Are rapid transitions between invasive and native species caused by alternative stable states, and does it matter?

PubMed

Hansen, Gretchen J A; Ives, Anthony R; Vander Zanden, M Jake; Carpenter, Stephen R

2013-10-01

Rapid transitions in ecosystem structure, or regime shifts, are a hallmark of alternative stable states (ASS). However, regime shifts can occur even when feedbacks are not strong enough to cause ASS. We investigated the potential for ASS to explain transitions between dominance of an invasive species, rusty crayfish (Orconectes rusticus), and native sunfishes (Lepomis spp.) in northern Wisconsin (USA) lakes. A rapid transition from Lepomis to rusty crayfish dominance occurred as rusty crayfish invaded Trout Lake, and the reverse transition resulted from an eight-year experimental removal of rusty crayfish from Sparkling Lake. We fit a stage-structured population model of species interactions to 31 years of time-series data from each lake. The model identified water level as an important driver, with drought conditions reducing rusty crayfish recruitment and allowing Lepomis dominance. The maximum-likelihood parameter estimates of the negative interaction between rusty crayfish and Lepomis led to ASS in the model, where each species was capable of excluding the other within a narrow range of environmental conditions. However, uncertainty in parameter estimates made it impossible to exclude the potential that rapid transitions were caused by a simpler threshold response lacking alternative equilibria. Simulated forward and backward transitions between species dominance occurred at different environmental conditions (i.e., hysteresis), even when the parameters used for simulation did not predict ASS as a result of slow species responses to environmental drivers. Thus, ASS are possible, but by no means certain, explanations for rapid transitions in this system, and our results highlight the difficulties associated with distinguishing ASS from other types of threshold responses. However, whether regime shifts are caused by ASS may be relatively unimportant in this system, as the range of conditions over which transitions occur is narrow, and under most conditions, the system is predicted to exist in only a single state.

Does juvenile competition explain displacement of a native crayfish by an introduced crayfish?

USGS Publications Warehouse

Larson, E.R.; Magoulick, D.D.

2009-01-01

The coldwater crayfish Orconectes eupunctus is endemic to the Spring and Eleven Point Rivers of Arkansas and Missouri, and appears to have been displaced from a portion of its range by the recently introduced ringed crayfish Orconectes neglectus. We examined competition among juveniles as a potential mechanism for this crayfish species displacement through laboratory and field experiments. Orconectes eupunctus juveniles survived and grew in stream cages in their former range, implicating biotic interactions rather than habitat degradation in the displacement. Laboratory experiments revealed O. neglectus juveniles were dominant in the presence of limited food, whereas size rather than species determined occupancy of limited shelter. In a field competition experiment using stream cages, O. neglectus juveniles did not inhibit growth or reduce survival of O. eupunctus juveniles. Consequently, laboratory evidence of O. neglectus dominance did not correspond with competition under field conditions. Combined with previous studies examining the effects of O. neglectus on O. eupunctus, these results suggest that competition may not be a factor in this crayfish species displacement. Alternate mechanisms for the apparent displacement of O. eupunctus by O. neglectus, such as differential predation or reproductive interference, should be investigated. ?? 2008 Springer Science+Business Media B.V.

Ecological effects of lead mining on Ozark streams: In-situ toxicity to woodland crayfish (Orconectes hylas)

USGS Publications Warehouse

Allert, A.L.; Fairchild, J.F.; DiStefano, R.J.; Schmitt, C.J.; Brumbaugh, W.G.; Besser, J.M.

2009-01-01

The Viburnum Trend mining district in southeast Missouri, USA is one of the largest producers of lead-zinc ore in the world. Previous stream surveys found evidence of increased metal exposure and reduced population densities of crayfish immediately downstream of mining sites. We conducted an in-situ 28-d exposure to assess toxicity of mining-derived metals to the woodland crayfish (Orconectes hylas). Crayfish survival and biomass were significantly lower at mining sites than at reference and downstream sites. Metal concentrations in water, detritus, macroinvertebrates, fish, and crayfish were significantly higher at mining sites, and were negatively correlated with caged crayfish survival. These results support previous field and laboratory studies that showed mining-derived metals negatively affect O. hylas populations in streams draining the Viburnum Trend, and that in-situ toxicity testing was a valuable tool for assessing the impacts of mining on crayfish populations.

Life-history notes on Cambarus hubbsi creaser (Hubbs crayfish) from the South Fork Spring River, Arkansas

USGS Publications Warehouse

Larson, E.R.; Magoulick, Daniel D.

2011-01-01

Many crayfish species native to the southeastern United States are imperiled due to small range sizes and anthropogenic impacts such as habitat loss and introduction of non-native species. Furthermore, effective management of crayfish is limited by the scarcity of life-history and ecological data for many of these species. We report results of the first life-history study of the crayfish Cambarus hubbsi (Hubbs Crayfish). We collected 466 Hubbs Crayfish from the South Fork Spring River, AR throughout 2006 and recorded carapace lengths, wet weights, indicators of reproductive activity, and number of eggs on ovigerous females. Using length-frequency distributions, we identified four Hubbs Crayfish age classes and evaluated growth rates by plotting size by season (winter, spring, summer, autumn). Male Hubbs Crayfish were more common than females in all seasons except autumn, and males weighed more at equivalent lengths than females. Reproductive activity in Hubbs Crayfish peaked in late winter and spring, and ovigerous females were collected in March, April, and June. Ovigerous females were age II or III and carried few eggs relative to co-occurring crayfish of the genus Orconectes. Compared to these Orconectes species, Hubbs Crayfish is comparatively slow growing, long lived, with low reproductive potential, and as a result may be categorized as a K life-history strategist. Based on this species' life-history strategy and previously documented habitat specificity and taxonomic distinctiveness, Hubbs Crayfish may require monitoring and management attention normally reserved for species with smaller ranges.

Effectiveness of two commercial rotenone formulations in the eradication of virile crayfish Orconectes virillis

USGS Publications Warehouse

Recsetar, Matthew S.; Bonar, Scott A.

2015-01-01

The virile or northern crayfish Orconectes virilis is an invasive species throughout much of the USA, damaging aquatic communities where it is introduced. Therefore, identification of effective methods for its eradication from areas in which it is unwanted is important. We studied the effectiveness of two commercial formulations of rotenone, Chem Fish Regular and CFT Legumine, for virile crayfish control. Although both formulations were effective for fish eradication, earlier observations by fisheries managers suggested that the relative effectiveness of the two formulations differs for crayfish. The only noteworthy difference between the formulations is that the former contains a synergist. In our first experiment, we tested each toxicant at the maximum labeled dosage (5 ppm) and found CFT Legumine to be 100% ineffective (0% mortality), while the Chem Fish Regular treatment resulted in 12.5% mortality. After we deemed Chem Fish Regular to be the only toxicant with any effectiveness against virile crayfish, we tested concentrations from 5 to 50 ppm and found 10 times the maximum labeled dosage (50 ppm rotenone) was needed to kill all virile crayfish. Because crayfish burrow and can leave water, and because 100% eradication is usually desired, rotenone applied at the labeled rates will not be effective for crayfish control. However, treating a body of water with CFT Legumine to eradicate invasive fish while leaving desirable crayfish unharmed is possible.

Impacts of drought and crayfish invasion on stream ecosystem structure and function

USGS Publications Warehouse

Magoulick, Daniel D.

2014-01-01

Drought and seasonal drying can be important disturbance events in many small streams, leading to intermittent or isolated habitats. Many small streams contain crayfish populations that are often keystone or dominant species in these systems. I conducted an experiment in stream mesocosms to examine the effects of drought and potential ecological redundancy of a native and invasive crayfish species. I examined the effects of drought (drought or control) and crayfish presence (none, native crayfish Orconectes eupunctus or invasive crayfish Orconectes neglectus) on stream mesocosm structure and function (leaf breakdown, community metabolism, periphyton, sediment and chironomid densities) in a fully factorial design. Each mesocosm contained a deep and shallow section, and drought treatments had surface water present (5-cm depth) in deep sections where tiles and leaf packs were placed. Drought and crayfish presence did not interact for any response variable. Drought significantly reduced leaf breakdown, and crayfish presence significantly increased leaf breakdown. However, the native and invasive crayfish species did not differ significantly in their effects on leaf breakdown. Drought significantly reduced primary production and community respiration overall, whereas crayfish presence did not significantly affect primary production and community respiration. Neither drought nor crayfish presence significantly affected periphyton overall. However, drought significantly reduced autotrophic index (AI), and crayfish presence increased AI. Inorganic sediment and chironomid density were not affected by drought, but both were significantly reduced by crayfish presence. O. eupunctus reduced AI and sediment more than O. neglectus did. Neither drought nor crayfish species significantly affected crayfish growth or survival. Drought can have strong effects on ecosystem function, but weaker effects on benthic structure. Crayfish can have strong effects on ecosystem structure and function regardless of drought. In stream mesocosms, native and invasive crayfish species appeared largely ecologically redundant, although subtle differences in crayfish effects could cascade throughout the food web, and further research is needed to address this question. 

Physical habitat and water quality correlates of crayfish distributions in a mined watershed

USGS Publications Warehouse

Welsh, Stuart A.; Loughman, Zachary J.

2014-01-01

In mined watersheds, water quality alters aquatic faunas, but few studies have focused on associations between stream habitat and crayfish distributions. We examined associations of water quality and physical habitat quality on presence/absence of six crayfish species in the upper Kanawha River drainage of southern West Virginia, USA, a region with a long history of surface and mountaintop removal mining of coal. Data supported an association of physical habitat quality with the presence of four species (Cambarus carinirostris, Cambarus robustus, Cambarus cf. sciotensis, and Orconectes sanbornii). Cambarus bartonii cavatus and the non-native Orconectes virilis were associated with lower quality physical habitat than that of the other four species. Relative to other species, C. b. cavatus was associated with the lowest conductivity values, whereas O. virilis was associated with the highest conductivity values. Secondary and tertiary burrowers were generally associated with relatively high-quality physical habitat. However, C. b. cavatus, a crayfish known to burrow extensively in headwater streams, was associated with the lowest quality physical habitat. Physical habitat quality was generally supported over stream conductivity as a variable influencing crayfish distributions. Our data demonstrate the importance of stream habitat quality when assessing crayfish assemblages within mined watersheds.

Effects of historical lead–zinc mining on riffle-dwelling benthic fish and crayfish in the Big River of southeastern Missouri, USA

USGS Publications Warehouse

Allert, A.L.; DiStefano, R.J.; Fairchild, J.F.; Schmitt, C.J.; McKee, M.J.; Girondo, J.A.; Brumbaugh, W.G.; May, T.W.

2013-01-01

The Big River (BGR) drains much of the Old Lead Belt mining district (OLB) in southeastern Missouri, USA, which was historically among the largest producers of lead–zinc (Pb–Zn) ore in the world. We sampled benthic fish and crayfish in riffle habitats at eight sites in the BGR and conducted 56-day in situ exposures to the woodland crayfish (Orconectes hylas) and golden crayfish (Orconectes luteus) in cages at four sites affected to differing degrees by mining. Densities of fish and crayfish, physical habitat and water quality, and the survival and growth of caged crayfish were examined at sites with no known upstream mining activities (i.e., reference sites) and at sites downstream of mining areas (i.e., mining and downstream sites). Lead, zinc, and cadmium were analyzed in surface and pore water, sediment, detritus, fish, crayfish, and other benthic macro-invertebrates. Metals concentrations in all materials analyzed were greater at mining and downstream sites than at reference sites. Ten species of fish and four species of crayfish were collected. Fish and crayfish densities were significantly greater at reference than mining or downstream sites, and densities were greater at downstream than mining sites. Survival of caged crayfish was significantly lower at mining sites than reference sites; downstream sites were not tested. Chronic toxic-unit scores and sediment probable effects quotients indicated significant risk of toxicity to fish and crayfish, and metals concentrations in crayfish were sufficiently high to represent a risk to wildlife at mining and downstream sites. Collectively, the results provided direct evidence that metals associated with historical mining activities in the OLB continue to affect aquatic life in the BGR.

Whole-lake invasive crayfish removal and qualitative modeling reveal habitat-specific food web topology

DOE PAGES

Hansen, Gretchen J. A.; Tunney, Tyler D.; Winslow, Luke A.; ...

2017-02-10

Patterning of the presence/absence of food web linkages (hereafter topology) is a fundamental characteristic of ecosystems that can influence species responses to perturbations. However, the insight from food web topology into dynamic effects of perturbations on species is potentially hindered because most described topologies represent data integrated across spatial and temporal scales. We conducted a 10-year, whole-lake experiment in which we removed invasive rusty crayfish ( Orconectes rusticus) from a 64-ha north-temperate lake and monitored responses of multiple trophic levels. We compared species responses observed in two sub-habitats to the responses predicted from all topologies of an integrated, literature-informed basemore » food web model of 32 potential links. Out of 4.3 billion possible topologies, only 308,833 (0.0072%) predicted responses that qualitatively matched observed species responses in cobble habitat, and only 12,673 (0.0003%) matched observed responses in sand habitat. Furthermore, when constrained to predictions that both matched observed responses and were highly reliable (i.e., predictions were robust to link strength values), only 5040 (0.0001%) and 140 (0.000003%) topologies were identified for cobble and sand habitats, respectively. A small number of linkages were nearly always present in these valid, reliable networks in sand, while a greater variety of possible network configurations were possible in cobble. Direct links involving invasive rusty crayfish were more important in cobble, while indirect effects involving Lepomis spp. were more important in sand. Importantly, the importance of individual species linkages differed dramatically among cobble and sand sub-habitats within a single lake, even though species composition was identical. Furthermore the true topology of food webs is difficult to determine, constraining topologies to include spatial resolution that matches observed experimental outcomes may reduce possibilities to a small number of plausible alternatives.« less

Whole-lake invasive crayfish removal and qualitative modeling reveal habitat-specific food web topology

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hansen, Gretchen J. A.; Tunney, Tyler D.; Winslow, Luke A.

Patterning of the presence/absence of food web linkages (hereafter topology) is a fundamental characteristic of ecosystems that can influence species responses to perturbations. However, the insight from food web topology into dynamic effects of perturbations on species is potentially hindered because most described topologies represent data integrated across spatial and temporal scales. We conducted a 10-year, whole-lake experiment in which we removed invasive rusty crayfish ( Orconectes rusticus) from a 64-ha north-temperate lake and monitored responses of multiple trophic levels. We compared species responses observed in two sub-habitats to the responses predicted from all topologies of an integrated, literature-informed basemore » food web model of 32 potential links. Out of 4.3 billion possible topologies, only 308,833 (0.0072%) predicted responses that qualitatively matched observed species responses in cobble habitat, and only 12,673 (0.0003%) matched observed responses in sand habitat. Furthermore, when constrained to predictions that both matched observed responses and were highly reliable (i.e., predictions were robust to link strength values), only 5040 (0.0001%) and 140 (0.000003%) topologies were identified for cobble and sand habitats, respectively. A small number of linkages were nearly always present in these valid, reliable networks in sand, while a greater variety of possible network configurations were possible in cobble. Direct links involving invasive rusty crayfish were more important in cobble, while indirect effects involving Lepomis spp. were more important in sand. Importantly, the importance of individual species linkages differed dramatically among cobble and sand sub-habitats within a single lake, even though species composition was identical. Furthermore the true topology of food webs is difficult to determine, constraining topologies to include spatial resolution that matches observed experimental outcomes may reduce possibilities to a small number of plausible alternatives.« less

Systematics and biogeography of Orconectes, subgenus Trisellescens, in the southeastern United States, a test of morphology-based classification

Treesearch

Christopher A. Taylor; Susan B. Adams; Guenter A. Schuster

2014-01-01

Diagnosable taxonomic units are fundamental to conservation biology and management of resources and the need for sound science in both fields is more pressing for aquatic ecosystems. Within freshwater crayfishes, the North American genus Orconectes is one of the most diverse in the World. Accurate assessments of species level relationships and species boundaries within...

Differences found in the macroinvertebrate community composition in the presence or absence of the invasive alien crayfish, Orconectes hylas

USGS Publications Warehouse

Freeland-Riggert, Brandye T.; Cairns, Stefan H.; Poulton, Barry C.; Riggert, Chris M.

2016-01-01

Introductions of alien species into aquatic ecosystems have been well documented, including invasions of crayfish species; however, little is known about the effects of these introductions on macroinvertebrate communities. The woodland crayfish (Orconectes hylas (Faxon)) has been introduced into the St. Francis River watershed in southeast Missouri and has displaced populations of native crayfish. The effects of O. hylas on macroinvertebrate community composition were investigated in a fourth-order Ozark stream at two locations, one with the presence of O. hylas and one without. Significant differences between sites and across four sampling periods and two habitats were found in five categories of benthic macroinvertebrate metrics: species richness, percent/composition, dominance/diversity, functional feeding groups, and biotic indices. In most seasons and habitat combinations, the invaded site had significantly higher relative abundance of riffle beetles (Coleoptera: Elmidae), and significantly lower Missouri biotic index values, total taxa richness, and both richness and relative abundance of midges (Diptera: Chironomidae). Overall study results indicate that some macroinvertebrate community differences due to the O. hylas invasion were not consistent between seasons and habitats, suggesting that further research on spatial and temporal habitat use and feeding ecology of Ozark crayfish species is needed to improve our understanding of the effects of these invasions on aquatic communities.

Differences Found in the Macroinvertebrate Community Composition in the Presence or Absence of the Invasive Alien Crayfish, Orconectes hylas

PubMed Central

Freeland-Riggert, Brandye T.

2016-01-01

Introductions of alien species into aquatic ecosystems have been well documented, including invasions of crayfish species; however, little is known about the effects of these introductions on macroinvertebrate communities. The woodland crayfish (Orconectes hylas (Faxon)) has been introduced into the St. Francis River watershed in southeast Missouri and has displaced populations of native crayfish. The effects of O. hylas on macroinvertebrate community composition were investigated in a fourth-order Ozark stream at two locations, one with the presence of O. hylas and one without. Significant differences between sites and across four sampling periods and two habitats were found in five categories of benthic macroinvertebrate metrics: species richness, percent/composition, dominance/diversity, functional feeding groups, and biotic indices. In most seasons and habitat combinations, the invaded site had significantly higher relative abundance of riffle beetles (Coleoptera: Elmidae), and significantly lower Missouri biotic index values, total taxa richness, and both richness and relative abundance of midges (Diptera: Chironomidae). Overall study results indicate that some macroinvertebrate community differences due to the O. hylas invasion were not consistent between seasons and habitats, suggesting that further research on spatial and temporal habitat use and feeding ecology of Ozark crayfish species is needed to improve our understanding of the effects of these invasions on aquatic communities. PMID:26986207

Competition for food between an introduced crayfish and two fishes endemic to the Colorado River basin

USGS Publications Warehouse

Carpenter, J.

2005-01-01

Crayfish are not native to the Colorado River basin (CRB), however they are now established in portions of the mainstem and in many tributaries. I used density manipulation experiments in a laboratory setting to determine intra- and interspecific competition for food between Orconectes virilis, an aggressive polytrophic crayfish now common in the CRB, and two native fishes: Gila chub, Gila intermedia, and flannelmouth sucker, Catostomus latipinnis. I tested each fish species in separate trials. Growth of Gila chub decreased when animal densities increased, however they were more affected by intraspecific competition than by crayfish presence. In contrast, growth of flannelmouth suckers was more affected by crayfish than by intraspecific competition. Crayfish growth was not significantly altered by presence of either fish. Crayfish thus reduced fish growth by competition for food, but the effect differed markedly between the two species.

Do environmental changes or juvenile competition act as mechanisms of species displacement in crayfishes?

USGS Publications Warehouse

Westhoff, Jacob T.; DiStefano, R.J.; Magoulick, D.D.

2012-01-01

The Big Creek Crayfish, Orconectes peruncus, is native to the St. Francis River drainage in Missouri, USA and is often absent where the introduced Woodland Crayfish, Orconectes hylas, has established. We performed a field experiment to determine whether effects of current abiotic conditions and interspecific competition with O. hylas were responsible for displacement of O. peruncus from parts of their former range. We examined growth and survival of juvenile male O. peruncus exposed to juvenile male O. hylas in enclosures at two sites in the former range of O. peruncus. Enclosures contained 8 (low density) or 16 individuals (high density) and had O. peruncus only (control) or both species (interspecific treatment). Juvenile O. peruncus were able to survive and grow in portions of their former range, implicating biotic versus abiotic factors in the displacement of O. peruncus. Survival rates of O. peruncus did not differ among treatments at either site. Orconectes peruncus showed significant growth in all treatments and interspecific effects were not greater than intraspecific effects on O. peruncus growth rates. High-density treatments showed significantly reduced O. peruncus growth rates compared to low-density treatments, except in Carver Creek interspecific treatments. When considered in the context of previous studies examining the effects of O. hylas on O. peruncus, results suggest that neither direct competition between juvenile males of the two species or abiotic change are responsible for the decreased range of O. peruncus. Additional research is required to determine the mechanism(s) driving the displacement of O. peruncus. ?? 2011 Springer Science+Business Media B.V.

Laboratory agonistic interactions demonstrate failure of an introduced crayfish to dominate two imperiled endemic crayfishes

USGS Publications Warehouse

Rahm, E.J.; Griffith, S.A.; Noltie, Douglas B.; DiStefano, R.J.

2005-01-01

Following its introduction into the St. Francis River drainage, Missouri, U.S.A., the woodland crayfish, Orconectes hylas has expanded its range there; simultaneously populations of two imperiled endemic species, the Big Creek crayfish, O. peruncus, and the St. Francis River crayfish, O. quadruncus have declined therein. In seeking a basis for this decline, our study objective was to test whether the outcome of aggressive inter-specific interactions would favor O. hylas. We studied agonistic encounters between size-matched pairs of same-sex individuals of the introduced and the endemic species in a laboratory setting, first with juveniles and then with adults. Within each life stage, we conducted four sets of laboratory experiments, with approximately 20 trials in each set: (1) O. hylas males versus O. peruncus males, (2) O. hylas males versus O. quadruncus males, (3) O. hylas females versus O. peruncus females, and (4) O. hylas females versus O. quadruncus females. In addition, these same four experiment sets were repeated using larger adult O. hylas crayfish matched with smaller-sized adult endemics, mimicking the mismatch in adult sizes that occurs in the wild. Within each experiment, every trial was analysed to quantify the frequency of occurrence of three initiation behaviors and to determine the overall outcome of the trial. Results did not show O. hylas (juveniles or adults) to be behaviorally dominant over either endemic species. Orconectes hylas displayed the majority of one of the initiation behaviors significantly more often than did the endemic species in only two of the twelve experiments. Because direct aggressive interaction was not demonstrated to be the mechanism whereby O. peruncus and O. quadruncus are being replaced by O. hylas, other life history and ecological factors will require investigation. ?? Koninklijke Brill NV, 2005.

Habitat use and growth of the western painted crayfish Orconectes palmeri longimanus

USGS Publications Warehouse

Dyer, Joseph J.; Mouser, Joshua; Brewer, Shannon K.

