future study should include the effects of different cooking methods on amino acids and fatty acids compositions of fish and shellfish.
NASA Astrophysics Data System (ADS)
Magyar, Imre; Cziczer, István; Sztanó, Orsolya; Dávid, Árpád; Johnson, Michael
2016-12-01
Stratigraphic subdivision of the Upper Miocene deposits in the Pannonian Basin has been traditionally based on the endemic mollusc species of Lake Pannon. The cockle species Lymnocardium soproniense Vitális, apparently evolving through a sympatric speciation event in the sublittoral zone of Lake Pannon about 10.2-10.3 Ma, attained wide geographical distribution in the Pannonian basin and thus may serve as a good stratigraphic marker. Lymnocardium soproniense was one of the few large-sized cockles in Lake Pannon, most closely related to its ancestor, L. schedelianum (Fuchs), and to another descendant of the latter, L. variocostatum Vitális. According to the δ18O stable isotope record of its shells, the large size of L. soproniense was coupled with an extended life time of more than 10 years, probably reflecting a stable lake environment with increased resource availability and decreased predation. The species lived in quiet offshore conditions, below the storm wave base, where clay was deposited from suspension and the influence of currents was negligible. The base of the Lymnocardium soproniense Zone in the sublittoral deposits of Lake Pannon is defined by the first occurrence of the species, whereas the top of the zone is marked with the base of the overlying Congeria praerhomboidea Zone, defined by the FAD of C. praerhomboidea.
Cadmium and lead in blood cockle (Anadara granosa) from Asajaya, Sarawak, Malaysia.
Hossen, Md Faruk; Hamdan, Sinin; Rahman, Md Rezaur
2014-01-01
The concentrations were ranged from 1.35 ± 0.16 to 2.22 ± 0.34 µg/g (dry weight) and 2.65 ± 0.34 to 4.36 ± 0.53 µg/g (dry weight) for Cd and Pb, respectively, in blood cockle Anadara granosa from four sites of Sabang River, namely, Kampung Sambir, Kampung Tambirat, Beliong Temple, and Kampung Tanjung Apong, which are located at Asajaya, Sarawak, Malaysia. All values exceeded safety limits set by Malaysian Food Regulation (1985). It may be the cause of serious human health problems after long term consumption. Thus, consumer should have consciousness about such type of seafood from mentioned sites and need further investigation.
Cadmium and Lead in Blood Cockle (Anadara granosa) from Asajaya, Sarawak, Malaysia
Hossen, Md. Faruk; Hamdan, Sinin; Rahman, Md. Rezaur
2014-01-01
The concentrations were ranged from 1.35 ± 0.16 to 2.22 ± 0.34 µg/g (dry weight) and 2.65 ± 0.34 to 4.36 ± 0.53 µg/g (dry weight) for Cd and Pb, respectively, in blood cockle Anadara granosa from four sites of Sabang River, namely, Kampung Sambir, Kampung Tambirat, Beliong Temple, and Kampung Tanjung Apong, which are located at Asajaya, Sarawak, Malaysia. All values exceeded safety limits set by Malaysian Food Regulation (1985). It may be the cause of serious human health problems after long term consumption. Thus, consumer should have consciousness about such type of seafood from mentioned sites and need further investigation. PMID:25538965
Impact of high pCO2 on shell structure of the bivalve Cerastoderma edule.
Milano, Stefania; Schöne, Bernd R; Wang, Schunfeng; Müller, Werner E
2016-08-01
Raised atmospheric emissions of carbon dioxide (CO2) result in an increased ocean pCO2 level and decreased carbonate saturation state. Ocean acidification potentially represents a major threat to calcifying organisms, specifically mollusks. The present study focuses on the impact of elevated pCO2 on shell microstructural and mechanical properties of the bivalve Cerastoderma edule. The mollusks were collected from the Baltic Sea and kept in flow-through systems at six different pCO2 levels from 900 μatm (control) to 24,400 μatm. Extreme pCO2 levels were used to determine the effects of potential leaks from the carbon capture and sequestration sites where CO2 is stored in sub-seabed geological formations. Two approaches were combined to determine the effects of the acidified conditions: (1) Shell microstructures and dissolution damage were analyzed using scanning electron microscopy (SEM) and (2) shell hardness was tested using nanoindentation. Microstructures of specimens reared at different pCO2 levels do not show significant changes in their size and shape. Likewise, the increase of pCO2 does not affect shell hardness. However, dissolution of ontogenetically younger portions of the shell becomes more severe with the increase of pCO2. Irrespective of pCO2, strong negative correlations exist between microstructure size and shell mechanics. An additional sample from the North Sea revealed the same microstructural-mechanical interdependency as the shells from the Baltic Sea. Our findings suggest that the skeletal structure of C. edule is not intensely influenced by pCO2 variations. Furthermore, our study indicates that naturally occurring shell mechanical property depends on the shell architecture at μm-scale. Copyright © 2016 Elsevier Ltd. All rights reserved.
Omoruyi, Beauty Etinosa; Afolayan, Anthony Jide; Bradley, Graeme
2014-01-01
Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could help to verify the efficacy of the plant in the management or treatment of these illnesses. Various concentrations of the hydro-distilled essential oil, ranging from 0.005-5 mg/ml, were tested against some fungal strains, using the micro-dilution method. Minimum inhibitory activity was compared with four other different crude extracts of hexane, acetone, ethanol and aqueous samples from the same plant. The chemical composition of the essential oil, hexane, acetone and ethanol extracts was determined using GC-MS. GC/MS analysis of the essential oil resulted in the identification of 28 compounds, representing 99.99% of the total oil. Phytoconstituents of hexane, acetone and ethanol extracts yielded a total peak chromatogram of fifty nine compounds. A total amount of 10.6% and 36.61% of the constituents were obtained as monoterpenes and oxygenated monoterpenes. Sesquiterpene hydrocarbons (3.58%) were relatively low compared to the oxygenated sesquiterpenes (9.28%), while the major concentrated diterpenes and oxygenated diterpenes were 1.43% and 19.24 %, respectively and phytol 12.41%. Total amount of fatty acids and their methyl esters content, present in the oil extract, were found to be 19.25 %. Antifungal activity of the oil extract and four solvent extracts were tested against five pathogenic fungal strains. The oil extract showed antifungal activity against Candida albican, Candida krusei, Candida rugosa, Candida glabrata and Cryptococcus neoformans with MIC ranges of 0.02 0.31 mg/ml. Hexane extract was active against the five fungal strains with MICs ranging between 0.02-1.25 mg/ml. Acetone extracts were active against C. krusei only at 0.04mg/ml. No
Low molecular weight squash trypsin inhibitors from Sechium edule seeds.
Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J
2006-02-01
Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.
Shellfish dredging pushes a flexible avian top predator out of a marine protected area.
van Gils, Jan A; Piersma, Theunis; Dekinga, Anne; Spaans, Bernard; Kraan, Casper
2006-11-01
There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called "marine protected areas" (MPAs), which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule). Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica), a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell). From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives.
Shellfish Dredging Pushes a Flexible Avian Top Predator out of a Marine Protected Area
van Gils, Jan A; Piersma, Theunis; Dekinga, Anne; Spaans, Bernard; Kraan, Casper
2006-01-01
There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called “marine protected areas” (MPAs), which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule). Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica), a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell). From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives. PMID:17105350
Waste cockle shell as natural catalyst for biodiesel production from jatropha oil
NASA Astrophysics Data System (ADS)
Hadi, Norulakmal Nor; Idrus, Nur Afini; Ghafar, Faridah; Salleh, Marmy Roshaidah Mohd
2017-12-01
Due to the increasing of industrialization and modernization of the world, the demand of petroleum has risen rapidly. The increasing demand for energy and environmental awareness has prompted many researches to embark on alternative fuel platforms that are environmentally acceptable. In this study, jatropha oil was used to produce biodiesel by a new transesterification routine in which cockle shell was used as source of heterogeneous catalyst. The investigation showed the catalyst that was calcined at temperature of 800 °C has the optimum capability to produce high yield. The highest yield of biodiesel production of 93.20 % were obtained by using 1.5 wt% of catalyst. The reaction was conducted at a temperature of 65 °C with the optimum methanol to oil ratio of 6:1. It was found that the physical properties of the biodiesel produced were significant to ASTM standard of fatty acid methyl ester (FAME).
NASA Astrophysics Data System (ADS)
Khalil, Munawar; Yasin, Zulfigar; Hwai, Tan Shau
2017-03-01
A study on the reproductive cycle of the blood cockle Anadara granosa (Bivalvia: Arcidae) was conducted at three different areas in the northern region of the Strait of Malacca. A total of 1,920 samples of adult A. granosa (38-71 mm length) were collected from June 2009 until September 2010. Qualitative techniques (gonadal microscopic fresh smear test and histology analysis) as well as quantitative techniques (analysis of condition index and gonadal index) were used to predict monthly gonadal development stages of A. granosa. The gonadal index of A. granosa from Banda Aceh (Indonesia) ( r = 0.469, P > 0.05) and Pulau Pinang (Malaysia) ( r = 0.123, P > 0.05) did not show any correlation to their condition index, whereas the gonadal index of A. granosa from Lhokseumawe (Indonesia) ( r = 0.609, P < 0.05) showed moderate positive correlation to the condition index. During the 16 month sampling period, four reproductive cycles were observed: each from three to six months. The process of releasing gametes is termed dribble spawning, and is the same in all populations. The principle component analysis (PCA) indicated that A. granosa reproduction was affected by interaction between internal physiological factors and indigenous environmental factors. In all sampling areas, phytoplankton density played a key role in the reproductive cycle in A. granosa. Information on the reproductive biology of this species is essential for species management and to improve the sustainability practices of the fisheries industry. These findings will provide basic information on the biology of the blood cockle A. granosa for stock management in the region.
Di Bella, Giuseppa; Potortì, Angela Giorgia; Licata, Patrizia; Pellizzeri, Vito; Ben Mansour, Hedi; Dugo, Giacomo; Lo Turco, Vincenzo
2018-06-01
Two species of edible clams Venerupis aurea laeta and Cerastoderma edule glaucum from Ganzirri Lake (Sicily, Italy) were investigated to determine OCP and PCB residues by GC-MS. Thirty-five samples were examined for two years in order to perform: a) their actual contamination; b) the daily dietary exposure of seafood consumers to the pollutants in question. In all the clams analysed in this study, PCB and OCP (4,4'-DDE) residues are always below the limits fixed by law. It seems that there is some seasonality of concentrations observed. In fact the more high concentrations of residues are detected in the hot months, for both species and years. Given the consumption of clams and the values obtained in this study for the two species analysed, it is possible estimate that the average daily dietary intake of NDL-PCB and of 4,4'-DDE for adults is really low.
NASA Astrophysics Data System (ADS)
Brom, Krzysztof Roman; Szopa, Krzysztof
2016-12-01
Environmental adaptation of molluscs during evolution has led to form biomineral exoskeleton - shell. The main compound of their shells is calcium carbonate, which is represented by calcite and/or aragonite. The mineral part, together with the biopolymer matrix, forms many types of microstructures, which are differ in texture. Different types of internal shell microstructures are characteristic for some bivalve groups. Studied bivalve species (freshwater species - duck mussel (Anodonta anatina Linnaeus, 1758) and marine species - common cockle (Cerastoderma edule Linnaeus, 1758), lyrate Asiatic hard clam (Meretrix lyrata Sowerby II, 1851) and blue mussel (Mytilus edulis Linnaeus, 1758)) from different locations and environmental conditions, show that the internal shell microstructure with the shell morphology and thickness have critical impact to the ability to survive in changing environment and also to the probability of surviving predator attack. Moreover, more detailed studies on molluscan structures might be responsible for create mechanically resistant nanomaterials.
Jaji, Alhaji Zubair; Bakar, Md Zuki Bin Abu; Mahmud, Rozi; Loqman, Mohamad Yusof; Hezmee, Mohamad Noor Mohamad; Isa, Tijani; Wenliang, Fu; Hammadi, Nahidah Ibrahim
2017-01-01
Calcium carbonate is a porous inorganic nanomaterial with huge potential in biomedical applications and controlled drug delivery. This study aimed at evaluating the physicochemical properties and in vitro efficacy and safety of cockle shell aragonite calcium carbonate nanocrystals (ANC) as a potential therapeutic and hormonal delivery vehicle for osteoporosis management. Free and human recombinant parathyroid hormone 1-34 (PTH 1-34)-loaded cockle shell aragonite calcium carbonate nanocrystals (PTH-ANC) were synthesized and evaluated using standard procedures. Transmission electron microscopy and field emission scanning electron microscopy results demonstrated highly homogenized spherical-shaped aragonite nanocrystals of 30±5 nm diameter. PTH-ANC had a zeta potential of -27.6±8.9 mV. The encapsulation efficiency of the formulation was found to be directly proportional to the concentrations of the drug fed. The X-ray diffraction patterns revealed strong crystallizations with no positional change of peaks before and after PTH-ANC synthesis. Fourier transform infrared spectroscopy demonstrated no detectable interactions between micron-sized aragonite and surfactant at molecular level. PTH-ANC formulation was stabilized at pH 7.5, enabling sustained slow release of PTH 1-34 for 168 h (1 week). A 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide cytocompatibility assay in Human Foetal Osteoblast Cell Line hFOB 1.19 showed that ANC can safely support osteoblast proliferation up to 48 h whereas PTH-ANC can safely support the proliferation at 72 h and beyond due to the sustained slow release of PTH 1-34. It was concluded that due to its biogenic nature, ANC is a cytocompatible antiosteoporotic agent. It doubles as a nanocarrier for the enhancement of efficacy and safety of the bone anabolic PTH 1-34. ANC is expected to reduce the cost, dosage, and dose frequency associated with the use of PTH 1-34 management of primary and secondary forms of osteoporosis.
Jaji, Alhaji Zubair; Bakar, Md Zuki Bin Abu; Mahmud, Rozi; Loqman, Mohamad Yusof; Hezmee, Mohamad Noor Mohamad; Isa, Tijani; Wenliang, Fu; Hammadi, Nahidah Ibrahim
2017-01-01
Calcium carbonate is a porous inorganic nanomaterial with huge potential in biomedical applications and controlled drug delivery. This study aimed at evaluating the physicochemical properties and in vitro efficacy and safety of cockle shell aragonite calcium carbonate nanocrystals (ANC) as a potential therapeutic and hormonal delivery vehicle for osteoporosis management. Free and human recombinant parathyroid hormone 1-34 (PTH 1-34)-loaded cockle shell aragonite calcium carbonate nanocrystals (PTH-ANC) were synthesized and evaluated using standard procedures. Transmission electron microscopy and field emission scanning electron microscopy results demonstrated highly homogenized spherical-shaped aragonite nanocrystals of 30±5 nm diameter. PTH-ANC had a zeta potential of −27.6±8.9 mV. The encapsulation efficiency of the formulation was found to be directly proportional to the concentrations of the drug fed. The X-ray diffraction patterns revealed strong crystallizations with no positional change of peaks before and after PTH-ANC synthesis. Fourier transform infrared spectroscopy demonstrated no detectable interactions between micron-sized aragonite and surfactant at molecular level. PTH-ANC formulation was stabilized at pH 7.5, enabling sustained slow release of PTH 1-34 for 168 h (1 week). A 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide cytocompatibility assay in Human Foetal Osteoblast Cell Line hFOB 1.19 showed that ANC can safely support osteoblast proliferation up to 48 h whereas PTH-ANC can safely support the proliferation at 72 h and beyond due to the sustained slow release of PTH 1-34. It was concluded that due to its biogenic nature, ANC is a cytocompatible antiosteoporotic agent. It doubles as a nanocarrier for the enhancement of efficacy and safety of the bone anabolic PTH 1-34. ANC is expected to reduce the cost, dosage, and dose frequency associated with the use of PTH 1-34 management of primary and secondary forms of osteoporosis
Lalthansanga, James; Samanta, A K
2015-07-01
This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (p<0.01) as compared to G2, G3, and G4. Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.
Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).
Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito
2015-10-23
β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.
Extracts and Fractions from Edible Roots of Sechium edule (Jacq.) Sw. with Antihypertensive Activity
Lombardo-Earl, Galia; Roman-Ramos, Rubén; Zamilpa, Alejandro; Herrera-Ruiz, Maribel; Rosas-Salgado, Gabriela; Tortoriello, Jaime; Jiménez-Ferrer, Enrique
2014-01-01
Sechium edule is traditionally used in Mexico as a therapeutic resource against renal diseases and to control high blood pressure. The purpose of this work is to evaluate the antihypertensive effect of the hydroalcoholic extract obtained from the roots of this plant, including its fractions and subfractions, on different hypertension models induced with angiotensin II (AG II). The hydroalcoholic extract was tested on an in vitro study of isolated aorta rings denuded of endothelial cells, using AG II as the agonist; this assay proved the vasorelaxant effect of this extract. Vagotomized rats were administered different doses of AG II as well as the Hydroalcoholic extract, which reduced blood pressure in 30 mmHg approximately; subsequently this extract was separated into two fractions (acetone and methanol) which were evaluated in the acute hypertension mouse model induced with AG II, where the acetone fraction was identified as the most effective one and was subsequently subfractioned using an open chromatographic column packed with silica gel. The subfractions were also evaluated in the acute hypertension model. Finally, the extract, fraction, and active subfraction were analyzed by MS-PDA-HPLC, identifying cinnamic derivative compounds like cinnamic acid methyl ester. PMID:24812568
Lalthansanga, James; Samanta, A. K.
2015-01-01
Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). Results: During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (p<0.01) as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization. PMID:27047176
Eiders Somateria mollissima scavenging behind a lugworm boat
NASA Astrophysics Data System (ADS)
Leopold, Mardik F.
2002-02-01
The eider is one of the most important molluscivorous birds in the Wadden Sea, where it feeds mainly on blue mussels Mytilus edulis and edible cockles Cerastoderma edule. These prey species are within reach of the birds at all times. Other potential prey of suitable size that are abundantly present, such as several polychaete worms, or the clam Mya arenaria, are taken to a much lesser extent, possibly because they live buried in the sediment and digging them out would take too much effort. Mya may pose another problem because they grow to sizes that prevent eiders from swallowing them. Large Mya also live too deep down in the sediment, but young (small) specimens should be available to eiders. Yet, even these have only rarely been found as prey in eiders in the Wadden Sea. However, diet studies in relation to food abundance have been few, and may have missed prey that do not leave large shell fragments (i.e. in faeces studies). This paper describes observations on eiders taking both Mya and polychaete worms. The eiders fed on these prey in a fashion reminiscent of gulls that scavenge behind fishing vessels: some eiders have learnt to follow professional worm-digging boats that supply a bycatch of molluscs (mainly Mya arenaria) and polychaete worms (mainly Arenicola marina and Nephtys hombergii) .Mya and worms were also the main targets of the eiders that fed in a dense flock close to the boat's stern. Faeces found on the flats at low tide comprised mainly cockle shell fragments, a prey rarely taken by the eiders behind the boat. Faeces studies may thus give a highly biased impression of local eider diet.
Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra
2004-10-20
A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society
Study of copper (Cu) contents in blood cockles (Anadara sp.) at Surabaya coastal waters
NASA Astrophysics Data System (ADS)
Alfionita, S.; Pursetyo, K. T.; Sahidu, A. M.
2018-04-01
Heavy metal pollution categorized as harmful effect on the environment. This study aims to determine the content and the rate of accumulation of heavy metals copper (Cu) in the mussel of cockles (Anadara sp.) This study uses observation method with descriptive analysis. The test results Cu in sea water was <0.0223 mg/L. The results have exceeded the water quality standard according to state environmental ministerial decree number 51 2004 on marine water quality standards for marine biota maximum limit of Cu in sea water is 0.008 mg/L. Copper concentration in the sediment of 6.16 mg/kg at the Wonokromo station and at the Dadapan station is 4.03 mg/kg. According to the US-EPA in 2004 on the instructions of sediment pollution classification 49.98 mg Cu/kg. The results of shells fur Cu on Wonokromo was 1.833 mg/kg and Dadapan was 1.352 mg/kg. According to the MOH Decree No.0375/B/SK/1989 about Quality Standard Biota Consumption of Metals to the maximum limit of the existing Cu concentrations in marine biota was 20 ppm or 20 mg / kg so that the content of Cu in shellfish feathers still below the limit of existing quality standards.
Faça, Vitor M; Pereira, Sandra R; Laure, Hélen J; Greene, Lewis J
2004-07-01
The determination of the disulfide pairings of SETI-II, a trypsin inhibitor isolated from Sechium edule, is described herein. The inhibitor contains 31 amino acid residues per mol, 6 of which are cysteine. Forty-five nmol (160 microg) of SETI-II was hydrolyzed with 20 microg thermolysin for 48 hr at 45 degrees C, and peptides were separated by reverse phase high performance liquid chromatography (RP-HPLC). The major products were identified by amino acid composition, Edman degradation, and on the basis of the sequence of the inhibitor. The disulfide bridge pairings and (yields) are: Cys1-Cys4 (79%), Cys2-Cys5 (21%) and Cys3-Cys6 (43%). When the reduced inhibitor was reoxidized with glutathione reduced form (GSH)/glutathione oxidized form (GSSG) at pH 8.5 for 3 hr, full activity was recovered. These data show that disulfide bridge pairing and oxidation can be determined at nanomole levels and that sensitive and quantitative Edman degradation can eliminate the final time- and material-consuming step of disulfide determinations by eliminating the need to purify and cleave each peptide containing a disulfide bridge.