2016-01-01

Identifying ontogenetic shifts in habitat use by aquatic organisms is necessary for improving conservation strategies; however, our ability to designate life stages based on surrogate metrics (i.e., length) is questionable without validation. This study identified growth patterns of age-0 western painted crayfish Orconectes palmeri longimanus (Faxon, 1898) reared in the laboratory, provided support for field-based designations of age-0 lengths, and identified microhabitat factors important to adult and juvenile presence from field collections. Two growth periods of a laboratory crayfish population were described using a broken line model: a rapid, early-growth period (weeks 2-20, slope = 0.81 ± 0.03SE), and a slower, late-growth period (weeks 22-50, slope = 0.13 ± 0.03SE). A smoothed curve was generated to represent the size distribution of juveniles from our laboratory population to determine the probability that an age-0 crayfish from our laboratory population had a carapace length (CL) similar to that found in previous field studies using onset of maturity (22.4 mm CL). We determined that the probability of the age-0 crayfish in our summer laboratory population exceeding 22.4 mm CL was 0.06. The threshold between the lower 0.95 and upper 0.05 probabilities was 22.9 mm CL, confirming previous field observations of onset at maturity. We used this threshold to identify juveniles and adults from our field collections, and found that both life stages were positively associated with coarse substrate and negatively associated with water depth. Adults, however, were negatively related to gravel, whereas juveniles showed a positive relationship. This result is reflective of the relationship between crayfish body size and refuge use within the interstitial spaces of substrates, whereby adult crayfish are unable to seek refuge in the small interstitial spaces of gravel.

Evolutionary History and Conservation Status of Cave Crayfishes Along the Cumberland Plateau

NASA Astrophysics Data System (ADS)

Buhay, J. E.; Crandall, K. A.

2005-05-01

Obligate cave-dwelling crayfish species are found only in southeastern United States, Mexico, and Cuba. Most species are considered to be endangered because of surface pollution threats to groundwater and small geographic distributions. There are currently three subterranean species of the genus Orconectes found along the Cumberland Plateau, a worldwide hotspot of cave biodiversity. The objectives of my dissertation research are to: 1) delineate species' boundaries using molecular genetic data in a phylogenetic framework, 2) examine evolutionary history of each species using Nested Clade Analysis, and 3) assess conservation status of each species using measures of effective population size and genetic diversity. This research project has uncovered a new species of cave crayfish along the border of Tennessee and Kentucky, an area previously thought to have "intergrades" between two subspecies of O. australis. It appears that Cambarus gentryi, a surface-dwelling burrowing species, is the closest living ancestor to the cave Orconectes assemblage on the Plateau. The origin appears to be Eastern Kentucky, with range expansions occuring southward down the Plateau. Although controversial, these cave species exhibit high levels of genetic diversity, especially in comparison to surface-dwellers. Conservation efforts should focus on protecting `high-traffic' areas to maintain gene flow and prevent isolation.

Effect of temperature on heavy metal toxicity to juvenile crayfish, Orconectes immunis (Hagen).

PubMed

Khan, M A Q; Ahmed, S A; Catalin, Bogdon; Khodadoust, A; Ajayi, Oluwaleke; Vaughn, Mark

2006-10-01

The acute toxicity of four selected heavy metals to juvenile crayfish Orconectes immunis (Hagen) (1-2 g wet body wt. each) at room temperature increased in the following order: cadmium (x3) < copper (x10) < zinc (x2) < lead. The toxicity of these metals to crayfish acclimated at 17, 20, 23/24, and 27 degrees C increased with temperature (by 7-20% between 20 and 24 degrees C and 14-26% between 20 and 27 degrees C) as judged by the lowering of LT(50) (time to kill 50% of test animals at a fixed concentration) values. A 4 degrees C rise in temperature (from 20 to 24 degrees C), which increased the toxicity of copper by about 7%, increased the rate of oxygen consumption by about 34%. Heavy metals inhibited the rate of oxygen consumption at all temperatures. In 20 degrees C-acclimated crayfish, copper caused about 17% inhibition of oxygen consumption compared to about 7-12% by other metals including the most toxic cadmium. A 3-4 degrees C rise in temperature tripled the inhibitory effect of copper (20%), cadmium and zinc (26 and 18%, respectively), but not of lead, on oxygen consumption. A 7 degrees C-rise in temperature (from 20 to 27 degrees C) increased the inhibitory effect of heavy metals, including lead, on oxygen consumption by up to 54% in the case of copper. The data indicate that rising global temperatures (currently 0.60 degrees C) associated with climate change can have the potential to increase the sensitivity of aquatic animals to heavy metals in their environment.

Evaluation of chemical control for nonnative crayfish at a warm-water fish production hatchery

USGS Publications Warehouse

Allert, Ann L.; McKee, M.J.; DiStefano, R.J.; Fairchild, J.F.

2016-01-01

Invasive crayfish are known to displace native crayfish species, alter aquatic habitat and community structure and function, and are serious pests for fish hatcheries. White River Crawfish (WRC; Procambarus acutus) were inadvertently introduced to a warm-water fish hatchery in Missouri, USA, possibly in an incoming fish shipment. We evaluated the use of chemical control for crayfish to ensure incoming and outgoing fish shipments from hatcheries do not contain live crayfish. We conducted acute (≤24 hr) static toxicity tests to determine potency, dose-response, and selectivity of pesticides to WRC, Virile Crayfish (VC; Orconectes virilis), and Fathead Minnow (FHM; Pimephales promelas). Testing identified a formulation of cypermethrin (Cynoff®) as the most potent of five pesticides evaluated for toxicity to crayfish. A 4-hr exposure to a cypermethrin concentration of 100 μg · L-1 was found to kill 100% of juvenile and adult WRC; however, adult VC were not consistently killed. Concentrations of cypermethrin ≤100 μg · L-1 did not cause significant (>10%) mortality in juvenile FHM. Additional testing is needed to examine selectivity between crayfish and hatchery fish species. Biosecurity protocols at hatcheries that use chemical control have the potential to reliably prevent inadvertent transfers of live crayfish in fish shipments.

Concentrations of elements in fish fillets, fish muscle plugs, and crayfish from the 2007 Missouri Department of Conservation General Contaminant Monitoring Program

USGS Publications Warehouse

May, Thomas W.; Walther, Michael J.; Brumbaugh, William G.; McKee, Michael J.

2009-01-01

This report presents the results of a contaminant monitoring survey conducted annually by the Missouri Department of Conservation to examine the levels of selected elemental contaminants in fish fillets, fish muscle plugs, and crayfish. Fillets of channel catfish (Ictalurus punctatus), bass (Micropterus salmoides, Micropterus dolomieu, Morone chrysops), walleye (Sander vitreus), common carp (Cyprinus carpio), lake sturgeon (Acipenser fulvescens), northern hog sucker (Hypentelium nigricans), and rainbow trout (Oncorhynchus mykiss) were collected from 21 sites as part of the Department's Fish Contaminant Monitoring Program. Long-pincered crayfish (Orconectes longidigitus) were collected from one site to assess trophic transfer of metals to fish. Fish muscle plugs were collected from smallmouth bass (Micropterus dolomieu) at two different locations from one site.

Conservation and management of crayfishes: Lessons from Pennsylvania

USGS Publications Warehouse

Lieb, D.A.; Bouchard, R.W.; Carline, R.F.; Nuttall, T.R.; Wallace, J.R.; Burkholder, C.L.

2011-01-01

North America's crayfish fauna is diverse, ecologically important, and highly threatened. Unfortunately, up-to-date information is scarce, hindering conservation and management efforts. In Pennsylvania and nearby states, recent efforts allowed us to determine the conservation status of several native crayfishes and develop management strategies for those species. Due to rarity and proximity to urban centers and introduced (exotic) crayfishes, Cambarus (Puncticambarus) sp., an undescribed member of the Cambarus acuminatus complex, is critically imperiled in Pennsylvania and possibly range-wide. Orconectes limosus is more widespread; however, recent population losses have been substantial, especially in Pennsylvania and northern Maryland, where its range has declined (retreated eastward) by greater than 200 km. Introduced congeners likely played a major role in those losses. Although extirpated from some areas, Cambarus bartonii bartonii remains widespread and is not an immediate conservation concern. In light of these findings, the role of barriers (e.g., dams), environmental protection, educational programs, and regulations in preventing crayfish invasions and conserving native crayfishes is discussed, and management initiatives centered on those factors are presented. The need for methods to eliminate exotics and monitor natives is highlighted. Although tailored to a specific regional fauna, these ideas have broad applicability and would benefit many North American crayfishes. ?? copyright 2011. Periodicals postage paid at Bethesda.

Characterization of a molt-inhibiting hormone (MIH) of the crayfish, Orconectes limosus, by cDNA cloning and mass spectrometric analysis.

PubMed

Bulau, Patrick; Okuno, Atsuro; Thome, Elke; Schmitz, Tina; Peter-Katalinic, Jasna; Keller, Rainer

2005-11-01

The structure of the precursor of a molt-inhibiting hormone (MIH) of the American crayfish, Orconectes limosus was determined by cloning of a cDNA based on RNA from the neurosecretory perikarya of the X-organ in the eyestalk ganglia. The open reading frame includes the complete precursor sequence, consisting of a signal peptide of 29, and the MIH sequence of 77 amino acids. In addition, the mature peptide was isolated by HPLC from the neurohemal sinus gland and analyzed by ESI-MS and MALDI-TOF-MS peptide mapping. This showed that the mature peptide (Mass 8664.29 Da) consists of only 75 amino acids, having Ala75-NH2 as C-terminus. Thus, C-terminal Arg77 of the precursor is removed during processing, and Gly76 serves as an amide donor. Sequence comparison confirms this peptide as a novel member of the large family, which includes crustacean hyperglycaemic hormone (CHH), MIH and gonad (vitellogenesis)-inhibiting hormone (GIH/VIH). The lack of a CPRP (CHH-precursor related peptide) in the hormone precursor, the size and specific sequence characteristics show that Orl MIH belongs to the MIH/GIH(VIH) subgroup of this larger family. Comparison with the MIH of Procambarus clarkii, the only other MIH that has thus far been identified in freshwater crayfish, shows extremely high sequence conservation. Both MIHs differ in only one amino acid residue ( approximately 99% identity), whereas the sequence identity to several other known MIHs is between 40 and 46%.

A successful crayfish invader is capable of facultative parthenogenesis: a novel reproductive mode in decapod crustaceans.

PubMed

Buřič, Miloš; Hulák, Martin; Kouba, Antonín; Petrusek, Adam; Kozák, Pavel

2011-01-01

Biological invasions are impacting biota worldwide, and explaining why some taxa tend to become invasive is of major scientific interest. North American crayfish species, particularly of the family Cambaridae, are prominent invaders in freshwaters, defying the "tens rule" which states that only a minority of species introduced to new regions become established, and only a minority of those become invasive and pests. So far, success of cambarid invaders has largely been attributed to rapid maturation, high reproductive output, aggressiveness, and tolerance to pollution. We provide experimental evidence that females of one cambarid species particularly widespread in Europe, the spiny-cheek crayfish Orconectes limosus, are capable of facultative parthenogenesis. Such reproductive mode has never before been recognized in decapods, the most diverse crustacean order. As shown by analysis of seven microsatellite loci, crayfish females kept physically separated from males produced genetically homogeneous offspring identical with maternal individuals; this suggests they reproduced by apomixis, unlike those females which mated with males and had a diverse offspring. Further research is needed to clarify what environmental conditions are necessary for a switch to parthenogenesis in O. limosus, and what role it plays in natural crayfish populations. However, if such reproductive plasticity is present in other cambarid crayfish species, it may contribute to the overwhelming invasive success of this group.

Chytrid fungus Batrachochytrium dendrobatidis has nonamphibian hosts and releases chemicals that cause pathology in the absence of infection

PubMed Central

McMahon, Taegan A.; Brannelly, Laura A.; Chatfield, Matthew W. H.; Johnson, Pieter T. J.; Joseph, Maxwell B.; McKenzie, Valerie J.; Richards-Zawacki, Corinne L.; Venesky, Matthew D.; Rohr, Jason R.

2013-01-01

Batrachochytrium dendrobatidis, a pathogenic chytrid fungus implicated in worldwide amphibian declines, is considered an amphibian specialist. Identification of nonamphibian hosts could help explain the virulence, heterogeneous distribution, variable rates of spread, and persistence of B. dendrobatidis in freshwater ecosystems even after amphibian extirpations. Here, we test whether mosquitofish (Gambusia holbrooki) and crayfish (Procambarus spp. and Orconectes virilis), which are syntopic with many amphibian species, are possible hosts for B. dendrobatidis. Field surveys in Louisiana and Colorado revealed that zoosporangia occur within crayfish gastrointestinal tracts, that B. dendrobatidis prevalence in crayfish was up to 29%, and that crayfish presence in Colorado wetlands was a positive predictor of B. dendrobatidis infections in cooccurring amphibians. In experiments, crayfish, but not mosquitofish, became infected with B. dendrobatidis, maintained the infection for at least 12 wk, and transmitted B. dendrobatidis to amphibians. Exposure to water that previously held B. dendrobatidis also caused significant crayfish mortality and gill recession. These results indicate that there are nonamphibian hosts for B. dendrobatidis and suggest that B. dendrobatidis releases a chemical that can cause host pathology, even in the absence of infection. Managing these biological reservoirs for B. dendrobatidis and identifying this chemical might provide new hope for imperiled amphibians. PMID:23248288

Bioenergetics assessment of fish and crayfish consumption by river otter (Lontra canadensis): integrating prey availability, diet, and field metabolic rate

USGS Publications Warehouse

Dekar, Matthew P.; Magoulick, Daniel D.; Beringer, J.

2010-01-01

River otters (Lontra canadensis) are important predators in aquatic ecosystems, but few studies quantify their prey consumption. We trapped crayfish monthly as an index of availability and collected otter scat for diet analysis in the Ozark Mountains of northwestern Arkansas, USA. We measured otter daily energy expenditure (DEE) with the doubly labeled water method to develop a bioenergetics model for estimating monthly prey consumption. Meek's crayfish (Orconectes meeki) catch-per-unit-effort was positively related to stream temperature, indicating that crayfish were more available during warmer months. The percentage frequency of occurrence for crayfish in scat samples peaked at 85.0% in summer and was lowest (42.3%) in winter. In contrast, the percentage occurrence of fish was 13.3% in summer and 57.7% in winter. Estimates of DEE averaged 4738 kJ·day-1 for an otter with a body mass of 7842 g. Total biomass consumption ranged from 35 079 to 52 653 g·month-1 (wet mass), corresponding to a high proportion of fish and crayfish in the diet, respectively. Otter consumption represents a large fraction of prey production, indicating potentially strong effects of otters on trophic dynamics in stream ecosystems.

A comparison of two gears for quantifying abundance of lotic-dwelling crayfish

USGS Publications Warehouse

Williams, Kristi; Brewer, Shannon K.; Ellersieck, Mark R.

2014-01-01

Crayfish (saddlebacked crayfish, Orconectes medius) catch was compared using a kick seine applied two different ways with a 1-m2 quadrat sampler (with known efficiency and bias in riffles) from three small streams in the Missouri Ozarks. Triplicate samples (one of each technique) were taken from two creeks and one headwater stream (n=69 sites) over a two-year period. General linear mixed models showed the number of crayfish collected using the quadrat sampler was greater than the number collected using either of the two seine techniques. However, there was no significant interaction with gear suggesting year, stream size, and channel unit type did not relate to different catches of crayfish by gear type. Variation in catch among gears was similar, as was the proportion of young-of-year individuals across samples taken with different gears or techniques. Negative binomial linear regression provided the appropriate relation between the gears which allows correction factors to be applied, if necessary, to relate catches by the kick seine to those of the quadrat sampler. The kick seine appears to be a reasonable substitute to the quadrat sampler in these shallow streams, with the advantage of ease of use and shorter time required per sample.

Landscape- and local-scale habitat influences on occupancy and detection probability of stream-dwelling crayfish: Implications for conservation

USGS Publications Warehouse

Magoulick, Daniel D.; DiStefano, Robert J.; Imhoff, Emily M.; Nolen, Matthew S.; Wagner, Brian K.

2017-01-01

Crayfish are ecologically important in freshwater systems worldwide and are imperiled in North America and globally. We sought to examine landscape- to local-scale environmental variables related to occupancy and detection probability of a suite of stream-dwelling crayfish species. We used a quantitative kickseine method to sample crayfish presence at 102 perennial stream sites with eight surveys per site. We modeled occupancy (psi) and detection probability (P) and local- and landscape-scale environmental covariates. We developed a set of a priori candidate models for each species and ranked models using (Q)AICc. Detection probabilities and occupancy estimates differed among crayfish species with Orconectes eupunctus, O. marchandi, and Cambarus hubbsi being relatively rare (psi < 0.20) with moderate (0.46–0.60) to high (0.81) detection probability and O. punctimanus and O. ozarkae being relatively common (psi > 0.60) with high detection probability (0.81). Detection probability was often related to local habitat variables current velocity, depth, or substrate size. Important environmental variables for crayfish occupancy were species dependent but were mainly landscape variables such as stream order, geology, slope, topography, and land use. Landscape variables strongly influenced crayfish occupancy and should be considered in future studies and conservation plans.

Effects of introduced crayfish on selected native fishes of Arizona

USGS Publications Warehouse

Carpenter, J.

2000-01-01

The virile crayfish (Orconectes virilis), an aggressive polytrophic species, has been introduced into many Arizona streams. I investigated competition and predation between this crayfish and several native Arizona fishes. I conducted field experiments to assess competition for food between crayfish and fish, and laboratory experiments to examine competition for shelter and food, and predation. In Sabino Creek, I manipulated crayfish densities in isolated pools to examine effects of crayfish on growth, mortality, and recruitment of Gila chub (Gila intermedia). Regardless of crayfish density, Gila chub declined slightly in weight and condition. Mortality and recruitment did not differ between densities of crayfish. I examined crayfish effects on benthic macroinvertebrates, a submerged aquatic macrophyte and associated invertebrates, and three fish species in a small stream in the White Mountains by fencing eight stream sections to prevent movement. The three fishes were speckled dace (Rhinichthys osculus), Sonora sucker (Catostomus insignis), and desert sucker (C. clarki). Molluscs > 10 mm and macrophytes were less abundant at sites with a high density of crayfish than at sites with low crayfish densities. Insect diversity was lower in high- vs. low-density sites. No treatment effect was observed on growth or condition of individually marked fish. Short-term laboratory experiments demonstrated predatory interactions and competition for shelter between crayfish and Gila chub, desert sucker, and speckled dace. Crayfish used shelter more than fish, displaced fish from shelter, and frequently attacked fish. Fish never attacked crayfish, and only once displaced crayfish from shelter. In predation experiments, crayfish preyed upon all species, but preyed most heavily upon desert suckers. Fish never altered use of the water column in the presence of crayfish. Density manipulation experiments in a laboratory measured food competition between crayfish and two native fishes. Growth of Gila chub was less affected by crayfish than by increased density of Gila chub. Thus crayfish are not strong competitors with Gila chub for food. However, growth of flannelmouth sucker (Catostomus latipinnis) was negatively impacted by presence of crayfish. These laboratory experiments provide evidence that introduced crayfish can reduce fish growth by competition for food, and that native fishes are vulnerable to crayfish predation.

Heavy Metals Bioaccumulation in Tissues of Spiny-Cheek Crayfish (Orconectes limosus) from Lake Gopło: Effect of Age and Sex.

PubMed

Stanek, Magdalena; Dąbrowski, Janusz; Różański, Szymon; Janicki, Bogdan; Długosz, Jacek

2017-06-01

The aim of the present work was to assess the concentrations of metals in the abdominal muscle and exoskeleton of 3-year-old males and 4-year-old females and males of spiny-cheek crayfish (Orconectes limosus) collected from Lake Gopło. A total of 93 males and 35 females were collected in autumn (October 2014). The analyzes of heavy metals were conducted by means of atomic absorption spectroscopy with a PU9100X spectrometer. The content of mercury was determined using AMA 254 mercury analyser. As analyses indicated heavy metals accumulated in the muscle and exoskeleton in the following sequence: Zn > Cu > Pb > Mn > Ni > Hg and Mn > Pb > Zn > Ni > Cu > Hg, respectively. Statistically significant differences between 3- and 4-year-old males were found for all analyzed metals. Gender dependent differences were calculated only for Ni in the muscle tissue and for Mn and Hg in the exoskeleton. In comparison with the study carried out 2 years ago notably higher concentrations of Pb were found in the muscle and a higher content of Zn, Pb, Mn and Ni was determined in the exoskeleton.

Invasive crayfish in the Pacific Northwest

USGS Publications Warehouse

Pearl, Christopher A.; McCreary, Brome; Adams, Michael

2011-01-01

Invasive species directly threaten freshwater biodiversity, particularly in regions of high aquatic richness like the Pacific Northwest (PNW). Crayfish are among the most impactful of aquatic invasive species. Invasive crayfish are considered ecosystem engineers due to their ability to alter basic wetland properties, such as reducing vegetation and bank integrity and increasing turbidity. In areas where invasion is advanced, crayfish pose major economic and ecological problems. Crayfish have been widely introduced for aquaculture and can become established in a wide range of habitat conditions. They also may be spread by anglers who use them as bait. Several non-native crayfish are established in the PNW, but the extent of their invasion is not well known. At least two groups are known from scattered sites in the PNW, and both have proven problematic for native species in other parts of the world: Red swamp crayfish (Procambarus clarkii) and several members of the genus Orconectes. Both groups are native to areas of the eastern United States. Both are identified globally as invasives of high concern and appear on the Oregon Department of Fish and Wildlife's "10 Most Unwanted" and the U.S. Forest Service's "Primary Species of Concern" lists for stream systems in the PNW. Despite the presence of introduced crayfish in the PNW and their high potential for negative effects, the scope of their invasion and effects on aquatic systems are not well known. The U.S. Geological Survey (USGS), along with local groups and state agencies, is working to clarify crayfish distribution and to outline which basins may not yet be invaded. Other goals are to improve understanding of habitat associations of invasive crayfish and their potential effects on native crayfish.

Assessing potential abiotic and biotic complications of crayfish-induced gravel transport in experimental streams

NASA Astrophysics Data System (ADS)

Statzner, Bernhard; Peltret, Odile

2006-03-01

Biogeomorphology adds the element "biological dynamics" (of populations or communities) to chemical and physical geomorphic factors and thus complicates the framework of geomorphic processes. Such biological complications of the animal-induced transport of solids in streams should be particularly important in crayfish, as crayfish affect this transport through their overall activity and intraspecific aggression levels, which could be modified by shelter availability or the establishment of dominance hierarchies among individuals not knowing each other. Using experimental streams, we tested these hypotheses by measuring how shelter availability or residential crayfish group invasion by unknown individuals affected the impact of the crayfish Orconectes limosus on the (i) transport of gravel at baseflow (during 12 experimental days); (ii) sediment surface characteristics (after 12 days); and (iii) critical shear stress causing incipient gravel motion during simulated floods (after 12 days). The two potentially important factors shelter availability or residential group invasion negligibly affected the crayfish impact on gravel sediments, suggesting that habitat unfamiliarity (a third potentially important factor affecting crayfish activity) should increase the crayfish-induced sediment transport. Because habitat unfamiliarity is associated with sporadic long-distance migrations of a few crayfish individuals, this third factor should play a minor role in real streams, where crayfish biomass should be a key factor in relations with crayfish effects on sediments. Therefore, we combined the results of this study with those of previous crayfish experiments to assess how crayfish biomass could serve in modelling the gravel transport. Crayfish biomass explained 47% of the variability in the baseflow gravel transport and, in combination with the coefficient of variation of the bed elevation and algal cover, 72% of the variability in the critical gravel shear stress. These results encourage more research on the topic, as an increasing number of eliminations of abiotic and biotic factors that could complicate the animal-induced sediment transport in streams would facilitate the use of biological variables (e.g., bioturbator biomass) in future modelling of the transport of solids.

Effects of depth and crayfish size on predation risk and foraging profitability of a lotic crayfish

USGS Publications Warehouse

Flinders, C.A.; Magoulick, D.D.

2007-01-01

We conducted field surveys and experiments to determine whether observed distributions of crayfish among habitats were influenced by differential resource availability, foraging profitability, and predation rates and whether these factors differed with crayfish size and habitat depth. We sampled available food resources (detritus and invertebrates) and shelter as rock substrate in deep (>50 cm) and shallow (<30 cm) habitats. We used an enclosure-exclosure experiment to examine the effects of water depth and crayfish size on crayfish biomass and survival, and to determine whether these factors affected silt accrual, algal abundance (chlorophyll a [chl a]), and detritus and invertebrate biomass (g ash-free dry mass) differently from enclosures without crayfish. We conducted tethering experiments to assess predation on small (13-17 mm carapace length [CL]) and large (23-30 mm CL) Orconectes marchandi and to determine whether predation rates differed with water depth. Invertebrate biomass was significantly greater in shallow water than in deep water, whereas detritus biomass did not differ significantly between depths. Cobble was significantly more abundant in shallow than in deep water. Depth and crayfish size had a significant interactive effect on change in size of enclosed crayfish when CL was used as a measure of size but not when biomass was used as a measure of size. CL of small crayfish increased significantly more in enclosures in shallow than in deep water, but CL of large crayfish changed very little at either depth. Silt, chl a, and detritus biomass were significantly lower on tiles in large- than in small- and no-crayfish enclosures, and invertebrate biomass was significantly lower in large- than in no-crayfish enclosures. Significantly more crayfish were consumed in deep than in shallow water regardless of crayfish size. Our results suggest that predation and resource availability might influence the depth distribution of small and large crayfish. Small crayfish grew faster in shallow habitats where they might have had a fitness advantage caused by high prey availability and reduced predation risk. Size-dependent reduction of silt by crayfish might influence benthic habitats where large crayfish are abundant. ?? 2007 by The North American Benthological Society.

A Successful Crayfish Invader Is Capable of Facultative Parthenogenesis: A Novel Reproductive Mode in Decapod Crustaceans

PubMed Central

Buřič, Miloš; Hulák, Martin; Kouba, Antonín

2011-01-01

Biological invasions are impacting biota worldwide, and explaining why some taxa tend to become invasive is of major scientific interest. North American crayfish species, particularly of the family Cambaridae, are prominent invaders in freshwaters, defying the “tens rule” which states that only a minority of species introduced to new regions become established, and only a minority of those become invasive and pests. So far, success of cambarid invaders has largely been attributed to rapid maturation, high reproductive output, aggressiveness, and tolerance to pollution. We provide experimental evidence that females of one cambarid species particularly widespread in Europe, the spiny-cheek crayfish Orconectes limosus, are capable of facultative parthenogenesis. Such reproductive mode has never before been recognized in decapods, the most diverse crustacean order. As shown by analysis of seven microsatellite loci, crayfish females kept physically separated from males produced genetically homogeneous offspring identical with maternal individuals; this suggests they reproduced by apomixis, unlike those females which mated with males and had a diverse offspring. Further research is needed to clarify what environmental conditions are necessary for a switch to parthenogenesis in O. limosus, and what role it plays in natural crayfish populations. However, if such reproductive plasticity is present in other cambarid crayfish species, it may contribute to the overwhelming invasive success of this group. PMID:21655282

Crayfish Impact Desert River Ecosystem Function and Litter-Dwelling Invertebrate Communities through Association with Novel Detrital Resources

PubMed Central

Moody, Eric K.; Sabo, John L.

2013-01-01

Shifts in plant species distributions due to global change are increasing the availability of novel resources in a variety of ecosystems worldwide. In semiarid riparian areas, hydric pioneer tree species are being replaced by drought-tolerant plant species as water availability decreases. Additionally, introduced omnivorous crayfish, which feed upon primary producers, allochthonous detritus, and benthic invertebrates, can impact communities at multiple levels through both direct and indirect effects mediated by drought-tolerant plants. We tested the impact of both virile crayfish (Orconectes virilis) and litter type on benthic invertebrates and the effect of crayfish on detrital resources across a gradient of riparian vegetation drought-tolerance using field cages with leaf litter bags in the San Pedro River in Southeastern Arizona. Virile crayfish increased breakdown rate of novel drought-tolerant saltcedar (Tamarix ramosissima), but did not impact breakdown of drought-tolerant seepwillow (Baccharis salicifolia) or hydric Fremont cottonwood (Populus fremontii) and Gooding's willow (Salix goodingii). Effects on invertebrate diversity were observed at the litter bag scale, but no effects were found at the cage scale. Crayfish decreased alpha diversity of colonizing macroinvertebrates, but did not affect beta diversity. In contrast, the drought-tolerant litter treatment decreased beta diversity relative to hydric litter. As drought-tolerant species become more abundant in riparian zones, their litter will become a larger component of the organic matter budget of desert streams which may serve to homogenize the litter-dwelling community and support elevated populations of virile crayfish. Through impacts at multiple trophic levels, crayfish have a significant effect on desert stream ecosystems. PMID:23667600

The Impacts of flow alterations to crayfishes in Southeastern Oklahoma, with an emphasis on the mena crayfish (orconectes menae)

USGS Publications Warehouse

Brewer, Shannon K.; Dyer, Joseph J.

2016-01-01

Human activities can alter the environment to the point that it is unsuitable to the native species resulting in a loss of biodiversity. Ecologists understand the importance of biodiversity and the conservation of vulnerable species. Species that are narrowly endemic are considered to be particularly vulnerable because they often use specific habitats that are highly susceptible to human disturbance. The basic components of species conservation are 1) delineation of the spatial distribution of the species, 2) understanding how the species interacts with its environment, and 3) employing management strategies based on the ecology of the species. In this study, we investigated several crayfish species endemic to the Ouachita Mountains in Oklahoma and Arkansas. We established the spatial distributions (i.e., range) of the crayfish using Maximum Entropy species distribution modeling. We then investigated crayfish habitat use with quantitative sampling and a paired movement study. Finally, we evaluated the ability of crayfish to burrow under different environmental conditions in a controlled laboratory setting. Crayfish distribution at the landscape scale was largely driven by climate, geology and elevation. In general, the endemic crayfish in this study occurred above 300-m elevation where the geology was dominated by sandstone and shale, and rainfall totals were the highest compared to the rest of the study region. Our quantitative data indicated crayfish did not select for specific habitat types at the reach scale; however, crayfish appeared to continue to use shallow and dry habitat even as the streams dried. Movement by passive integrated transponder (PIT) tagged crayfish was highly variable but crayfish tended to burrow in response to drought rather than migrate to wet habitat. Controlled laboratory experiments revealed smaller substrate size (pebble) restricted crayfish burrowing more than larger substrates (cobble). We also found excess fine sediment restricted crayfish burrowing regardless of dominant substrate size. Our results suggest climate change and sedimentation resulting from land-use practices, combined with increased water withdrawals have the potential to alter crayfish distributions and affect persistence of some crayfish populations.

Habitat and co-occurrence of native and invasive crayfish in the Pacific Northwest, USA

USGS Publications Warehouse

Pearl, Christopher A.; Adams, Michael J.; McCreary, Brome

2013-01-01

Biological invasions can have dramatic effects on freshwater ecosystems and introduced crayfish can be particularly impacting. We document crayfish distribution in three large hydrographic basins (Rogue, Umpqua, Willamette/Columbia) in the Pacific Northwest USA. We used occupancy analyses to investigate habitat relationships and evidence for displacement of native Pacifastacus leniusculus (Dana, 1852) by two invaders. We found invasive Procambarus clarkii (Girard, 1852), in 51 of 283 sites and in all three hydrographic basins. We found invasive Orconectes n. neglectus (Faxon, 1885) at 68% of sites in the Rogue basin and provide first documentation of their broad distribution in the Umpqua basin. We found P. clarkii in both lentic and lotic habitats, and it was positively associated with manmade sites. P. leniusculus was positively associated with lotic habitats and negatively related to manmade sites. In the Rogue and Umpqua basins, O. n. neglectus and P. leniusculus were similar in their habitat associations. We did not find a negative relationship in site occupancy between O. n. neglectus and P. leniusculus. Our data suggest that P. clarkii has potential to locally displace P. leniusculus. There is still time for preventive measures to limit the spread of the invasive crayfish in this region.

Cadmium and lead uptake by Red Swamp crayfish (Procambarus clarkii) of Louisiana

DOE Office of Scientific and Technical Information (OSTI.GOV)

Naqvi, S.M.; Howell, R.D.

1993-08-01

Environmental contamination by heavy metals such as cadmium and lead is generally reflected by an increase in the tissue residues of aquatic animals. This is also true for fresh-water crayfish as reported by Bagatto and Khan (1987) for Orconectes virilis collected in the vicinity of Canadian smelters. They found a positive correlation between the residues of Cd and Pb in crayfish tissues and the distance from smelters. Stinson and Eaton reported similar findings for another crayfish, Pacifasticus leniusculus, collected from a lake on the West Coast of the US which was receiving urban runoff. Cadmium and lead were more concentratedmore » in the viscera and exoskeleton, respectively. Madigosky et al. (1991) found that Procambarus clarkii collected from roadside drainage ditches of Louisiana contained greater amounts of Cd and Pb than commercially harvested control groups. Lead accumulation has been attributed to the use of farm machinery runoff in agricultural areas and Cd to rubber tires. Cadmium and lead are known to accumulate even in those crayfish where no known contamination can be established, e.g., Dickson et al. (1980) found metal residues in troglobitic crayfish. Accumulation of Pb and Cd in the tissues in laboratory-exposed crayfish of different species has been documented by several investigators. These metals accumulate in exoskeleton, hepatopancreas, gills, antennal glands, mid-gut glands and abdominal muscles of crayfish. Generally, all studies mentioned above report metal uptake by crayfish but have not quantified the amount of metal remaining after the crayfish are transferred to uncontaminated water (depuration). The purpose of this study was to: (1) assess Cd and Pb accumulation in laboratory-exposed male and female P. clarkii (total body wet weight basis), and (2) to determine how much metal is lost when crayfish are transferred to uncontaminated aged tap water. 17 refs., 3 tabs.« less

Effects of predators on fish and crayfish survival in intermittent streams

USGS Publications Warehouse

Dekar, Matthew P.; Magoulick, Daniel D.

2013-01-01

Predation from aquatic and terrestrial predators arc important factors structuring the size and depth distribution of aquatic prey. We conducted mesocosm and tethering experiments on Little Mulberry Creek in northwest Arkansas during low flows to examine the effects of predators on fish and crayfish survival in intermittent streams Using shallow artificial pools (10 cm deep) and predator exclusions, we tested the hypothesis that large-bodied fish are at greater risk from terrestrial predators in shallow habitats compared to small-bodied individuals. Twenty-four circular pools (12 open top. 12 closed top) were stocked with two size classes of Campostoma anomalum (Central Stonerller) and deployed systematically in a single stream pool. In addition, we used a crayfish tethering experiment to test the hypothesis that the survival of small and large crayfish is greater in shallow and deep habitats, respectively. We tethered two size classes of Orconectes meeki meeki (Meek's Crayfish) along shallow and deep transects in two adjacent stream pools and measured survival for 15 days. During both experiments, we monitored the presence or absence of predators by visual observation and from scat surveys. We demonstrated a negative effect of terrestrial predators on Central Stonerller survival in the artificial pools, and larger individuals were more susceptible to predation. In contrast, small crayfish experienced low survival at all depths and large crayfish were preyed upon much less intensively during the tethering study, particularly in the pool with larger substrate. More studies are needed to understand how stream drying and environmental heterogeneity influence the complex interactions between predator and prey populations in intermittent streams.

Upstream dispersal of an invasive crayfish aided by a fish passage facility

USGS Publications Warehouse

Welsh, Stuart A.; Loughman, Zachary J.

2015-01-01

Fish passage facilities for reservoir dams have been used to restore habitat connectivity within riverine networks by allowing upstream passage for native species. These facilities may also support the spread of invasive species, an unintended consequence and potential downside of upstream passage structures. We documented dam passage of the invasive virile crayfish, Orconectes virilis (Hagen, 1870), at fish ladders designed for upstream passage of American eels, Anguilla rostrata (Lesueur, 1817), in the Shenandoah River drainage, USA. Ladder use and upstream passage of 11 virile crayfish occurred from 2007–2014 during periods of low river discharge (<30 m3s–1) and within a wide range of water temperatures from 9.0–28.6 °C. Virile crayfish that used the eel ladders were large adults with a mean carapace length and width of 48.0 mm and 24.1 mm, respectively. Our data demonstrated the use of species-specific fish ladders by a non-target non-native species, which has conservation and management implications for the spread of aquatic invasive species and upstream passage facilities. Specifically, managers should consider implementing long-term monitoring of fish passage facilities with emphasis on detection of invasive species, as well as methods to reduce or eliminate passage of invasive species. 

Environmental fate of mercury discharged into the upper Wisconsin River

USGS Publications Warehouse

Rada, R.G.; Findley, J.E.; Wiener, J.G.

1986-01-01

The authors studied the distribution of Hg in sediments, fish, and crayfish in a 60 km reach of the Upper Wisconsin River that formerly received Hg in discharges from pulp and paper mills. The most heavily contaminated strata of sediments were deposited during the 1950s and early 1960s and buried under subsequent deposits; however, surficial sediments remained substantially enriched at certain sites in 1981. Median concentrations of Hg in surficial sediments, adjusted for grain size, were at least 10-fold greater at the main study area than at an upstream reference site. Total concentrations exceeded 1.0 mu g g super(-1) wet weight in axial muscle tissue in only 2 of 173 fish analyzed from the study area; however, historical comparisons revealed that Hg contamination of fish (common carp Cyprinus carpio and walleye Stizostedion vitreum vitreum ) and crayfish (Orconectes ) in the river had not decreased since the early 1970s.

Interactions of bullfrog tadpole predators and an insecticide: Predation release and facilitation

USGS Publications Warehouse

Boone, M.D.; Semlitsch, R.D.

2003-01-01

The effect of a contaminant on a community may not be easily predicted, given that complex changes in food resources and predator-prey dynamics may result. The objectives of our study were to determine the interactive effects of the insecticide carbaryl and predators on body size, development, survival, and activity of tadpoles of the bullfrog (Rana catesbeiana). We conducted the study in cattle tank mesocosm ponds exposed to 0, 3.5, or 7.0 mg/l carbaryl, and no predators or two red-spotted newts (Notophthalmus viridescens), bluegill sunfish (Lepomis macrochirus), or crayfish (Orconectes sp.). Carbaryl negatively affected predator survival by eliminating crayfish from all ponds, and by eliminating bluegill sunfish from ponds exposed to the highest concentration of carbaryl; carbaryl exposure did not effect survival of red-spotted newts. Because crayfish were eliminated by carbaryl, bullfrogs were released from predation and survival was near that of predator controls at low concentrations of carbaryl exposure. High concentrations of carbaryl reduced tadpole survival regardless of whether predators survived carbaryl exposure or not. Presence of crayfish and newts reduced tadpole survival, while bluegill sunfish appeared to facilitate bullfrog tadpole survival. Presence of carbaryl stimulated bullfrog tadpole mass and development. Our study demonstrates that the presence of a contaminant stress can alter community regulation by releasing prey from predators that are vulnerable to contaminants in some exposure scenarios.

Trophic overlap between native and invasive stream crayfish

USGS Publications Warehouse

Magoulick, Daniel D.; Piercey, Glenn L.

2016-01-01

We examined trophic dynamics of a stream food web where invasive Orconectes neglectus appear to be displacing native O. eupunctus in the Spring River drainage of the Ozark Highlands, Missouri and Arkansas, USA. We collected crayfish species and possible food sources seasonally from a site of sympatry on the South Fork Spring River. We determined diet overlap and potential for competition between O. eupunctus and O. neglectus, and investigated seasonal variation using carbon and nitrogen stable isotope analyses and gut content analyses. Gut content analysis showed both species of crayfish consumed mainly detritus during summer and spring, with other prey categories varying by species and season. Stable isotope analysis showed that O. eupunctus and O. neglectus relied on invertebrates as a major energy and nutrient source throughout summer, autumn, and spring, and the two species showed differences in their stable isotope signatures during spring and summer, but not autumn. Given the trophic overlap between O. eupunctus and O. neglectus, there is a potential for the two species to compete for food and to be ecologically redundant. Ecological redundancy can lead to reduced effects on ecosystem function post-invasion, and therefore examining ecological redundancy of potential invaders should be a conservation priority.

Life history of the vulnerable endemic crayfish Cambarus (Erebicambarus) maculatus Hobbs and Pflieger, 1988 (Decapoda: Astacoidea: Cambaridae) in Missouri, USA

USGS Publications Warehouse

DiStefano, Robert J.; Westhoff, Jacob T.; Ames, Catlin W.; Rosenberger, Amanda E.

2016-01-01

The vulnerable freckled crayfish, Cambarus maculatus Hobbs and Pflieger, 1988, is endemic to only one drainage in eastern Missouri, USA, which is impacted by heavy metals mining and adjacent to a rapidly-expanding urban area. We studied populations of C. maculatus in two small streams for 25 months to describe annual reproductive cycles, and gather information about fecundity, sex ratio, size at maturity, size-class structure, and growth, capturing a monthly average of more than 50 individuals from each of the two study populations. Information about the density of the species at supplemental sampling streams was also obtained. The species exhibited traits consistent with a K-strategist life history; long-lived, slow-growing, with fewer but larger eggs than sympatric crayfish species. Breeding season occurred in mid- to late autumn, potentially extending into early winter. Egg brooding occurred primarily in May. Young of year were first observed in June. We estimated that these populations contained four to six size-classes, observed smaller individuals grew faster than larger individuals, and most became sexually mature in their second year of life. Densities of C. maculatus were low relative to several sympatric species of Orconectes Cope, 1872. Life history information presented herein will be important for anticipated future conservation efforts.

Trophic overlap between native and invasive stream crayfish

USGS Publications Warehouse

Magoulick, Daniel D.; Piercey, Glenn L.

2016-01-01

We examined trophic dynamics of a stream food web where invasive Orconectes neglectusappear to be displacing native O. eupunctus in the Spring River drainage of the Ozark Highlands, Missouri and Arkansas, USA. We collected crayfish species and possible food sources seasonally from a site of sympatry on the South Fork Spring River. We determined diet overlap and potential for competition between O. eupunctus and O. neglectus, and investigated seasonal variation using carbon and nitrogen stable isotope analyses and gut content analyses. Gut content analysis showed both species of crayfish consumed mainly detritus during summer and spring, with other prey categories varying by species and season. Stable isotope analysis showed that O. eupunctus and O. neglectus relied on invertebrates as a major energy and nutrient source throughout summer, autumn, and spring, and the two species showed differences in their stable isotope signatures during spring and summer, but not autumn. Given the trophic overlap between O. eupunctus and O. neglectus, there is a potential for the two species to compete for food and to be ecologically redundant. Ecological redundancy can lead to reduced effects on ecosystem function post-invasion, and therefore examining ecological redundancy of potential invaders should be a conservation priority.

Concentrations of metals in aquatic invertebrates from the Ozark National Scenic Riverways, Missouri

USGS Publications Warehouse

Schmitt, Christopher J.; Brumbaugh, William G.; Besser, John M.; May, Thomas W.

2007-01-01

This report summarizes the findings of a study conducted as a pilot for part of a park-wide monitoring program being developed for the Ozark National Scenic Riverways (ONSR) of southeastern Missouri. The objective was to evaluate using crayfish (Orconectes spp.) and Asian clam (Corbicula fluminea) for monitoring concentrations of metals associated with lead-zinc mining. Lead-zinc mining presently (2007) occurs near the ONSR and additional mining has been proposed. Three composite samples of each type (crayfish and Asian clam), each comprising ten animals of approximately the same size, were collected during late summer and early fall of 2005 from five sites on the Current River and Jacks Fork within the ONSR and from one site on the Eleven Point River and the Big River, which are outside the ONSR. The Big River has been contaminated by mine tailings from historical leadzinc mining. Samples were analyzed by inductively coupled plasma mass spectrometry for lead, zinc, cadmium, cobalt, and nickel concentrations. All five metals were detected in all samples; concentrations were greatest in samples of both types from the Big River, and lowest in samples from sites within the ONSR. Concentrations of zinc and cadmium typically were greater in Asian clams than in crayfish, but differences were less evident for the other metals. In addition, differences among sites were small for cobalt in Asian clams and for zinc in crayfish, indicating that these metals are internally regulated to some extent. Consequently, both sample types are recommended for monitoring. Concentrations of metals in crayfish and Asian clams were consistent with those reported by other studies and programs that sampled streams in southeast Missouri.

Testing Phylogenetic Hypotheses of the Subgenera of the Freshwater Crayfish Genus Cambarus (Decapoda: Cambaridae)

PubMed Central

Breinholt, Jesse W.; Porter, Megan L.; Crandall, Keith A.

2012-01-01

Background The genus Cambarus is one of three most species rich crayfish genera in the Northern Hemisphere. The genus has its center of diversity in the Southern Appalachians of the United States and has been divided into 12 subgenera. Using Cambarus we test the correspondence of subgeneric designations based on morphology used in traditional crayfish taxonomy to the underlying evolutionary history for these crayfish. We further test for significant correlation and explanatory power of geographic distance, taxonomic model, and a habitat model to estimated phylogenetic distance with multiple variable regression. Methodology/Principal Findings We use three mitochondrial and one nuclear gene regions to estimate the phylogenetic relationships for species within the genus Cambarus and test evolutionary hypotheses of relationships and associated morphological and biogeographical hypotheses. Our resulting phylogeny indicates that the genus Cambarus is polyphyletic, however we fail to reject the monophyly of Cambarus with a topology test. The majority of the Cambarus subgenera are rejected as monophyletic, suggesting the morphological characters used to define those taxa are subject to convergent evolution. While we found incongruence between taxonomy and estimated phylogenetic relationships, a multiple model regression analysis indicates that taxonomy had more explanatory power of genetic relationships than either habitat or geographic distance. Conclusions We find convergent evolution has impacted the morphological features used to delimit Cambarus subgenera. Studies of the crayfish genus Orconectes have shown gonopod morphology used to delimit subgenera is also affected by convergent evolution. This suggests that morphological diagnoses based on traditional crayfish taxonomy might be confounded by convergent evolution across the cambarids and has little utility in diagnosing relationships or defining natural groups. We further suggest that convergent morphological evolution appears to be a common occurrence in invertebrates suggesting the need for careful phylogenetically based interpretations of morphological evolution in invertebrate systematics. PMID:23049950

A screening-level assessment of lead, cadmium, and zinc in fish and crayfish from northeastern Oklahoma, USA

USGS Publications Warehouse

Schmitt, C.J.; Brumbaugh, W.G.; Linder, G.L.; Hinck, J.E.