Peteiro, Laura G; Woodin, Sarah A; Wethey, David S; Costas-Costas, Damian; Martínez-Casal, Arantxa; Olabarria, Celia; Vázquez, Elsa
2018-05-29
Estuarine bivalves are especially susceptible to salinity fluctuations. Stage-specific sensibilities may influence the structure and spatial distribution of the populations. Here we investigate differences on the energetic strategy of thread drifters (3-4 mm) and sedentary settlers (9-10 mm) of Cerastoderma edule over a wide range of salinities. Several physiological indicators (clearance, respiration and excretion rates, O:N) were measured during acute (2 days) and acclimated responses (7 days of exposure) for both size classes. Our results revealed a common lethal limit for both developmental stages (Salinity 15) but a larger physiological plasticity of thread drifters than sedentary settlers. Acclimation processes in drifters were initiated after 2 days of exposure and they achieved complete acclimation by day 7. Sedentary settlers delay acclimation and at day 7 feeding activity had not resumed and energetic losses through respiration and excretion were higher at the lowest salinity treatment. Different responses facing salinity stress might be related to differences in habitat of each stage. For sedentary settlers which occupy relatively stable niches, energy optimisation include delaying the initiation of the energetically expensive acclimation processes while drifters which occupy less stable environments require a more flexible process which allow them to optimize energy acquisition as fast as possible.
Abdelnour-Esquivel, Ana; Engelmann, Florent
2002-01-01
This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.
NASA Astrophysics Data System (ADS)
Németh, Alexandra; Kern, Zoltán
2017-04-01
The use of the annual increments in the shell of the abundant dog cockle (Glycymeris glycymeris L.) in sclerochronological studies has been demonstrated to be a valid method to reconstruct oceanographic variability in the North Atlantic region [1,2]. However, the sclerochronological potential of the species has not been investigated at the southern limit of its distribution, at the southern North East Atlantic. Therefore the first aim of our study was to analyse growth patterns of G. glycymeris specimens collected around the Madeira Islands to understand which environmental variable has the strongest limiting effect on their growth. The second aim was to find out whether G. glycymeris could be used to build chronologies for sea surface temperature (SST) reconstruction for the region. In 2013 a group of dead shells were collected near the Desertas Islands, Madeira, at 80-300 m water depth range, together with two living specimens. The live collected shells were relatively young (<37 years) while the dead shells proved to have much higher ontogenetic ages (up to 164 years). All groups showed similar ontogenetic trends, however, the average growth rate in the shallower environment was higher in the first four years of their life compared to the deeper collection sites. Subsets of the Madeira (n=18) samples could be collected into a robust chronology: between 1950 and 2000 the value of the expressed population signal EPS was found to be higher than 0.8. In this time interval their composite chronology exhibited negative correlation (r=-0.6, p<0.1.) with the averaged February-May SST fields around Madeira. At the same time, it correlated positively (r>0.8) with the averaged February satellite derived Chlorophyll (Chl) concentrations in the region, although this data was available only between 1998 and 2012. Our results suggest that the relationship between shell growth of G. glycymeris and SST is complex and not direct. In contrast with the northern populations the low
NASA Astrophysics Data System (ADS)
Kiranda, Hanan Karimah; Mahmud, Rozi; Abubakar, Danmaigoro; Zakaria, Zuki Abubakar
2018-01-01
The evolution of nanomaterial in science has brought about a growing increase in nanotechnology, biomedicine, and engineering fields. This study was aimed at fabrication and characterization of conjugated gold-cockle shell-derived calcium carbonate nanoparticles (Au-CSCaCO3NPs) for biomedical application. The synthetic technique employed used gold nanoparticle citrate reduction method and a simple precipitation method coupled with mechanical use of a Programmable roller-ball mill. The synthesized conjugated nanomaterial was characterized for its physicochemical properties using transmission electron microscope (TEM), field emission scanning electron microscope (FESEM) equipped with energy dispersive X-ray (EDX) and Fourier transform infrared spectroscopy (FTIR). However, the intricacy of cellular mechanisms can prove challenging for nanomaterial like Au-CSCaCO3NPs and thus, the need for cytotoxicity assessment. The obtained spherical-shaped nanoparticles (light-green purplish) have an average diameter size of 35 ± 16 nm, high carbon and oxygen composition. The conjugated nanomaterial, also possesses a unique spectra for aragonite polymorph and carboxylic bond significantly supporting interactions between conjugated nanoparticles. The negative surface charge and spectra absorbance highlighted their stability. The resultant spherical shaped conjugated Au-CSCaCO3NPs could be a great nanomaterial for biomedical applications.
Turner, Andrew D.; Dhanji-Rapkova, Monika; Coates, Lewis; Bickerstaff, Lesley; Milligan, Steve; O’Neill, Alison; Faulkner, Dermot; McEneny, Hugh; Baker-Austin, Craig; Lees, David N.; Algoet, Myriam
2017-01-01
Tetrodotoxins (TTXs) are traditionally associated with the occurrence of tropical Pufferfish Poisoning. In recent years, however, TTXs have been identified in European bivalve mollusc shellfish, resulting in the need to assess prevalence and risk to shellfish consumers. Following the previous identification of TTXs in shellfish from southern England, this study was designed to assess the wider prevalence of TTXs in shellfish from around the coast of the UK. Samples were collected between 2014 and 2016 and subjected to analysis using HILIC-MS/MS. Results showed the continued presence of toxins in shellfish harvested along the coast of southern England, with the maximum concentration of total TTXs reaching 253 µg/kg. TTX accumulation was detected in Pacific oysters (Crassostrea gigas), native oysters (Ostrea edulis) common mussels (Mytilus edulis) and hard clams (Mercenaria mercenaria), but not found in cockles (Cerastoderma edule), razors (Ensis species) or scallops (Pecten maximus). Whilst the highest concentrations were quantified in samples harvested during the warmer summer months, TTXs were still evident during the winter. An assessment of the potential causative factors did not reveal any links with the phytoplankton species Prorocentrum cordatum, instead highlighting a greater level of risk in areas of shallow, estuarine waters with temperatures above 15 °C. PMID:28867772
NASA Astrophysics Data System (ADS)
Füllenbach, Christoph S.; Schöne, Bernd R.; Shirai, Kotaro; Takahata, Naoto; Ishida, Akizumi; Sano, Yuji
2017-05-01
It remains a challenging task to reconstruct water temperatures from Sr/Ca ratios of bivalve shells. Although in many aragonitic species, Sr/Ca is negatively correlated to temperature - which is expected based on abiogenic precipitation experiments, the incorporation of Sr into the shell of bivalves is strongly controlled by physiological processes and occurs away from the predicted thermodynamic equilibrium. Strontium-to-calcium ratios of aragonitic shells remain far below that of the ambient water. Moreover, Sr concentrations vary considerably among shell portions consisting of different microstructures and/or organic content. Values observed at annual growth lines and within the intervening shell portions (= annual growth increments) deviate much stronger from each other than expected from a change in temperature or Sr/Cawater. As demonstrated here by ultra-high-resolution chemical analysis (EPMA, NanoSIMS) of a Cerastoderma edule shell, Sr concentrations are also heterogeneously distributed at approximately micrometer resolution. For example, in the outer portion of the outer shell layer, Sr/Ca ratios were statistically significantly (t-, u-tests) higher at circatidal growth lines (irregular simple prismatic structure; arithmetic mean ± 1 standard deviation = 2.86 ± 0.38 mmol/mol; n = 53) than within circatidal increments (nondenticular prismatic structure; 2.42 ± 0.25 mmol/mol; n = 51). S/Cashell, a representative of the concentration of organics, showed the opposite pattern, i.e., significantly higher values in circatidal increments (2.37 ± 0.29 mmol/mol; n = 51) than at circatidal growth lines (2.13 ± 0.47 mmol/mol; n = 53). Overall highest values of Sr/Cashell (3.47 ± 0.65 mmol/mol; n = 3) and S/Cashell (3.98 ± 0.65 mmol/mol; n = 3), however, were typically associated with annual growth lines and larger biomineral units. The intimate link between Sr/Cashell, S/Cashell and shell architecture may indicate that microstructures or the processes
Isa, Tijani; Zakaria, Zuki Abu Bakar; Rukayadi, Yaya; Mohd Hezmee, Mohd Noor; Jaji, Alhaji Zubair; Imam, Mustapha Umar; Hammadi, Nahidah Ibrahim; Mahmood, Saffanah Khuder
2016-01-01
The use of nanoparticle delivery systems to enhance intracellular penetration of antibiotics and their retention time is becoming popular. The challenge, however, is that the interaction of nanoparticles with biological systems at the cellular level must be established prior to biomedical applications. Ciprofloxacin–cockle shells-derived calcium carbonate (aragonite) nanoparticles (C-CSCCAN) were developed and characterized. Antibacterial activity was determined using a modified disc diffusion protocol on Salmonella Typhimurium (S. Typhimurium). Biocompatibilittes with macrophage were evaluated using the 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and 5-Bromo-2′-deoxyuridine (BrdU) assays. Transcriptional regulation of interleukin 1 beta (IL-1β) was determined using reverse transcriptase-polymerase chain reaction (RT-PCR). C-CSCCAN were spherical in shape, with particle sizes ranging from 11.93 to 22.12 nm. Encapsulation efficiency (EE) and loading content (LC) were 99.5% and 5.9%, respectively, with negative ζ potential. X-ray diffraction patterns revealed strong crystallizations and purity in the formulations. The mean diameter of inhibition zone was 18.6 ± 0.5 mm, which was better than ciprofloxacin alone (11.7 ± 0.9 mm). Study of biocompatability established the cytocompatability of the delivery system without upregulation of IL-1β. The results indicated that ciprofloxacin–nanoparticles enhanced the antibacterial efficacy of the antibiotic, and could act as a suitable delivery system against intracellular infections. PMID:27213349
Isa, Tijani; Zakaria, Zuki Abu Bakar; Rukayadi, Yaya; Mohd Hezmee, Mohd Noor; Jaji, Alhaji Zubair; Imam, Mustapha Umar; Hammadi, Nahidah Ibrahim; Mahmood, Saffanah Khuder
2016-05-19
The use of nanoparticle delivery systems to enhance intracellular penetration of antibiotics and their retention time is becoming popular. The challenge, however, is that the interaction of nanoparticles with biological systems at the cellular level must be established prior to biomedical applications. Ciprofloxacin-cockle shells-derived calcium carbonate (aragonite) nanoparticles (C-CSCCAN) were developed and characterized. Antibacterial activity was determined using a modified disc diffusion protocol on Salmonella Typhimurium (S. Typhimurium). Biocompatibilittes with macrophage were evaluated using the 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and 5-Bromo-2'-deoxyuridine (BrdU) assays. Transcriptional regulation of interleukin 1 beta (IL-1β) was determined using reverse transcriptase-polymerase chain reaction (RT-PCR). C-CSCCAN were spherical in shape, with particle sizes ranging from 11.93 to 22.12 nm. Encapsulation efficiency (EE) and loading content (LC) were 99.5% and 5.9%, respectively, with negative ζ potential. X-ray diffraction patterns revealed strong crystallizations and purity in the formulations. The mean diameter of inhibition zone was 18.6 ± 0.5 mm, which was better than ciprofloxacin alone (11.7 ± 0.9 mm). Study of biocompatability established the cytocompatability of the delivery system without upregulation of IL-1β. The results indicated that ciprofloxacin-nanoparticles enhanced the antibacterial efficacy of the antibiotic, and could act as a suitable delivery system against intracellular infections.
Pradit, Siriporn; Shazili, Noor Azhar Mohamed; Towatana, Prawit; Saengmanee, Wuttipong
2016-04-01
This study was undertaken to assess the levels of trace metals (As, Cd, Cu, Pb, and Zn) in two common species of cockles (Anadara granosa and Anadara inaequivalvis) from two coastal areas in Thailand (Pattani Bay) and Malaysia (the Setiu Wetlands). A total of 350 cockles were collected in February and September 2014. Trace metals were determined by Inductively Coupled Plasma Mass Spectrometry. We observed that cockles in both areas had a higher accumulation of metals in September. Notably, the biota-sediment accumulation (BSAF) of Cd was highest in both areas. A strong positive correlation of Cd with the length of the cockles at Pattani Bay (r(2) = 0.597) and the Setiu Wetlands (r(2) = 0.675) was noted. It was suggested that As could be a limiting element (BSAF < 1) of cockles obtained from Pattani Bay. In comparison with the permissible limits set by the Thailand Ministry of Public Health and the Malaysia Food Regulations, mean values of As, Cd, Cu, Pb, and Zn were within acceptable limits, but the maximum values of Cd and Pb exceeded the limits for both areas. Regular monitoring of trace metals in cockles from both areas is suggested for more definitive contamination determination.
Karray, Sahar; Smaoui-Damak, Wafa; Rebai, Tarek; Hamza-Chaffai, Amel
2015-11-01
The gametogenic cycle of the Cerastoderma glaucum was analyzed using both qualitative and semi-quantitative methods. The condition index and glycogen concentrations were determined in order to provide information on energy storage. The cockles were collected monthly from a Bayyadha site located 15 km south of Sfax City (Gulf of Gabès) between January 2007 and January 2008. From histological point of view, we applied two approaches: (i) the qualitative method describing the various stages of gamete development for males and females during a cycle of 13 months, and (ii) the semi-quantitative method concerning the estimation of different tissue surfaces. The results showed that there is evidence of three periods of reproduction in this population. A comparison between the surfaces occupied by the three organs showed that the foot and the gonad surfaces are higher than the surface of the adductor muscle. This could suggest that these two organs are more involved in the process of glycogen reserve storage. The results of the glycogen concentrations in the different tissues (gonad, adductor muscle, and "remainders") show that during the second and third periods of reproduction, glycogen was stored in the adductor muscle and in the remainder during sexual rest, and in the gonad during the gametogenesis phases in order to supply the reproductive effort. On the contrary, in the first period of reproduction, the low concentrations of glycogen recorded in the gonad coincided with its high degree of development. This fact could be related to environmental conditions (low temperature and food) recorded during this period.
Sahilah, A M; Laila, R A S; Sallehuddin, H Mohd; Osman, H; Aminah, A; Ahmad Azuhairi, A
2014-02-01
Genomic DNA of Vibrio parahaemolyticus were characterized by antibiotic resistance, enterobacterial repetitive intergenic consensus-polymerase chain reaction (ERIC-PCR) and random amplified polymorphic DNA-polymerase chain reaction (RAPD-PCR) analysis. These isolates originated from 3 distantly locations of Selangor, Negeri Sembilan and Melaka (East coastal areas), Malaysia. A total of 44 (n = 44) of tentatively V. parahaemolyticus were also examined for the presence of toxR, tdh and trh gene. Of 44 isolates, 37 were positive towards toxR gene; while, none were positive to tdh and trh gene. Antibiotic resistance analysis showed the V. parahaemolyticus isolates were highly resistant to bacitracin (92%, 34/37) and penicillin (89%, 33/37) followed by resistance towards ampicillin (68%, 25/37), cefuroxime (38%, 14/37), amikacin (6%, 2/37) and ceftazidime (14%, 5/37). None of the V. parahaemolyticus isolates were resistant towards chloramphenicol, ciprofloxacin, ceftriaxone, enrofloxacin, norfloxacin, streptomycin and vancomycin. Antibiogram patterns exhibited, 9 patterns and phenotypically less heterogenous when compared to PCR-based techniques using ERIC- and RAPD-PCR. The results of the ERIC- and RAPD-PCR were analyzed using GelCompare software. ERIC-PCR with primers ERIC1R and ERIC2 discriminated the V. parahaemolyticus isolates into 6 clusters and 21 single isolates at a similarity level of 80%. While, RAPD-PCR with primer Gen8 discriminated the V. parahaemolyticus isolates into 11 clusters and 10 single isolates and Gen9 into 8 clusters and 16 single isolates at the same similarity level examined. Results in the presence study demonstrated combination of phenotypically and genotypically methods show a wide heterogeneity among cockle isolates of V. parahaemolyticus.
Tijuana River Flood Control Project, San Diego County, California.
1976-05-20
vulgare Fragrant everlasting Gnaphalium beneolens White hoarhound Marrubium vulgere Hottentot-f ig Mesembryanthemum edule ANNUALS Tumbleweed Amaranthus a...scoparium California box-thorn Lycium californicum See fig Mesembryanthemum chilense Ice plant Mesembryanthemum crystallinum Hottentot fig... Mesembryanthemum edule Little ice plant Mesembryanthemum nodiflorum Coastal prickly pear Opuntia occidentalis San Diego cholla Opuntia serpentia Salt marsh
Tierney, Kieran M; Muir, Graham K P; Cook, Gordon T; MacKinnon, Gillian; Howe, John A; Heymans, Johanna J; Xu, Sheng
2016-01-01
The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ((14)C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This (14)C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate (14)C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in (14)C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine (14)C-enriched material close to Sellafield. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.
NASA Astrophysics Data System (ADS)
Flach, E. C.
On the tidal flats of the Wadden Sea, a zonation pattern can be found with Corophium volutator and Nereis diversicolor as the dominating species of the upper intertidal zone and Arenicola marina and Cerastoderma edule as the dominating species of the lower zone. As C. volutator can live under a great variety of physical conditions, its restriction to higher areas might result from biotic interactions. This was investigated by field experiments on a tidal flat in the westernmost part of the Wadden Sea. Within large depopulated areas, small plots were recolonized with different densities of N. diversicolor, A. marina, C. edule and Macoma balthica and the subsequent settlement and dynamics of C. volutator were studied. In addition, A. marina and/or C. edule were added to or removed from small plots within a natural benthic community. Neither the presence of M. balthica not that of N. diversicolor significantly affected the abundance of C. volutator. A strongly negative effect was found of C. edule when present in high densities, whereas A. marina negatively affected C. volutator abundance already at relatively low densities. Local removals of A. marina and C. edule from their own zone resulted in increases of Corophium numbers at these locations and local additions of these species within the Corophium zone resulted in decreases of Corophium numbers at these locations. It is suggested that the major species to restrict C. volutator effectively to the upper tidal zone is A. marina.
McFarland, L H; Mouritsen, K N; Poulin, Robert
2003-06-01
The trematode Curtuteria australis uses the whelk Cominella glandiformis as first intermediate host and the cockle Austrovenus stutchburyi as second intermediate host before maturing in shorebirds. The whelk also happen to be an important predator of cockles on intertidal mudflats. In this study we show that whelks can act as temporary paratenic hosts for the trematode. A single whelk feeding on 1 cockle can ingest large numbers of metacercariae, which remain within the whelk for 1-3 days before passing out in feces. The viability of these metacercariae assessed as the percentage capable of successfully excysting under conditions simulating those inside a bird's digestive tract, is lower after passage through a whelk (48%) than before (59%). Still, given that shorebird definitive hosts prey on whelks as well as cockles, survival inside the whelk allows C. australis to complete its life cycle: overall, though, whelk predation is likely to be an important sink for the trematode population. To our knowledge, this is the first report of a trematode using a snail as both first intermediate host and paratenic host, offering an alternative transmission route for the parasite as a result of the unusual trophic relationships of its hosts.
NASA Astrophysics Data System (ADS)
Schade, Hanna; Mevenkamp, Lisa; Guilini, Katja; Meyer, Stefanie; Gorb, Stanislav N.; Abele, Doris; Vanreusel, Ann; Melzner, Frank
2016-08-01
Carbon capture and storage is promoted as a mitigation method counteracting the increase of atmospheric CO2 levels. However, at this stage, environmental consequences of potential CO2 leakage from sub-seabed storage sites are still largely unknown. In a 3-month-long mesocosm experiment, this study assessed the impact of elevated pCO2 levels (1,500 to 24,400 μatm) on Cerastoderma edule dominated benthic communities from the Baltic Sea. Mortality of C. edule was significantly increased in the highest treatment (24,400 μatm) and exceeded 50%. Furthermore, mortality of small size classes (0-1 cm) was significantly increased in treatment levels ≥6,600 μatm. First signs of external shell dissolution became visible at ≥1,500 μatm, holes were observed at >6,600 μatm. C. edule body condition decreased significantly at all treatment levels (1,500-24,400 μatm). Dominant meiofauna taxa remained unaffected in abundance. Densities of calcifying meiofauna taxa (i.e. Gastropoda and Ostracoda) decreased in high CO2 treatments (>6,600 μatm), while the non - calcifying Gastrotricha significantly increased in abundance at 24,400 μatm. In addition, microbial community composition was altered at the highest pCO2 level. We conclude that strong CO2 leakage can alter benthic infauna community composition at multiple trophic levels, likely due to high mortality of the dominant macrofauna species C. edule.