2006-01-01

The objective of this study was to evaluate potential human and ecological risks associated with metals in fish and crayfish from mining in the Tri-States Mining District (TSMD). Crayfish (Orconectes spp.) and fish of six frequently consumed species (common carp, Cyprinus carpio; channel catfish, Ictalurus punctatus; flathead catfish, Pylodictis olivaris; largemouth bass, Micropterus salmoides; spotted bass, M. punctulatus; and white crappie, Pomoxis annularis) were collected in 2001-2002 from the Oklahoma waters of the Spring River (SR) and Neosho River (NR), which drain the TSMD. Samples from a mining-contaminated site in eastern Missouri and from reference sites were also analyzed. Individual fish were prepared for human consumption in the manner used locally by Native Americans (headed, eviscerated, and scaled) and analyzed for lead, cadmium, and zinc. Whole crayfish were analyzed as composite samples of 5-60 animals. Metals concentrations were typically higher in samples from sites most heavily affected by mining and lowest in reference samples. Within the TSMD, most metals concentrations were higher at sites on the SR than on the NR and were typically highest in common carp and crayfish than in other taxa. Higher concentrations and greater risk were associated with fish and crayfish from heavily contaminated SR tributaries than the SR or NR mainstems. Based on the results of this and previous studies, the human consumption of carp and crayfish could be restricted based on current criteria for lead, cadmium, and zinc, and the consumption of channel catfish could be restricted due to lead. Metals concentrations were uniformly low in Micropterus spp. and crappie and would not warrant restriction, however. Some risk to carnivorous avian wildlife from lead and zinc in TSMD fish and invertebrates was also indicated, as was risk to the fish themselves. Overall, the wildlife assessment is consistent with previously reported biological effects attributed to metals from the TSMD. The results demonstrate the potential for adverse effects in fish, wildlife, and humans and indicate that further investigation of human health and ecological risks, to include additional exposure pathways and endpoints, is warranted. ?? Springer Science+Business Media B.V. 2006.

High-resolution structural and elemental analyses of calcium storage structures synthesized by the noble crayfish Astacus astacus.

PubMed

Luquet, Gilles; Salomé, Murielle; Ziegler, Andreas; Paris, Céline; Percot, Aline; Dauphin, Yannicke

2016-11-01

During premolt, crayfish develop deposits of calcium ions, called gastroliths, in their stomach wall. The stored calcium is used for the calcification of parts of the skeleton regularly renewed for allowing growth. Structural and molecular analyses of gastroliths have been primarily performed on three crayfish species, Orconectes virilis, Procambarus clarkii, and more recently, Cherax quadricarinatus. We have performed high-resolution analyses of gastroliths from the native noble crayfish, Astacus astacus, focusing on the microstructure, the mineralogical and elemental composition and distribution in a comparative perspective. Field emission scanning electron microscopy (FESEM) and atomic force microscopy (AFM) observations showed a classical layered microstructure composed of 200-nm diameter granules aligned along fibers. These granules are themselves composed of agglomerated nanogranules of 50nm-mean diameters. Denser regions of bigger fused granules are also present. Micro-Raman spectroscopy show that if A. astacus gastroliths, similarly to the other analyzed gastroliths, are mainly composed of amorphous calcium carbonate (ACC), they are also rich in amorphous calcium phosphate (ACP). The presence of a carotenoid pigment is also observed in A. astacus gastrolith contrary to C. quadricarinatus. Energy-dispersive X-ray spectroscopy (EDX) analyses demonstrate the presence of minor elements such as Mg, Sr, Si and P. The distribution of this last element is particularly heterogeneous. X-ray absorption near edge structure spectroscopy (XANES) reveals an alternation of layers more or less rich in phosphorus evidenced in the mineral phase as well as in the organic matrix in different molecular forms. Putative functions of the different P-comprising molecules are discussed. Copyright © 2016 Elsevier Inc. All rights reserved.

The influence of coarse-scale environmental features on current and predicted future distributions of narrow-range endemic crayfish populations

USGS Publications Warehouse

Dyer, Joseph J.; Brewer, Shannon K.; Worthington, Thomas A.; Bergey, Elizabeth A.

2013-01-01

1.A major limitation to effective management of narrow-range crayfish populations is the paucity of information on the spatial distribution of crayfish species and a general understanding of the interacting environmental variables that drive current and future potential distributional patterns. 2.Maximum Entropy Species Distribution Modeling Software (MaxEnt) was used to predict the current and future potential distributions of four endemic crayfish species in the Ouachita Mountains. Current distributions were modelled using climate, geology, soils, land use, landform and flow variables thought to be important to lotic crayfish. Potential changes in the distribution were forecast by using models trained on current conditions and projecting onto the landscape predicted under climate-change scenarios. 3.The modelled distribution of the four species closely resembled the perceived distribution of each species but also predicted populations in streams and catchments where they had not previously been collected. Soils, elevation and winter precipitation and temperature most strongly related to current distributions and represented 6587% of the predictive power of the models. Model accuracy was high for all models, and model predictions of new populations were verified through additional field sampling. 4.Current models created using two spatial resolutions (1 and 4.5km2) showed that fine-resolution data more accurately represented current distributions. For three of the four species, the 1-km2 resolution models resulted in more conservative predictions. However, the modelled distributional extent of Orconectes leptogonopodus was similar regardless of data resolution. Field validations indicated 1-km2 resolution models were more accurate than 4.5-km2 resolution models. 5.Future projected (4.5-km2 resolution models) model distributions indicated three of the four endemic species would have truncated ranges with low occurrence probabilities under the low-emission scenario, whereas two of four species would be severely restricted in range under moderatehigh emissions. Discrepancies in the two emission scenarios probably relate to the exclusion of behavioural adaptations from species-distribution models. 6.These model predictions illustrate possible impacts of climate change on narrow-range endemic crayfish populations. The predictions do not account for biotic interactions, migration, local habitat conditions or species adaptation. However, we identified the constraining landscape features acting on these populations that provide a framework for addressing habitat needs at a fine scale and developing targeted and systematic monitoring programmes.

Exposure Through Runoff and Ground Water Contamination Differentially Impact Behavior and Physiology of Crustaceans in Fluvial Systems.

PubMed

Steele, Alexandra N; Belanger, Rachelle M; Moore, Paul A

2018-06-19

Chemical pollutants enter aquatic systems through numerous pathways (e.g., surface runoff and ground water contamination), thus associating these contaminant sources with varying hydrodynamic environments. The hydrodynamic environment shapes the temporal and spatial distribution of chemical contaminants through turbulent mixing. The differential dispersal of contaminants is not commonly addressed in ecotoxicological studies and may have varying implications for organism health. The purpose of this study is to understand how differing routes of exposure to atrazine alter social behaviors and physiological responses of aquatic organisms. This study used agonistic encounters in crayfish Orconectes virilis as a behavioral assay to investigate impact of sublethal concentrations of atrazine (0, 40, 80, and 160 µg/L) delivered by methods mimicking ground water and surface runoff influx into flow-through exposure arenas for a total of 23 h. Each experimental animal participated in a dyadic fight trial with an unexposed opponent. Fight duration and intensity were analyzed. Experimental crayfish hepatopancreas and abdominal muscle tissue samples were analyzed for cytochrome P450 and acetylcholinesterase levels to discern mechanism of detoxification and mode of action of atrazine. Atrazine delivered via runoff decreased crayfish overall fight intensity and contrastingly ground water delivery increased overall fight intensity. The behavioral differences were mirrored by increases in cytochrome P450 activity, whereas no differences were found in acetylcholinesterase activity. This study demonstrates that method of delivery into fluvial systems has differential effects on both behavior and physiology of organisms and emphasizes the need for the consideration of delivery pathway in ecotoxicological studies and water-impairment standards.

Environmental conditions and biotic interactions influence ecosystem structure and function in a drying stream

USGS Publications Warehouse

Ludlam, J.P.; Magoulick, D.D.

2010-01-01

Benthic consumers influence stream ecosystem structure and function, but these interactions depend on environmental context. We experimentally quantified the effects of central stoneroller minnows (Campostoma anomalum (Rafinesque) and Meek's crayfish (Orconectes meeki meeki (Faxon)) on benthic communities using electric exclusion quadrats in Little Mulberry Creek before (June) and during (August) seasonal stream drying. Unglazed ceramic tiles were deployed in June and August to measure periphyton and invertebrate abundance, and leafpack decomposition and primary production were also measured in August. Relationships between stoneroller and crayfish density and the size of consumer effects were evaluated with multiple linear regression models. Average chlorophyll a abundance was greater on exposed than exclusion tiles in August, but not in June. Sediment dry mass, periphyton ash-free dry mass (AFDM), and chironomid densities on tiles did not differ among treatments in either period. Leaf packs decayed faster in exposed than exclusion treatments (kexposed = 0.038 ?? 0.013, kexclusion = 0.007 ?? 0.002), but consumer effects were stronger in some pools than others. Leafpack invertebrate biomass and abundance and tile primary productivity did not differ among treatments. Consumer effects on chlorophyll a were related to crayfish and stoneroller density, and effects on chironomid density were related to stoneroller density. These results contrast with a previous exclusion experiment in Little Mulberry Creek that demonstrated strong consumer effects. The influence of stream drying on consumer effects appears to have been reduced by strong spates, underscoring the importance of conducting multi-year studies to determine the magnitude of variability in ecological interactions. ?? US Government: USGS 2010.

Female reproductive characteristics of three species in the Orconectes subgenus Trisellescens and comparisons to other Orconectes species

Treesearch

S. B. Adams

2008-01-01

In streams of Mississippi and southwest Tennessee, Orconectes females with eggs or hatchlings are not commonly encountered while sampling. I report on fecundity, egg size, and aspects of reproductive timing for small samples of female Orconectes chickasawae, Orconectes etnieri, and Orconectes jonesi carrying eggs or hatchlings and...

Single and Multiple Visual Systems in Arthropods

PubMed Central

Wald, George

1968-01-01

Extraction of two visual pigments from crayfish eyes prompted an electrophysiological examination of the role of visual pigments in the compound eyes of six arthropods. The intact animals were used; in crayfishes isolated eyestalks also. Thresholds were measured in terms of the absolute or relative numbers of photons per flash at various wavelengths needed to evoke a constant amplitude of electroretinogram, usually 50 µv. Two species of crayfish, as well as the green crab, possess blue- and red-sensitive receptors apparently arranged for color discrimination. In the northern crayfish, Orconectes virilis, the spectral sensitivity of the dark-adapted eye is maximal at about 550 mµ, and on adaptation to bright red or blue lights breaks into two functions with λmax respectively at about 435 and 565 mµ, apparently emanating from different receptors. The swamp crayfish, Procambarus clarkii, displays a maximum sensitivity when dark-adapted at about 570 mµ, that breaks on color adaptation into blue- and red-sensitive functions with λmax about 450 and 575 mµ, again involving different receptors. Similarly the green crab, Carcinides maenas, presents a dark-adapted sensitivity maximal at about 510 mµ that divides on color adaptation into sensitivity curves maximal near 425 and 565 mµ. Each of these organisms thus possesses an apparatus adequate for at least two-color vision, resembling that of human green-blinds (deuteranopes). The visual pigments of the red-sensitive systems have been extracted from the crayfish eyes. The horse-shoe crab, Limulus, and the lobster each possesses a single visual system, with λmax respectively at 520 and 525 mµ. Each of these is invariant with color adaptation. In each case the visual pigment had already been identified in extracts. The spider crab, Libinia emarginata, presents another variation. It possesses two visual systems apparently differentiated, not for color discrimination but for use in dim and bright light, like vertebrate rods and cones. The spectral sensitivity of the dark-adapted eye is maximal at about 490 mµ and on light adaptation, whether to blue, red, or white light, is displaced toward shorter wavelengths in what is essentially a reverse Purkinje shift. In all these animals dark adaptation appears to involve two phases: a rapid, hyperbolic fall of log threshold associated probably with visual pigment regeneration, followed by a slow, almost linear fall of log threshold that may be associated with pigment migration. PMID:5641632

Protocol for monitoring metals in Ozark National Scenic Riverways, Missouri: Version 1.0

USGS Publications Warehouse

Schmitt, Christopher J.; Brumbaugh, William G.; Besser, John M.; Hinck, Jo Ellen; Bowles, David E.; Morrison, Lloyd W.; Williams, Michael H.

2008-01-01

The National Park Service is developing a monitoring plan for the Ozark National Scenic Riverways in southeastern Missouri. Because of concerns about the release of lead, zinc, and other metals from lead-zinc mining to streams, the monitoring plan will include mining-related metals. After considering a variety of alternatives, the plan will consist of measuring the concentrations of cadmium, cobalt, lead, nickel, and zinc in composite samples of crayfish (Orconectes luteus or alternate species) and Asian clam (Corbicula fluminea) collected periodically from selected sites. This document, which comprises a protocol narrative and supporting standard operating procedures, describes the methods to be employed prior to, during, and after collection of the organisms, along with procedures for their chemical analysis and quality assurance; statistical analysis, interpretation, and reporting of the data; and for modifying the protocol narrative and supporting standard operating procedures. A list of supplies and equipment, data forms, and sample labels are also included. An example based on data from a pilot study is presented.

Neuropeptide Signaling in Crustaceans Probed by Mass Spectrometry

NASA Astrophysics Data System (ADS)

Liang, Zhidan

Neuropeptides are one of the most diverse classes of signaling molecules whose identities and functions are not yet fully understood. They have been implicated in the regulation of a wide range of physiological processes, including feeding-related and motivated behaviors, and also environmental adaptations. In this work, improved mass spectrometry-based analytical platforms were developed and applied to the crustacean systems to characterize signaling molecules. This dissertation begins with a review of mass spectrometry-based neuropeptide studies from both temporal- and spatial-domains. This review is then followed by several chapters detailing a few research projects related to the crustacean neuropeptidomic characterization and comparative analysis. The neuropeptidome of crayfish, Orconectes rusticus is characterized for the first time using mass spectrometry-based tools. In vivo microdialysis sampling technique offers the capability of direct sampling from extracellular space in a time-resolved manner. It is used to investigate the secreted neuropeptide and neurotransmitter content in Jonah crab, Cancer borealis, in this work. A new quantitation strategy using alternative mass spectrometry data acquisition approach is developed and applied for the first time to quantify neuropeptides. Coupling of this method with microdialysis enables the study of neuropeptide dynamics concurrent with different behaviors. Proof-of-principle experiments validating this approach have been carried out in Jonah crab, Cancer borealis to study feeding- and circadian rhythm-related neuropeptide changes using micoridialysis in a time-resolved manner. This permits a close correlation between behavioral and neurochemical changes, providing potential candidates for future validation of regulatory roles. In addition to providing spatial information, mass spectrometry imaging (MSI) technique enables the characterization of signaling molecules while preserving the temporal resolution. A novel MSI-based platform is developed by interfacing with microdialysis sample collection and is applied to the study of in vivo neuropeptide degradation profiles in an off-line 'real-time' fashion. This unique platform provides novel insights into neuropeptide inactivation/elimination process, which is an essential step to understand peptidergic signaling pathway. In addition to neuropeptides, this platform has been further modified to study secreted neurotransmitters, and small molecule metabolites that might interact with neuropeptides in crustacean for the first time. This work not only reports improvements upon neuropeptides identification and quantitation by developing improved analytical strategies, but also provides important evidence for the potential roles of several neuropeptides in regulating food intake and circadian rhythm behaviors. Novel platform that integrates MALDI-MSI with microdialysis in exploring neurochemical changes in dynamic biological events is also presented, which could be potentially applied to many other systems in future research. Collectively this dissertation research develops new analytical methods and improves our fundamental understanding of neuropeptide signaling.

Mimicking natural systems: Changes in behavior as a result of dynamic exposure to naproxen.

PubMed

Neal, Alexandra E; Moore, Paul A

2017-01-01

Animals living in aquatic habitats regularly encounter anthropogenic chemical pollution. Typically, the toxicity of a chemical toxicant is determined by the median lethal concentration (LC 50 ) through a static exposure test. However, LC 50 values and static tests do not provide an accurate representation of exposure to pollutants within natural stream systems. In their native habitats, animals experience exposure as a fluctuating concentration due to turbulent mixing, temporal variations of contamination (seasonal inputs), and contaminant input type (point vs. non-point). Research has shown that turbulent environments produce exposures with a high degree of fluctuation in frequency, duration, and intensity. In order to more effectively evaluate the effects of pollutants, we created a dynamic exposure paradigm, utilizing both flow and substrate within a small mesocosm. A commonly used pharmaceutical, naproxen, was used as the toxicant and female crayfish (Orconectes virilis) as the target organism to investigate changes in fighting behavior as a result of dynamic exposure. Crayfish underwent either a 23h long static or a dynamic exposure to naproxen. Following exposure, the target crayfish and an unexposed size matched opponent underwent a 15min fight trial. These fight trials were recorded and later analyzed using a standard ethogram. Results indicate that exposure to sublethal concentrations of naproxen, in both static and flowing conditions, negatively impact aggressive behavior. Results also indicate that a dynamic exposure paradigm has a greater negative impact on behavior than a static exposure. Turbulence and habitat structure play important roles in shaping chemical exposure. Future research should incorporate features of dynamic chemical exposure in order to form a more comprehensive image of chemical exposure and predict the resulting sublethal effects from exposure. Possible techniques for assessment include utilizing flow-through experimental set-ups in tandem with behavioral or physiological endpoints as opposed to acute toxicity. Other possibilities of assessment could involve utilizing fine-scale chemical measurements of pollutants to determine the actual concentrations animals encounter during an exposure event. Copyright © 2016 Elsevier Inc. All rights reserved.

Speedy Recovery - Stream Macroinvertebrate Communities Show Extraordinary Recovery from Mining-Related Acidification

NASA Astrophysics Data System (ADS)

Jackson, D. A.

2005-05-01

An area in northern Ontario, Wawa, was severely damaged by a century of iron mining and smelting with exceptional acidification (pH 3-4) and the accumulation of arsenic and other toxins. No formal restoration occurred following cessation of operations in 1998, but natural recovery began. In May 2004 we sampled the benthic macroinvertebrate communities of 20 stream riffles within and around the former fume kill area with the goal of estimating the state of community recovery. Despite watercourse colonization routes being blocked by waterfalls and the short time available for recovery, the macroinvertebrate communities showed remarkable recovery with both taxon richness and abundances being well within the range found in nearby reference streams belonging to the same watershed. Even relatively slow colonizers such as Pisidium bivalve mollusks and Orconectes crayfish, were found in the fume kill area streams. The biological recovery has been matched only by the chemical recovery of the systems. We attribute the rapid recovery firstly to the underlying calcium-rich geology, which apparently led to a quick decrease of acidity, thus facilitating re-colonization of the streams. Secondly, stream orientation relative to the acidic deposition zone facilitated rapid re-colonization from upstream areas.

Reproductive plasticity in freshwater invader: from long-term sperm storage to parthenogenesis.

PubMed

Buřič, Miloš; Kouba, Antonín; Kozák, Pavel

2013-01-01

Orconectes limosus, a North American crayfish species, is one of the most important aquatic invaders in European inland waters. Despite more than 120 years occurrence in Europe and intense research, there are still gaps in knowledge of its life history and ecology. Investigation into O. limosus invasive success requires identifying the mechanisms that enabled them to establish dense and widespread populations from small initial numbers without observable limitation by an introduction bottleneck. In part, O. limosus success may lie in its ability to reproduce by facultative parthenogenesis. Moreover, there are possible other mating scenarios, because of two mating seasons (autumn and spring) in O. limosus. This work investigated the effect of four reproductive scenarios (autumn mating only, spring mating only, autumn and spring mating, and without mating) on the reproductive success of O. limosus. Females successfully reproduced in all tested mating regimes using parthenogenesis as well as log term sperm storage. This reproductive plasticity likely facilitates the overwhelming success of O. limosus spread and establishment in new localities. It can explain the spread of O. limosus from the initial introduction of 90 specimens to most of continental Europe and Great Britain. These conclusions imply a serious threat, not only for autochthonous European astacofauna, but for other aquatic organisms as well as entire ecosystems.

Reproductive Plasticity in Freshwater Invader: From Long-Term Sperm Storage to Parthenogenesis

PubMed Central

Buřič, Miloš; Kouba, Antonín; Kozák, Pavel

2013-01-01

Orconectes limosus, a North American crayfish species, is one of the most important aquatic invaders in European inland waters. Despite more than 120 years occurrence in Europe and intense research, there are still gaps in knowledge of its life history and ecology. Investigation into O. limosus invasive success requires identifying the mechanisms that enabled them to establish dense and widespread populations from small initial numbers without observable limitation by an introduction bottleneck. In part, O. limosus success may lie in its ability to reproduce by facultative parthenogenesis. Moreover, there are possible other mating scenarios, because of two mating seasons (autumn and spring) in O. limosus. This work investigated the effect of four reproductive scenarios (autumn mating only, spring mating only, autumn and spring mating, and without mating) on the reproductive success of O. limosus. Females successfully reproduced in all tested mating regimes using parthenogenesis as well as log term sperm storage. This reproductive plasticity likely facilitates the overwhelming success of O. limosus spread and establishment in new localities. It can explain the spread of O. limosus from the initial introduction of 90 specimens to most of continental Europe and Great Britain. These conclusions imply a serious threat, not only for autochthonous European astacofauna, but for other aquatic organisms as well as entire ecosystems. PMID:24204886

The Role of Sex and Mating Status in the Expansion Process of Arhopalus rusticus (Coleoptera: Cerambycidae)-an Exotic Cerambycid in Argentina.

PubMed

Grilli, Mariano Pablo; Fachinetti, Romina

2017-06-01

In Córdoba province, central Argentina, there is an area of introduced pine trees, in which an invading Cerambycid, Arhopalus rusticus (L.), was detected in this region for the first time in 2006. The species has since expanded its range until it now occupies the whole area. Arhopalus rusticus is a common species in pine forests of the northern hemisphere. In this paper, we analyze how sex and mating status affects flight performance and the potential distribution of this species. The study was performed with individuals collected from introduced pine forests in the center-west of Córdoba Province (Argentina). The dispersal capability of A. rusticus was determined by measuring flight speed and distance traveled by recently emerged mated and unmated A. rusticus in flight mills. Data of preflight body weight, postflight body weight, body length, and elytron size were obtained from the individuals that were flown in the flight mill. We found that females had a greater body length, weighed more, had longer elytra, and were stronger flyers than males. We also found that mated individuals flew faster and longer distances than unmated individuals, and consumed a smaller fraction of their body weight. A positive ratio was observed between elytra size and flight speed. A map of males' and females' dispersal distances was produced for the study region, using the adjusted dispersal distance distribution of males and females. The flight performance showed that, as females disperse after copulation, they increase the chances of establishing the species in unoccupied areas.En la provincia de Córdoba, Argentina, hay una importante área de pinos implantados. En esta región durante el año 2006 se detectó por primera vez a Arhopalus rusticus (L.), un Cerambycidae invasor. A. rusticus es una especie común en los bosques de pino del hemisferio norte. En este trabajo analizamos de qué manera el sexo y el estado de apareamiento afectan el desempeño de vuelo y la distribución potencial de esta especie. Utilizamos individuos recolectados de los bosques de pino implantados en la región centro oeste de la provincia de Córdoba (Argentina). La capacidad de dispersión de Arhopalus rusticus se determinó haciendo volar individuos recién emergidos en un molino de vuelo. Se registró el peso previo y posterior al vuelo, el largo del cuerpo y el tamaño del élitro. Las hembras fueron mejores voladoras, más largas, más pesadas, con élitros más largos que los machos. Observamos diferencias entre el potencial de dispersión dependiendo del estado de apareamiento de los individuos. Los individuos apareados volaron más rápido y mayores distancias que los individuos no apareados y consumieron una menor fracción de su peso corporal. Se observó una relación positiva entre el tamaño del élitro y la velocidad de vuelo. Se generó un mapa de las distancias de dispersión potencial de los machos y de las hembras para la región de estudio utilizando las distribuciones de las distancias obtenidas del molino de vuelo. La dispersión post copulación incrementa las chances de que la especie se establezca en zonas no ocupadas. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Density-dependent effects of omnivorous stream crayfish on benthic trophic dynamics

USGS Publications Warehouse

Ludlam, J.P.; Banks, B. T.; Magoulick, Daniel D.

2015-01-01

Crayfish are abundant and important consumers in aquatic food webs and crayfish invasions have demonstrated strong effects of crayfish on multiple trophic levels. Density may be an important factor determining the role of omnivorous crayfish in benthic communities, especially if density alters the strength of trophic interactions. The effect of crayfish density on a simple benthic food web using ceramic tiles was examined in three treatments (crayfish exclusion cage, cage control (open to crayfish), and exposed ceramic tiles) in mesocosms stocked with 6, 12, or 18 crayfish·m-2. We hypothesized that at low densities crayfish consumption of herbivorous chironomids would increase algal abundance, but at high densities crayfish would reduce both periphyton and invertebrates. In the experiment, periphyton and chironomid abundance increased with declining crayfish biomass on day 30 but not day 15. The magnitude of crayfish effects on day 15 periphyton chlorophyll a abundance increased with crayfish biomass, but crayfish effects on day 30 periphyton chlorophyll a or chironomid biomass did not increase with crayfish biomass. In this experiment there was little evidence for a trophic cascade at low crayfish densities and strong omnivory by crayfish dominated trophic dynamics.

Presence and biomagnification of organochlorine chemical residues in oxbow lakes of northeastern Louisiana

USGS Publications Warehouse

Niethammer, K.R.; White, D.H.; Baskett, T.S.; Sayre, M.W.

1984-01-01

Samples (98) of 16 spp. of animals were collected at Lake Providence, 88 samples of 15 spp. at Lake Bruin and 21 samples of 5 spp. at Lake St. John, Louisiana, between July 15 and Sept. 25, 1980. Residues of 13 organochlorine compounds were identified in these samples. Substantial concentrations of many compounds throughout the food webs of all 3 lakes showed that the lakes acted as sumps, accumulating residues from nearby agricultural land. DDT and its metabolites (DDE, TDE and DDMU [1-chloro-2,2,-bis(p-chlorophenyl)ethylene]), toxaphene and polychlorobiphenyls (PCB) were the principal organochloride residues detected. With few exceptions, biomagnification of the principal residues was clearly illustrated. Tertiary consumers such as green-backed heron (Butorides striatus), snakes, spotted gar (Lepisosteus oculatus) and largemouth bass (Micropterus salmoides) contained the highest residues. Bluegill (Lepomis macrochirus), blacktail shiner (Notropis venustus), yellow-crowned night heron (Nycticorax violaceus) and other secondary consumers contained lower levels of residues. Primary consumers, crayfish (Orconectes lancifer) and threadfin shad (Dorosoma petenense), contained relatively low residue levels of most compounds. Frogs contained lower residue levels than expected based on their position in the food web. Residue levels in immature green-backed herons and .gtoreq. 1 of the longer-lived predators, e.g., snakes, gars or largemouth bass could be monitored to evaluate levels of organochlorine chemical contaminants in aquatic habitats.

Using eDNA to detect the distribution and density of invasive crayfish in the Honghe-Hani rice terrace World Heritage site

PubMed Central

Yang, Chunyan; Wang, Lin; Wang, Wenzhi; Zhao, Guigang; Geng, Yupeng; Yu, Douglas W.

2017-01-01

The Honghe-Hani landscape in China is a UNESCO World Natural Heritage site due to the beauty of its thousands of rice terraces, but these structures are in danger from the invasive crayfish Procambarus clarkii. Crayfish dig nest holes, which collapse terrace walls and destroy rice production. Under the current control strategy, farmers self-report crayfish and are issued pesticide, but this strategy is not expected to eradicate the crayfish nor to prevent their spread since farmers are not able to detect small numbers of crayfish. Thus, we tested whether environmental DNA (eDNA) from paddy-water samples could provide a sensitive detection method. In an aquarium experiment, Real-time Quantitative polymerase chain reaction (qPCR) successfully detected crayfish, even at a simulated density of one crayfish per average-sized paddy (with one false negative). In a field test, we tested eDNA and bottle traps against direct counts of crayfish. eDNA successfully detected crayfish in all 25 paddies where crayfish were observed and in none of the 7 paddies where crayfish were absent. Bottle-trapping was successful in only 68% of the crayfish-present paddies. eDNA concentrations also correlated positively with crayfish counts. In sum, these results suggest that single samples of eDNA are able to detect small crayfish populations, but not perfectly. Thus, we conclude that a program of repeated eDNA sampling is now feasible and likely reliable for measuring crayfish geographic range and for detecting new invasion fronts in the Honghe Hani landscape, which would inform regional control efforts and help to prevent the further spread of this invasive crayfish. PMID:28505200

Using eDNA to detect the distribution and density of invasive crayfish in the Honghe-Hani rice terrace World Heritage site.

PubMed

Cai, Wang; Ma, Zhuxin; Yang, Chunyan; Wang, Lin; Wang, Wenzhi; Zhao, Guigang; Geng, Yupeng; Yu, Douglas W

2017-01-01

The Honghe-Hani landscape in China is a UNESCO World Natural Heritage site due to the beauty of its thousands of rice terraces, but these structures are in danger from the invasive crayfish Procambarus clarkii. Crayfish dig nest holes, which collapse terrace walls and destroy rice production. Under the current control strategy, farmers self-report crayfish and are issued pesticide, but this strategy is not expected to eradicate the crayfish nor to prevent their spread since farmers are not able to detect small numbers of crayfish. Thus, we tested whether environmental DNA (eDNA) from paddy-water samples could provide a sensitive detection method. In an aquarium experiment, Real-time Quantitative polymerase chain reaction (qPCR) successfully detected crayfish, even at a simulated density of one crayfish per average-sized paddy (with one false negative). In a field test, we tested eDNA and bottle traps against direct counts of crayfish. eDNA successfully detected crayfish in all 25 paddies where crayfish were observed and in none of the 7 paddies where crayfish were absent. Bottle-trapping was successful in only 68% of the crayfish-present paddies. eDNA concentrations also correlated positively with crayfish counts. In sum, these results suggest that single samples of eDNA are able to detect small crayfish populations, but not perfectly. Thus, we conclude that a program of repeated eDNA sampling is now feasible and likely reliable for measuring crayfish geographic range and for detecting new invasion fronts in the Honghe Hani landscape, which would inform regional control efforts and help to prevent the further spread of this invasive crayfish.

Habitat associations of three crayfish endemic to the Ouachita Mountain Ecoregion

USGS Publications Warehouse

Dyer, Joseph J.; Brewer, Shannon K.

2018-01-01

Many crayfish are of conservation concern because of their use of unique habitats and often narrow ranges. In this study, we determined fine-scale habitat use by 3 crayfishes that are endemic to the Ouachita Mountains, in Oklahoma and Arkansas. We sampled Faxonius menae (Mena Crayfish), F. leptogonopodus (Little River Creek Crayfish), and Fallicambarus tenuis (Ouachita Mountain Crayfish) from wet and dry erosional channel units of 29 reaches within the Little River catchment. We compared channel-unit and microhabitat selection for each species. Crayfish of all species and life stages selected erosional channel units more often than depositional units, even though these sites were often dry. Accordingly, crayfish at all life stages typically selected the shallowest available microhabitats. Adult crayfish of all species and juvenile Little River Creek Crayfish selected patches of coarse substrate, and all crayfish tended to use the lowest amount of bedrock available. In general, we showed that these endemic crayfish used erosional channel units of streams, even when the channel units were dry. Conservation efforts that protect erosional channel units and mitigate actions that cause channel downcutting to bedrock would benefit these crayfish, particularly during harsh, summer drying periods.

Intensive removal of signal crayfish (Pacifastacus leniusculus) from rivers increases numbers and taxon richness of macroinvertebrate species.

PubMed

Moorhouse, Tom P; Poole, Alison E; Evans, Laura C; Bradley, David C; Macdonald, David W

2014-02-01

Invasive species are a major cause of species extinction in freshwater ecosystems, and crayfish species are particularly pervasive. The invasive American signal crayfish Pacifastacus leniusculus has impacts over a range of trophic levels, but particularly on benthic aquatic macroinvertebrates. Our study examined the effect on the macroinvertebrate community of removal trapping of signal crayfish from UK rivers. Crayfish were intensively trapped and removed from two tributaries of the River Thames to test the hypothesis that lowering signal crayfish densities would result in increases in macroinvertebrate numbers and taxon richness. We removed 6181 crayfish over four sessions, resulting in crayfish densities that decreased toward the center of the removal sections. Conversely in control sections (where crayfish were trapped and returned), crayfish density increased toward the center of the section. Macroinvertebrate numbers and taxon richness were inversely correlated with crayfish densities. Multivariate analysis of the abundance of each taxon yielded similar results and indicated that crayfish removals had positive impacts on macroinvertebrate numbers and taxon richness but did not alter the composition of the wider macroinvertebrate community. Synthesis and applications: Our results demonstrate that non-eradication-oriented crayfish removal programmes may lead to increases in the total number of macroinvertebrates living in the benthos. This represents the first evidence that removing signal crayfish from riparian systems, at intensities feasible during control attempts or commercial crayfishing, may be beneficial for a range of sympatric aquatic macroinvertebrates.

Intensive removal of signal crayfish (Pacifastacus leniusculus) from rivers increases numbers and taxon richness of macroinvertebrate species

PubMed Central

Moorhouse, Tom P; Poole, Alison E; Evans, Laura C; Bradley, David C; Macdonald, David W

2014-01-01

Invasive species are a major cause of species extinction in freshwater ecosystems, and crayfish species are particularly pervasive. The invasive American signal crayfish Pacifastacus leniusculus has impacts over a range of trophic levels, but particularly on benthic aquatic macroinvertebrates. Our study examined the effect on the macroinvertebrate community of removal trapping of signal crayfish from UK rivers. Crayfish were intensively trapped and removed from two tributaries of the River Thames to test the hypothesis that lowering signal crayfish densities would result in increases in macroinvertebrate numbers and taxon richness. We removed 6181 crayfish over four sessions, resulting in crayfish densities that decreased toward the center of the removal sections. Conversely in control sections (where crayfish were trapped and returned), crayfish density increased toward the center of the section. Macroinvertebrate numbers and taxon richness were inversely correlated with crayfish densities. Multivariate analysis of the abundance of each taxon yielded similar results and indicated that crayfish removals had positive impacts on macroinvertebrate numbers and taxon richness but did not alter the composition of the wider macroinvertebrate community. Synthesis and applications: Our results demonstrate that non-eradication-oriented crayfish removal programmes may lead to increases in the total number of macroinvertebrates living in the benthos. This represents the first evidence that removing signal crayfish from riparian systems, at intensities feasible during control attempts or commercial crayfishing, may be beneficial for a range of sympatric aquatic macroinvertebrates. PMID:24634733

Effects of natural flooding and manual trapping on the facilitation of invasive crayfish-native amphibian coexistence in a semi-arid perennial stream

USGS Publications Warehouse

Kats, Lee B.; Bucciarelli, Gary; Vandergon, Thomas L.; Honeycutt, Rodney L.; Mattiasen, Evan; Sanders, Arthur; Riley, Seth P.D.; Kerby, Jacob L.; Fisher, Robert N.

2013-01-01

Aquatic amphibians are known to be vulnerable to a myriad of invasive predators. Invasive crayfish are thought to have eliminated native populations of amphibians in some streams in the semi-arid Santa Monica Mountains of southern California. Despite their toxic skin secretions that defend them from native predators, newts are vulnerable to crayfish attacks, and crayfish have been observed attacking adult newts, and eating newt egg masses and larvae. For 15 years, we have observed invasive crayfish and native California newts coexisting in one stream in the Santa Monica Mountains. During that period, we monitored the densities of both crayfish and newt egg mass densities and compared these to annual rainfall totals. After three seasons of below average rainfall, we reduced crayfish numbers by manual trapping. Our long-term data indicated that crayfish did not fare well in years when rainfall is above the historic average. This invasive predator did not evolve with high velocity streams, and observations indicated that southern California storm events washed crayfish downstream, killing many of them. Newts exhibit increased reproduction in years when crayfish numbers were reduced. A comparison with a nearby stream that does not contain crayfish indicated that newt reproduction positively responded to increased rainfall, but that fluctuations were much greater in the stream that contains crayfish. We suggest that rainfall patterns help explain invasive crayfish/newt coexistence and that management for future coexistence may benefit from manual trapping.

Response of crayfish to hyporheic water availability and excess sedimentation

USGS Publications Warehouse

Dyer, Joseph J.; Worthington, Thomas A.; Brewer, Shannon K.

2015-01-01

Crayfish in many headwater streams regularly cope with seasonal drought. However, it is unclear how landscape changes affect the long-term persistence of crayfish populations. We designed two laboratory experiments to investigate the acute effects of common landscape stressors on crayfish: water withdrawal and sedimentation. The first experiment tested the interaction among water withdrawals (four 24-h water reductions of 0, 15, 30, or 45 cm) and two substrate treatments (pebble and cobble) on the burrowing depth of crayfish. The second experiment evaluated the effects of excess fine sediment (three treatments of 0, 45, and 90% sediment) and substrate type (cobble and pebble) on crayfish burrowing depth. Crayfish were able to burrow deeper into the simulated hyporheic zone in cobble substrate when compared to pebble. Crayfish subjected to greater water withdrawals in the pebble treatment were not able to reach the simulated hyporheic zone. Excess fine sediment reduced the depth that crayfish burrowed, regardless of substrate type. Results from this study suggest excess fine sediment may reduce crayfish persistence, particularly when seeking refuge during prolonged dry conditions.

Comparative acute toxicity of neonicotinoid and pyrethroid insecticides to non-target crayfish (Procambarus clarkii) associated with rice-crayfish crop rotations.

PubMed

Barbee, Gary C; Stout, Michael J

2009-11-01

Most insecticides used to control rice water weevil (Lissorhoptrus oryzophilus Kuscel) infestations are pyrethroids. However, pyrethroids are highly toxic to non-target crayfish associated with rice-crayfish crop rotations. One solution to the near-exclusive reliance on pyrethroids in a rice-crayfish pest management program is to incorporate neonicotinoid insecticides, which are insect specific and effective against weevils but not extremely toxic to crayfish. This study aimed to take the first step to assess neonicotinoids as alternatives to pyrethroids in rice-crayfish crop rotations by measuring the acute toxicities of three candidate neonicotinoid insecticides, clothianidin, dinotefuran and thiamethoxam, to juvenile Procambarus clarkii (Girard) crayfish and comparing them with the acute toxicities of two currently used pyrethroid insecticides, lambda-cyhalothrin and etofenprox. Neonicotinoid insecticides are at least 2-3 orders of magnitude less acutely toxic (96 h LC(50)) than pyrethroids to juvenile Procambarid crayfish: lambda-cyhalothrin (0.16 microg AI L(-1)) = etofenprox (0.29 microg AI L(-1)) > clothianidin (59 microg AI L(-1)) > thiamethoxam (967 microg AI L(-1)) > dinotefuran (2032 microg AI L(-1)). Neonicotinoid insecticides appear to be much less hazardous alternatives to pyrethroids in rice-crayfish crop rotations. Further field-level neonicotinoid acute and chronic toxicity testing with crayfish is needed. (c) 2009 Society of Chemical Industry.

Crayfish behavioral changes with CO2

NASA Astrophysics Data System (ADS)

Ellis, J.

2017-12-01

Changes in carbon dioxide (CO2) could have a major impact on aquatic life. We examined the effects of different levels of CO2 on the behavior of crayfish. The shelter treatments showed that crayfish became less active with increased CO2. The predator treatments showed that crayfish became more aggressive with increased CO2. From these experiments, we conclude that the roles of crayfish in the ecosystem could change.

Nitrite toxicity to the crayfish Procambarus clarkii

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gutzmer, M.P.; Tomasso, J.R.

The purpose of this study was to determine the effects of acute nitrite exposure to the crayfish Procambarus clarkii (Decapoda). Specific objectives of this study included (1) determining the 24-, 48-, 72- and 96-h LC-50's of nitrite to crayfish of different weights and genders in freshwater, (2) determining the LC-50's of nitrite to crayfish in water with elevated chloride concentrations, and (3), in order to gain insight into the mechanisms of nitrite toxicity in crayfish, determining hemolymph nitrite concentrations in crayfish exposed to nitrite in freshwater and water with elevated chloride concentrations.

Evaluation of Crayfish Growth and Assimilation on Animal and Detrital Food Sources: Are Stable Isotopes Telling the Whole Story?

NASA Astrophysics Data System (ADS)

Warren, L. L.; Wotton, R. S.; Wharton, G.; Fortino, K.; Ulseth, A. J.; Hershey, A. E.

2005-05-01

Crayfish are the dominant omnivores of many ecosystems and have strong direct and indirect effects through predation and organic matter processing. Despite this, the importance of detritus for crayfish production is poorly understood. We conducted a laboratory experiment where we fed crayfish an ad. lib. diet of only detritus, only fish tissue, or a mixture the above. The crayfish grew more on a diet which contained meat but growth was highly correlated with the amount of food consumed. The least amount of food was consumed in the detritus treatment, an intermediate amount of food in the meat treatment, and the most food in the mix treatment, suggesting that consumption of detritus by crayfish is related to more than simply the abundance of detritus. Nonetheless, isotopic evidence indicated that the crayfish were not assimilating leaf C and N. Additionally, crayfish in the meat containing treatments never exceeded the del 15N signature of their source by the approximately 3 units expected following fractionation, despite coming to isotopic equilibrium with their source. These findings suggest that crayfish may fractionate C and N uniquely. This difference may have to do with gut microbial activity and may have implications for the interpretation crayfish isotopic signatures.

Interactions between accumulated copper, bacterial community structure and histamine levels in crayfish meat during storage.

PubMed

Soedarini, Bernadeta; van Gestel, Cornelis A M; van Straalen, Nico M; Widianarko, Budi; Röling, Wilfred F M

2014-08-01

Pollution in aquaculture areas may negatively impact edible species and threaten seafood quality and safety. The aim of this study was to determine the interaction between copper and bacteria in the aquatic habitat and their impact upon crustaceans. Marbled crayfish was chosen as a model of aquatic crustaceans and the influence of metal contamination on bacterial community structure in water used to culture crayfish and in crayfish themselves was investigated. Histamine, an allergen commonly formed by certain groups of bacteria in crustacean edible tissue during storage, was also determined. Copper exposure increased its concentration in crayfish meat by 17.4%, but the copper concentration remained within acceptable food safety limits. Elevated copper levels affected the bacterial community both in the water used to cultivate crayfish and in the marbled crayfish themselves. Cluster analysis of 16S rRNA-gene based microbial community fingerprints revealed that copper impacted the bacterial community in the water and in the crayfish meat. However, copper exposure reduced the formation of histamine in crayfish meat during storage by 66.3%. Copper from the habitat appears to reduce histamine accumulation in crayfish meat during storage by affecting the bacterial community structure of the cultivation water and most likely also in the intestine of the crayfish. From a food safety point of view, copper treatment during the aqua culturing of crustaceans has a positive impact on the postharvest stage. © 2013 Society of Chemical Industry.

Effects of climate change, invasive species, and disease on the distribution of native European crayfishes.

PubMed

Capinha, César; Larson, Eric R; Tricarico, Elena; Olden, Julian D; Gherardi, Francesca

2013-08-01

Climate change will require species to adapt to new conditions or follow preferred climates to higher latitudes or elevations, but many dispersal-limited freshwater species may be unable to move due to barriers imposed by watershed boundaries. In addition, invasive nonnative species may expand into new regions under future climate conditions and contribute to the decline of native species. We evaluated future distributions for the threatened European crayfish fauna in response to climate change, watershed boundaries, and the spread of invasive crayfishes, which transmit the crayfish plague, a lethal disease for native European crayfishes. We used climate projections from general circulation models and statistical models based on Mahalanobis distance to predict climate-suitable regions for native and invasive crayfishes in the middle and at the end of the 21st century. We identified these suitable regions as accessible or inaccessible on the basis of major watershed boundaries and present occurrences and evaluated potential future overlap with 3 invasive North American crayfishes. Climate-suitable areas decreased for native crayfishes by 19% to 72%, and the majority of future suitable areas for most of these species were inaccessible relative to native and current distributions. Overlap with invasive crayfish plague-transmitting species was predicted to increase. Some native crayfish species (e.g., noble crayfish [Astacus astacus]) had no future refugia that were unsuitable for the modeled nonnative species. Our results emphasize the importance of preventing additional introductions and spread of invasive crayfishes in Europe to minimize interactions between the multiple stressors of climate change and invasive species, while suggesting candidate regions for the debatable management option of assisted colonization. © 2013 Society for Conservation Biology.

Acute toxicity of chlorantraniliprole to non-target crayfish (Procambarus clarkii) associated with rice-crayfish cropping systems.

PubMed

Barbee, Gary C; McClain, W Ray; Lanka, Srinivas K; Stout, Michael J

2010-09-01

Chlorantraniliprole, a novel anthranilic diamide insecticide, was recently introduced into the United States where rice-crayfish crop rotations are practiced to control rice water weevil (Lissorhoptrus oryzophilus Kuschel) infestations. Chlorantraniliprole has high margins of mammalian safety and excellent insecticidal efficacy, but its toxicity to non-target crayfish is uncertain. In this study, the acute toxicity of chlorantraniliprole to the red swamp crayfish Procambarus clarkii Girard was determined using aquatic and feeding assays. The aquatic 96 h median lethal toxicity (LC(50)) data indicate that technical-grade chlorantraniliprole is highly toxic (US EPA category) to crayfish with an LC(50) of 951 microg L(-1) (95% CL = 741-1118 microg L(-1)). A no observed effect concentration (NOEC) of 480 microg L(-1) was recorded. Neither the 36 day chronic feeding study, where crayfish fed on chlorantraniliprole-treated rice seed in aquaria, nor the 144 h acute feeding test, where crayfish fed on rice seeds treated with chlorantraniliprole, produced mortality or abnormal behavior. Chlorantraniliprole is three orders of magnitude less acutely toxic to P. clarkii than lambda-cyhalothrin and etofenprox, two pyrethroid insecticides also used in rice, and is less likely to cause acute crayfish toxicity in rice pond ecosystems. Based on acute toxicity data, the use of chlorantraniliprole should be more compatible with rice-crayfish crop rotations than pyrethroids. (c) 2010 Society of Chemical Industry.