Schade, Hanna; Mevenkamp, Lisa; Guilini, Katja; Meyer, Stefanie; Gorb, Stanislav N; Abele, Doris; Vanreusel, Ann; Melzner, Frank
2016-08-19
Carbon capture and storage is promoted as a mitigation method counteracting the increase of atmospheric CO2 levels. However, at this stage, environmental consequences of potential CO2 leakage from sub-seabed storage sites are still largely unknown. In a 3-month-long mesocosm experiment, this study assessed the impact of elevated pCO2 levels (1,500 to 24,400 μatm) on Cerastoderma edule dominated benthic communities from the Baltic Sea. Mortality of C. edule was significantly increased in the highest treatment (24,400 μatm) and exceeded 50%. Furthermore, mortality of small size classes (0-1 cm) was significantly increased in treatment levels ≥6,600 μatm. First signs of external shell dissolution became visible at ≥1,500 μatm, holes were observed at >6,600 μatm. C. edule body condition decreased significantly at all treatment levels (1,500-24,400 μatm). Dominant meiofauna taxa remained unaffected in abundance. Densities of calcifying meiofauna taxa (i.e. Gastropoda and Ostracoda) decreased in high CO2 treatments (>6,600 μatm), while the non - calcifying Gastrotricha significantly increased in abundance at 24,400 μatm. In addition, microbial community composition was altered at the highest pCO2 level. We conclude that strong CO2 leakage can alter benthic infauna community composition at multiple trophic levels, likely due to high mortality of the dominant macrofauna species C. edule.
Influence of intertidal recreational fisheries and 'bouchot' mussel culture on bivalve recruitment.
Toupoint, Nicolas; Barbier, Pierrick; Tremblay, Réjean; Archambault, Philippe; McKindsey, Christopher W; Winkler, Gesche; Meziane, Tarik; Olivier, Frédéric
2016-06-01
In coastal environments, fishing and aquaculture may be important sources of disturbance to ecosystem functioning, the quantification of which must be assessed to make them more sustainable. In the Chausey Archipelago, France, recreational fishing and commercial shellfish farming are the only two evident anthropogenic activities, dominated by bivalve hand-raking and 'bouchot' mussel culture, respectively. This study evaluates the impact of both activities on bivalve recruitment dynamics by comparing primary recruitment intensity (short-term effect) and recruitment efficiency (medium-term effect) by sampling bivalves in reference (undisturbed) and disturbed (i.e. subjected to hand-raking or in 'bouchot' mussel culture areas) parcels throughout and at the end of the recruitment season, respectively. Specific hypotheses evaluated were that (H1) bivalve hand-raking negatively affects bivalve recruitment and that (H2) 'bouchot' mussel culture promotes bivalve recruitment. Patterns in bivalve community structure in reference parcels (i.e. natural pattern) differed between initial and final recruitment, underlining the great importance of early post-settlement processes, particularly secondary dispersal. Primary recruitment intensity was inhibited in hand-raking parcels whereas it was promoted in 'bouchot' mussel culture parcels, but the effect on recruitment efficiency was muted for both activities due to post-settlement processes. Nevertheless, the importance of effects that occur during the first step of recruitment should not be ignored as they may affect bivalve communities and induce immediate consequences on the trophic web through a cascade effect. Finally, it is highlighted that hand-raking damages all life stages of the common cockle Cerastoderma edule, one of the major target species, suggesting that this activity should be managed with greater caution than is currently done. Copyright © 2016 Elsevier Ltd. All rights reserved.
The human alimentary tract transfer and body retention of environmental polonium-210.
Hunt, G J; Rumney, H S
2007-12-01
This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f(A) value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent fA values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first approximately 7 days provided additional data on fA values. Pooled results for the apparent fA for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true fA value of approximately 0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation.
Martorelli, Sergio R; Poulin, Robert; Mouritsen, Kim N
2006-09-01
A new 23-collar-spined cercaria and metacercaria are described from intertidal molluscs of the coast of New Zealand. The new cercaria found emerging from the mud snails Zeacumantus subcarinatus (Sowerby) (Prosobranchia: Batillariidae) is characterized mainly by the number and arrangement of the cephalic glands, the size of the suckers, and the size and number of the collar spines. The cercaria encysts in the cockle Austrovenus stutchburyi (Wood) (Bivalvia: Veneridae) which lives in sympatry with the first intermediate host throughout New Zealand. Laboratory infections of cockles by cercariae from naturally infected snails resulted in metacercariae identical to those found in naturally infected cockles. The main features of the cercaria and metacercaria are the presence of a reniform collar with 23 spines, two pairs of small cephalic glands at the oral sucker level, another two pairs of much longer ones posterior to the pharynx, and the excretory vesicle Y-shaped with the main collecting canals extending to the anterior level of the ventral sucker. Each of the main collecting canals had 10-11 pairs of bilateral diverticula between the anterior edge of the ventral sucker and anterior body end. A brief discussion of its possible life cycle and ecology is also provided.
50 CFR Table 2d to Part 679 - Species Codes-Non-FMP Species
Code of Federal Regulations, 2010 CFR
2010-10-01
... GENERAL USE Arctic char (anadromous) 521 Bering flounder (Hippoglossoides robustus) 116 Dolly varden... 680 Wrymouths 211 SHELLFISH Abalone, northern (pinto) 860 CLAMS: Arctic surf 812 Cockle 820 Eastern...
50 CFR Table 2d to Part 679 - Species Codes-Non-FMP Species
Code of Federal Regulations, 2011 CFR
2011-10-01
... description Code Arctic char, anadromous 521 Dolly varden, anadromous 531 Eels or eel-like fish 210 Eel, wolf... Arctic surf 812 Cockle 820 Eastern softshell 842 Pacific geoduck 815 Pacific littleneck 840 Pacific razor...
Enteric virus and vibrio contamination of shellfish: intervention strategies
USDA-ARS?s Scientific Manuscript database
INTRODUCTION. Molluscan shellfish include oysters, clams, mussels, and cockles, which can cause illnesses from a variety of human pathogens. Enteric viruses, like norovirus and hepatitis A virus, are generally transmitted to shellfish through fecal contamination of shellfish harvesting areas, alth...
Community type classification of forest vegetation in young, mixed stands, interior Alaska.
Andrew Youngblood
1993-01-01
A total of 53 upland mixed communities were sampled and classified into five community types: Populus tremuloides/Arctostaphylos uva-ursi, Populus tremuloides/Shepherdla canadensis, Betula papyrifera-Populus tremuloides/Viburnum edule, Betula papyrifera-Populus tremuloldes/Alnus crispa and Picea glauca-Betula papyrlfera/Hylocomlum splendens. Community types were...
Castro, Ruth M.; Moreira, Lisela; Rojas, María R.; Gilbertson, Robert L.; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar
2013-01-01
Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere. PMID:25288955
Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar
2013-09-01
Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.
1987-12-01
DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to
Federal Register 2010, 2011, 2012, 2013, 2014
2012-02-27
... carved to represent a cockle shell; two bundles of sticks, bone spikes and feathers wrapped around an animal tongue; a bone bracelet ornamented in cuts and lines with a plant fiber fastener; a neck ornament... decorated with ivory, bone, deer hooves and brass ornaments; a skin shoulder robe decorated with walrus...
Identification and Characterization of Memecylon Species Using Isozyme Profiling
Bharathi, T. R.; Sekhar, Shailasree; Geetha, N.; Niranjana, S. R.; Prakash, H. S.
2017-01-01
Background: The protein/isozyme fingerprint is useful in differentiating the species and acts as a biochemical marker for identification and systematic studies of medicinal plant species. Objective: In the present study, protein and isozyme profiles for peroxidase, esterase, acid phosphatase, polyphenol oxidase, alcohol dehydrogenase, and alkaline phosphatase of five species of Memecylon (Melastomataceae), Memecylon umbellatum, Memecylon edule, Memecylon talbotianum, Memecylon malabaricum, and Memecylon wightii were investigated. Materials and Methods: Fresh leaves were used to prepare crude enzyme extract for analyzing the five enzymes isozyme variations. Separation of isozymes was carried out using polyacrylamide gel electrophoresis (PAGE) and the banding patterns of protein were scored. Pair-wise comparisons of genotypes, based on the presence or absence of unique and shared polymorphic products, were used to regenerate similarity coefficients. The similarity coefficients were then used to construct dendrograms, using the unweighted pair group method with arithmetic averages. Results: A total of 50 bands with various Rf values and molecular weight were obtained through PAGE analysis. Among the five Memecylon species, more number of bands was produced in M. wightii and less number of bands was observed in M. edule. The results of similarity indices grouped M. malabaricum and M. wightii in one cluster with 98% similarity and M. umbellatum, M. edule, and M. talbotianum are grouped in another cluster with 79% similarity showing close genetic similarities which is in accordance with the morphological identification of Memecylon species. Conclusion: The protein/isozyme fingerprint is useful in differentiating the species and acts as a biochemical marker for identification of Memecylon species. SUMMARY Biochemical characterization of Memecylon species was evaluated by SDS-PAGE of extracted protein and isozyme profiling on native PAGE.After electrophoresis, each gel was
Chayote (Sechium edule) causing hypokalemia in pregnancy.
Jensen, L P; Lai, A R
1986-11-01
A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.
2008-02-01
Sweet gale (Myrica gale) 1.7 ± 0.7 3.3 ± 1.2 1.6 0.0 ± 0.0 0.3 ± 0.2 * Bog cranberry (Oxycoccus microcarpus) 0.6 ± 0.3...Vaccinium vitis-idaea) 3.0 ± 0.9 2.1 ± 0.6 2.3 0.6 ± 0.3 0.9 ± 0.5 4.0 Highbush cranberry (Viburnum edule) 0.5 ± 0.4 0.5
Woodring, Joseph; Srijan, Apichai; Puripunyakom, Paksathorn; Oransathid, Wilawan; Wongstitwilairoong, Boonchai; Mason, Carl
2012-01-01
Uncooked seafood samples were collected from open markets and supermarkets in Bangkok, Thailand, and were examined for the presence of Vibrio, Salmonella, and Aeromonas species from January to February 2008. From 120 samples, 272 bacterial isolates were identified through biochemical testing. Of all sea bass, shrimp, oyster, and blood cockle samples (30 of each) that were processed for culture, 114 (95%) samples had at least one detectable isolate of Vibrio, Salmonella, or Aeromonas, leaving only 6 (5%) samples free of them. All oyster sample (100%) had at least one pathogen, followed by sea bass (97%), blood cockles (97%), and shrimp (90%). Overall, 111 (92%) of all samples had detectable Vibrio spp., 32 (27%) had detectable Aeromonas spp., and 25 (21%) had detectable Salmonella enterica. There was no overall difference between positive samples collected from fresh markets versus supermarkets (relative risk, 0.97; 95% CI, 0.89 to 1.05). Resistance to ampicillin among isolated pathogens was relatively high (56%), while resistance to 12 other antibiotics, including azithromycin, ciprofloxacin, and trimethoprim-sulfamethoxazole, was relatively low (0, 0, and 3%, respectively). Study results indicate that uncooked seafood in Bangkok, Thailand, commonly harbors enteric pathogens and that consumption of uncooked seafood should be avoided to reduce foodborne illnesses.
Surveillance of hepatitis A and E viruses contamination in shellfish in Thailand.
Namsai, A; Louisirirotchanakul, S; Wongchinda, N; Siripanyaphinyo, U; Virulhakul, P; Puthavathana, P; Myint, K S; Gannarong, M; Ittapong, R
2011-12-01
To survey for hepatitis A virus (HAV) and hepatitis E virus (HEV) contamination in edible bivalve shellfish. A total of 213 shellfish (52 oysters, 69 cockles and 92 mussels) collected from a culture farm and two retailed markets were investigated for HAV and HEV contamination by reverse transcription-polymerase chain reaction (RT-PCR) assay using HA2-HA1 (capsid region) and HE366-HE363 (ORF2/3 overlapping region) primers, respectively. It was found that 3.8% of the shellfish and 2.9 and 6.5% of the cockle and mussel, respectively, showed positive for HAV detection. Nucleotide sequencing of all the 8 HAV-positive shellfish revealed 97-100% similarity to HAV subgenotype IA. Interestingly, viruses were found more frequently in the gills than in digestive tissue (4.5%vs 0.5%, P = 0.045). All the shellfish were negative for HEV. Significant contamination of HAV in edible bivalve shellfish was observed. Beside digestive tissue, gills are one of the important samples for viral genome detection. HAV-contaminated shellfish can play a role as reservoirs and/or vehicles in faecal-oral transmission in Thailand, and further monitoring of such a contamination is required. © 2011 The Authors. Letters in Applied Microbiology © 2011 The Society for Applied Microbiology.
Horn, Sabine; de la Vega, Camille; Asmus, Ragnhild; Schwemmer, Philipp; Enners, Leonie; Garthe, Stefan; Binder, Kirsten; Asmus, Harald
2017-01-01
The determination of food web structures using Ecological Network Analysis (ENA) is a helpful tool to get insight into complex ecosystem processes. The intertidal area of the Wadden Sea is structured into diverse habitat types which differ in their ecological functioning. In the present study, six different intertidal habitats (i.e. cockle field, razor clam field, mud flat, mussel bank, sand flat and seagrass meadow) were analyzed using ENA to determine similarities and characteristic differences in the food web structure of the systems. All six systems were well balanced between their degree of organization and their robustness. However, they differed in their detailed features. The cockle field and the mussel bank exhibited a strong dependency on external imports. The razor clam field appeared to be a rather small system with low energy transfer. In the mud flat microphytobenthos was used as a main food source and the system appeared to be sensitive to perturbations. Bird predation was the most pronounced in the sand flat and the seagrass meadow and led to an increase in energy transfer and parallel trophic cycles in these habitats. Habitat diversity appears to be an important trait for the Wadden Sea as each subsystem seems to have a specific role in the overall functioning of the entire ecosystem.
Horn, Sabine; de la Vega, Camille; Asmus, Ragnhild; Schwemmer, Philipp; Enners, Leonie; Garthe, Stefan; Binder, Kirsten; Asmus, Harald
2017-01-01
The determination of food web structures using Ecological Network Analysis (ENA) is a helpful tool to get insight into complex ecosystem processes. The intertidal area of the Wadden Sea is structured into diverse habitat types which differ in their ecological functioning. In the present study, six different intertidal habitats (i.e. cockle field, razor clam field, mud flat, mussel bank, sand flat and seagrass meadow) were analyzed using ENA to determine similarities and characteristic differences in the food web structure of the systems. All six systems were well balanced between their degree of organization and their robustness. However, they differed in their detailed features. The cockle field and the mussel bank exhibited a strong dependency on external imports. The razor clam field appeared to be a rather small system with low energy transfer. In the mud flat microphytobenthos was used as a main food source and the system appeared to be sensitive to perturbations. Bird predation was the most pronounced in the sand flat and the seagrass meadow and led to an increase in energy transfer and parallel trophic cycles in these habitats. Habitat diversity appears to be an important trait for the Wadden Sea as each subsystem seems to have a specific role in the overall functioning of the entire ecosystem. PMID:28489869
The Use of Tailored Testing with Instructional Programs.
1986-03-01
AVAILABILITY OF REPORT Approved for public release: distribution un- t~X DWNCADNGSCHiEDULE li-mited. Reproduction in whole or in part is...of Education ,-’ Washington, DC 20V 0 Chicago, IL r06 Air Force Human Resources Lab Cdt. Arnold Bohrer . AFHRL/MPD Sectie Psychologisch Cnderzoek...University of Texas-Austin Univ-ir-tat Puss-ldorf Measurement and Evalu-,tion Er zi, gswi ssensch;ftl iches Cpnter Un ivf rsit ’tsst r. 1 Austin, TX 787
Atmospheric Triatomic Molecular Studies.
1980-11-17
ADORE.SS(Jf dlII.,.nt tra 05), tivl 15, SECURITY CLA’.SS. (of this rwpofl) __ 1 P7 jl / 15&. DECLASSJFI CAT DJGft*114I1 -J SCmEDULE If- DiSTRIBUT ION...work in Table I are given in Appendix I. I (3) 41 S. - I + t/n LU ) *C14~ & c .) a)Z. W i 0 0 uL a) NCDNN N 0 4-3 0) cl b -4 cu a x of acca Lm %- a
Thresholds of motion of shell debris under unidirectional flow: influence of faunal composition
NASA Astrophysics Data System (ADS)
Rieux, A.; Weill, P.; Mouazé, D.; Poirier, C.; Tessier, B.
2017-12-01
Quantifying bottom sediment erodibility is necessary to refine understanding of coastal processes and fossil records. Coastal sediments are partly composed of biogenic particles, which shape and density differ from rounded quartz grain and vary between species. Numerous studies have investigated the hydrodynamic behaviour of bioclastic sediments derived from reef-dwelling organisms, but research focusing on "cool-water carbonate" bioclastic particles (i.e. mollusc shell debris, calcareous algae, …) are rare. The present study aims in characterizing the influence of faunal composition on the entrainment threshold of mollusc shell debris from temperate regions. Shells have been sampled on shelly ridges in the southern coast of the Mont-Saint-Michel bay (NW France), before being ground and separated into individual sieve fractions. Eight species, representative of the local faunal composition, have been studied: four wild (cockle, furrow shell, saddle oyster, flat oyster), three reared (japanese oyster, mussel, manila clam) and one introduced (slipper limpet) species. Experiments for defining the threshold of motion of all samples were conducted in a small recirculating flume, under unidirectional current, and using an Acoustic Doppler Velocimeter Profiler. Critical bed shear stress values (τcr) were derived from velocity profiles in the boundary layer, by a logarithmic regression of the "law of the wall". Depending on the species, the evolution of τcr with increasing grain diameters follows either an asymptotic or a more linear trend. Differences between species can be discerned: saddle oyster, japanese oyster and flat oyster show the smallest τcr, slipper limpet, furrow shell and mussel have an intermediate τcr and cockle and manila clam the highest τcr. For the 2-3.15 mm fraction, τcr ranges from 0.38 N.m-2 (saddle oyster) to 2.13 N.m-2 (cockle). Oyster shells (japanese and flat oysters) are composed of foliated sheets of calcite, interbedded with soft
Mojiri, Amin; Ahmad, Zakiah; Tajuddin, Ramlah Mohd; Arshad, Mohd Fadzil; Gholami, Ali
2017-07-01
Water pollution is a global problem. During current study, ammonia, phosphate, phenol, and copper(II) were removed from aqueous solution by subsurface and surface flow constructed wetland. In current investigation, distilled water was polluted with four contaminants including ammonia, phosphate, copper (Cu), and phenol. Response surface methodology and central composite design were applied to optimize pollutant removal during treatment by subsurface flow constructed wetland (SSFCW). Contact time (12 to 80 h) and initial pollutant concentration (20 to 85 mg/L) were selected as independent factors; some upper and lower ranges were also monitored for accuracy. In SSFCW, water hyacinth transplanted in two substrate layers, namely zeolite and cockle shell. SSFCW removed 87.7, 81.4, 74.7, and 54.9% of ammonia, phosphate, Cu, and phenol, respectively, at optimum contact time (64.5 h) and initial pollutant concentration (69.2 mg/L). Aqueous solution was moved to a surface flow constructed wetland (SFCW) after treating via SSFCW at optimum conditions. In SFCW, Typha was transplanted to a fixed powdered substrate layer, including bentonite, zeolite, and cockle shell. SFCW could develop performance of this combined system and could improve elimination efficacy of the four contaminants to 99.99%. So this combined CW showed a good performance in removing pollutants. Graphical abstract Wetlands arrangement for treating aqueous solution in current study.
Larger Units: Theater Army -- Army Group -- Field Army
1985-01-01
la ing r sky. To prove val ire pport, ire ntrol arties rom h rtillery attalion ceived rai ing serving ntrolling val nfire . rangements ere r ir...servation ntrol f val ire. fantry iv sion val nfire iaison ficer signed. 43 t lization ir sets s y sed e rinciple at ir rength uld ~ ept der...en eaters resented other rce f.ten on . acArthur, r a ple, rrowed al rps) its o , is fusal lease ips edule ened val nfire port e arine
1979-01-01
UNCLASSIFIED AFIT-CI-79-22T NL;IEllllllEI mIIIhElhElhEI IIIIEEEEEEEEEE EIIIIEEIIIIII IIIIIIEEIIIIEE EIIIIIEIIIIII IIIIIIIIIIIIII LINCI.ASS SECURITY ... SECURITY CLASS. (of thgo report) UNCLASS I ~ f~ ;~ 7 -i; yISO. OECLASSIFrICATIoN/oowNGdrAiNG6i ; SCH EDULE 44: OSISTRIBUTION STAEMENT (ofth ft~ipot APPROVED...IC). - SECURITY CLASSIFICATION OF THIS PAGE (W~hen Dotes Entered) Darwish Mo d I., ynn, 1 T., ilson, e L. (M.S. Ole ic ions) TI - ond Ele roni y~ii es
Infrared thermography for examination of paper structure
NASA Astrophysics Data System (ADS)
Kiiskinen, Harri T.; Pakarinen, Pekka I.
1998-03-01
The paper industry has used IR cameras primarily for troubleshooting, where the most common examples include the examination of the condition of dryer fabrics and dryer cylinders and the analysis of moisture variations in a paper web. Another application extensively using IR thermography is non-destructive testing of composite materials. This paper presents some recently developed laboratory methods using an IR camera to examine paper structure. Specific areas include cockling, moisture content, thermal uniformity, mechanism of failure, and an analysis of the copying process.
Prevalence of potentially pathogenic Vibrio species in the seafood marketed in Malaysia.