Biomonitoring of Trace Metals in the Keban Dam Reservoir (Turkey) Using Mussels (Unio elongatulus eucirrus) and Crayfish (Astacus leptodactylus).

PubMed

Varol, Memet; Sünbül, Muhammet Raşit

2018-01-03

Freshwater mussels and crayfish are commonly used as biomonitors of trace metals. In the present study, the concentrations of ten metals were determined in mussels (Unio elongatulus eucirrus) and crayfish (Astacus leptodactylus) collected from the Keban Dam Reservoir in Turkey. The significant spatial differences in concentrations of studied metals except As in mussels were not found. However, Co, Cr, Cu, and Zn concentrations in mussels and As, Co, Cu, Fe, Pb, and Zn concentrations in crayfish showed significant seasonal differences. As, Cd, and Mn levels in mussels were about nine times higher than those in crayfish. The concentrations of Cd, Cr, Cu, Pb, Zn, and inorganic As in crayfish and mussels were lower than maximum permissible levels. When compared with other biomonitoring studies using mussels and crayfish, high concentrations of As, Cd, Co, Cr, and Ni in mussels and Cr and Ni in crayfish were observed due to lithogenic sources and anthropogenic activities in the basin. Bioconcentration factor values of Fe, Mn, Cd, and Zn in mussels and Zn, Cu, Fe, and Co in crayfish were > 1000, which indicates that both U. e. eucirrus and A. leptodactylus have potential to bioaccumulate these metals. Therefore, attention should be paid to mussels and crayfish from ecological and human health perspective, because they are potential vectors of metals to higher trophic levels.

The monophyletic origin of freshwater crayfish estimated from nuclear and mitochondrial DNA sequences.

PubMed Central

Crandall, K A; Harris, D J; Fetzner, J W

2000-01-01

Despite their widespread use as model organisms, the phylogenetic status of the around 520 species of freshwater crayfish is still in doubt. One hypothesis suggests two distinct origins of freshwater crayfish as indicated by their geographical distribution, with two centres of origin near the two present centres of diversity; one in south-eastern United States and the other in Victoria, Australia. An alternative theory proposes a single (monophyletic) origin of freshwater crayfish. Here we use over 3000 nucleotides from three different gene regions in estimating phylogenetic relationships among freshwater crayfish and related Crustacea. We show clear evidence for monophyly of freshwater crayfish and for the sister-group relationship between crayfish and clawed lobsters. Monophyly of the superfamilies Astacoidea and Parastacoidea is also supported. However, the monophyly of the family Cambaridae is questioned with the genus Cambaroides being associated with the Astacidae. PMID:11467432

Tag retention, growth, and survival of red swamp crayfish Procambarus clarkii marked with coded wire tags

USGS Publications Warehouse

Isely, J.J.; Eversole, A.G.

1998-01-01

Juvenile red swamp crayfish (or crawfish), Procambarus clarkii (20-41 mm in total length) were collected from a crayfish culture pond by dipnetting and tagged with sequentially numbered, standard length, binary-coded wire tags. Four replicates of 50 crayfish were impaled perpendicular to the long axis of the abdomen with a fixed needle. Tags were injected transversely into the ventral surface of the first or second abdominal segment and were imbedded in the musculature just beneath the abdominal sternum. Tags were visible upon inspection. Additionally, two replicates of 50 crayfish were not tagged and were used as controls. Growth, survival, and tag retention were evaluated after 7 d in individual containers, after 100 d in aquaria, and after 200 d in field cages. Tag retention during each sample period was 100%, and average mortality of tagged crayfish within 7 d of tagging was 1%. Mortality during the remainder of the study was high (75-91%) but was similar between treatment and control samples. Most of the deaths were probably due to cannibalism. Average total length increased threefold during the course of the study, and crayfish reached maturity. Because crayfish were mature by the end of the study, we concluded that the coded wire tag was retained through the life history of the crayfish.

Monitoring of noble, signal and narrow-clawed crayfish using environmental DNA from freshwater samples.

PubMed

Agersnap, Sune; Larsen, William Brenner; Knudsen, Steen Wilhelm; Strand, David; Thomsen, Philip Francis; Hesselsøe, Martin; Mortensen, Peter Bondgaard; Vrålstad, Trude; Møller, Peter Rask

2017-01-01

For several hundred years freshwater crayfish (Crustacea-Decapoda-Astacidea) have played an important ecological, cultural and culinary role in Scandinavia. However, many native populations of noble crayfish Astacus astacus have faced major declines during the last century, largely resulting from human assisted expansion of non-indigenous signal crayfish Pacifastacus leniusculus that carry and transmit the crayfish plague pathogen. In Denmark, also the non-indigenous narrow-clawed crayfish Astacus leptodactylus has expanded due to anthropogenic activities. Knowledge about crayfish distribution and early detection of non-indigenous and invasive species are crucial elements in successful conservation of indigenous crayfish. The use of environmental DNA (eDNA) extracted from water samples is a promising new tool for early and non-invasive detection of species in aquatic environments. In the present study, we have developed and tested quantitative PCR (qPCR) assays for species-specific detection and quantification of the three above mentioned crayfish species on the basis of mitochondrial cytochrome oxidase 1 (mtDNA-CO1), including separate assays for two clades of A. leptodactylus. The limit of detection (LOD) was experimentally established as 5 copies/PCR with two different approaches, and the limit of quantification (LOQ) were determined to 5 and 10 copies/PCR, respectively, depending on chosen approach. The assays detected crayfish in natural freshwater ecosystems with known populations of all three species, and show promising potentials for future monitoring of A. astacus, P. leniusculus and A. leptodactylus. However, the assays need further validation with data 1) comparing traditional and eDNA based estimates of abundance, and 2) representing a broader geographical range for the involved crayfish species.

Monitoring of noble, signal and narrow-clawed crayfish using environmental DNA from freshwater samples

PubMed Central

Knudsen, Steen Wilhelm; Strand, David; Thomsen, Philip Francis; Hesselsøe, Martin; Mortensen, Peter Bondgaard; Vrålstad, Trude; Møller, Peter Rask

2017-01-01

For several hundred years freshwater crayfish (Crustacea—Decapoda—Astacidea) have played an important ecological, cultural and culinary role in Scandinavia. However, many native populations of noble crayfish Astacus astacus have faced major declines during the last century, largely resulting from human assisted expansion of non-indigenous signal crayfish Pacifastacus leniusculus that carry and transmit the crayfish plague pathogen. In Denmark, also the non-indigenous narrow-clawed crayfish Astacus leptodactylus has expanded due to anthropogenic activities. Knowledge about crayfish distribution and early detection of non-indigenous and invasive species are crucial elements in successful conservation of indigenous crayfish. The use of environmental DNA (eDNA) extracted from water samples is a promising new tool for early and non-invasive detection of species in aquatic environments. In the present study, we have developed and tested quantitative PCR (qPCR) assays for species-specific detection and quantification of the three above mentioned crayfish species on the basis of mitochondrial cytochrome oxidase 1 (mtDNA-CO1), including separate assays for two clades of A. leptodactylus. The limit of detection (LOD) was experimentally established as 5 copies/PCR with two different approaches, and the limit of quantification (LOQ) were determined to 5 and 10 copies/PCR, respectively, depending on chosen approach. The assays detected crayfish in natural freshwater ecosystems with known populations of all three species, and show promising potentials for future monitoring of A. astacus, P. leniusculus and A. leptodactylus. However, the assays need further validation with data 1) comparing traditional and eDNA based estimates of abundance, and 2) representing a broader geographical range for the involved crayfish species. PMID:28654642

Crayfish: a newly recognized vehicle for vibrio infections.

PubMed

Bean, N H; Maloney, E K; Potter, M E; Korazemo, P; Ray, B; Taylor, J P; Seigler, S; Snowden, J

1998-10-01

We conducted a 1-year case-control study of sporadic vibrio infections to identify risk factors related to consumption of seafood products in two coastal areas of Louisiana and Texas. Twenty-six persons with sporadic vibrio infections and 77 matched controls were enrolled. Multivariate analysis revealed that crayfish (P < 0.025) and raw oysters (P < 0.009) were independently associated with illness. Species-specific analysis revealed an association between consumption of cooked crayfish and Vibrio parahemolyticus infection (OR 9.24, P < 0.05). No crayfish consumption was reported by persons with V. vulnificus infection. Although crayfish had been suspected as a vehicle for foodborne disease, this is the first time to our knowledge that consumption of cooked crayfish has been demonstrated to be associated with vibrio infection.

Habitat use and life history of the vernal crayfish, Procambarus viaeviridis (Faxon, 1914), a secondary burrowing crayfish in Mississippi, USA

Treesearch

Zanethia C. Barnett; Susan B. Adams; Rebecca L.   Rosamond

2017-01-01

The Lower Mississippi Alluvial Valley (LMAV) is a species-rich region in North America, but its crayfish community has not been extensively sampled. We investigated the annual life cycle, habitat use, and some morphological characteristics of the vernal crayfish, Procambarus viaeviridis (Faxon, 1914), in the Dahomey National Wildlife Refuge,...

Incomes, Attitudes, and Occurrences of Invasive Species: An Application to Signal Crayfish in Sweden

NASA Astrophysics Data System (ADS)

Gren, Ing-Marie; Campos, Monica; Edsman, Lennart; Bohman, Patrik

2009-02-01

This article analyzes and carries out an econometric test of the explanatory power of economic and attitude variables for occurrences of the nonnative signal crayfish in Swedish waters. Signal crayfish are a carrier of plague which threatens the native noble crayfish with extinction. Crayfish are associated with recreational and cultural traditions in Sweden, which may run against environmental preferences for preserving native species. Econometric analysis is carried out using panel data at the municipality level with economic factors and attitudes as explanatory variables, which are derived from a simple dynamic harvesting model. A log-normal model is used for the regression analysis, and the results indicate significant impacts on occurrences of waters with signal crayfish of changes in both economic and attitude variables. Variables reflecting environmental and recreational preferences have unexpected signs, where the former variable has a positive and the latter a negative impact on occurrences of waters with signal crayfish. These effects are, however, counteracted by their respective interaction effect with income.

Invasive crayfish as vectors of mercury in freshwater food webs of the Pacific Northwest

USGS Publications Warehouse

Johnson, Branden L.; Willacker, James J.; Eagles-Smith, Collin A.; Pearl, Christopher A.; Adams, Michael J.

2014-01-01

Invasive species are important drivers of environmental change in aquatic ecosystems and can alter habitat characteristics, community composition, and ecosystem energetics. Such changes have important implications for many ecosystem processes, including the bioaccumulation and biomagnification of contaminants through food webs. Mercury concentrations were measured in 2 nonnative and 1 native crayfish species from western Oregon (USA). Nonnative red swamp crayfish had mercury concentrations similar to those in native signal crayfish (0.29 ± 0.05 µg/g dry wt and 0.36 ± 0.06 µg/g dry wt, respectively), whereas the nonnative ringed crayfish had lower mercury concentrations (0.10 ± 0.02 µg/g dry wt) than either of the other species. The mean energy content of muscle was similar between the native signal crayfish and nonnative ringed crayfish but was significantly higher in the nonnative red swamp crayfish. Across species, mercury concentrations were negatively correlated with energy density. Such energetic differences could exacerbate changes in mercury transfer through trophic pathways of food webs, especially via alterations to the growth dynamics of consumers. Thus, it is important to consider the role of energy content in determining effective mercury exposure even when mercury concentrations on a per-unit mass basis do not differ between species.

Hardy exotics species in temperate zone: can “warm water” crayfish invaders establish regardless of low temperatures?

PubMed Central

Veselý, Lukáš; Buřič, Miloš; Kouba, Antonín

2015-01-01

The spreading of new crayfish species poses a serious risk for freshwater ecosystems; because they are omnivores they influence more than one level in the trophic chain and they represent a significant part of the benthic biomass. Both the environmental change through global warming and the expansion of the pet trade increase the possibilities of their spreading. We investigated the potential of four “warm water” highly invasive crayfish species to overwinter in the temperate zone, so as to predict whether these species pose a risk for European freshwaters. We used 15 specimens of each of the following species: the red swamp crayfish (Procambarus clarkii), the marbled crayfish (Procambarus fallax f. virginalis), the yabby (Cherax destructor), and the redclaw (Cherax quadricarinatus). Specimens were acclimatized and kept for 6.5 months at temperatures simulating the winter temperature regime of European temperate zone lentic ecosystems. We conclude that the red swamp crayfish, marbled crayfish and yabby have the ability to withstand low winter temperatures relevant for lentic habitats in the European temperate zone, making them a serious invasive threat to freshwater ecosystems. PMID:26572317

Enzymatic production of N-acetyl-d-glucosamine from crayfish shell wastes pretreated via high pressure homogenization.

PubMed

Wei, Guoguang; Zhang, Alei; Chen, Kequan; Ouyang, Pingkai

2017-09-01

This study presents an efficient pretreatment of crayfish shell using high pressure homogenization that enables N-acetyl-d-glucosamine (GlcNAc) production by chitinase. Firstly, the chitinase from Serratia proteamaculans NJ303 was screened for its ability to degrade crayfish shell and produce GlcNAc as the sole product. Secondly, high pressure homogenization, which caused the crayfish shell to adopt a fluffy netted structure that was characterized by Scanning electron microscope (SEM), Fourier transform infrared spectrometer (FT-IR), X-ray diffraction (XRD), was evaluated as the best pretreatment method. In addition, the optimal conditions of high pressure homogenization of crayfish shell were determined to be five cycles at a pressure of 400bar, which achieved a yield of 3.9g/L of GlcNAc from 25g/L of crayfish shell in a batch enzymatic reaction over 1.5h. The results showed high pressure homogenization might be an efficient method for direct utilization of crayfish shell for enzymatic production of GlcNAc. Copyright © 2017 Elsevier Ltd. All rights reserved.

Tag retention, growth, and survival of red swamp crayfish marked with a visible implant tag

USGS Publications Warehouse

Isely, J.J.; Stockett, P.E.

2001-01-01

Eighty juvenile (means: 42.4 mm total length, 1.6 g) red swamp crayfish Procambarus clarkii were implanted with sequentially numbered visible implant tags and held in the laboratory. Tags were injected transversely into the musculature just beneath the exoskeleton of the third abdominal segment from the cephalothorax; tags were visible upon inspection. An additional 20 crayfish were left untagged and served as controls. After 150 d, tag retention was 80% and all tags were readable. No tagged crayfish died during the study, and no differences in total length or weight were detected between tagged and control crayfish. All individuals molted at least three times during the 150-d study, and some individuals molted up to six times, suggesting that most tags would be permanently retained. The readability in the field without specialized equipment makes the visible implant tag ideal for studies of crayfish ecology, management, and culture.

A synthetic phylogeny of freshwater crayfish: insights for conservation.

PubMed

Owen, Christopher L; Bracken-Grissom, Heather; Stern, David; Crandall, Keith A

2015-02-19

Phylogenetic systematics is heading for a renaissance where we shift from considering our phylogenetic estimates as a static image in a published paper and taxonomies as a hardcopy checklist to treating both the phylogenetic estimate and dynamic taxonomies as metadata for further analyses. The Open Tree of Life project (opentreeoflife.org) is developing synthesis tools for harnessing the power of phylogenetic inference and robust taxonomy to develop a synthetic tree of life. We capitalize on this approach to estimate a synthesis tree for the freshwater crayfish. The crayfish make an exceptional group to demonstrate the utility of the synthesis approach, as there recently have been a number of phylogenetic studies on the crayfishes along with a robust underlying taxonomic framework. Importantly, the crayfish have also been extensively assessed by an IUCN Red List team and therefore have accurate and up-to-date area and conservation status data available for analysis within a phylogenetic context. Here, we develop a synthesis phylogeny for the world's freshwater crayfish and examine the phylogenetic distribution of threat. We also estimate a molecular phylogeny based on all available GenBank crayfish sequences and use this tree to estimate divergence times and test for divergence rate variation. Finally, we conduct EDGE and HEDGE analyses and identify a number of species of freshwater crayfish of highest priority in conservation efforts. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

A synthetic phylogeny of freshwater crayfish: insights for conservation

PubMed Central

Owen, Christopher L.; Bracken-Grissom, Heather; Stern, David; Crandall, Keith A.

2015-01-01

Phylogenetic systematics is heading for a renaissance where we shift from considering our phylogenetic estimates as a static image in a published paper and taxonomies as a hardcopy checklist to treating both the phylogenetic estimate and dynamic taxonomies as metadata for further analyses. The Open Tree of Life project (opentreeoflife.org) is developing synthesis tools for harnessing the power of phylogenetic inference and robust taxonomy to develop a synthetic tree of life. We capitalize on this approach to estimate a synthesis tree for the freshwater crayfish. The crayfish make an exceptional group to demonstrate the utility of the synthesis approach, as there recently have been a number of phylogenetic studies on the crayfishes along with a robust underlying taxonomic framework. Importantly, the crayfish have also been extensively assessed by an IUCN Red List team and therefore have accurate and up-to-date area and conservation status data available for analysis within a phylogenetic context. Here, we develop a synthesis phylogeny for the world's freshwater crayfish and examine the phylogenetic distribution of threat. We also estimate a molecular phylogeny based on all available GenBank crayfish sequences and use this tree to estimate divergence times and test for divergence rate variation. Finally, we conduct EDGE and HEDGE analyses and identify a number of species of freshwater crayfish of highest priority in conservation efforts. PMID:25561670

Quantification of the nitrogen cycle in a prairie stream

USGS Publications Warehouse

Dodds, Walter K.; Evans-White, Michelle A.; Gerlanc, Nicole M.; Gray, Lawrence; Gudder, Dolly A.; Kemp, Melody J.; Lopez, Amanda L.; Stagliano, David; Strauss, Eric A.; Tank, Jennifer L.; Whiles, Matt R.; Wollheim, Wilfred M.

2000-01-01

Nitrogen (N) was added for 35 days in the form of 15NH4Cl to Kings Creek on Konza Prairie, Kansas. Standing stocks of N in key compartments (that is, nutrients, detritus, organisms) were quantified, and the amount of labeled N entering the compartments was analyzed. These data were used to calculate turnover and flux rates of N cycling through the food web, as well as nutrient transformation rates. Inorganic N pools turned over much more rapidly in the water column of this stream than in pelagic systems where comparable measurements have been made. As with other systems, the mass of ammonium was low but it was the key compartment mediating nutrient flux through the ecosystem, whereas dissolved organic N, the primary component of N flux through the system, is not actively cycled. Nitrification was also a significant flux of N in the stream, with rates in the water column and surface of benthos accounting for approximately 10% of the total ammonium uptake. Primary consumers assimilated 67% of the inorganic N that entered benthic algae and microbes. Predators acquired 23% of the N that consumers obtained. Invertebrate collectors, omnivorous crayfish (Orconectes spp.), and invertebrate shredders dominated the N flux associated with primary consumers. Mass balance calculations indicated that at least 23% of the 309 mg of 15N added during the 35 days of release was retained within the 210-m stream reach during the release. Overall, the rates of turnover of N in organisms and organic substrata were significantly greater when C:N was low. This ratio may be a surrogate for biological activity with regard to N flux in streams.

Crayfish for Research

ERIC Educational Resources Information Center

Poulos, C. Jean

1977-01-01

This article describes how Robert LeBleu's interest in aquatic life developed and that today he owns a large hydroculture operation supplying research crayfish nationwide. Suggested laboratory experiments with crayfish are described, as well as information on additional studies, equipment needs, and tours of the hatchery. (MA)

Stream permanence influences crayfish occupancy and abundance in the Ozark Highlands, USA

USGS Publications Warehouse

Yarra, Allyson N.; Magoulick, Daniel D.

2018-01-01

Crayfish use of intermittent streams is especially important to understand in the face of global climate change. We examined the influence of stream permanence and local habitat on crayfish occupancy and species densities in the Ozark Highlands, USA. We sampled in June and July 2014 and 2015. We used a quantitative kick–seine method to sample crayfish presence and abundance at 20 stream sites with 32 surveys/site in the Upper White River drainage, and we measured associated local environmental variables each year. We modeled site occupancy and detection probabilities with the software PRESENCE, and we used multiple linear regressions to identify relationships between crayfish species densities and environmental variables. Occupancy of all crayfish species was related to stream permanence. Faxonius meeki was found exclusively in intermittent streams, whereas Faxonius neglectus and Faxonius luteushad higher occupancy and detection probability in permanent than in intermittent streams, and Faxonius williamsi was associated with intermittent streams. Estimates of detection probability ranged from 0.56 to 1, which is high relative to values found by other investigators. With the exception of F. williamsi, species densities were largely related to stream permanence rather than local habitat. Species densities did not differ by year, but total crayfish densities were significantly lower in 2015 than 2014. Increased precipitation and discharge in 2015 probably led to the lower crayfish densities observed during this year. Our study demonstrates that crayfish distribution and abundance is strongly influenced by stream permanence. Some species, including those of conservation concern (i.e., F. williamsi, F. meeki), appear dependent on intermittent streams, and conservation efforts should include consideration of intermittent streams as an important component of freshwater biodiversity.

Heavy metals in Tuskegee Lake crayfish

DOE Office of Scientific and Technical Information (OSTI.GOV)

Khan, A.T.

1995-12-31

The crayfish, Onconectes virifis, is a bottom dweller and eats insect larvae, worms, crustaceans, small snails, fishes, and dead animal matter. They can be used to monitor the aquatic environment such as lakes, ponds and creeks. To monitor the environmental contamination of heavy metals (Hg, Pb, Cd, Cu, Co, Ni, and Zn) in Tuskegee Lake, Tuskegee, Alabama, adult crayfish were collected and analyzed for these metals. The Pb, Cd, Cu, Ni, and Zn concentrations were 3.91, 0.22, 8.06, 1.11, and 33.37 ppm in muscle and 28.98, 1.15, 9.86, 2.1 8, and 32.62 ppm in exoskeleton of crayfish, respectively. The concentrationsmore » of Pb and Cd were significantly higher in exoskeleton than those of muscle. However, the concentrations of Cu, Ni, and Zn did not show any significant difference between the muscle and the exoskeleton of the crayfish. The concentrations of Hg and Co were undetected in both the exoskeleton and muscle of the crayfish.« less

Baited lines: An active nondestructive collection method for burrowing crayfish

USGS Publications Warehouse

Loughman, Zachary J.; Foltz, David A.; Welsh, Stuart A.