Elhadi, Nasreldin; Radu, Son; Chen, Chien-Hsien; Nishibuchi, Mitsuaki
2004-07-01
Seafood samples obtained in seafood markets and supermarkets at 11 sites selected from four states in Malaysia were examined for the presence of nine potentially pathogenic species from the genus Vibrio between July 1998 and June 1999. We examined 768 sample sets that included shrimp, squid, crab, cockles, and mussels. We extensively examined shrimp samples from Selangor State to determine seasonal variation of Vibrio populations. Eight potentially pathogenic Vibrio species were detected, with overall incidence in the samples at 4.6% for V. cholerae, 4.7% for V. parahaemolyticus, 6.0% for V. vulnificus, 11% for V. alginolyticus, 9.9% for V. metschnikovii, 1.3% for V. mimicus, 13% for V. damsela, 7.6% for V. fluvialis, and 52% for a combined population of all of the above. As many as eight Vibrio species were detected in shrimp and only four in squid and peel mussels. The overall percent incidence of any of the eight vibrios was highest (82%) in cockles (Anadara granosa) among the seafoods examined and was highest (100%) in Kuching, Sarawak State, and lowest (25%) in Penang, Pulau Penang State, among the sampling sites. Of 97 strains of V. cholerae isolated, one strain belonged to the O1 serotype and 14 to the O139 serotype. The results indicate that the various seafood markets in Malaysia are contaminated with potentially pathogenic Vibrio species regardless of the season and suggest that there is a need for adequate consumer protection measures.
Stability Analysis of Interconnected Random-Access Networks.
1986-04-01
NERAKOS ET AL. APR 6 UCLRSSIFIED UCT/ DEECS /TR-116-6 RFOSR-TR-86-0552 FIG 07/2 M WII, 1j08 1225 11111 .g.02 MICROCOPY RESOLUTION TEST CHART NATIONAL BUREAU...SCH4EDULE Unlimited NA 4. PERFORMING ORGANIZATION REPORT NUMBERIS) S. MONITORING ORGANIZATION REPORT NUMEER(S) UCT/ DEECS /TR-86-6 A’FOSR.TR. 8 6 - 0 Ga...theorem 2 in [71, as in (10), we have that - - . - - --i -- - - -- * ,,, * ..J - -...... -18- f n E(- U-1 A.. Ee) P Ia a.e. (14) nin i n-11 lrn n1 l -i n1
Pikart, Tiago G; Costa, Valmir A; Hansson, Christer; Cristo, Sandra C DE; Vitorino, Marcelo D
2017-05-30
This paper deals with the description of two new species of Horismenus Walker (Hymenoptera: Eulophidae) from Brazil, parasitoids of larvae of Adetus analis (Haldeman) (Coleoptera: Cerambycidae). Both species are similar to Horismenus steirastomae (Girault), a species that also parasitizes cerambycids. Adetus analis is a pest of Sechium edule (Jacq.) Swartz (Cucurbitaceae), a minor crop in Brazil, Argentina and U.S.A., but also feeds in stems of Pereskia aculeata Miller (Cactaceae), an ornamental plant that has become a problematic weed species in Africa, where it was introduced. The two new Horismenus species are described, diagnosed, and compared to H. steirastomae.
1984-12-31
NiGjA0’NG S04EDULE suniitd N /A since Unclassified A OER04ORMING ORG.AP4IMIOIJ REPORT NUMBER(S) S. MONITORING ORGAzuZ.lION AEPORT NI.JMSEMR(S) R:LJF-84...foot-poad-toro~ Joule (J) 1.355 I1I galo0 (U.S. Liquid) setar ( I( 3.735 412 xI -), inch eater (a) 2.540000 N I - jrk joule M) [.am 000 x 4. joule...Division (How to Fight), FM 11-50, 8. Military Symbols, FM 21-30. 9. NBC (Nuclear, Biological and Chemical) Defense, FM 21-40. N " 10. Combat Communications
López-Martínez, R; Castañón-Olivares, L R
1995-01-01
The presence of Cryptococcus neoformans in various natural sources, such as bird droppings, fruits and vegetables, was investigated. A total of 711 samples were analyzed; C. neoformans var. neoformans was isolated from seven out of 74 bird droppings (9.5%), with parrots as one of the most significant sources. Fruits were positive in 9.5% of the 169 samples studied, specially citrus fruits, particularly grapefruit, in which the highest frequency was found. From the 468 vegetable samples, only 20 were positive (4.2%). It is emphasized that five of the positive vegetables species are autochthonous to Mexico: avocado (Nectandra salicifolia), beet (Beta vulgaris var. quinopodiace), chayote (Sechium edule), stringbean (Cassia sp), and nopal (Opuntia ficus-indica).
Flores, Luis; Licandeo, Roberto; Cubillos, Luis A; Mora, Elba
2014-06-01
Anadara tuberculosa is one of the most important bivalves along the Western Pacific coast because of its commercial value. Nevertheless, the variability in growth, long-life span, natural mortality and reproductive parameters of this mangrove cockle has not yet been described. The aim of this study was to analyze these life-history traits in three areas of the Southern coast of Ecuador. Empirical and length-based methods were used to estimate these biological parameters. Body size data were collected from the commercial fishery between 2004 and 2011 in landing ports near to the Archipelago of Jambeli [Puerto Bolivar (PB), Puerto Jeli (PJ) and Puerto Hualtaco (PH)]. The von Bertalanffy growth parameters for combined sex were estimated between 70.87 to 93.45mm for L(infinity) and 0.22 to 0.80/year for k. The growth indices (PHI') ranged from 3.17 to 3.85, while the overall growth performance (OGP) ranged from 5.03 to 5.82. The mean of long-life span (t(max)), size and age at maturity (L50% and t50%) were estimated in 7.71 +/- 2.53 years, 39.13 +/- 2.24mm and 1.46 +/- 0.56 years for PB; 9.51 +/- 2.85 years, 37.78 +/- 1.95mm and 1.37 +/- 0.41 years for PJ and 5.81 +/- 2.11 years, 39.73 +/- 3.31mm and 0.94 +/- 0.41 years for PH. Natural mortality (M) ranged from 0.46 to 1.28/year. We concluded that significant intra-specific variation was observed in a temporal scale in PHI' and OGP indices as well as L50% and M. Therefore, temporal changes in these life-history traits should be taken into account when assessing the status of the mangrove cockle fishery.
Rogalla, N.S.; Carter, J.G.; Pojeta, J.
2003-01-01
The Late Carboniferous bransoniid conocardioidean Apotocardium lanterna (Branson, 1965) had an entirely aragonitic shell with a finely prismatic outer shell layer, a predominantly crossed lamellar to complex crossed lamellar middle shell layer, and an "inner" shell layer of finely textured porcelaneous and/or matted structure. This "inner" layer is probably homologous with the inner part of the middle shell layer and the inner layer sensu stricto of bivalved molluscs. Shell morphological and microstructural convergences between conocardioids and living heart cockles suggest that at least some conocardioids may have farmed algal endosymbionts in their posterior mantle margins. This symbiosis may have helped conocardioids compete with the biomechanically more efficient bivalves during the latter part of the Paleozoic.
NASA Astrophysics Data System (ADS)
Seyler, Monique; Brunelli, Daniele
2018-03-01
higher SmN/YbN ratios (> 0.8) than clinopyroxenes poorer in Na and Cr. The two clinopyroxenes having the highest SmN/YbN (2.1, 2.4) and CeN/YbN (0.8, 1.8) ratios have REE patterns indicating of equilibration with an alkaline basalt or a melt derived from a garnet-bearing source [e.g., EDUL Dr6-1-2, Seyler et al. (2011) and PS55-90-20, Hellebrand and Snow (2003)]. However, CeN/YbN ratios do not increase linearly with increasing Na2O and/or Cr2O3. In EDUL peridotites, trends of increasing SmN/YbN and CeN/YbN vs YbN can be modelled by near-batch melting of a depleted spinel peridotite influxed with a melt derived from a garnet-bearing source (Brunelli et al., 2014). SWF-26 peridotites do not follow the same trends as EDUL Dr6 and Arctic peridotites, suggesting different melting conditions and/or interaction with different melt compositions.
Effects of pollination timing and distance on seed production in a dioecious weed Silene latifolia
NASA Astrophysics Data System (ADS)
Anderson, Jay F.; Duddu, Hema S. N.; Shirtliffe, Steven J.; Benaragama, Dilshan; Syrovy, Lena D.; Stanley, Katherine A.; Haile, Teketel A.
2015-11-01
Silene latifolia Poir. (white cockle or white campion) is an important invasive weed in North American agriculture. It exhibits dioecy, therefore, both male and female plants are required in order for seed production to occur. However, dioecious species being invasive is not common because of their limitations in pollination and subsequent seed production. The objective of this study is to determine the effect of pollination timing and distance on seed production of Silene latifolia. A series of experiments including pollination exclusion, timing and pollination distance were conducted in 2009 and 2010 at or around Saskatoon, Saskatchewan. For pollination exclusion, exclosures were built around the natural female plants for exclosure, sham-exclosure, and male and female combined treatments. Pollination timing was studied by applying exclosure, non-exclosure, night-exclosure, and day-exclosure treatments to individual female plants. Female plants were transplanted along a linear interval at six different distances from the pollen source to study the effect of pollination distance. S. latifolia was exclusively insect-pollinated and pollination occurred both day and night; however, in one year, pollination occurred mainly at night. Female plants that were in the range of 0-4 m from a compatible pollen source experienced no limitation to pollination. However, when the distance was increased further up to 128 m, pollination levels and subsequent seed production were declined. Moreover, there were differences in seed production between years suggesting that pollination was affected by the environmental conditions during pollination and the crop that white cockle was grown in. These experiments indicate that seed production in S. latifolia is limited by insect-pollination. Although there was pollination limitation for seed production at greater distances from a pollen source, the high fecundity rate (3000-18000 seeds per plant) resulted in a large seed output. Thus, we
Berenguer, J A; Gonzalez, L; Jimenez, I; Legarda, T M; Olmedo, J B; Burdaspal, P A
1993-01-01
A study was undertaken to determine if any reduction in contamination of Acanthocardia tuberculatum L. (Mediterranean cockle) by paralytic shellfish poisons (PSP) could be enhanced by operations carried out during the industrial canning process, allowing contaminated raw material to be commercially marketed in safe conditions for edible purposes. A general decrease in PSP levels was consistently observed when comparing raw materials and their corresponding final products, these dropping to acceptable levels. PSP levels were determined by mouse bioassay and a fluorometric method, and saxitoxin was determined by HPLC. The detoxifying effects averaged over 71.7% and 81.8% (mouse bioassay), 70.6% and 90.9% (fluorometric method), 77.9% and 83.5% (HPLC), for boiling and sterilizing operations respectively. The highest level detected in raw material was 800 micrograms/100 g by mouse bioassay.
Polysaccharide composition of raw and cooked chayote (Sechium edule Sw.) fruits and tuberous roots.
Shiga, Tânia M; Peroni-Okita, Fernanda Helena Gonçalves; Carpita, Nicholas C; Lajolo, Franco Maria; Cordenunsi, Beatriz Rosana
2015-10-05
Chayote is a multipurpose table vegetable widely consumed in Latin America countries. Chayote fruits, leaves and tuberous roots contain complex carbohydrates as dietary fiber and starch, vitamins and minerals. The complex polysaccharides (cell walls and starch) were analyzed in the black and green varieties of chayote fruits as well as in green chayote tuberous root before and after a controlled cooking process to assess changes in their composition and structure. The monosaccharide composition and linkage analysis indicated pectins homogalacturonans and rhamnogalacturonan I backbones constitute about 15-20% of the wall mass, but are heavily substituted with, up to 60% neutral arabinans, galactans, arabinogalactans. The remainder is composed of xyloglucan, glucomannans and galactoglucomannans. Chayote cell-wall polysaccharides are highly stable under normal cooking conditions, as confirmed by the optical microscopy of wall structure. We found also that tuberous roots constitute a valuable additional source of quality starch and fiber. Published by Elsevier Ltd.
Randazzo, Walter; Khezri, Mohammad; Ollivier, Joanna; Le Guyader, Françoise S; Rodríguez-Díaz, Jesús; Aznar, Rosa; Sánchez, Gloria
2018-02-02
Shellfish contamination by human noroviruses (HuNoVs) is a serious health and economic problem. Recently an ISO procedure based on RT-qPCR for the quantitative detection of HuNoVs in shellfish has been issued, but these procedures cannot discriminate between inactivated and potentially infectious viruses. The aim of the present study was to optimize a pretreatment using PMAxx to better discriminate between intact and heat-treated HuNoVs in shellfish and sewage. To this end, the optimal conditions (30min incubation with 100μM of PMAxx and 0.5% of Triton, and double photoactivation) were applied to mussels, oysters and cockles artificially inoculated with thermally-inactivated (99°C for 5min) HuNoV GI and GII. This pretreatment reduced the signal of thermally-inactivated HuNoV GI in cockles and HuNoV GII in mussels by >3 log. Additionally, this pretreatment reduced the signal of thermally-inactivated HuNoV GI and GII between 1 and 1.5 log in oysters. Thermal inactivation of HuNoV GI and GII in PBS, sewage and bioaccumulated oysters was also evaluated by the PMAxx-Triton pretreatment. Results showed significant differences between reductions observed in the control and PMAxx-treated samples in PBS following treatment at 72 and 95°C for 15min. In sewage, the RT-qPCR signal of HuNoV GI was completely removed by the PMAxx pretreatment after heating at 72 and 95°C, while the RT-qPCR signal for HuNoV GII was completely eliminated only at 95°C. Finally, the PMAxx-Triton pretreatment was applied to naturally contaminated sewage and oysters, resulting in most of the HuNoV genomes quantified in sewage and oyster samples (12 out of 17) corresponding to undamaged capsids. Although this procedure may still overestimate infectivity, the PMAxx-Triton pretreatment represents a step forward to better interpret the quantification of intact HuNoVs in complex matrices, such as sewage and shellfish, and it could certainly be included in the procedures based on RT-qPCR. Copyright
Bu-Olayan, A H; Thomas, B V
2015-11-01
The present study determined total mercury (T-Hg) in crustacean Portunus pelagicus (blue crab) and mollusc Tapes sulcarius (Furrowed Venus: Cockle) following suspected rise in beach plastic wastes and their effect on marine organisms. Live samples were collected from beaches representing six Kuwait Governorate areas and exposed to toxicity (96hr) and bio accumulation tests for 180 d with inclusion of plastic wastes and environmental conditions simulated in laboratory. Results revealed high T-Hg concentrations in T sulcarius (1.44ng l(-1)) compared to P. pelagicus (1.03ng l(-1)) during winter than summer, with bio accumulation factor (BAF) > 1 labelled these species as hyper-accumulators. Significantly, combination of T-Hg concentrations from plastic wastes and in seawater validated the possibilities of detrimental effects of other marine lives besides deteriorating the aesthetic values of scenic beaches and likelihood of invasive species in such coastal areas.
Ksouri, Riadh; Megdiche, Wided; Falleh, Hanen; Trabelsi, Nejla; Boulaaba, Mondher; Smaoui, Abderrazak; Abdelly, Chedly
2008-11-01
Halophyte ability to withstand salt-triggered oxidative stress is governed by multiple biochemical mechanisms that facilitate retention and/or acquisition of water, protect chloroplast functioning, and maintain ion homeostasis. Most essential traits include the synthesis of osmolytes, specific proteins, and antioxidant molecules. This might explain the utilization of some halophytes as traditional medicinal and dietary plants. The present study aimed at assessing the phenolic content and antioxidant activities of some Tunisian halophytes (Cakile maritima, Limoniastrum monopetalum, Mesembryanthemum crystallinum, M. edule, Salsola kali, and Tamarix gallica), depending on biological (species, organ and developmental stage), environmental, and technical (extraction solvent) factors. The total polyphenol contents and antioxidant activities (DPPH and superoxide radicals scavenging activities, and iron chelating and reducing powers) were strongly affected by the above-cited factors. Such variability might be of great importance in terms of valorising these halophytes as a source of naturally secondary metabolites, and the methods for phenolic and antioxidant production.
Maba, Dao Lamèga; Guelly, Atsu K; Yorou, Nourou S; Verbeken, Annemieke; Agerer, Reinhard
2015-06-01
Despite the crucial ecological role of lactarioid taxa (Lactifluus, Lactarius) as common ectomycorrhiza formers in tropical African seasonal forests, their current diversity is not yet adequately assessed. During the last few years, numerous lactarioid specimens have been sampled in various ecosystems from Togo (West Africa). We generated 48 ITS sequences and aligned them against lactarioid taxa from other tropical African ecozones (Guineo-Congolean evergreen forests, Zambezian miombo). A Maximum Likelihood phylogenetic tree was inferred from a dataset of 109 sequences. The phylogenetic placement of the specimens, combined with morpho-anatomical data, supported the description of four new species from Togo within the monophyletic genus Lactifluus: within subgen. Lactifluus (L. flavellus), subgen. Russulopsis (L. longibasidius and L. pectinatus), and subgen. Edules (L. melleus). This demonstrates that the current species richness of the genus is considerably higher than hitherto estimated for African species and, in addition, a need to redefine the subgenera and sections within it.
Pattern of relative growth in cockle Anadara antiquata in Ihamahu coastal waters, Central Maluku
NASA Astrophysics Data System (ADS)
Siahainenia, L.; Tuhumury, S. F.; Uneputty, P. A.; Tuhumury, N. C.
2018-03-01
Anadara antiquata is economically important species for fisheries and belong to phylum mollusc which also found in Maluku. However, the density of population begins to decrease recently due to high exploitation by people. The objective of the present study was to analyze relative growth pattern of A. antiquata including size distribution and growth pattern based on shell dimensions. The study was conducted from December 2016 to February 2017 in Ihamahu coastal waters. Data were collected by using purposive random sampling. All the individuals of A. antiquata found were measured the length, width and height by using a vernier caliper to the nearest 0.01mm. Data were analyzed by using SPSS 20 and Microsoft Excel software. The results indicated that the A. antiquata mostly found in seagrass bed with a muddy substrate. The size distribution of shell dimensions was different during sampling. Overall, the length ranged from 15.87 mm to 57.5 mm, the width from 15.50 mm to 48.60 mm and the height was from 9.36 mm to 35.9 mm. The population of A. antiquata consisted of juvenile and mature size. The mature size (> 30 mm) was more dominant in the population. The A. antiquata showed allometric relative growth pattern based on shell dimensions.
Are metallothioneins equally good biomarkers of metal and oxidative stress?
Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa
2012-10-01
Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine
Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K
2015-07-15
The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.
Utilization of ground waste seashells in cement mortars for masonry and plastering.
Lertwattanaruk, Pusit; Makul, Natt; Siripattarapravat, Chalothorn
2012-11-30
In this research, four types of waste seashells, including short-necked clam, green mussel, oyster, and cockle, were investigated experimentally to develop a cement product for masonry and plastering. The parameters studied included water demand, setting time, compressive strength, drying shrinkage and thermal conductivity of the mortars. These properties were compared with those of a control mortar that was made of a conventional Portland cement. The main parameter of this study was the proportion of ground seashells used as cement replacement (5%, 10%, 15%, or 20% by weight). Incorporation of ground seashells resulted in reduced water demand and extended setting times of the mortars, which are advantages for rendering and plastering in hot climates. All mortars containing ground seashells yielded adequate strength, less shrinkage with drying and lower thermal conductivity compared to the conventional cement. The results indicate that ground seashells can be applied as a cement replacement in mortar mixes and may improve the workability of rendering and plastering mortar. Copyright © 2012 Elsevier Ltd. All rights reserved.
Two genera of Aulacoscelinae beetles reflexively bleed azoxyglycosides found in their host cycads.
Prado, Alberto; Ledezma, Julieta; Cubilla-Rios, Luis; Bede, Jacqueline C; Windsor, Donald M
2011-07-01
Aulacoscelinae beetles have an ancient relationship with cycads (Cycadophyta: Zamiaceae), which contain highly toxic azoxyglycoside (AZG) compounds. How these "primitive" leaf beetles deal with such host-derived compounds remains largely unknown. Collections were made of adult Aulacoscelis appendiculata from Zamia cf. elegantissima in Panama, A. vogti from Dioon edule in Mexico, and Janbechynea paradoxa from Zamia boliviana in Bolivia. Total AZG levels were quantified in both cycad leaves and adult beetles by high performance liquid chromatography (HPLC). On average, cycad leaves contained between 0.5-0.8% AZG (frozen weight, FW), while adult beetles feeding on the same leaves contained even higher levels of the compounds (average 0.9-1.5% FW). High AZG levels were isolated from reflex bleeding secreted at the leg joints when beetles were disturbed. Nuclear magnetic resonance and mass spectroscopy identified two AZGs, cycasin and macrozamin, in the reflex bleeding; this is the first account of potentially plant-derived compounds in secretions of the Aulacoscelinae. These data as well as the basal phylogenetic position of the Aulacoscelinae suggest that sequestration of plant secondary metabolites appeared early in leaf beetle evolution.
NASA Astrophysics Data System (ADS)
Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric
2010-07-01
The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.