2013-01-01

A new method (baited lines) is described for the collection of burrowing crayfishes, where fishing hooks baited with earthworms and tied to monofilament leaders are used to lure crayfishes from their burrow entrances. We estimated capture rates using baited lines at four locations across West Virginia for a total of four crayfish taxa; the taxa studied were orange, blue, and blue/orange morphs of Cambarus dubius (Upland Burrowing Catfish), and C. thomai (Little Brown Mudbug). Baited-line capture rates were lowest for C. thomai (81%; n = 21 attempts) and highest for the orange morph ofC. dubius (99%; n = 13 attempts). The pooled capture rate across all taxa was 91.5% (n = 50 attempts). Baited lines represent an environmentally nondestructive method to capture burrowing crayfishes without harm to individuals, and without disturbing burrows or the surrounding area. This novel method allows for repeat captures and long-term studies, providing a useful sampling method for ecological studies of burrowing crayfishes.

Toxic and heavy metals as a cause of crayfish mass mortality from acidified headwater streams.

PubMed

Svobodová, Jitka; Douda, Karel; Fischer, David; Lapšanská, Natalia; Vlach, Pavel

2017-03-01

Mining activities are responsible for high concentrations of metals in river networks in many parts of the world. Mining activities and the resulting high loads of heavy metals interact with intensive acid rain, and often have great consequences for biodiversity. However, considering the frequently episodic nature of these heavy acid rains, there is little detailed evidence of direct impacts. In 2011 we observed a massive mortality of noble crayfish and stone crayfish in Padrťsko Special Area of Conservation (SAC) in the Brdy Mountain region of the Czech Republic. Based on concentrations of metals (Al, Fe, As, Cd, Pb, Cu, Zn and Hg) in various tissues (gills, hepatopancreas, muscle) of both dead and live crayfish in this locality compared to reference populations, these crayfish had experienced long-term exposure to increased levels of these metals. Here we give detailed documentation of crayfish mortality associated with high metal concentrations in the gills and other tissues of these endangered invertebrates.

Reduced aggression and foraging efficiency of invasive signal crayfish (Pacifastacus leniusculus) infested with non-native branchiobdellidans (Annelida: Clitellata).

PubMed

James, J; Davidson, K E; Richardson, G; Grimstead, C; Cable, J

2015-11-17

Biological invasions are a principal threat to global biodiversity and identifying the determinants of non-native species' success is a conservation priority. Through their ability to regulate host populations, parasites are increasingly considered as important in determining the outcome of species' invasions. Here, we present novel evidence that the common crayfish ecto-symbiont, Xironogiton victoriensis (Annelida: Clitellata) can affect the behaviour of a widespread and ecologically important invader, the signal crayfish (Pacifastacus leniusculus). To assess the signal crayfish-X. victoriensis relationship naïve crayfish were infested with an intensity of worms typically observed under natural conditions. Over a 10-week period the growth rate and survivorship of these animals was monitored and compared to those of uninfested counterparts. Complementary dyadic competition and foraging experiments were run to assess the behaviour of infested compared to uninfested animals. These data were analysed using General Linear Models and Generalized Linear Mixed Models. Whilst X. victoriensis did not affect the growth rate or survivorship of signal crayfish under laboratory conditions, infested animals were significantly less aggressive and poorer foragers than uninfested individuals. Through reducing aggression and foraging efficiency, infestation with X. victoriensis may disrupt the social structure, and potentially growth rate and/or dispersal of afflicted crayfish populations, with potential effects on their invasion dynamics. This is important given the widespread invasive range of crayfish and their functional roles as ecosystem engineers and keystone species.

SEASONAL FORAGING BY CHANNEL CATFISH ON TERRESTRIALLY BURROWING CRAYFISH IN A FLOODPLAIN-RIVER ECOSYSTEM

EPA Science Inventory

The seasonal use of terrestrially burrowing crayfish as a food item by channel catfish Ictalurus punctatus was studied in channelized and non-channelized sections of the Yockanookany River (Mississippi, USA). During seasonal inundation of the floodplains, the crayfish occupied o...

Influence of instream habitat and water quality on aggressive behavior in crayfish of channelized headwater streams

USDA-ARS?s Scientific Manuscript database

Many agricultural drainage ditches that border farm fields of the Midwestern United States are degraded headwater streams that possess communities of crayfish. We hypothesized that crayfish communities at sites with low instream habitat diversity and poor water quality would show greater evidence of...

Crazy about Crayfish

ERIC Educational Resources Information Center

Endreny, Anna

2006-01-01

Crayfish, also known as "crawfish" or "crawdads," are easy to keep in the classroom, and with patience and luck, students will observe the complete life cycle of the crayfish. They will also learn about aquatic animals and habitats and get to conduct inquiry experiments about animal behavior. This article describes how a third-grade teacher used…

Effects of small impoundments on downstream crayfish assemblages

Treesearch

Susan B. Adams

2013-01-01

Dams and impoundments, both large and small, affect downstream physicochemical characteristics and up- and downstream biotic communities. I tested whether small dams and their impoundments altered downstream crayfish assemblages in northern Mississippi. I sampled crayfish and measured physicochemical variables at 4 sites downstream of impoundments (outlet sites) and 4...

‘Leaves and Eats Shoots’: Direct Terrestrial Feeding Can Supplement Invasive Red Swamp Crayfish in Times of Need

PubMed Central

Grey, Jonathan; Jackson, Michelle C.

2012-01-01

We used stable isotope analyses to characterise the feeding dynamics of a population of red swamp crayfish in Lake Naivasha, Kenya, after the crash of submerged macrophytes and associated macroinvertebrates, and during a natural draw-down of the lake water level. We expected a heavy reliance upon a diet of detrital matter to sustain the population as a consequence, and indeed, for the majority of the crayfish population caught from the lake, we saw a concomitant shift in isotopic values reflecting a dietary change. However, we also caught individual crayfish that had occupied the footprints of hippopotamus and effectively extended their range beyond the lake up to 40 m into the riparian zone. Isotopic analysis confirmed limited nocturnal observations that these individuals were consuming living terrestrial plants in the vicinity of the footprints. These are the first empirical data to demonstrate direct use of terrestrial resources by an aquatic crayfish species and further highlight the traits that make red swamp crayfish such opportunistic and successful invaders. PMID:22880039

Rediscovery and uncertain future of high-elevation Haleakala carabid beetles (Coleoptera)

USGS Publications Warehouse

Krushelnycky, Paul D.; Gillespie, Rosemary G.; Loope, Lloyd L.; Liebherr, James K.

2005-01-01

Recent biotic surveys in subalpine shrubland on Haleakala¯ Volcano, Maui, Hawai‘i, have resulted in rediscovery of several species of carabid beetles previously known only from their nineteenth-century type specimens. Blackburnia lenta (Sharp), described from specimens collected just below Haleakala¯ summit in 1894, was found at lower elevational sites ranging from 2,400 to 2,750 m. Mecyclothorax rusticus Sharp, last seen in 1896, and M. nubicola (Blackburn), collected only in 1878, were also rediscovered in that vicinity. Recent collections of B. lenta contradict the U.S. Fish and Wildlife Service’s previous classification of this species as one likely to be extinct. Nevertheless, B. lenta’s known distribution comprises only 145 ha within an elevational zone that is bounded above and below by unicolonial populations of the invasive alien Argentine ant, Linepithema humile (Mayr). The known recent collections of M. rusticus and M. nubicola also occurred outside the distributional range of the Argentine ant. Mature eggs held in the lateral oviducts of B. lenta females averaged 1.4 the volume of the largest eggs previously reported among 13 species of Blackburnia. We hypothesize that the giant eggs of B. lenta result from selective forces favoring large, well-nourished developing and hatched first-instar larvae, consistent with a patchy distribution of suitable microhabitat and prey in the subalpine Haleakala¯ landscape. The specialized life history of B. lenta, and coincidence of distributional limits of the three rediscovered carabid species with range limits of the Argentine ant populations suggest that all would be jeopardized by future distributional expansion of Argentine ant. These intersecting phenomena compel us to conclude that B. lenta, M. nubicola, and M. rusticus are appropriate candidates for I.U.C.N. threatened species designation, pending further studies of their geographic ranges and historical trends in abundance.

Direct and indirect effects of channel catfish (Ictalurus punctatus) on native crayfishes (Cambaridae) in experimental tanks

Treesearch

Susan B. Adams

2006-01-01

For The incised, sand-bed streams of northcentral Mississippi, USA, fish predation is one plausible mechanism to explain both relatively low crayfish densities and differences in stream size occupied by various native crayfishes. I conducted two mesocosm experiments to test effects of a fish predator (channel catfish, Ictalurus punctahls) on the...

Resistance to the crayfish plague, Aphanomyces astaci (Oomycota) in the endangered freshwater crayfish species, Austropotamobius pallipes.

PubMed

Martín-Torrijos, Laura; Campos Llach, Miquel; Pou-Rovira, Quim; Diéguez-Uribeondo, Javier

2017-01-01

The pathogen Aphanomyces astaci Schikora 1906 is responsible for the decline of the native crayfish species of Europe, and their current endangered status. This pathogenic species is native to North America and only colonizes aquatic decapods. The North American crayfish species have a high resistance to this pathogen, while species from other regions are highly susceptible. However, recent field and laboratory observations indicate that there might exist some populations with resistance against this disease. The objective of this study was to test the susceptibility of 8 selected native European crayfish populations of Austropotamobius pallipes Lereboullet 1858 from the Pyrenees. We challenged them against the genome sequenced strain AP03 of A. astaci isolated from a North American red swamp crayfish, Procambarus clarkii Girard 1852, in the Garrotxa Natural Park, Girona. The results showed that there are significant differences (P<0,001) among populations, although most of them show high mortality rates after the zoospore challenge with A. astaci. However, one population from Girona exhibited a 100% survival during a four-month monitoring period under the experimental conditions tested. Histological analyses revealed a high immune reaction in tissues examined, i.e., encapsulation and melanization of hyphae, similar to that found in North American resistant crayfish species. These results represent the first observation of a native European crayfish population showing high resistance towards the most virulent genotype of this pathogen, i.e., genotype Pc. The identification of this population is of key importance for the management of these endangered species, and represents a crucial step forward towards the elucidation of the factors involved in the immune reaction against this devastating pathogen.

Nutritional treatment of cancer cachexia in rats. Use of a diet formulated with a crayfish enzymatic extract.

PubMed

Cremades, Olga; Parrado, Juan; Jover, María; Collantes de Terán, Laura; Gutiérrez, Juan Francisco; Bautista Palomas, Juan D

2007-09-01

Terminal cancer-associated cachexia, characterized by a marked weight loss, anorexia, asthenia and anemia, is usually associated with a malnutrition status. To investigate whether a diet formulated with a crayfish enzymatic extract, enriched in essential amino acids, omega-3 fatty acids, and astaxanthin, would be effective for the treatment of cancer-associated cachexias, by decreasing mortality and morbidity rates in cachectic rats and/or improving survival. Two types of diet were used: a standard diet and one formulated with crayfish enzymatic extract. Rats were divided into two groups (24 animals per group): one without tumor (T-) and the other with tumor (T+) (AH-130 Yoshida ascites hepatoma). Each group was further divided into two subgroups (12 animals per subgroup). Two subgroups (T-(standard) and T+(standard)) were fed the standard diet and the other two (T-(CFEE) and T+(CFEE)) the crayfish enzymatic extract one for four weeks, after which different tissue and plasma parameters were studied. The implantation of the tumor resulted in a considerable loss of muscle and adipose tissue mass in both groups, but the loss of muscle and fat was lower in the group fed the crayfish enzymatic extract diet. There was also a concomitant increase in the plasma concentration of TNF-alpha, although the increase was smaller in the crayfish enzymatic extract-treated group. This study shows that although the treatment of cachetic rats with the crayfish enzymatic extract diet did not revert the cachexia, it increased survival (57.1% vs. 25.9% in the group treated with crayfish enzymatic extract and standard diets, respectively) and meliorated the cachexia symptoms--anorexia and body mass loss (muscle and adipose tissue).

Consumptive effects of fish reduce wetland crayfish recruitment and drive species turnover.

PubMed

Kellogg, Christopher M; Dorn, Nathan J

2012-04-01

Predators and dry-disturbances have pronounced effects on invertebrate communities and can deterministically affect compositional turnover between discrete aquatic habitats. We examined the effect of sunfish (Lepomis spp.) predators on two native crayfish, Procambarus alleni and P. fallax, that regionally coexist in an expansive connected wetland in order to test the hypotheses that sunfish predation limits crayfish recruitment (both species) and that it disproportionately affects P. alleni, the species inhabiting temporary wetlands. In replicate vegetated wetlands (18.6 m(2)), we quantified summertime crayfish recruitment and species composition across an experimental gradient of sunfish density. Separately, we quantified effects of sunfish on crayfish growth, conducted a complimentary predation assay in mesocosms, and compared behavior of the two crayfish. Sunfish reduced P. alleni summertime recruitment by >99% over the full sunfish gradient, and most of the effect was caused by low densities of sunfish (0.22-0.43 m(-2)). P. alleni dominated wetlands with few or no sunfish, but the composition shifted towards P. fallax dominance in wetlands with abundant sunfish. P. fallax survived better than P. alleni over 40 h in smaller mesocosms stocked with warmouth. Sunfish reduced P. fallax recruitment 62% in a second wetland experiment, but growth rates of caged crayfish (both species) were unaffected by sunfish presence, suggesting predatory effects were primarily consumptive. Consistent with life histories of relatively fish-sensitive invertebrates, P. alleni engaged in more risky behaviors in the laboratory. Our results indicate that sunfish predators limit recruitment of both species, but disproportionately remove the more active and competitively dominant P. alleni. Spatially and temporally variable dry-disturbances negatively co-varying with sunfish populations allow for regional coexistence of these two crayfish and may release populations of either species from control by predatory fishes.

Resistance to the crayfish plague, Aphanomyces astaci (Oomycota) in the endangered freshwater crayfish species, Austropotamobius pallipes

PubMed Central

Martín-Torrijos, Laura; Campos Llach, Miquel; Pou-Rovira, Quim

2017-01-01

The pathogen Aphanomyces astaci Schikora 1906 is responsible for the decline of the native crayfish species of Europe, and their current endangered status. This pathogenic species is native to North America and only colonizes aquatic decapods. The North American crayfish species have a high resistance to this pathogen, while species from other regions are highly susceptible. However, recent field and laboratory observations indicate that there might exist some populations with resistance against this disease. The objective of this study was to test the susceptibility of 8 selected native European crayfish populations of Austropotamobius pallipes Lereboullet 1858 from the Pyrenees. We challenged them against the genome sequenced strain AP03 of A. astaci isolated from a North American red swamp crayfish, Procambarus clarkii Girard 1852, in the Garrotxa Natural Park, Girona. The results showed that there are significant differences (P<0,001) among populations, although most of them show high mortality rates after the zoospore challenge with A. astaci. However, one population from Girona exhibited a 100% survival during a four-month monitoring period under the experimental conditions tested. Histological analyses revealed a high immune reaction in tissues examined, i.e., encapsulation and melanization of hyphae, similar to that found in North American resistant crayfish species. These results represent the first observation of a native European crayfish population showing high resistance towards the most virulent genotype of this pathogen, i.e., genotype Pc. The identification of this population is of key importance for the management of these endangered species, and represents a crucial step forward towards the elucidation of the factors involved in the immune reaction against this devastating pathogen. PMID:28750039

Trophic Tangles through Time? Opposing Direct and Indirect Effects of an Invasive Omnivore on Stream Ecosystem Processes

PubMed Central

Moore, Jonathan W.; Carlson, Stephanie M.; Twardochleb, Laura A.; Hwan, Jason L.; Fox, Justin M.; Hayes, Sean A.

2012-01-01

Omnivores can impact ecosystems via opposing direct or indirect effects. For example, omnivores that feed on herbivores and plants could either increase plant biomass due to the removal of herbivores or decrease plant biomass due to direct consumption. Thus, empirical quantification of the relative importance of direct and indirect impacts of omnivores is needed, especially the impacts of invasive omnivores. Here we investigated how an invasive omnivore (signal crayfish, Pacifastacus leniusculus) impacts stream ecosystems. First, we performed a large-scale experiment to examine the short-term (three month) direct and indirect impacts of crayfish on a stream food web. Second, we performed a comparative study of un-invaded areas and areas invaded 90 years ago to examine whether patterns from the experiment scaled up to longer time frames. In the experiment, crayfish increased leaf litter breakdown rate, decreased the abundance and biomass of other benthic invertebrates, and increased algal production. Thus, crayfish controlled detritus via direct consumption and likely drove a trophic cascade through predation on grazers. Consistent with the experiment, the comparative study also found that benthic invertebrate biomass decreased with crayfish. However, contrary to the experiment, crayfish presence was not significantly associated with higher leaf litter breakdown in the comparative study. We posit that during invasion, generalist crayfish replace the more specialized native detritivores (caddisflies), thereby leading to little long-term change in net detrital breakdown. A feeding experiment revealed that these native detritivores and the crayfish were both effective consumers of detritus. Thus, the impacts of omnivores represent a temporally-shifting interplay between direct and indirect effects that can control basal resources. PMID:23209810

Influence of elevated temperature and acid mine drainage on mortality of the crayfish Cambarus bartonii

USGS Publications Warehouse

Hartman, K.J.; Hom, C.D.; Mazik, P.M.

2010-01-01

Effects of elevated temperature and acid mine drainage (AMD) on crayfish mortality were investigated in the Stony River, Grant County, West Virginia. During summers 2003 and 2004, four-week in situ bioassays were performed along a thermal and AMD gradient with the native crayfish Cambarus bartonii. Crayfish mortality was analyzed in conjunction with temperature and AMD related variables (pH, specific conductivity). Mortality was significantly higher (48-88%) at sites with high temperatures during 2003 (max = 33.0??C), but no significant differences were observed in 2004 (max = 32.0??C). Temperatures were higher in 2003 than 2004 due to increased discharge from a cooling reservoir flowing into the river. Additionally, duration of high temperature was approximately four days in 2003 as compared with only one day in 2004. No significant relationship between acid mine drainage variables and crayfish mortality was apparent.

Range extensions of three crayfishes (Faxonius yanahlindus, F. placidus, and F. erichsonianus) into Mississippi

Treesearch

Susan B. Adams; Robert L. Jones

2018-01-01

We report 3 new state crayfish records from the Tennessee River drainage in Tishomingo County, Mississippi: 1 is a re-identification of previously published material, and 2 are from unpublished collections. Faxonius yanahlindus (Spinywrist Crayfish), recently described from the middle Tennessee River drainage in northwest Alabama and southern...

Purification and cDNA cloning of ferritin from the hepatopancreas of the freshwater crayfish Pacifastacus leniusculus.

PubMed

Huang, T S; Law, J H; Söderhäll, K

1996-03-01

Ferritin was purified from the hepatopancreas of the freshwater crayfish Pacifastacus leniusculus after injection of iron. It has the same size as horse spleen ferritin (440 kDa) and migrates as two bands, 19 kDa and 20 kDa, respectively, in SDS/PAGE under reducing conditions. Crayfish ferritin (20 kDa) was cloned from a hepatopancreas cDNA library. The deduced amino acid sequence of the crayfish ferritin shows a closer relationship to vertebrate ferritin heavy chains than to insect ferritin and contains the conserved H-specific residues for the ferroxidase centre found in vertebrate ferritin heavy chain. An IRE(iron-responsive element)-like sequence with a predicted stem-loop structure was present in the 5' untranslated region of the crayfish ferritin mRNA. Crayfish ferritin does not share the atypical properties of insect ferritins, such as high molecular mass of intact protein, abundance in hemolymph, and export into vacuoles. We suggest that there are two different types of ferritins distributed in different species: insect-type or secretory ferritins which are predominant in the snail oocyte and insects, and vertebrate (crustacean)-type or cytosolic ferritins which are predominant in vertebrates and crustacea.

Habituation of LG-mediated tailflip in the crayfish.

PubMed

Nagayama, Toshiki; Araki, Makoto

2015-06-01

Crayfish escape from threatening stimuli by tailflipping. If a stimulus is applied to the rear, crayfish escape up and forwards in a summersault maneuver that is mediated by the activation of lateral giant (LG) interneurons. The occurrence probability of LG-mediated tailflip, however, diminishes and habituates if a stimulus is repeatedly applied. Since crayfish have a relatively simple CNS with many identifiable neurons, crayfish represent a good animal to analyze the cellular basis of habituation. A reduction in the amplitude of the EPSP in the LGs, caused by direct chemical synaptic connection from sensory afferents by repetitive stimulations, is essential to bring about an inactivation of the LGs. The spike response of the LGs recovers within several minutes of habituation, but the LGs subsequently fail to spike when an additional stimulus is applied after specific periods following habituation. These results indicate that a decline in synaptic efficacy from the mechanosensory afferents recovers readily after a short delay, but then the excitability of the LGs themselves decreases. Furthermore, the processes underlying habituation are modulated depending on a social status. When two crayfish encounter each other, a winner-loser relationship is established. With a short interstimulus interval of 5 s, the rate of habituation of the LG in both socially dominant and subordinate crayfish becomes lower than in socially isolated animals. Serotonin and octopamine affect this social status-dependent modulation of habituation by means of activation of downstream second messenger system of cAMP and IP3 cascades, respectively.

New crayfish species records from the Sipsey Fork drainage, including Lewis Smith Reservoir (Alabama, USA): Native or introduced species?

Treesearch

Susan B. Adams; Craig Roghair; Colin Krause; Mel Warren; J. Allison Cochran; Andy Dolloff; John Moran; Stuart W. McGregor; Guenter A. Schuester; Michael Gangloff; Dennis R. DeVries; Michael R. Kendrick; G. Lee Grove; Russell A. Wright

2015-01-01

As part of a study of aquatic faunal community changes along riverine-lacustrine transition zones upstream of Lewis Smith Reservoir in northwest Alabama, USA, we collected crayfish from 60 sites in the Sipsey Fork, Brushy Creek, and selected tributaries (Black Warrior River system). After finding two unexpected and possibly-introduced crayfish species, we expanded our...

Histological changes and antioxidant enzyme activity in signal crayfish (Pacifastacus leniusculus) associated with sub-acute peracetic acid exposure.

PubMed

Chupani, Latifeh; Zuskova, Eliska; Stara, Alzbeta; Velisek, Josef; Kouba, Antonin

2016-01-01

Peracetic acid (PAA) is a powerful disinfectant recently adopted as a therapeutic agent in aquaculture. A concentration of 10 mg L(-1) PAA effectively suppresses zoospores of Aphanomyces astaci, the agent of crayfish plague. To aid in establishing safe therapeutic guideline, the effects of PAA on treated crayfish were investigated through assessment of histological changes and oxidative damage. Adult female signal crayfish Pacifastacus leniusculus (n = 135) were exposed to 2 mg L(-1) and 10 mg L(-1) of PAA for 7 days followed by a 7 day recovery period in clean water. Superoxide dismutase activity was significantly lower in gill and hepatopancreas after three days exposure to 10 mg L(1) PAA than in the group treated with 2 mg L(-1) PAA and a control in only clean water. Catalase activity in gill and hepatopancreas remained unaffected by both exposures. Glutathione reductase was significantly decreased in gill of 10 mg L(-1) PAA treated crayfish and increased in group exposed to 2 mg L(-1) compared to control after 7 days exposure. Antioxidant enzyme activity in exposed groups returned to control values after recovery period. Gill, hepatopancreas, and antennal gland showed slight damage in crayfish treated with 2 mg L(-1) of PAA compared to the control group. The extent and frequency of histological alterations were more pronounced in animals exposed to 10 mg L(-1). The gill was the most affected organ, infiltrated by granular hemocytes and displaying malformations of lamella tips and disorganization of epithelial cells. After a 7 day recovery period, the infiltrating cells in affected tissues of the exposed crayfish began to return to normal levels. Results suggested that the given concentrations could be applied to signal crayfish against crayfish plague agent in aquaculture; however, further studies are required for safe use. Copyright © 2015 Elsevier Ltd. All rights reserved.