Antioxidant Activity in Extracts of 27 Indigenous Taiwanese Vegetables
Chao, Pi-Yu; Lin, Su-Yi; Lin, Kuan-Hung; Liu, Yu-Fen; Hsu, Ju-Ing; Yang, Chi-Ming; Lai, Jun-You
2014-01-01
The objectives of this study were to identify the antioxidants and antioxidant axtivity in 27 of Taiwan’s indigenous vegetables. Lycium chinense (Lc), Lactuca indica (Li), and Perilla ocymoides (Po) contained abundant quercetin (Que), while Artemisia lactiflora (Al) and Gynura bicolor (Gb) were rich in morin and kaempferol, respectively. Additionally, Nymphoides cristata (Nc) and Sechium edule (Se)-yellow had significantly higher levels of myricetin (Myr) than other tested samples. Cyanidin (Cyan) and malvidin (Mal) were abundant in Gb, Abelmoschus esculentus Moench (Abe), Po, Anisogonium esculentum (Retz.) Presl (Ane), Ipomoea batatas (Ib)-purple, and Hemerocallis fulva (Hf)-bright orange. Relatively high levels of Trolox equivalent antioxidant capacity (TEAC), oxygen radical absorption capacity (ORAC), and 1,1-diphenyl-2-picryl-hydrazyl (DPPH) radical scavenger were generated from extracts of Toona sinensis (Ts) and Po. Significant and positive correlations between antioxidant activity and polyphenols, anthocyanidins, Que, Myr, and morin were observed, indicating that these phytochemicals were some of the main components responsible for the antioxidant activity of tested plants. The much higher antioxidant activity of Po, Ts, and Ib (purple leaf) may be related to their higher Cyan, Que, and polyphenol content. PMID:24858497
Nutrient over-enrichment of estuaries is a pervasive issue worldwide that often results in blooms of green macroalgae (GMA; Ulva spp.), which can have disruptive and deleterious effects to estuarine flora and fauna. However, little is known of the effects of GMA blooms on the pr...
Osteoblasts Growth Behaviour on Bio-Based Calcium Carbonate Aragonite Nanocrystal
Zakaria, Zuki Abu Bakar
2014-01-01
Calcium carbonate (CaCO3) nanocrystals derived from cockle shells emerge to present a good concert in bone tissue engineering because of their potential to mimic the composition, structure, and properties of native bone. The aim of this study was to evaluate the biological response of CaCO3 nanocrystals on hFOB 1.19 and MC3T3 E-1 osteoblast cells in vitro. Cell viability and proliferation were assessed by MTT and BrdU assays, and LDH was measured to determine the effect of CaCO3 nanocrystals on cell membrane integrity. Cellular morphology was examined by SEM and fluorescence microscopy. The results showed that CaCO3 nanocrystals had no toxic effects to some extent. Cell proliferation, alkaline phosphatase activity, and protein synthesis were enhanced by the nanocrystals when compared to the control. Cellular interactions were improved, as indicated by SEM and fluorescent microscopy. The production of VEGF and TGF-1 was also affected by the CaCO3 nanocrystals. Therefore, bio-based CaCO3 nanocrystals were shown to stimulate osteoblast differentiation and improve the osteointegration process. PMID:24734228
The shellfish enigma across the Mesolithic-Neolithic transition in southern Scandinavia
NASA Astrophysics Data System (ADS)
Lewis, J. P.; Ryves, D. B.; Rasmussen, P.; Olsen, J.; Knudsen, K.-L.; Andersen, S. H.; Weckström, K.; Clarke, A. L.; Andrén, E.; Juggins, S.
2016-11-01
The well-known and widespread replacement of oysters (abundant during the Mesolithic period) by cockles and mussels in many Danish Stone Age shell middens ca. 5900 cal yrs BP coincides with the transition to agriculture in southern Scandinavia. This human resource shift is commonly believed to reflect changing resource availability, driven by environmental and/or climatic change at the Mesolithic-Neolithic transition rather than cultural choice. While several hypotheses have been proposed to explain the ;Mesolithic-Neolithic oyster decline;, an explanation based on a sudden freshening of the inner Danish waters has received most attention. Here, for the first time, we test and refute this long-standing hypothesis that declining salinity explains the marked reduction in oysters identified within numerous shell middens across coastal Denmark at the Mesolithic-Neolithic transition using quantitative and qualitative salinity inference from several, independent proxies (diatoms, molluscs and foraminifera) from multiple Danish fjord sites. Alternatively, we attribute the oyster decline to other environmental causes (particularly changing sedimentation), ultimately driven by external climatic forcing. Critical application of such high-quality environmental archives can reinvigorate archaeological debates and can aid in understanding and managing environmental change in increasingly impacted coastal regions.
Verma, Veerendra Kumar; Pandey, Avinash; Jha, Anjani Kumar; Ngachan, S V
2017-10-01
Chayote or chow-chow is an underutilized cucurbit vegetable crop, widely cultivated by farmers in the backyards and Jhum lands for its tender leaves, fruits and tuberous root. In order to initiate crop improvement program in this crop, the present study was undertaken to assess the genetic variations in the 74 chow-chow landraces collected from the North Eastern Hill region of India. Wide variations for fruit colors, fruit length (6.5-21.5 cm), fruit width (4.2-10.7 cm), fruit weight (60-560 g), vitamin-C (2.6-13.8 mg/100 g), reducing sugar (0.18-2.77%), total sugar (1.09-2.94%) and phenol content (0.17-3.85 mg/100 g FW) were recorded among the landraces. All the landraces were also characterized using random amplified polymorphic DNA (RAPD) and inter simple sequence repeat (ISSR) markers. In RAPD analyses, out of 28 primers a total of 198 reproducible amplicons were formed at an average of 7.01 per primer and an overall polymorphism of 88.38%. Eight fragments were specific to landraces with light green fruits. Four fragments were observed to be specific to RCSC-22 (dark green fruits) and another four specific to a RCSC-30 (pale yellow fruits). Out of 30 ISSR, only 5 primers generated a total of 32 reproducible amplicons with an average of 6.4 per primer and overall polymorphism of 62.5%. The pair wise similarity coefficient values ranged from 0.55 to 0.96. The grouping of landraces in cluster analysis was found to be independent of their respective geographic locations. The cuttings of suckers and shoot top (2 months old) treated with indole-3-butyric acid (200 mg l -1 ) provide an alternative for the conservation of the diverse genetic materials to the researchers.
Aguiñiga-Sánchez, Itzen; Soto-Hernández, Marcos; Cadena-Iñiguez, Jorge; Ruíz-Posadas, Lucero del Mar; Cadena-Zamudio, Jorge David; González-Ugarte, Ana Karen; Steider, Benny Weiss; Santiago-Osorio, Edelmiro
2015-01-01
The antiproliferative potential of a crude extract from the chayote hybrid H-837-07-GISeM® and its potential for apoptosis induction were assessed in leukaemic cell lines and normal mouse bone marrow mononuclear cells (BM-MNCs). The extract strongly inhibited the proliferation of the P388, J774, and WEHI-3 cell lines (with an IC50 below 1.3 μg·mL(-1)), reduced cell viability, and induced apoptotic body production, phosphatidylserine translocation, and DNA fragmentation. However, the extract had no effect on BM-MNCs. We postulate that these properties make the extract a good candidate for an anti-tumour agent for clinical use.
Kraan, Casper; Aarts, Geert; Van der Meer, Jaap; Piersma, Theunis
2010-06-01
Ongoing statistical sophistication allows a shift from describing species' spatial distributions toward statistically disentangling the possible roles of environmental variables in shaping species distributions. Based on a landscape-scale benthic survey in the Dutch Wadden Sea, we show the merits of spatially explicit generalized estimating equations (GEE). The intertidal macrozoobenthic species, Macoma balthica, Cerastoderma edule, Marenzelleria viridis, Scoloplos armiger, Corophium volutator, and Urothoe poseidonis served as test cases, with median grain-size and inundation time as typical environmental explanatory variables. GEEs outperformed spatially naive generalized linear models (GLMs), and removed much residual spatial structure, indicating the importance of median grain-size and inundation time in shaping landscape-scale species distributions in the intertidal. GEE regression coefficients were smaller than those attained with GLM, and GEE standard errors were larger. The best fitting GEE for each species was used to predict species' density in relation to median grain-size and inundation time. Although no drastic changes were noted compared to previous work that described habitat suitability for benthic fauna in the Wadden Sea, our predictions provided more detailed and unbiased estimates of the determinants of species-environment relationships. We conclude that spatial GEEs offer the necessary methodological advances to further steps toward linking pattern to process.
Chaiyut, Nattawut; Worawanitchaphong, Phatsakon
2013-01-01
The waste shell was utilized as a bioresource of calcium oxide (CaO) in catalyzing a transesterification to produce biodiesel (methyl ester). The economic and environmen-friendly catalysts were prepared by a calcination method at 700–1,000°C for 4 h. The heterogeneous catalysts were characterized by X-ray diffraction (XRD), X-ray fluorescence (XRF), scanning electron microscopy (SEM), and the Brunauer-Emmett-Teller (BET) method. The effects of reaction variables such as reaction time, reaction temperature, methanol/oil molar ratio, and catalyst loading on the yield of biodiesel were investigated. Reusability of waste shell catalyst was also examined. The results indicated that the CaO catalysts derived from waste shell showed good reusability and had high potential to be used as biodiesel production catalysts in transesterification of palm oil with methanol. PMID:24453854
Nagendran, K; Mohankumar, S; Mohammed Faisal, P; Bagewadi, B; Karthikeyan, G
2017-12-01
During 2012-2014, mosaic disease on chayote in the farmers field of Kodaikanal region (high altitude zone) of Tamil Nadu was observed. The disease was characterized with severe mosaic, cupping and enation on leaves with reduced fruit size. Disease was found to causes an yield loss of more than 60% with the maximum disease incidence of 100% for the past 5 years consecutively. Preliminary serological and molecular screening indicated the association of begomovirus with the disease. Complete nucleotide sequence and phylogenetic analysis of DNA A revealed the identity of the virus as tomato leaf curl New Delhi virus (ToLCNDV). In recombination analysis study, the major parent was identified as ToLCNDV from Pakistan infecting tomato. Thus the present finding confirms expansion of new geographical region and host for ToLCNDV causing mosaic disease on chayote from Tamil Nadu. To our knowledge this is the first confirmed report for the occurrence of ToLCNDV on chayote in southern India.
Staining human lymphocytes and onion root cell nuclei with madder root.
Cücer, N; Guler, N; Demirtas, H; Imamoğlu, N
2005-01-01
We performed staining experiments on cells using natural dyes and different mordants using techniques that are used for wool and silk dyeing. The natural dye sources were madder root, daisy, corn cockle and yellow weed. Ferrous sulfate, copper sulfate, potassium tartrate, urea, potassium aluminum sulfate and potassium dichromate were used as mordants. Distilled water, distilled water plus ethanol, heptane, and distilled water plus methanol were used as solvents. All dye-mordant-solvent combinations were studied at pH 2.4, 3.2 and 4.2. The generic staining procedure was to boil 5-10 onion roots or stimulated human lymphocyte (SHL) preparations in a dye bath on a hot plate. Cells were examined at every half hour. For multicolor staining, madder-dyed lymphocytes were decolorized, then stained with Giemsa. The AgNOR technique was performed following the decolorization of Giemsa stained lymphocytes. Good results were obtained for both onion root cells and lymphocytes that were boiled for 3 h in a dye bath that included 4 g madder root, 4 g ferrous sulfate as mordant in 50 ml of 1:1 (v/v) methanol:distilled water. The pH was adjusted to 4.2 with 6 ml acetic acid. We conclude that madder root has potential as an alternative dye for staining biological materials.
Catry, Teresa; Figueira, Paula; Carvalho, Lina; Monteiro, Rui; Coelho, Pedro; Lourenço, Pedro Miguel; Catry, Paulo; Tchantchalam, Quintino; Catry, Inês; Botelho, Maria J; Pereira, Eduarda; Granadeiro, José Pedro; Vale, Carlos
2017-11-01
Shellfish harvesting in intertidal areas is a widespread and economically important activity in many countries across West Africa. However, in some areas, there is virtually no information concerning the levels of contaminants (and other elements related to nutritional aspects) in the harvested species. We collected sediments and several individuals of the West African bloody cockle Senilia senilis and of the razor clam Tagelus adansoni during the dry season of 2015 nearby three islands in the Bijagós archipelago, Guinea-Bissau. Aluminium, Ca, Fe, Mg, As, Cd, Co, Cr, Cu, Mn, Ni, Pb and Zn were determined in sediments and whole soft tissues of the two bivalves. Sediments showed uniformly low trace element concentrations, pointing to an ecosystem with low levels of trace element contamination. T. adansoni presented higher concentrations of most elements than S. senilis, with the exception of Cd that showed up to 40 times higher values in S. senilis than in T. adansoni from the same sites. Furthermore, Cd concentrations (25±8.7 mg kg -1 , dw) in S. senilis are clearly above the maximum level established for human consumption. Future studies should clarify whether biological factors are the major responsible for this unusual situation.
Leão, Jose Manuel; Lozano-Leon, Antonio; Giráldez, Jorge; Vilariño, Óscar; Gago-Martínez, Ana
2018-01-01
Tetrodotoxins (TTX) are a potent group of natural neurotoxins putatively produced by symbiotic microorganisms and affecting the aquatic environment. These neurotoxins have been recently found in some species of bivalves and gastropods along the European Coasts (Greece, UK, and The Netherlands) linked to the presence of high concentrations of Vibrio, in particular Vibrio parahaemolyticus. This study is focused on the evaluation of the presence of Vibrio species and TTX in bivalves (mussels, oysters, cockles, clams, scallops, and razor clams) from Galician Rias (northwest of Spain). The detection and isolation of the major Vibrio spp. and other enterobacterial populations have been carried out with the aim of screening for the presence of the pathways genes, poliketide synthase (PKS) and non-ribosomal peptide synthetase (NRPS) possibly involved in the biosynthesis of these toxins. Samples containing Vibrio spp. were analyzed by biochemical (API20E-galery) and genetic tests (PCR-RT). These samples were then screened for TTX toxicity by a neuroblastoma cell-based assay (N2a) and the presence of TTX was further confirmed by LC-MS/MS. TTX was detected in two infaunal samples. This is the first confirmation of the presence of TTX in bivalve molluscs from the Galician Rias. PMID:29509715
NASA Astrophysics Data System (ADS)
Latynova, N. E.
2010-03-01
The spatial-temporal features of the radioactive contamination of terrestrial ecosystem components caused by the deterioration of the multibarrier protection of regional radioactive waste storages of the State Research Center of the Russian Federation-Leipunskii Institute of Physics and Power Engineering at the input of radionuclides into the soil and ground water were studied. The composition of the radioactive contamination was determined, and the hydrological and geochemical processes resulting in the formation of large radioactive sources were described. The natural features of the radioactive waste storage areas favoring the entry of 90Sr, 137Cs, and 226Ra into the soils and their inclusion in the biological turnover were characterized. The directions of the horizontal migration of 90Sr, 137Cs, and 226Ra and the sites of their accumulation within the superaquatic and aquatic landscapes of a near-terrace depression were studied; the factors of the 90Sr accumulation in plants and cockles were calculated. The results of the studies expand the theoretical concepts of the mechanisms, processes, and factors controlling the behavior of radionuclides at the deterioration of the multibarrier protection of radioactive waste storages. The presented experimental data can be used for solving practical problems related to environmental protection in the areas of industrial nuclear complexes.
Nutrient over-enrichment can produce adverse ecological effects within coastal ecosystems and negatively impact the production of ecosystem goods and services. In small estuaries of the U.S. Pacific Northwest, seasonal blooms of green macroalgae (GMA; Ulva spp.) are primarily ass...
NASA Astrophysics Data System (ADS)
Singer, Anja; Millat, Gerald; Staneva, Joanna; Kröncke, Ingrid
2017-03-01
Small-scale spatial distribution patterns of seven macrofauna species, seagrass beds and mixed mussel/oyster reefs were modelled for the Jade Bay (North Sea, Germany) in response to climatic and environmental scenarios (representing 2050). For the species distribution models four presence-absence modelling methods were merged within the ensemble forecasting platform 'biomod2'. The present spatial distribution (representing 2009) was modelled by statistically related species presences, true species absences and six high-resolution environmental grids. The future spatial distribution was then predicted in response to expected climate change-induced ongoing (1) sea-level rise and (2) water temperature increase. Between 2009 and 2050, the present and future prediction maps revealed a significant range gain for two macrofauna species (Macoma balthica, Tubificoides benedii), whereas the species' range sizes of five macrofauna species remained relatively stable across space and time. The predicted probability of occurrence (PO) of two macrofauna species (Cerastoderma edule, Scoloplos armiger) decreased significantly under the potential future habitat conditions. In addition, a clear seagrass bed extension (Zostera noltii) on the lower intertidal flats (mixed sediments) and a decrease in the PO of mixed Mytilus edulis/Crassostrea gigas reefs was predicted for 2050. Until the mid-21st century, our future climatic and environmental scenario revealed significant changes in the range sizes (gains-losses) and/or the PO (increases-decreases) for seven of the 10 modelled species at the study site.
Role of acyl carrier protein isoforms in plant lipid metabolism: Progress report
DOE Office of Scientific and Technical Information (OSTI.GOV)
Ohlrogge, J.B.
1989-01-01
Previous research from my lab has revealed that several higher plant species have multiple isoforms of acyl carrier protein (ACP) and therefore this trait appears highly conserved among higher plants. This level of conservation suggests that the existence of ACP isoforms is not merely the results of neutral gene duplications. We have developed techniques to examine a wider range of species. Acyl carrier proteins can be labelled very specifically and to high specific activity using H-palmitate and the E. coli enzyme acyl-ACP synthetase. Isoforms were then resolved by western blotting and native PAGE of H-palmitate labelled ACP's. Multiple isoforms ofmore » ACP were observed the leaf tissue of the monocots Avena sativa and Hordeum vulgare and dicots including Arabidopsis thallina, Cuphea wrightii, and Brassica napus. Lower vascular plants including the cycad, Dioon edule, Ginkgo biloba, the gymnosperm Pinus, the fern Anernia phyllitidis and Psilotum nudum, the most primitive known extant vascular plant, were also found to have multiple ACP isoforms as were the nonvascular liverwort, Marchantia and moss, Polytrichum. Therefore, the development of ACP isoforms occurred early in evolution. However, the uniellular alge Chlamydomonas and Dunaliella and the photosynthetic cyanobacteria Synechocystis and Agmnellum have only a single elecrophotetic form of ACP. Thus, multiple forms of ACP do not occur in all photosynthetic organisms but may be associated with multicellular plants.« less
NASA Astrophysics Data System (ADS)
Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.
2017-09-01
At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.
ESTIMATING THE DISTRIBUTION OF HARVESTED ...
Habitat suitability models are used to forecast how environmental change may affect the abundance or distribution of species of interest. The development of habitat suitability models may be used to estimate the vulnerability of this valued ecosystem good to natural or anthropogenic stressors. Using natural history information, rule-based habitat suitability models were constructed in a GIS for two recreationally harvested bivalve species (cockles Clinocardium nuttallii; softshells Mya arenaria) common to NE Pacific estuaries (N. California to British Columbia). Tolerance limits of each species were evaluated with respect to four parameters that are easy to sample: salinity, depth, sediment grain size, and the presence of bioturbating burrowing shrimp and were determined through literature review. Spatially-explicit habitat maps were produced for Yaquina and Tillamook estuaries (Oregon) using environmental data from multiple studies ranging from 1960 to 2012. Suitability of a given location was ranked on a scale of 1-4 (lowest to highest) depending on the number of variables that fell within a bivalve’s tolerance limits. The models were tested by comparison of the distribution of each suitability class to the observed distribution of bivalves reported in benthic community studies (1996-2012). Results showed that the areas of highest habitat suitability (value=4) within our model contained the greatest proportion of bivalve observations and highest popula
Metalexical awareness: development, methodology or written language? A cross-linguistic comparison.
Kurvers, Jeanne; Uri, Helene
2006-07-01
This study explores the ability to access word boundaries of pre-school children, using an on-line methodology (Karmiloff-Smith, Grant, Sims, Jones, & Cockle (1996). Cognition, 58, 197-219.), which has hardly been used outside English-speaking countries. In a cross-linguistic study in the Netherlands and Norway, four and five-year-old children were asked to repeat the last word every time a narrator stopped reading a story. In total 32 target-words were used, both closed and open class words, and both monosyllabic and disyllabic words. The outcomes in both countries were different from those of the original English study (Karmiloff-Smith et al., 1996): four- and five-year-olds were successful in only about 26% of the cases, whereas the success rate in the former English experiment was 75% for the younger and 96% for the older children. No differences were found between age groups and between open and closed class words. This methodology does reveal the ability to access word boundaries, but probably not because of the ease of the on-line methodology in itself, but rather because literacy introduces new representations of language, even in on-line processing. The outcomes implicate that the ability to mark word boundaries does not seem to be a valid indication of who is ready for reading.
Shell architecture: a novel proxy for paleotemperature reconstructions?
NASA Astrophysics Data System (ADS)
Milano, Stefania; Nehrke, Gernot; Wanamaker, Alan D., Jr.; Witbaard, Rob; Schöne, Bernd R.
2017-04-01
Mollusk shells are unique high-resolution paleoenvironmental archives. Their geochemical properties, such as oxygen isotope composition (δ18Oshell) and element-to-calcium ratios, are routinely used to estimate past environmental conditions. However, the existing proxies have certain drawbacks that can affect paleoreconstruction robustness. For instance, the estimation of water temperature of brackish and near-shore environments can be biased by the interdependency of δ18Oshell from multiple environmental variables (water temperature and δ18Owater). Likely, the environmental signature can be masked by physiological processes responsible for the incorporation of trace elements into the shell. The present study evaluated the use of shell structural properties as alternative environmental proxies. The sensitivity of shell architecture at µm and nm-scale to the environment was tested. In particular, the relationship between water temperature and microstructure formation was investigated. To enable the detection of potential structural changes, the shells of the marine bivalves Cerastoderma edule and Arctica islandica were analyzed with Scanning Electron Microscopy (SEM), nanoindentation and Confocal Raman Microscopy (CRM). These techniques allow a quantitative approach to the microstructural analysis. Our results show that water temperature induces a clear response in shell microstructure. A significant alteration in the morphometric characteristics and crystallographic orientation of the structural units was observed. Our pilot study suggests that shell architecture records environmental information and it has potential to be used as novel temperature proxy in near-shore and open ocean habitats.
Chelli, Venkatanarasimha Rao; Golder, Animes Kumar
2018-05-28
The analytes such as ascorbic acid (AA) present in Sechium edule were extracted (294 mg AA kg -1 fruit) in an aqueous media for its potential application for Ag-doping onto wurtzite ZnO. The bandgap of ZnO was decreased to 2.85 eV at the optimal Ag-loading of 1.18% (w/w) against 3.13 eV for the control catalyst without using the analytes and, the commercial AA only could reduce the bandgap to 2.91 eV. The saturation photo-electrochemical current density (46.68 mA cm -2 ) at E anode ≥ 0.31 V vs. Ag/AgCl was almost double than pristine ZnO under visible light illumination (λ mean = 525 nm, 18 K lux) and, the current density was insignificant in the dark. The doped catalyst exhibited the maximum 79.5% degradation (71% COD removal) of an anti-analgesic drug, dipyrone (100 μg L -1 dipyrone, catalyst 100 mg L -1 ) resulted from the formation of O 2 •- radical (g-factor of 2.002-2.008) and paramagnetic oxygen vacancies (g-factor of 2.020) and, no effect of dye-sensitization was noted. The highest quantum yield was found to be 34.7%. The catalyst loss was 6% after the fourth cycle and the dipyrone degradation was reduced to 70.8%. Copyright © 2018 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Beukema, J. J.
Annual variation in recruitment and biomass was studied during 13 years for the 5 species contributing most to total zoobenthic biomass in a tidal flat area in the westernmost part of the Wadden Sea. In all of these species annual biomass values tended to be more stable than numbers of recruits. In Cerastoderma edule and in Mytilus edulis recruitment variability was high, and was passed on almost completely to biomass, probably as a consequence of rapid juvenile growth and a high mortality, also in the adult stage, leaving few year-classes in the population. In Arenicola marina and in Mya arenaria biomass values varied much less than recruit numbers. Both species showed a low adult mortality rate with many year-classes present in the population, holding many old and heavy specimens that dominated biomass. Macoma balathica took an intermediate position in these respects. Recruitment was relatively stable in Arenicola and was probably controlled by the high numbers of adults. Recruitment variability was fairly low too in Macoma, but in this species juvenile mortality appeared to be directly related to their own density. Successful and poor years for recruitment were roughly the same for the 4 bivalve species. Particularly heavy spatfall was found during the summer following the severe 1978-1979 winter. Such synchronized recruitment does not fully add to variability in annual biomass values as the time needed for the recruted cohorts to reach maximum biomass values differs greatly between most of the high-biomass species.
Battey, J F; Ohlrogge, J B
1990-02-01
We have examined the occurrence of multiple acyl-carrier protein (ACP), isoforms in evolutionarily diverse species of higher and lower plants. Isoforms were resolved by native polyacrylamide gel electrophoresis (PAGE), and were detected by Western blotting or fluorography of [(3)H]-palmitate-labelled ACPs. Multiple isoforms of ACP were found in leaf tissue of the monocotyledons Avena sativa and Hordeum vulgare and dicotyledons Arabidopsis thaliana, Cuphea wrightii, and Brassica napus. Lower vascular plants including the lycopod Selaginella krausseriana, the gymnosperms Ephedra sp. and Dioon edule, the ferns Davallia feejensis and Marsilea sp. and the most primitive known extant vascular plant, Psilotum nudum, were all found to have multiple ACP isoforms, as were the nonvascular liverworts, Lunularia sp. and Marchantia sp. and the moss, Polytrichum sp. Therefore, the development of ACP isoforms appears to have occurred early in plant evolution. However, we could detect only a single electrophoretic form of ACP in the unicellular algae Chlamydomonas reinhardtii and Dunaliella tertiolecta and the photosynthetic cyanobacteria Synechocystis strain 6803 and Agmnellum quadruplicatum. Thus, multiple forms of ACP do not occur in all photosynthetic organisms but may be associated with multicellular plants. We have also examined tissue specificity and light control over the expression of ACP isoforms. The relative abundance of multiple forms of ACP in leaf of Spinacia and Avena was altered very little by light. Rather, the different patterns of ACP isoforms were primarily dependent on the tissue type.
NASA Astrophysics Data System (ADS)
Powers, H.; McDowell, N.; Breecker, D. O.
2010-12-01
We test the hypothesis that soils collected near dead and living pinus edulous (piñon pine) trees should show a difference in their capacities to decompose complex carbon compounds. Since soils near dead trees have a large amount of cellulose and other complex carbon, the soil microbial community should be selected to metabolize cellulose. We collected soils from both live and dead piñon trees, added cellulose to half of the replicates, and placed them in microcosms for incubation. The microcosms were periodically sampled by a trace gas analyzer (TGA100, Campbell Scientific, USA) for CO2 concentration and δ13C and δ18O analysis. We found that CO2 evolution rates from live soils were significantly higher than rates from dead soils (1.1 and 0.6 ug CO2 g-1 soil s-1 respectively); soils with added cellulose displayed higher rates (1.1 and 0.8 and ug CO2 g-1 soil s-1). We did not see any significant differences in δ13C values between treatments, but there was a difference in δ18O between soils treated with cellulose and soils with no cellulose. Soils from both dead and live trees showed an increase in CO2 efflux when cellulose was added; however there was no distinguishable difference in efflux rate between live and dead soils in the cellulose added treatments.
Azoxyglycoside content and beta-glycosidase activities in leaves of various cycads.
Yagi, Fumio
2004-12-01
Azoxyglycoside contents in leaves of 32 cycad species belonging to 10 cycad genera and the seeds of 4 Encephalartos species were analyzed by HPLC with a YMC-PA03 amide column. Azoxyglycosides were detected in mature leaves of 14 cycad species including 2 Bowenia, 2 Lepidozamia, 1 Microcycas, and 1 Stangeria species, but not in mature leaves of 18 other cycad species; 2 of 3 Ceratozamia, 1 of 3 Cycas, 3 of 3 Dioon, 10 of 11 Encephalartos, 1 of 3 Macrozamia and 1 of 3 Zamia species analyzed. The ratios of beta-glycosidase activity toward cycasin and macrozamin in extracts from the leaves of 9 species belonging to 9 genera were measured. The hydrolysis of cycasin was higher in the leaf extracts of Cycas revoluta, Bowenia spectabilis, Stangeria eriopus and Ceratozamia mexicana, whereas in Lepidozamia hopei, the hydrolysis levels of cycasin and macrozamin were similar. On the other hand, activity toward macrozamin was higher in Dioon edule, Encephalartos villosus, Macrozamia miquelii and Zamia fischeri. The hydrolytic activities in most species were estimated to be sufficient for the release of methylazoxymethanol in leaves analogous to the cyanogenesis of cyanogenic plants. Therefore, hydrolysis of azoxyglycosides by endogenous glycosidase in leaves seems to occur by accidental injury of leaves. However, in M. miquelii leaf extract, hydrolytic activity toward macrozamin was high and the activity toward cycasin was very low, though only cycasin was found in the leaves of this species.
Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.
Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani
2015-06-01
Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
NASA Astrophysics Data System (ADS)
Zwarts, Leo; Wanink, Jan H.
For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low
Birds of the Severn Estuary and Bristol Channel: their current status and key environmental issues.
Burton, N H K; Musgrove, A J; Rehfisch, M M; Clark, N A
2010-01-01
The Severn Estuary and Bristol Channel encompass a number of designated sites supporting populations of waterbirds and seabirds that are of national or international importance, including the Severn Estuary and Burry Inlet Special Protection Areas (SPAs)/Ramsar Sites and Carmarthen Bay, the UK's first marine SPA. Here, we provide an overview of the present numbers and trends of the waterbirds and seabirds using these sites, updating previous reviews undertaken prior to these designations. We further provide a summary of the main issues that have affected the status of the area's bird populations. Declines in the numbers of waders on the Severn Estuary and the southwest over the last two decades have been linked to climate change. The Sea Empress oil-spill impacted both breeding seabirds and the wintering Common Scoters in Carmarthen Bay, though numbers of the latter recovered 3years after the spill. At the Burry Inlet, Oystercatcher numbers have fallen over the last 25years and considerable research has been undertaken into the conflict with cockle and mussel fisheries. A long-term study at Cardiff Bay, at the mouth of the Severn, revealed a significant impact on the survival of Redshanks following its impoundment and has helped to further understanding of responses of waterbirds to estuarine habitat loss. The potential impacts of the construction of a tidal power scheme on the Severn Estuary are also discussed. (c) 2009 Elsevier Ltd. All rights reserved.
Modelling of enterobacterial loads to the Baie des Veys (Normandy, France).
Lafforgue, Michel; Gerard, Laure; Vieillard, Celine; Breton, Marguerite
2018-06-01
The Baie des Veys (Normandy, France) has abundant stocks of shellfish (oyster and cockle farms). Water quality in the bay is affected by pollutant inputs from a 3500 km 2 watershed and notably occasional episodes of contamination by faecal coliforms. In order to characterise enterobacterial loads and develop a plan of action to improve the quality of seawater and shellfish in the bay, a two-stage modelling procedure was adopted. This focused on Escherichia coli and included a catchment model describing the E. coli releases, and the transport and die-off of this bacteria up to the coast. The output from this model then served as input for a marine model used to determine the concentration of E. coli in seawater. A total 60 scenarios were tested, including different wind, tidal, rainfall and temperature conditions and accidental pollution events, for both current situations and future scenarios. The modelling results highlighted the impact of rainfall on E. coli loadings to the sea, as well as the effects of sluice gates and tidal cycles, which dictated the use of an hourly timescale for the modelling process. The coupled models also made it possible to identify the origin of these enterobacteria as found in shellfish harvesting areas, both in terms of the contributing watercourses and the sources of contamination of those watercourses. The tool can accordingly be used to optimise remedial action. Copyright © 2018 Elsevier GmbH. All rights reserved.
Thermal inactivation kinetics of hepatitis A virus in homogenized clam meat (Mercenaria mercenaria).
Bozkurt, H; D'Souza, D H; Davidson, P M
2015-09-01
Epidemiological evidence suggests that hepatitis A virus (HAV) is the most common pathogen transmitted by bivalve molluscs such as clams, cockles, mussels and oysters. This study aimed to generate thermal inactivation kinetics for HAV as a first step to design adequate thermal processes to control clam-associated HAV outbreaks. Survivor curves and thermal death curves were generated for different treatment times (0-6 min) at different temperatures (50-72°C) and Weibull and first-order models were compared. D-values for HAV ranged from 47·37 ± 1·23 to 1·55 ± 0·12 min for the first-order model and 64·43 ± 3·47 to 1·25 ± 0·45 min for the Weibull model at temperatures from 50 to 72°C. z-Values for HAV in clams were 12·97 ± 0·59°C and 14·83 ± 0·0·28°C using the Weibull and first-order model respectively. The calculated activation energies for the first-order and Weibull model were 145 and 170 kJ mole(-1) respectively. The Weibull model described the thermal inactivation behaviour of HAV better than the first-order model. This study provides novel and precise information on thermal inactivation kinetics of HAV in homogenized clams. This will enable reliable thermal process calculations for HAV inactivation in clams and closely related seafood. © 2015 The Society for Applied Microbiology.
Safety assessments of subcutaneous doses of aragonite calcium carbonate nanocrystals in rats
NASA Astrophysics Data System (ADS)
Jaji, Alhaji Zubair; Zakaria, Zuki Abu Bakar; Mahmud, Rozi; Loqman, Mohamad Yusof; Hezmee, Mohamad Noor Mohamad; Abba, Yusuf; Isa, Tijani; Mahmood, Saffanah Khuder
2017-05-01
Calcium carbonate nanoparticles have shown promising potentials in the delivery of drugs and metabolites. There is however, a paucity of information on the safety of their intentional or accidental over exposures to biological systems and general health safety. To this end, this study aims at documenting information on the safety of subcutaneous doses of biogenic nanocrystals of aragonite polymorph of calcium carbonate derived from cockle shells (ANC) in Sprague-Dawley (SD) rats. ANC was synthesized using the top-down method, characterized using the transmission electron microscopy and field emission scanning electron microscope and its acute and repeated dose 28-day trial toxicities were evaluated in SD rats. The results showed that the homogenous 30 ± 5 nm-sized spherical pure aragonite nanocrystals were not associated with mortality in the rats. Severe clinical signs and gross and histopathological lesions, indicating organ toxicities, were recorded in the acute toxicity (29,500 mg/m2) group and the high dose (5900 mg/m2) group of the repeated dose 28-day trial. However, the medium- (590 mg/m2 body weight) and low (59 mg/m2)-dose groups showed moderate to mild lesions. The relatively mild lesions observed in the low toxicity dosage group marked the safety margin of ANC in SD rats. It was concluded from this study that the toxicity of CaCO3 was dependent on the particulate size (30 ± 5 nm) and concentration and the route of administration used.
2013-01-01
Background Many edible plants are used in Cameroon since ancient time to control microbial infections. This study was designed at evaluating the antibacterial activities of the methanol extracts of ten Cameroonian vegetables against a panel of twenty nine Gram negative bacteria including multi-drug resistant (MDR) strains. Methods The broth microdilution method was used to determine the Minimal Inhibitory Concentrations (MIC) and the Minimal Bactericidal Concentrations (MBC) of the studied extracts. When chloramphenicol was used as a reference antibiotic, the MICs were also determined in the presence of Phenylalanine-Arginine β-Naphtylamide (PAβN), an efflux pumps inhibitor (EPI). The phytochemical screening of the extracts was performed using standard methods. Results All tested extracts exhibited antibacterial activities, with the MIC values varying from 128 to 1024 mg/L. The studied extracts showed large spectra of action, those from L. sativa, S. edule, C. pepo and S. nigrum being active on all the 29 bacterial strains tested meanwhile those from Amaranthus hybridus, Vernonia hymenolepsis, Lactuca.carpensis and Manihot esculenta were active on 96.55% of the strains used. The plant extracts were assessed for the presence of large classes of secondary metabolites: alkaloids, anthocyanins, anthraquinones, flavonoids, phenols, saponins, steroids, tannins and triterpenes. Each studied plant extract was found to contain compounds belonging to at least two of the above mentioned classes. Conclusion These results confirm the traditional claims and provide promising baseline information for the potential use of the tested vegetables in the fight against bacterial infections involving MDR phenotypes. PMID:23368430
Mahmood, Saffanah Khuder; Razak, Intan-Shameha Abdul; Ghaji, Mustafa Saddam; Yusof, Loqman Mohamed; Mahmood, Zaid Khudhur; Rameli, Mohd Adha Bin P; Zakaria, Zuki Abu Bakar
2017-01-01
The healing of load-bearing segmental defects in long bones is a challenge due to the complex nature of the weight that affects the bone part and due to bending, shearing, axial, and torsional forces. An innovative porous 3D scaffolds implant of CaCO3 aragonite nanocomposite derived from cockle shell was advanced for substitute bone solely for load-bearing cases. The biomechanical characteristics of such materials were designed to withstand cortical bone strength. In promoting bone growth to the implant material, an ideal surface permeability was formed by means of freeze drying and by adding copolymers to the materials. The properties of coating and copolymers supplement were also assessed for bone-implant connection resolutions. To examine the properties of the material in advanced biological system, an experimental trial in an animal model was carried out. Critical sized defect of bone was created in rabbit’s radial bone to assess the material for a load-bearing application with a short and extended period assessment with histological evaluation of the incorporated implanted material to the bone of the host. Trials in animal models proved that the material has the capability of enduring load-bearing conditions for long-term use devoid of breaking or generating stress that affects the host bone. Histological examination further confirmed the improved integration of the implanted materials to the host bone with profound bone development into and also above the implanted scaffold, which was attained with negligible reaction of the tissues to a foreign implanted material. PMID:29238193
Pérez-Huerta, Alberto; Etayo-Cadavid, Miguel F; Andrus, C Fred T; Jeffries, Teresa E; Watkins, Clifton; Street, Shane C; Sandweiss, Daniel H
2013-01-01
Marine macroinvertebrates are ideal sentinel organisms to monitor rapid environmental changes associated with climatic phenomena. These organisms build up protective exoskeletons incrementally by biologically-controlled mineralization, which is deeply rooted in long-term evolutionary processes. Recent studies relating potential rapid environmental fluctuations to climate change, such as ocean acidification, suggest modifications on carbonate biominerals of marine invertebrates. However, the influence of known, and recurrent, climatic events on these biological processes during active mineralization is still insufficiently understood. Analysis of Peruvian cockles from the 1982-83 large magnitude El Niño event shows significant alterations of the chemico-structure of carbonate biominerals. Here, we show that bivalves modify the main biomineralization mechanism during the event to continue shell secretion. As a result, magnesium content increases to stabilize amorphous calcium carbonate (ACC), inducing a rise in Mg/Ca unrelated to the associated increase in sea-surface temperature. Analysis of variations in Sr/Ca also suggests that this proxy should not be used in these bivalves to detect the temperature anomaly, while Ba/Ca peaks are recorded in shells in response to an increase in productivity, or dissolved barium in seawater, after the event. Presented data contribute to a better understanding of the effects of abrupt climate change on shell biomineralization, while also offering an alternative view of bivalve elemental proxy reconstructions. Furthermore, biomineralization changes in mollusk shells can be used as a novel potential proxy to provide a more nuanced historical record of El Niño and similar rapid environmental change events.
Comparative uptake from sea water and tissue distribution of 60Co in marine mollusks
DOE Office of Scientific and Technical Information (OSTI.GOV)
Carvalho, F.P.
Five different species of marine mollusks, Mytilus galloprovincialis Lmk., Tapes decussatus L., Cerastoderma (Cardium) edule (L.), Donax vittatus (da Costa) and Patella vulgata L., were exposed to /sup 60/Co-labelled sea water under laboratory conditions. After a 1-mo exposure, tested species reached different whole-body /sup 60/Co concentration factors (CF) over radioactive sea water of 73 +/- 27, 22 +/- 10, 84 +/- 25, 6.3 +/- 1.4 and 31 +/- 10, respectively, which are not dependent upon the size of mollusks. Equations for the experimental uptake curves, obtained using a multi-exponential model, indicate that /sup 60/Co uptake by mollusks involves two ormore » three compartments, according to the species. In all species, the larger compartments turn over with long biological half-lives, dependent upon species. At the beginning of the experiment, /sup 60/CoCl2 added to sea water was mainly in cationic forms. These forms were progressively converted into anionic plus neutral forms most likely due to complex formation with organic ligands. With time this physico-chemical evolution had a lowering effect on /sup 60/Co bioaccumulation by mollusks. Analysis of /sup 60/Co in tissues revealed that Donax shell and mantle do not accumulate the radionuclide in great quantities, generating the low whole-body concentration factor found. In contrast, shell and mantle from all other species displayed variable but high CFs. Shell by itself accounts for more than half of the /sup 60/Co whole-body burden. Among soft tissues, gills and viscera displayed the highest CF and muscle the lowest. From these experiments, one may conclude that significant differences among species do exist regarding Co bioaccumulation potential.« less
Nova, M X Vila; Borges, L R; de Sousa, A C B; Brasileiro, B T R V; Lima, E A L A; da Costa, A F; de Oliveira, N T
2011-02-22
Onion anthracnose, caused by Colletotrichum gloeosporioides, is one of the main diseases of onions in the State of Pernambuco. We examined the pathogenicity of 15 C. gloeosporioides strains and analyzed their genetic variability using RAPDs and internal transcribed spacers (ITS) of the rDNA region. Ten of the strains were obtained from substrates and hosts other than onion, including chayote (Sechium edule), guava (Psidium guajava), pomegranate (Punica granatum), water from the Capibaribe River, maracock (Passiflora sp), coconut (Cocus nucifera), surinam cherry (Eugenia uniflora), and marine soil; five isolates came from onions collected from four different regions of the State of Pernambuco and one region of the State of Amazonas. Pathogenicity tests were carried out using onion leaves and bulbs. All strains were capable of causing disease in leaves, causing a variable degree of lesions on the leaves; four strains caused the most severe damage. In the onion bulb tests, only three of the above strains caused lesions. Seven primers of arbitrary sequences were used in the RAPD analysis, generating polymorphic bands that allowed the separation of the strains into three distinct groups. The amplification products generated with the primers ITS1 and ITS4 also showed polymorphism when digested with three restriction enzymes, DraI, HaeIII and MspI. Only the latter two demonstrated genetic variations among the strains. These two types of molecular markers were able to differentiate the strain from the State of Amazonas from those of the State of Pernambuco. However, there was no relationship between groups of strains, based on molecular markers, and degree of pathogenicity for onion leaves and bulbs.
NASA Astrophysics Data System (ADS)
Duffy, James P.; Pratt, Laura; Anderson, Karen; Land, Peter E.; Shutler, Jamie D.
2018-01-01
Seagrass ecosystems are highly sensitive to environmental change. They are also in global decline and under threat from a variety of anthropogenic factors. There is now an urgency to establish robust monitoring methodologies so that changes in seagrass abundance and distribution in these sensitive coastal environments can be understood. Typical monitoring approaches have included remote sensing from satellites and airborne platforms, ground based ecological surveys and snorkel/scuba surveys. These techniques can suffer from temporal and spatial inconsistency, or are very localised making it hard to assess seagrass meadows in a structured manner. Here we present a novel technique using a lightweight (sub 7 kg) drone and consumer grade cameras to produce very high spatial resolution (∼4 mm pixel-1) mosaics of two intertidal sites in Wales, UK. We present a full data collection methodology followed by a selection of classification techniques to produce coverage estimates at each site. We trialled three classification approaches of varying complexity to investigate and illustrate the differing performance and capabilities of each. Our results show that unsupervised classifications perform better than object-based methods in classifying seagrass cover. We also found that the more sparsely vegetated of the two meadows studied was more accurately classified - it had lower root mean squared deviation (RMSD) between observed and classified coverage (9-9.5%) compared to a more densely vegetated meadow (RMSD 16-22%). Furthermore, we examine the potential to detect other biotic features, finding that lugworm mounds can be detected visually at coarser resolutions such as 43 mm pixel-1, whereas smaller features such as cockle shells within seagrass require finer grained data (<17 mm pixel-1).
Factors Controlling the Stable Nitrogen Isotopic Composition (δ15N) of Lipids in Marine Animals
Svensson, Elisabeth; Schouten, Stefan; Hopmans, Ellen C.; Middelburg, Jack J.; Sinninghe Damsté, Jaap S.
2016-01-01
Lipid extraction of biomass prior to stable isotope analysis is known to cause variable changes in the stable nitrogen isotopic composition (δ15N) of residual biomass. However, the underlying factors causing these changes are not yet clear. Here we address this issue by comparing the δ15N of bulk and residual biomass of several marine animal tissues (fish, crab, cockle, oyster, and polychaete), as well as the δ15N of the extracted lipids. As observed previously, lipid extraction led to a variable offset in δ15N of biomass (differences ranging from -2.3 to +1.8 ‰). Importantly, the total lipid extract (TLE) was highly depleted in 15N compared to bulk biomass, and also highly variable (differences ranging from -14 to +0.7 ‰). The TLE consisted mainly of phosphatidylcholines, a group of lipids with one nitrogen atom in the headgroup. To elucidate the cause for the 15N-depletion in the TLE, the δ15N of amino acids was determined, including serine because it is one of the main sources of nitrogen to N-containing lipids. Serine δ15N values differed by -7 to +2 ‰ from bulk biomass δ15N, and correlated well with the 15N depletion in TLEs. On average, serine was less depleted (-3‰) than the TLE (-7 ‰), possibly due to fractionation during biosynthesis of N-containing headgroups, or that other nitrogen-containing compounds, such as urea and choline, or recycled nitrogen contribute to the nitrogen isotopic composition of the TLE. The depletion in 15N of the TLE relative to biomass increased with the trophic level of the organisms. PMID:26731720
Ubertini, Martin; Lefebvre, Sébastien; Gangnery, Aline; Grangeré, Karine; Le Gendre, Romain; Orvain, Francis
2012-01-01
summer than in spring, in turn suggesting an important role of macrofauna bioturbation and filter feeding (Cerastoderma edule). PMID:22952910
Carroll, Michael L.; Johnson, Beverly J.; Henkes, Gregory A.; McMahon, Kelton W.; Voronkov, Andrey; Ambrose, William G.; Denisenko, Stanislav G.
2009-01-01
Identifying patterns and drivers of natural variability in populations is necessary to gauge potential effects of climatic change and the expected increases in commercial activities in the Arctic on communities and ecosystems. We analyzed growth rates and shell geochemistry of the circumpolar Greenland smooth cockle, Serripes groenlandicus, from the southern Barents Sea over almost 70 years between 1882 and 1968. The datasets were calibrated via annually-deposited growth lines, and growth, stable isotope (δ18O, δ13C), and trace elemental (Mg, Sr, Ba, Mn) patterns were linked to environmental variations on weekly to decadal scales. Standardized growth indices revealed an oscillatory growth pattern with a multi-year periodicity, which was inversely related to the North Atlantic Oscillation Index (NAO), and positively related to local river discharge. Up to 60% of the annual variability in the Ba/Ca could be explained by variations in river discharge at the site closest to the rivers, but the relationship disappeared at a more distant location. Patterns of δ18O, δ13C, and Sr/Ca together provide evidence that bivalve growth ceases at elevated temperatures during the fall and recommences at the coldest temperatures in the early spring, with the implication that food, rather than temperature, is the primary driver of bivalve growth. The multi-proxy approach of combining the annually integrated information from the growth results and higher resolution geochemical results yielded a robust interpretation of biophysical coupling in the region over temporal and spatial scales. We thus demonstrate that sclerochronological proxies can be useful retrospective analytical tools for establishing a baseline of ecosystem variability in assessing potential combined impacts of climatic change and increasing commercial activities on Arctic communities. PMID:19394657
Taboada-López, María Vanesa; Iglesias-López, Sara; Herbello-Hermelo, Paloma; Bermejo-Barrera, Pilar; Moreda-Piñeiro, Antonio
2018-08-14
Applicability of single-particle inductively coupled plasma mass spectrometry (sp-ICP-MS) using dwell times equal to or shorter than 100 μs has been tested for assessing titanium dioxide nanoparticles (TiO 2 NPs) in bivalve mollusks. TiO 2 NPs isolation from fresh mollusk tissues was achieved by ultrasound assisted enzymatic hydrolysis procedure using a pancreatin/lipase mixture. Optimum extraction conditions imply ultrasonication (60% amplitude) for 10 min, and 7.5 mL of a solution containing 3.0 g L -1 of pancreatin and lipase (pH 7.4). The developed method was found to be repeatable (repeatability of 17% for the over-all procedure, TiO 2 NPs concentration of 5.33 × 10 7 ± 8.89 × 10 6 , n = 11), showing a limit of detection of 5.28 × 10 6 NPs g -1 , and a limit of detection in size of 24.4-30.4 nm, based on the 3σ criteria, and on the 3σ/5 σ criteria, respectively. The analytical recovery within the 90-99% range (use of TiO 2 NPs standards of 50 nm at 7 and 14 μg L -1 as Ti). Several bivalve mollusks (clams, cockles, mussels, razor clams, oysters and variegated scallops) were analyzed for total titanium (ICP-MS after microwave assisted acid digestion), and for TiO 2 NPs by the proposed method. TiO 2 NPs concentrations were within the 2.36 × 10 7 -1.25 × 10 8 NPs g -1 range, and the most frequent sizes were from 50 to 70 nm. Copyright © 2018 Elsevier B.V. All rights reserved.
Development of an Electrochemical DNA Biosensor to Detect a Foodborne Pathogen.
Nordin, Noordiana; Yusof, Nor Azah; Radu, Son; Hushiarian, Roozbeh
2018-06-03
identification of V. parahaemolyticus in fresh cockles.
NASA Astrophysics Data System (ADS)
Lavaud, Romain; Thébault, Julien; Lorrain, Anne; van der Geest, Matthijs; Chauvaud, Laurent
2013-02-01
Environmental archives are useful tools for describing past and current climate variations and they provide an opportunity to assess the anthropogenic contribution in coastal ecological changes. Along the West African coast, few studies have focused on such archives in coastal ecosystems. The bloody cockle Senilia senilis, an intertidal bivalve mollusk species, is widely distributed from Western Sahara to Angola, and has been harvested by humans over thousands of years. Therefore, this species appears to be a good candidate for assessing past variations of key environmental parameters such as temperature, primary production, and Saharan dust advection within West African coastal ecosystems. In the present paper, we focused (i) on the identification of growth rhythms of S. senilis shells in Mauritania (Banc d'Arguin), and (ii) on the potential of these shells as (paleo-)environmental archives. The method we used combined environmental survey, sclerochronology, and geochemical analyses of aragonite samples. We showed that microgrowth line formation was controlled by a tidal forcing, leading to the formation of two lines per lunar day. Brightness and thickness of these microgrowth lines progressively decreased from spring to neap tides (fortnightly cycle). Lunar daily growth rates displayed strong seasonal variations, with highest values (> 300 μm per lunar day) recorded in summer. The oxygen isotope composition of S. senilis shells (δ18Oaragonite) accurately tracked seawater temperature seasonal variations, with a precision of 0.8 °C. Finally, we discussed the opportunity to use Ba:Ca ratio in shells as a proxy for primary production or for Saharan dust transport. We also hypothesized that either Canary Currentvariations or, more probably, massive aerosol transfers from Sahara to the Atlantic Ocean could control uranium availability in coastal waters and explain the occurrence of U:Ca peaks within S. senilis shells.
Morrison, Anthony L; Swierczek, Zofia; Gulson, Brian L
2016-03-01
The Imperial Smelting Furnace (ISF) for producing lead and zinc simultaneously has operated on four continents and in eleven countries from the 1950's. One of the process changes that the ISF introduced was the production of a finely granulated slag waste. Although this slag contained significant amounts of residual lead (Pb) and zinc (Zn), because of its glassy nature it was considered environmentally benign. From the Cockle Creek smelter near Boolaroo at the northern end of Lake Macquarie, NSW, Australia, it is estimated that around 2.1 million tonnes of the fine slag was distributed into the community and most remains where it was originally utilised. Residual tonnages of slag of this magnitude are common worldwide wherever the ISF operated. Studies of base metal smelting slags have concluded that mineralogical and morphological characteristics of the slag play a critical role in moderating environmental release of toxic elements. Scanning electron microscopy (SEM) and microanalysis of the ISF slags has shown that the Pb and associated elements are present as discrete nodules (∼6-22 μm) in the slag and that they are not associated with Zn which is contained in the glass slag phase. Using an automated SEM and analysis technique (QEMSCAN(®)) to "map" the mineralogical structure of the particles, it was possible to quantitatively determine the degree of access infiltrating fluids might have to the reaction surface of the Pb phases. The level of access decreases with increasing particle size, but in even the largest sized particles (-3350 + 2000 μm) nearly 80% of the Pb-containing phases were totally or partially accessible. These results provide evidence that the toxic elements in the slags are not contained by the glassy phase and will be vulnerable to leaching over time depending on their individual phase reactivity. Copyright © 2015 Elsevier Ltd. All rights reserved.
Doublet, Benoît; Granier, Sophie A.; Robin, Frédéric; Bonnet, Richard; Fabre, Laëtitia; Brisabois, Anne; Cloeckaert, Axel; Weill, François-Xavier
2009-01-01
We describe the characterization of a novel CTX-M β-lactamase from Salmonella enterica. Four S. enterica isolates (three of serotype Westhampton and one of serotype Senftenberg) resistant to extended-spectrum cephalosporins (cefotaxime and ceftazidime) were recovered in 2004 from living cockles in three supermarkets located in distant geographic areas in France, which got their supplies from the same fishery. The isolates were found to produce a novel extended-spectrum β-lactamase (ESBL) belonging to the CTX-M-1 phylogenetic group and named CTX-M-53. The CTX-M-53 β-lactamase harbored the substitution Asp240Gly, like the CTX-M-15 enzyme, which is specifically implicated in a higher catalytic efficiency against ceftazidime. The blaCTX-M-53 gene was located on a mobilizable 11-kb plasmid, pWES-1. The complete sequence of pWES-1 revealed the presence of a novel insertion sequence, ISSen2, and an IS26 element upstream and downstream of the blaCTX-M-53 gene, respectively; however, transposition assays of the blaCTX-M-53 gene were unsuccessful. IS26 elements may have contributed to the acquisition of the blaCTX-M-53 gene. Interestingly, the mobilization module of the pWES-1 plasmid was similar to that of quinolone resistance plasmids (carrying the qnrS2 gene) from aquatic sources. Although belonging to two serotypes differentiated on the basis of the O-antigen structure (E1 or E4 groups), the isolates were found to be genetically indistinguishable by pulsed-field gel electrophoresis. Multilocus sequence typing showed that the isolates of serotype Westhampton had a sequence type, ST14, common among isolates of serotype Senftenberg. This is the first characterization of the CTX-M-53 ESBL, which represents an additional ceftazidime-hydrolyzing CTX-M enzyme. PMID:19273683
NASA Astrophysics Data System (ADS)
Tillmann, Tanja; Ziehe, Daniel
2014-05-01
Dating of Holocene sediments in shallow coastal areas of the German North Sea by conventional techniques is commonly problematic. In particular the marine reservoir effect of radiocarbon means that radiocarbon dating cannot be applied to sediments younger than about 400 years. Amino acid racemization dating (AAR) is a viable alternative for dating young sediments. The method is based on the determination of ratios of D and L amino acid enantiomers in organic matrices of biogenic carbonates. In this study we use AAR as a tool for dating Holocene barrier islands sediments. Based on an AAR derived chronological framework we develop a model of barrier spit accretion which describes the interaction between extreme events, fair weather coastal processes and sedimentary development that constrains the major episodes of barrier island evolution. The stratigraphy was defined using ground-penetrating radar (GPR) surveys complemented by sedimentological coring data. The stratigraphy is then conceptualised in a AAR chronostratigraphic framework to define a chronological order and allow the development of a stratigraphic model of the evolution of Southern Sylt. The AAR data provide high temporal resolution and have been used for dating stages of barrier spit accretion. The time lines are marked as storm surge generated erosion unconformities in the stratigraphic profile. Individual shells and shell fragments of Cerastoderma edule, Mya arenaria, Mytilus edulis and Scrobicularia plana have been accumulated by short-term storm events as shell layers associated with the erosion unconformities and have been dated by AAR. Time lines reveal that the barrier spit accretion occurred episodically, and is dependant on the provided rate of sand delivery. The general trend is that sequences young to the. South. The AAR derived time lines have been verified and correlated by historic maps and sea charts. It is apparent that spit enlargement at this site increased significantly during the
NASA Astrophysics Data System (ADS)
Blanchet, Hugues; Gouillieux, Benoît; Alizier, Sandrine; Amouroux, Jean-Michel; Bachelet, Guy; Barillé, Anne-Laure; Dauvin, Jean-Claude; de Montaudouin, Xavier; Derolez, Valérie; Desroy, Nicolas; Grall, Jacques; Grémare, Antoine; Hacquebart, Pascal; Jourde, Jérôme; Labrune, Céline; Lavesque, Nicolas; Meirland, Alain; Nebout, Thiebaut; Olivier, Frédéric; Pelaprat, Corine; Ruellet, Thierry; Sauriau, Pierre-Guy; Thorin, Sébastien
2014-07-01
Based on a parallel sampling conducted during autumn 2008, a comparative study of the intertidal benthic macrofauna among 10 estuarine systems located along the Channel and Atlantic coasts of France was performed in order to assess the level of fauna similarity among these sites and to identify possible environmental factors involved in the observed pattern at both large (among sites) and smaller (benthic assemblages) scales. More precisely this study focused on unraveling the observed pattern of intertidal benthic fauna composition and diversity observed at among-site scale by exploring both biotic and abiotic factors acting at the among- and within-site scales. Results showed a limited level of similarity at the among-site level in terms of intertidal benthic fauna composition and diversity. The observed pattern did not fit with existing transitional water classification methods based on fish or benthic assemblages developed in the frame of the European Water Framework Directive (WFD). More particularly, the coastal plain estuaries displayed higher among-site similarity compared to ria systems. These coastal plain estuaries were characterized by higher influence of river discharge, lower communication with the ocean and high suspended particulate matter levels. On the other hand, the ria-type systems were more dissimilar and different from the coastal plain estuaries. The level of similarity among estuaries was mainly linked to the relative extent of the intertidal "Scrobicularia plana-Cerastoderma edule" and "Tellina tenuis" or "Venus" communities as a possible consequence of salinity regime, suspended matter concentrations and fine particles supply with consequences on the trophic functioning, structure and organization of benthic fauna. Despite biogeographical patterns, the results also suggest that, in the context of the WFD, these estuaries should only be compared on the basis of the most common intertidal habitat occurring throughout all estuarine systems
Dumbauld, B R; Brooks, K M; Posey, M H
2001-10-01
Oyster culture operations on the West coast of North America have developed into complete farming operations for the introduced Japanese oyster, Crassostrea gigas, which now covers vast areas of the intertidal landscape, particularly in Washington State where the pesticide carbaryl has also been used to control burrowing thalassinid shrimp for more than 30 years. Field experiments were conducted to examine the effects of these habitat modifications on the benthic community in Willapa, Bay Washington (124 degrees 06'W,46 degrees 24'N) where 50% of the state's oyster production occurs. Results indicated that the primary long-term effect of carbaryl application was removal of the two species of thalassinid shrimp (Neotrypaea californiensis and Upogebia pugettensis), which dominated the community at the start of the experiment and clearly influenced community composition themselves. Small peracarid crustaceans like the amphipods Corophium acherusicum and Eohaustorius estuarius experienced the most significant short-term mortalities, but generally recruited back to treated sites within 3 months, and were often more abundant on treated than untreated sites 1 year after carbaryl application. Results for molluscs were mixed, with no significant effect on Macoma spp, but a significant effect on the commensal clam Crytomya californica and mixed results for the cockle Clinocardium nutalli. Polychaetes were the least susceptible to carbaryl and with the exception of a short-term effect on oligochaetes, no significant negative effects were observed. The addition of oysters did not affect the infaunal community in this study, however greater abundance of epifaunal organisms like mussels, scaleworms, and the amphipod Amphithoe valida, which builds tubes in algae attached to shells, was observed. Carbaryl, which is currently applied to roughly 242 ha (< 6% of the intertidal) in Willapa Bay on an annual basis, has a variable but relatively short-term effect on the benthic community
Kahsay, Tesfay; Negash, Guesh; Hagos, Yohannes; Hadush, Birhanu
2015-08-21
Skins and hides are perishable resources that can be damaged by parasitic diseases and human error, which result in downgrading or rejection. This study was conducted to identify defect types and to determine their prevalence in pickled sheep and wet blue goat skins and wet blue hides. Each selected skin or hide was examined for defects in natural light and the defects were graded according to established quality criteria in Ethiopian standard manuals. Major defects were captured by digital photography. The major pre-slaughter defects included scratches (64.2%), cockle (ekek) (32.8%), wounds or scars (12.6%), lesions from pox or lumpy skin disease (6.1%), poor substance (5%), branding marks (2.3%) and tick bites (1.5%). The presence of grain scratches in wet blue hides (76.3%) was significantly higher than in pickled sheep (67.2%) and wet blue goat (59.1%) skins. The major slaughter defects included flay cuts or scores, holes, poor pattern and vein marks, with a higher occurrence in wet blue goat skins (28.7%; P < 0.001) than in wet blue hides (22.8%) and pickled sheep skins (11.1%). The most prevalent postslaughter defects were grain cracks (14.9%), hide beetle damage (8%), damage caused by heat or putrefaction (3.7%) and machine-induced defects (0.5%). Grain cracks (27.04%) and hide beetle damage (13.9%) in wet blue goat skins were significantly more common than in wet blue hides and pickled sheep skins. These defects cause depreciation in the value of the hides and skins. Statistically significant (P < 0.001) higher rejection rates were recorded for wet blue hides (82.9%) than for pickled sheep skins (18.3%) and wet blue goat skins (8.5%). Improved animal health service delivery, effective disease control strategies and strong collaboration between stakeholders are suggested to enhance the quality of skins and hides.
New results on Late Quaternary stratigraphy of Manych depression
NASA Astrophysics Data System (ADS)
Kurbanov, Redzhep; Yanina, Tamara; Borisova, Olga
2017-04-01
Manych-strait connected Black sea and Caspian Sea in Pleistocene is a great event in the history of the Ponto-Caspian region. The strait located within such geological structure as Manych Depression which is extended sublatitudinally from the west coast of Nothern Caspian to the north-west of the Azov sea. The existence of the Manych-strait is essentially for the stratigraphy and paleogeography. There were several stages when marine waters spilled over from Black sea to Caspian and alternatively. Due to the alternation of sedimentary layers it is possible to correlate pleistocene deposits and paleogeographic events. Nowadays there are a lot of materials and data about the history of Manych-strait. In the profile are distinguished interbedding marine deposits with lacustrine and alluvial formations and subaerial deposit on top. The main question is the paleogeographical reconstruction. We try to solve this problem using our new data and elaborating available information. In February 2016 complex geomorphologic and paleogeographic works in central part of depression on northern coast of Manych-Gudilo lake were carried out. We performed cable drilling of 2 cores (depth of each 45 m) and hand hammer drilling (8 boreholes, max. depth 12 m) of covering Holocene sediments on different geomorphological levels of depression. From the core (3 cm diameter) continuous sampling was made for spore-pollen, lithological and geochemical analyzes. The stratigraphic subdivision of the core is based on facial-lithology and macro-malakofaunistic analisys. In the lower part of both cores there is barren formation of interbedding layers of sand and clays. The bottom line is precise, below lays a marine Carangat formation (MIS-5) of sand and clay with well-preserved Black Sea marine mollusk shells (Cardium edule, Paphia senescens, Ostrea edulis, Loripes lacteus, Chione gallina, Chlamys glabra). Higher in the core there is a loam-clay layer including both Black Sea (euryhaline species
Evaluation of the cytotoxicity, mutagenicity and antimutagenicity of emerging edible plants.
Yen, G C; Chen, H Y; Peng, H H
2001-11-01
This study evaluates the toxic, mutagenic and antimutagenic effects of emerging edible plants that are consumed as new leafy vegetables in Taiwan. Among eight plant extracts, only the extracts of Sol (Solanum nigrum L.) showed cytotoxicity to Salmonella typhimurium TA100 in the absence of S9 mix. The toxicity of extracts from different parts of the Sol plant, such as leaf and stem, immature fruit and mature fruit, towards S. typhimurium TA100 and human lymphocytes was also assayed. The immature fruit extracts of Sol exhibited strong cytotoxicity with dose dependence and induced significant DNA damage in human lymphocytes based on the comet assay. However, no mutagenicity was found in eight plant extracts to TA98 or TA100 either with or without the S9 mixture. Sol and Sec [Sechium edule (Jacq.) Swartz] extracts showed the strongest inhibitory effect towards the mutagenicity of 2-amino-3-methyl-imidazo[4,5-f]quinoline (IQ) in S. typhimurium TA98 and TA100; the ID(50) was less then 1 mg/plate. Cra [Crassocephalum creidioides (Benth.) S. Moore] extracts also expressed moderate antimutagenic activities towards IQ and benzo[a]pyrene (B[a]P) either in TA98 or in TA100; the ID(50) was 1.63-2.41 mg/plate. The extracts from Bas (Basella alba L.), Bou (Boussingaultia gracilis Miers var. pseudobaselloides Bailey), Cen (Centella asiatica L. Urban), Cor (Corchorus olitorius L.) and Por (Portulaca oleracea L.) showed weak to moderate inhibition of mutagenicity of IQ. However, the potential antimutagenicity of these plant extracts towards B[a]P was weaker than that towards IQ. For a direct mutagen, 4-nitroquinoline-N-oxide (NQNO), only the Sol extracts showed strong inhibitory effects in the TA100 system. The antimutagenic activity of water extracts of Sec was partly reduced by heating at 100 degrees C for 20 min. The heat-stable antimutagens in Sec extracts could be produced in the plant extract preparation process. Fractions with molecular weights above 30,000 showed the
The ecology, evolution, impacts and management of host-parasite interactions of marine molluscs.
Coen, Loren D; Bishop, Melanie J
2015-10-01
Molluscs are economically and ecologically important components of aquatic ecosystems. In addition to supporting valuable aquaculture and wild-harvest industries, their populations determine the structure of benthic communities, cycling of nutrients, serve as prey resources for higher trophic levels and, in some instances, stabilize shorelines and maintain water quality. This paper reviews existing knowledge of the ecology of host-parasite interactions involving marine molluscs, with a focus on gastropods and bivalves. It considers the ecological and evolutionary impacts of molluscan parasites on their hosts and vice versa, and on the communities and ecosystems in which they are a part, as well as disease management and its ecological impacts. An increasing number of case studies show that disease can have important effects on marine molluscs, their ecological interactions and ecosystem services, at spatial scales from centimeters to thousands of kilometers and timescales ranging from hours to years. In some instances the cascading indirect effects arising from parasitic infection of molluscs extend well beyond the temporal and spatial scales at which molluscs are affected by disease. In addition to the direct effects of molluscan disease, there can be large indirect impacts on marine environments resulting from strategies, such as introduction of non-native species and selective breeding for disease resistance, put in place to manage disease. Much of our understanding of impacts of molluscan diseases on the marine environment has been derived from just a handful of intensively studied marine parasite-host systems, namely gastropod-trematode, cockle-trematode, and oyster-protistan interactions. Understanding molluscan host-parasite dynamics is of growing importance because: (1) expanding aquaculture; (2) current and future climate change; (3) movement of non-native species; and (4) coastal development are modifying molluscan disease dynamics, ultimately leading to
NASA Astrophysics Data System (ADS)
Freitas, Pedro; Richardson, Christopher; Chenery, Simon; Monteiro, Carlos; Butler, Paul; Reynolds, David; Scourse, James; Gaspar, Miguel
2017-04-01
Bivalve shells have a great potential as high-resolution geochemical proxy archives of marine environmental conditions. In addition, sclerochronology of long-lived bivalve species (e.g. Arctica islandica) provides a timeline of absolutely dated shell material for geochemical analysis that can extend into the past beyond the lifetime of single individuals through the use of replicated crossmatched centennial to millennial chronologies. However, the interpretation of such records remains extremely challenging and complex, with multiple environmental and biological processes affecting element incorporation in the shell (e.g. crystal fabrics, organic matrix, biomineralization mechanisms and physiological processes). As a result, the effective use of bivalve shell elemental/Ca ratios as palaeoenvironmental proxies has been limited, often to species-specific applications or applications restricted to particular environmental settings. The dog-cockle, Glycymeris glycymeris, is a relatively long-lived bivalve (up to 200 years) that occurs in coarse-grained subtidal sediments of coastal shelf seas of Europe and North West Africa. Glycymeris glycymeris shells provide a valuable, albeit not fully explored, archive to reconstruct past environmental variability in an area lacking sclerochronological studies due to the rarity of long-lived bivalves and lack of coral reefs. In this study, we evaluate the potential of Sr/Ca and Mg/Ca ratios in G. glycymeris shells as geochemical proxies of upwelling conditions in the Iberian Upwelling System, the northern section of the Canary Current Eastern Boundary Upwelling System. Sr/Ca and Mg/Ca generally co-varied significantly and a clear ontogenetic, non-environmental related change in Sr/Ca and Ba/Ca variability was observed. High Sr/Ca and Mg/Ca ratios in older shells (> 10 years old) were found to be associated with the occurrence of growth lines deposited during the winter reduction in shell growth. Nevertheless, Sr/Ca and Mg
NASA Astrophysics Data System (ADS)
Ahmedou Salem, Mohamed Vall; van der Geest, Matthijs; Piersma, Theunis; Saoud, Younès; van Gils, Jan A.
2014-01-01
At temperate latitudes densities and biomass of intertidal molluscs tend to be strongly seasonal. Here we provide a comparative study on seasonality of bivalves and gastropods in the tropical intertidal seagrass-covered soft sediment environment of Banc d'Arguin, Mauritania (20°N, 16°W). In this system, benthivorous shorebirds exert considerable predation pressure with strong seasonal variations. It has been proposed that during the period when (adult) shorebirds are absent (May-August) benthic biomass would be able to recover, but a first test was inconclusive. Over a full year (March 2011-February 2012), each month we sampled benthic invertebrates at sixteen permanent sites. The total of 3763 specimens comprised 20 species, representing eight orders and 19 families. Bivalves were much more common than gastropods. The bivalve Loripes lucinalis dominated the assemblage throughout the year (58% of total number), followed by Dosinia isocardia (10%), Senilia senilis (8%) and the gastropod Gibbula umbilicalis (6%). Average biomass amounted to 32 g AFDM/m2, of which the large West-African bloody cockle Senilia made up three-quarter, Loripes 16%, Gibbula 2% and Dosinia 1%. Across the 20 species, lowest densities were reached in late spring (May) and summer (Aug.), whereas highest densities occurred in autumn (Oct.). The lowest overall density of 676 specimens/m² in August more than doubled to a peak density of 1538 specimens/m² in October, most of the increase being due to strong recruitment in both Loripes (densities increasing from 322 specimens/m² in Sept. to 785 specimens/m² in Oct.) and Dosinia (densities increasing from 18 specimens/m² in Aug. to 265 specimens/m² in Sept.). Our results suggest that by the time the feathered molluscivore predators returned in high numbers to Banc d'Arguin (after their summer breeding season in the Arctic), benthic animals were at a peak. In order to quantitatively understand the seasonal changes in mollusc abundance, we
[State strategy for Cycad (Zamiaceae) conservation: a proposal for the State of Hidalgo, Mexico].
Vite, Aurelia; Pulido, María T; Flores-Vázquez, Juan C
2013-09-01
Mexico has the second largest cycad diversity in the world, and the Sierra Madre Oriental (SMO) is one of the richest biogeographic regions for these plants. Despite there is a general Cycad National Program in the country, there are no state-level cycad conservation strategies or programs. Thus the aim of this study was to propose a cycad conservation strategy for the state of Hidalgo, which is located in the Southern part of the SMO. For this, a cycad species inventory was made in the state, for which three methods were used: review of published literature; consultation in the main Mexican herbaria to verify botanical specimens; and exhaustive field research to compare findings with previously reported species and to recognize new records at the county and state level. The proposed research work strategy combined the following elements: prioritize the county and local areas with greatest cycad species richness; prioritize the species least resistant to environmental change and/or having restricted geographic distribution; and to consider the main uses of these plants by local residents. The results showed that Hidalgo has three genera and eight species ofcycads: Ceratozamia fuscoviridis, C. latifolia, C. mexicana, C. sabatoi, Dioon edule, Zamia fischeri, Z. loddigesii and Z. vazquezii, all of which are considered by the International Union for Conservation of Nature (IUCN). This study added two new species records for Hidalgo and 21 at the county level. The species are distributed in 26 counties, of which Chapulhuacán and Pisaflores are notable for their high species richness. Hidalgo has the fourth-greatest cycad species richness among Mexican states, although its area accounts for only 1.07% of the country. The state's diversity is greater than in other states with larger area, and even than in some other entire countries in Mesoamerica. The presented state cycad conservation strategy proposes that a total of some 11,325 ha to be conserved in nine zones
Harvey, P J; Taylor, M P; Kristensen, L J; Grant-Vest, S; Rouillon, M; Wu, L; Handley, H K
2016-08-01
This study examines the recent soil Lead Abatement Strategy (LAS) in Boolaroo, New South Wales, Australia, that was designed to "achieve a reduction in human exposure to lead dust contamination in surface soils". The abatement programme addressed legacy contamination of residential areas following closure of lead smelting operations in 2003 at the Pasminco Cockle Creek Smelter (PCCS). The principal objective of the LAS was to "cap and cover" lead-contaminated soils within the urban environment surrounding the PCCS. Soil lead concentrations of 2500-5000 mg/kg were scheduled for removal and replacement, while concentrations between 1500 and 2500 mg/kg were replaced only under limited circumstances. To date, there has been no industry, government or independent assessment of the clean-up programme that involved >2000 homes in the township of Boolaroo. Thus, by measuring post-abatement soil lead concentrations in Boolaroo, this study addresses this knowledge gap and evaluates the effectiveness of the LAS for reducing the potential for lead exposure. Soil lead concentrations above the Australian residential soil health investigation level value for residential soils (300 mg/kg) were identified at all but one of the residential properties examined (n = 19). Vacuum dust samples (n = 17) from the same homes had a mean lead concentration of 495 mg/kg (median 380 mg/kg). Bio-accessibility testing revealed that lead in household vacuum dust was readily accessible (% bio-accessible) (mean = 92 %, median = 90 %), demonstrating that the risk of exposure via this pathway remains. Assessment of a limited number of properties (n = 8) where pre-abatement soil lead levels were available for comparison showed they were not statistically different to post-abatement. Although the LAS did not include treatment of non-residential properties, sampling of community areas including public sports fields, playgrounds and schools (n = 32) was undertaken to determine the
NASA Astrophysics Data System (ADS)
Beukema, J. J.; Cadée, G. C.; Dekker, R.
2002-10-01
environmental conditions will have limited zoobenthic biomass in extreme areas such as the upper part of the intertidal and areas exposed to strong currents and wave action. Severe winters temporarily reduced the abundance of several sensitive (southern) species, including most of the infaunal and epifaunal predators. Even stronger temporary and local reductions of zoobenthic biomass occurred as a consequence of fishery activities for such benthic species as cockles, mussels and lugworms. Recovery after temporary biomass reductions was generally rapid, but late-winter values of total-Balgzand zoobenthos biomass never exceeded an upper level of 45 g AFDW per m 2 probably set by maximal annual rates of primary production of between 400 and 500 g C per m 2.
2011-01-01
Background Po210 can be accumulated in various environmental materials, including marine organisms, and contributes to the dose of natural radiation in seafood. The concentration of this radionuclide in the marine environment can be influenced by the operation of a coal burning power plant but existing studies regarding this issue are not well documented. Therefore, the aim of this study was to estimate the Po210 concentration level in marine organisms from the coastal area of Kapar, Malaysia which is very near to a coal burning power plant station and to assess its impact on seafood consumers. Methods Concentration of Po210 was determined in the edible muscle of seafood and water from the coastal area of Kapar, Malaysia using radiochemical separation and the Alpha Spectrometry technique. Results The activities of Po210 in the dissolved phase of water samples ranged between 0.51 ± 0.21 and 0.71 ± 0.24 mBql-1 whereas the particulate phase registered a range of 50.34 ± 11.40 to 72.07 ± 21.20 Bqkg-1. The ranges of Po210 activities in the organism samples were 4.4 ± 0.12 to 6.4 ± 0.95 Bqkg-1 dry wt in fish (Arius maculatus), 45.7 ± 0.86 to 54.4 ± 1.58 Bqkg-1 dry wt in shrimp (Penaeus merguiensis) and 104.3 ± 3.44 to 293.8 ± 10.04 Bqkg-1 dry wt in cockle (Anadara granosa). The variation of Po210 in organisms is dependent on the mode of their life style, ambient water concentration and seasonal changes. The concentration factors calculated for fish and molluscs were higher than the recommended values by the IAEA. An assessment of daily intake and received dose due to the consumption of seafood was also carried out and found to be 2083.85 mBqday-1person-1 and 249.30 μSvyr-1 respectively. These values are comparatively higher than reported values in other countries. Moreover, the transformation of Po210 in the human body was calculated and revealed that a considerable amount of Po210 can be absorbed in the internal organs. The calculated values of life time
Alam, Lubna; Mohamed, Che Abd Rahim
2011-05-20
Po²¹⁰ can be accumulated in various environmental materials, including marine organisms, and contributes to the dose of natural radiation in seafood. The concentration of this radionuclide in the marine environment can be influenced by the operation of a coal burning power plant but existing studies regarding this issue are not well documented. Therefore, the aim of this study was to estimate the Po²¹⁰ concentration level in marine organisms from the coastal area of Kapar, Malaysia which is very near to a coal burning power plant station and to assess its impact on seafood consumers. Concentration of Po²¹⁰ was determined in the edible muscle of seafood and water from the coastal area of Kapar, Malaysia using radiochemical separation and the Alpha Spectrometry technique. The activities of Po²¹⁰ in the dissolved phase of water samples ranged between 0.51 ± 0.21 and 0.71 ± 0.24 mBql⁻¹ whereas the particulate phase registered a range of 50.34 ± 11.40 to 72.07 ± 21.20 Bqkg⁻¹. The ranges of Po²¹⁰ activities in the organism samples were 4.4 ± 0.12 to 6.4 ± 0.95 Bqkg⁻¹ dry wt in fish (Arius maculatus), 45.7 ± 0.86 to 54.4 ± 1.58 Bqkg⁻¹ dry wt in shrimp (Penaeus merguiensis) and 104.3 ± 3.44 to 293.8 ± 10.04 Bqkg⁻¹ dry wt in cockle (Anadara granosa). The variation of Po²¹⁰ in organisms is dependent on the mode of their life style, ambient water concentration and seasonal changes. The concentration factors calculated for fish and molluscs were higher than the recommended values by the IAEA. An assessment of daily intake and received dose due to the consumption of seafood was also carried out and found to be 2083.85 mBqday⁻¹person⁻¹ and 249.30 μSvyr⁻¹ respectively. These values are comparatively higher than reported values in other countries. Moreover, the transformation of Po²¹⁰ in the human body was calculated and revealed that a considerable amount of Po²¹⁰ can be absorbed in the internal organs. The
Cockle-Hearne, Jane; Barnett, Deborah; Hicks, James; Simpson, Mhairi; White, Isabel; Faithfull, Sara
2018-04-30
2.5, SD 1.9) versus 92% (mean 3.7, SD 1.0); rate of completing cognitive behavior therapy exercises 77% (mean 16.1, SD 6.2) versus 88% (mean 18.6, SD 3.9). Chat room activity occurred among 63% (5/8) and 75% (12/16) of men, respectively. In phase I, 75% (6/8) of men viewed all the films; in phase II, the total number of unique views weekly was 16, 11, 11, and 10, respectively. The phase II mood diary was completed by 100% (16/16) of men. Satisfaction was high for the program and films. Limited efficacy testing indicated improvement in distress baseline to post intervention: phase I, P=.03, r=-.55; phase II, P=.001, r=-.59. Self-efficacy improved for coping P=.02, r=-.41. Service assessment confirmed ease of assimilation into clinical practice and clarified health care practitioner roles. The Web-based program is acceptable and innovative in clinical practice. It was endorsed by patients and has potential to positively impact the experience of men with distress after prostate cancer treatment. It can potentially be delivered in a stepped model of psychological support in primary or secondary care. Feasibility evidence is compelling, supporting further evaluative research to determine clinical and cost effectiveness. ©Jane Cockle-Hearne, Deborah Barnett, James Hicks, Mhairi Simpson, Isabel White, Sara Faithfull. Originally published in JMIR Cancer (http://cancer.jmir.org), 30.04.2018.
NASA Astrophysics Data System (ADS)
Lehnert, O.; Calner, M.; Ahlberg, P.; Harper, D. A.
2012-04-01
Several prominent palaeokarst surfaces have recently been detected in the Cambro-Ordovician sedimentary succession of Sweden. The oldest palaeokarst was found in autumn 2011 in Västergötland. An irregular palaeokarst cave with a breccia fill yielding large, angular Orsten clasts in a dark mud- to wackestone matrix is exposed beneath a karstic surface in the Cambrian Alum Shale Formation at Kakeled Quarry, Kinnekulle. The karstic surface occurs near the top of the Kakeled Limestone Bed that ranges from the upper Agnostus pisiformis into the Ctenopyge tumida Zone. The base of the cave is more than 1.4 m below this unconformity. A mass occurrence of Orusia lenticularis, a shallow-water brachiopod originally settling on hard substrates, in the karst pockets reflects deposition of the conglomeratic cover in extremely shallow marine environments. We interpret the widespread Orusia occurrences together with a brecciated or conglomeratic interval above an irregular surface in various Swedish locations as evidence for transgression after a major regression, regionally exposing the sea-floors of the Alum Shale Basin. A slightly younger karst surface is exposed in Tomten Quarry at Torbjörntorp, Västergötland. This resembles "Schrattenkalk" in the quarry wall but rock slabs cut vertical and parallel to bedding display a karren system, which reconstructed in 3D resembles "Napfkarren" or cockling features. Trilobites of the Ctenopyge bisulcata and C. linnarssoni zones have been recovered from the orsten bed just below the base of a 1-2 cm thick and irregular glauconitic packstone layer of the Bjørkåsholmen Formation (upper P. deltifer conodont Zone). The huge stratigraphic gap comprises the six uppermost trilobite zones of the Furongian plus most of the Tremadocian. Darriwilian conodonts with reworked older material within a limestone bed slightly above the glauconitic packstone point to yet another substantial gap in the succession. In the new Tingskullen core from
Sea otter studies in Glacier Bay National Park and Preserve: annual report 2002
Bodkin, James L.; Kloecker, Kimberly A.; Esslinger, George G.; Monson, Daniel H.; Coletti, Heather A.; Doherty, Janet
2003-01-01
Since 1995, the number of sea otters in Glacier Bay proper has increased from around 5 to more than 1200. Sea otter distribution is mostly limited to the Lower Bay, south of Sandy Cove, and is not continuous within that area. Concentrations occur in the vicinity of Sita Reef and Boulder Island and between Pt. Carolus and Rush Pt. on the west side of the Bay, although there have been occasional sightings north of Sandy Cove (Figure 1). Large portions of the Bay remain unoccupied by sea otters, but recolonization is occurring rapidly. Most prey recovered by sea otters in Glacier Bay are ecologically, commercially, or socially important species. In 2002 sea otter diet consisted of 35% clam, 26% mussel, 3% crab, 3.0% snail, 2% starfish, 11% urchins, 2% other, and 20% unidentified. Dominant clam species include the butter clam, Saxidomus gigantea, the Greenland cockle, Serripes groenlandicus, and the littleneck clam, Protothaca staminea. Urchins are primarily green urchins, Strongylocentrotus droebachiensis, and the mussel is Modiolus modiolus. Crabs observed in 2002 include the Dungeness, Cancer magister, the kelp crab Pugettia gracilis, and the helmet crab, Telmessus cherigonus. Although we characterize diet at broad geographic scales, we have previously found diet to vary between sites separated by as little as several hundred meters. Dietary variation among and within sites can reflect differences in prey availability as well as individual specialization. We estimated species composition, density, biomass, and sizes of subtidal clams, urchins, and mussels at 13 sites in Glacier Bay and 5 sites in nearby Port Althorp, where sea otters have been present for at least 20 years. All sites were selected based on the presence of abundant clam siphons and the absence of sea otters (Glacier Bay) or abundant shell litter and the presence of sea otters (Port Althorp). Glacier Bay sites were selected to achieve a broad geographic sample of dense subtidal clam beds within