Can crayfish take the heat? Procambarus clarkii show nociceptive behaviour to high temperature stimuli, but not low temperature or chemical stimuli

PubMed Central

Puri, Sakshi; Faulkes, Zen

2015-01-01

Nociceptors are sensory neurons that are tuned to tissue damage. In many species, nociceptors are often stimulated by noxious extreme temperatures and by chemical agonists that do not damage tissue (e.g., capsaicin and isothiocyanate). We test whether crustaceans have nociceptors by examining nociceptive behaviours and neurophysiological responses to extreme temperatures and potentially nocigenic chemicals. Crayfish (Procambarus clarkii) respond quickly and strongly to high temperatures, and neurons in the antenna show increased responses to transient high temperature stimuli. Crayfish showed no difference in behavioural response to low temperature stimuli. Crayfish also showed no significant changes in behaviour when stimulated with capsaicin or isothiocyanate compared to controls, and neurons in the antenna did not change their firing rate following application of capsaicin or isothiocyanate. Noxious high temperatures appear to be a potentially ecologically relevant noxious stimulus for crayfish that can be detected by sensory neurons, which may be specialized nociceptors. PMID:25819841

BAX inhibitor-1 silencing suppresses white spot syndrome virus replication in red swamp crayfish, Procambarus clarkii.

PubMed

Du, Zhi-Qiang; Lan, Jiang-Feng; Weng, Yu-Ding; Zhao, Xiao-Fan; Wang, Jin-Xing

2013-07-01

BAX inhibitor-1 (BI-1) was originally described as an anti-apoptotic protein in both animal and plant cells. BI-1 overexpression suppresses ER stress-induced apoptosis in animal cells. Inhibition of BI-1 activity could induce the cell death in mammals and plants. However, the function of BI-1 in crustacean immunity was unclear. In this paper, the full-length cDNA of a BI-1 protein in red swamp crayfish, Procambarus clarkii (PcBI-1) was cloned and its expression profiles in normal and infected crayfish were analyzed. The results showed that PcBI-1 was expressed in hemocytes, heart, hepatopancreas, gills, stomach, and intestines of the crayfish and was upregulated after challenged with Vibrio anguillarum and with white spot syndrome virus (WSSV). To determine the function of PcBI-1 in the innate immunity of the crayfish, the RNA interference against PcBI-1 was performed and the results indicated the hemocyte programmed cell death rate was increased significantly and WSSV replication was declined after PcBI-1 knocked down. Altogether, PcBI-1 plays an anti-apoptotic role, wherein high PcBI-1 expression suppresses programmed cell death, which is beneficial for WSSW replication in crayfish. Copyright © 2013 Elsevier Ltd. All rights reserved.

Predatory functional response and prey choice identify predation differences between native/invasive and parasitised/unparasitised crayfish.

PubMed

Haddaway, Neal R; Wilcox, Ruth H; Heptonstall, Rachael E A; Griffiths, Hannah M; Mortimer, Robert J G; Christmas, Martin; Dunn, Alison M

2012-01-01

Invasive predators may change the structure of invaded communities through predation and competition with native species. In Europe, the invasive signal crayfish Pacifastacus leniusculus is excluding the native white clawed crayfish Austropotamobius pallipes. This study compared the predatory functional responses and prey choice of native and invasive crayfish and measured impacts of parasitism on the predatory strength of the native species. Invasive crayfish showed a higher (>10%) prey (Gammarus pulex) intake rate than (size matched) natives, reflecting a shorter (16%) prey handling time. The native crayfish also showed greater selection for crustacean prey over molluscs and bloodworm, whereas the invasive species was a more generalist predator. A. pallipes parasitised by the microsporidian parasite Thelohania contejeani showed a 30% reduction in prey intake. We suggest that this results from parasite-induced muscle damage, and this is supported by a reduced (38%) attack rate and increased (30%) prey handling time. Our results indicate that the per capita (i.e., functional response) difference between the species may contribute to success of the invader and extinction of the native species, as well as decreased biodiversity and biomass in invaded rivers. In addition, the reduced predatory strength of parasitized natives may impair their competitive abilities, facilitating exclusion by the invader.

Accumulation of Heavy Metals in Crayfish and Fish from Selected Czech Reservoirs

PubMed Central

Kuklina, Iryna; Kouba, Antonín; Buřič, Miloš; Horká, Ivona; Ďuriš, Zdeněk; Kozák, Pavel

2014-01-01

To evaluate the accumulation of aluminium, cadmium, chromium, copper, lead, mercury, nickel, and zinc in crayfish and fish organ tissues, specimens from three drinking water reservoirs (Boskovice, Landštejn, and Nová Říše) and one contaminated site (Darkovské moře) in the Czech Republic were examined. Crayfish hepatopancreas was confirmed to be the primary accumulating site for the majority of metals (Cu > Zn > Ni > Cd > Cr), while Hg and Cr were concentrated in abdominal muscle, and Al and Pb were concentrated in gill. Metals found in Nová Říše specimens included Cu > Zn > Ni and those found in Boskovice included Zn > Hg > Cr. Cd concentrations were observed only in Landštejn specimens, while contaminated Darkovské moře specimens showed the highest levels of accumulation (Cu > Al > Zn > Pb). The majority of evaluated metals were found in higher concentrations in crayfish: Cu > Al > Zn > Ni > Cr > Cd > Pb, with Hg being the only metal accumulating higher in fish. Due to accumulation similarities of Al in crayfish and fish gill, differences of Hg in muscle, and features noted for the remaining metals in examined tissues, biomonitoring should incorporate both crayfish and fish to produce more relevant water quality surveys. PMID:24738051

Effects of Different Social and Environmental Conditions on Established Dominance Relationships in Crayfish.

PubMed

Herberholz, Jens; Swierzbinski, Matthew E; Birke, Juliane M

2016-04-01

Like most social animals, crayfish readily form dominance relationships and linear social hierarchies when competing for limited resources. Competition often entails dyadic aggressive interactions, from which one animal emerges as the dominant and one as the subordinate. Once dominance relationships are formed, they typically remain stable for extended periods of time; thus, access to future resources is divided unequally among conspecifics. We previously showed that firmly established dominance relationships in juvenile crayfish can be disrupted by briefly adding a larger conspecific to the original pair. This finding suggested that the stability of social relationships in crayfish was highly context-dependent and more transient than previously assumed. We now report results that further identify the mechanisms underlying the destabilization of crayfish dominance relationships. We found that rank orders remained stable when conspecifics of smaller or equal size were added to the original pair, suggesting that both dominant and subordinate must be defeated by a larger crayfish in order to destabilize dominance relationships. We also found that dominance relationships remained stable when both members of the original pair were defeated by larger conspecifics in the absence of their original opponent. This showed that dominance relationships are not destabilized unless both animals experience defeat together. Lastly, we found that dominance relationships of pairs were successfully disrupted by larger intruders, although with reduced magnitude, after all chemical cues associated with earlier agonistic experiences were eliminated. These findings provide important new insights into the contextual features that regulate the stability of social dominance relationships in crayfish and probably in other species as well. © 2016 Marine Biological Laboratory.

Crayfishes (Decapoda : Cambaridae) of Oklahoma: identification, distributions, and natural history.

PubMed

Morehouse, Reid L; Tobler, Michael

2013-01-01

We furnish an updated crayfish species list for the state of Oklahoma (United States of America), including an updated and illustrated dichotomous key. In addition, we include species accounts that summarize general characteristics, life coloration, similar species, distribution and habitat, life history, and syntopic species. Current and potential distributions were analyzed using ecological niche models to provide a critical resource for the identification of areas with conservation priorities and potential susceptibility to invasive species. Currently, Oklahoma harbors 30 species of crayfish, two of which were recently discovered. Eastern Oklahoma has the highest species diversity, as this area represents the western distribution extent for several species. The work herein provides baseline data for future work on crayfish biology and conservation in Oklahoma and surrounding states.

Application of morphologic burrow interpretations to discern continental burrow architects: Lungfish or crayfish?

USGS Publications Warehouse

Hasiotis, Stephen T.; Mitchell, Charles E.; Dubiel, Russell R.

1993-01-01

A methodology for trace fossil identification using burrowing signatures is tested by evaluating ancient and modern lungfish and crayfish burrows and comparing them to previously undescribed burrows in a stratigraphic interval thought to contain both lungfish and crayfish burrows. Permian burrows that bear skeletal remains of the lungfish Gnathorhiza, from museum collections, were evaluated to identify unique burrow morphologies that could be used to distinguish lungfish from crayfish burrows when fossil remains are absent. The lungfish burrows were evaluated for details of the burrowing mechanism preserved in the burrow morphologies together forming burrowing signatures and were compared to new burrows in the Chinle Formation of western Colorado to test the methodology of using burrow signatures to identify unknown burrows.Permian lungfish aestivation burrows show simple, nearly vertical, unbranched architectures and relatively smooth surficial morphologies with characteristic quasi‐horizontal striae on the burrow walls and vertical striae on the bulbous terminus. Burrow lengths do not exceed 0.5 m. In contrast, modern and ancient crayfish burrows exhibit simple to highly complex architectures with highly textured surficial morphologies. Burrow lengths may reach 4 to 5 m.Burrow morphologies unlike those identified in Gnathorhiza aestivation burrows were found in four burrow groups from museum collections. Two of these groups exhibit simple architectures and horizontal striae that were greater in sinuosity and magnitude, respectively. One of these burrows contains the remains of Lysoro‐phus, but the burrow surface reveals no reliable surficial characteristics. It is not clear whether Lysorophustruly burrowed or merely occupied a pre‐existing structure. The other two groups exhibit surficial morphologies similar to those found on modern and ancient crayfish burrows and may provide evidence of freshwater crayfish in the Permian.Burrows from the Upper Triassic Chinle Formation in western Colorado exhibit simple to moderately complex architectural morphologies, ranging from predominantly vertical, unbranched, with little or no chamber development to predominantly vertical, few branches, and with minor chamber development. Surficial burrow morphologies are moderate to highly textured. The burrows have scrape marks, scratch marks, mud and lag‐liners, knobby surfaces, pleopod striae, and body impressions.Although no fossil remains of the burrowing organism were found within or associated with the Chinle burrows from western Colorado, the similarity of architectural and surficial burrow morphologies to those in the Chinle of Canyonlands, Utah and to modern crayfish burrows, clearly indicates that the Colorado burrows are the product of burrowing crayfish rather than lungfish. Evaluation of burrowing signatures preserved in the architectural and surficial burrow morphologies is a very useful tool to compare and contrast Chinle burrows from different regions on the Colorado Plateau. Documentation of crayfish burrows in the Chinle of Utah and Colorado strongly suggests that other large‐diameter Chinle burrows elsewhere on the Colorado Plateau and in stratigraphically equivalent units may also be the product of crayfish activity.

Fluoride bioaccumulation and toxic effects on the survival and behavior of the endangered white-clawed crayfish Austropotamobius pallipes (Lereboullet).

PubMed

Aguirre-Sierra, Arantxa; Alonso, Alvaro; Camargo, Julio A

2013-08-01

Laboratory experiments were performed to examine the toxic effects of fluoride (F(-)) on the survival and behavior of white-clawed crayfish (Austropotamobius pallipes). Body fluoride contents (bioaccumulation) of test crayfish were also examined. No significant differences between male and female crayfish regarding mortality, escape (tail-flip) response, and fluoride bioaccumulation were detected. For mortality, 48-, 72-, 96-, 120-, 144-, 168-, and 192-h median lethal concentrations (LC50) were estimated to be 93.0, 55.3, 42.7, 36.5, 32.9, 30.6, and 28.9 mg F(-)/l, respectively. For the escape response, 48-, 72-, 96-, 120-, 144-, 168- and 192-h median effective concentrations (EC50) were estimated to be 18.4, 11.1, 8.6, 7.4, 6.7, 6.2 and 5.9 mg F(-)/l, respectively. Average food consumption in test crayfish tended to decrease with increasing water fluoride concentration with a 192-h lowest-observed effect concentration of 10.7 mg F(-)/l. These results indicate that the escape response was the most sensitive end point to fluoride toxicity followed by food consumption and mortality. Fluoride bioaccumulation in test crayfish increased with increasing water fluoride concentration and exposure time. The exoskeleton accumulated more fluoride than muscle. A comparison of the obtained results with previous data for other freshwater invertebrates shows that white-clawed crayfish are relatively tolerant to fluoride toxicity. We conclude that fluoride pollution in freshwater ecosystems should not be viewed as an important risk factor contributing to the catastrophic decrease of A. pallipes in many European countries. Our results indicate that fluoride bioaccumulation in A. pallipes might be used as a bioindicator of fluoride pollution in freshwater ecosystems where it is present.

Differences in aggression, activity and boldness between native and introduced populations of an invasive crayfish

USGS Publications Warehouse

Pintor, L.M.; Sih, A.; Bauer, M.L.

2008-01-01

Aggressiveness, along with foraging voracity and boldness, are key behavioral mechanisms underlying the competitive displacement and invasion success of exotic species. However, do aggressiveness, voracity and boldness of the invader depend on the presence of an ecologically similar native competitor in the invaded community? We conducted four behavioral assays to compare aggression, foraging voracity, threat response and boldness to forage under predation risk of multiple populations of exotic signal crayfish Pacifastacus leniusculus across its native and invaded range with and without a native congener, the Shasta crayfish P. fortis. We predicted that signal crayfish from the invaded range and sympatric with a native congener (IRS) should be more aggressive to outcompete a close competitor than populations from the native range (NR) or invaded range and allopatric to a native congener (IRA). Furthermore, we predicted that IRS populations of signal crayfish should be more voracious, but less bold to forage under predation risk since native predators and prey likely possess appropriate behavioral responses to the invader. Contrary to our predictions, results indicated that IRA signal crayfish were more aggressive towards conspecifics and more voracious and active foragers, yet also bolder to forage under predation risk in comparison to NR and IRS populations, which did not differ in behavior. Higher aggression/voracity/ boldness was positively correlated with prey consumption rates, and hence potential impacts on prey. We suggest that the positive correlations between aggression/voracity/boldness are the result of an overall aggression syndrome. Results of stream surveys indicated that IRA streams have significantly lower prey biomass than in IRS streams, which may drive invading signal crayfish to be more aggressive/voracious/bold to acquire resources to establish a population. ?? 2008 The Authors.

Can heat waves change the trophic role of the world's most invasive crayfish? Diet shifts in Procambarus clarkii.

PubMed

Carreira, Bruno M; Segurado, Pedro; Laurila, Anssi; Rebelo, Rui

2017-01-01

In the Mediterranean basin, the globally increasing temperatures are expected to be accompanied by longer heat waves. Commonly assumed to benefit cold-limited invasive alien species, these climatic changes may also change their feeding preferences, especially in the case of omnivorous ectotherms. We investigated heat wave effects on diet choice, growth and energy reserves in the invasive red swamp crayfish, Procambarus clarkii. In laboratory experiments, we fed juvenile and adult crayfish on animal, plant or mixed diets and exposed them to a short or a long heat wave. We then measured crayfish survival, growth, body reserves and Fulton's condition index. Diet choices of the crayfish maintained on the mixed diet were estimated using stable isotopes (13C and 15N). The results suggest a decreased efficiency of carnivorous diets at higher temperatures, as juveniles fed on the animal diet were unable to maintain high growth rates in the long heat wave; and a decreased efficiency of herbivorous diets at lower temperatures, as juveniles in the cold accumulated less body reserves when fed on the plant diet. Heat wave treatments increased the assimilation of plant material, especially in juveniles, allowing them to sustain high growth rates in the long heat wave. Contrary to our expectations, crayfish performance decreased in the long heat wave, suggesting that Mediterranean summer heat waves may have negative effects on P. clarkii and that they are unlikely to boost its populations in this region. Although uncertain, it is possible that the greater assimilation of the plant diet resulted from changes in crayfish feeding preferences, raising the hypotheses that i) heat waves may change the predominant impacts of this keystone species and ii) that by altering species' trophic niches, climate change may alter the main impacts of invasive alien species.

Hydrological disturbance diminishes predator control in wetlands.

PubMed

Dorn, Nathan J; Cook, Mark I

2015-11-01

Effects of predators on prey populations can be especially strong in aquatic ecosystems, but disturbances may mediate the strength of predator limitation and even allow outbreaks of some prey populations. In a two-year study we investigated the numerical responses of crayfish (Procambarus fallax) and small fishes (Poeciliidae and Fundulidae) to a brief hydrological disturbance in replicated freshwater wetlands with an experimental drying and large predatory fish reduction. The experiment and an in situ predation assay tested the component of the consumer stress model positing that disturbances release prey from predator limitation. In the disturbed wetlands, abundances of large predatory fish were seasonally reduced, similar to dynamics in the Everglades (southern Florida). Densities of small fish were unaffected by the disturbance, but crayfish densities, which were similar across all wetlands before drying, increased almost threefold in the year after the disturbance. Upon re-flooding, juvenile crayfish survival was inversely related to the abundance of large fish across wetlands, but we found no evidence for enhanced algal food quality. At a larger landscape scale (500 km2 of the Everglades), crayfish densities over eight years were positively correlated with the severity of local dry disturbances (up to 99 days dry) during the preceding dry season. In contrast, densities of small-bodied fishes in the same wetlands were seasonally depressed by dry disturbances. The results from our experimental wetland drought and the observations of crayfish densities in the Everglades represent a large-scale example of prey population release following a hydrological disturbance in a freshwater ecosystem. The conditions producing crayfish pulses in the Everglades appear consistent with the mechanics of the consumer stress model, and we suggest crayfish pulses may influence the number of nesting wading birds in the Everglades.

Effects of synbiotics on immunity and disease resistance of narrow-clawed crayfish, Astacus leptodactylus leptodactylus (Eschscholtz, 1823).

PubMed

Safari, Omid; Paolucci, Marina; Motlagh, Hamidreza Ahmadnia

2017-05-01

The aim of this study was to evaluate the effects of prebiotics (mannanoligosaccharide and xylooligosaccharide), probiotics (Enterococcus faecalis and Pediococcus acidilactici) and synbiotics for 126 days on the immune responses, hemolymph indices, antioxidant enzymes, and biological responses after a 48-hour Aeromonas hydrophila exposure of sub-adult crayfish (11.45 ± 1.87 g). Most antibacterial activities were observed in the shell mucus of crayfish fed a diet containing xylooligosaccharide + E. faecalis and mannanoligosaccharide + Pediococcus acidilactici against Nocardia brasilience and Vibrio harveyi (p < 0.05). Feeding crayfish a xylooligosaccharide + E. faecalis diet increased protein levels and the activities of alkaline phosphatase and lysozyme in the shell mucus after the feeding trial and 48 h after the A. hydrophila-injection challenge (p < 0.05). The highest ratio of the lactobacillus count to the total viable count was observed in synbiotic diets (p < 0.05). Feeding crayfish a xylooligosaccharide + E. faecalis diet increased the growth rate and the resistance to the A. hydrophila-injection challenge (p < 0.05). These results revealed that feeding crayfish with synbiotic diets was more effective than a single administration with prebiotics and probiotics. Copyright © 2017 Elsevier Ltd. All rights reserved.

Tyraminergic modulation of agonistic outcomes in crayfish.

PubMed

Momohara, Yuto; Aonuma, Hitoshi; Nagayama, Toshiki

2018-05-01

Octopamine, a biogenic amine, modulates various behaviors, ranging from locomotion and aggression to learning and memory in invertebrates. Several studies recently demonstrated that tyramine, the biological precursor of octopamine, also affects behaviors independent of octopamine. Here we investigated the involvement of tyramine in agonistic interaction of the male crayfish Procambarus clarkii. When male crayfish fight, larger animals (3-7% difference in body length) are more likely to win. By contrast, direct injection of tyramine or octopamine counteracted the physical advantage of larger animals. Tyramine or octopamine-injected naive large animals were mostly beaten by untreated smaller naive animals. This pharmacological effect was similar to the loser effect in which subordinate larger animals are frequently beaten by smaller animals. Furthermore, loser effects were partly eliminated by either injection of epinastine, an octopamine blocker, or yohimbine, a tyramine blocker, and significantly diminished by injection of a mixture of both blockers. We also observed that tyramine levels in the subesophageal ganglion were remarkably increased in subordinate crayfish after losing a fight. These results suggest that tyramine modulates aggressive levels of crayfish and contributes to the loser effect in parallel with octopamine.

36 CFR 7.35 - Buffalo National River.

Code of Federal Regulations, 2012 CFR

2012-07-01

... Superintendent is prohibited. (b) Frogs, Turtles and Crayfish. (1) The Superintendent may designate times and locations and establish conditions governing the taking of frogs, turtles and crayfish for personal use. (2...

36 CFR 7.35 - Buffalo National River.

Code of Federal Regulations, 2013 CFR

2013-07-01

... Superintendent is prohibited. (b) Frogs, Turtles and Crayfish. (1) The Superintendent may designate times and locations and establish conditions governing the taking of frogs, turtles and crayfish for personal use. (2...

36 CFR 7.35 - Buffalo National River.

Code of Federal Regulations, 2011 CFR

2011-07-01

... Superintendent is prohibited. (b) Frogs, Turtles and Crayfish. (1) The Superintendent may designate times and locations and establish conditions governing the taking of frogs, turtles and crayfish for personal use. (2...

36 CFR 7.35 - Buffalo National River.

Code of Federal Regulations, 2014 CFR

2014-07-01

... Superintendent is prohibited. (b) Frogs, Turtles and Crayfish. (1) The Superintendent may designate times and locations and establish conditions governing the taking of frogs, turtles and crayfish for personal use. (2...

36 CFR 7.35 - Buffalo National River.

Code of Federal Regulations, 2010 CFR

2010-07-01

... Superintendent is prohibited. (b) Frogs, Turtles and Crayfish. (1) The Superintendent may designate times and locations and establish conditions governing the taking of frogs, turtles and crayfish for personal use. (2...

Bullfrog tadpole (Rana catesbeiana) and red swamp crayfish (Procambarus clarkii) predation on early life stages of endangered razorback sucker (Xyrauchen texanus)

USGS Publications Warehouse

Mueller, G.A.; Carpenter, J.; Thornbrugh, D.

2006-01-01

Bullfrog tadpoles (Rana catesbeiana) and red swamp crayfish (Procambarus clarkii) are widespread introduced taxa that are problematic throughout the western United States. Their impact on native amphibians and crustaceans is well documented, but less is known regarding their influence on native fishes. Predator-prey tank tests showed both species consumed eggs and larvae of the endangered razorback sucker (Xyrauchen texanus) in a laboratory setting. Tadpoles consumed 2.2 razorback sucker eggs/d and 1.4 razorback sucker larvae/d, while crayfish ate 6.0 eggs/d and 3.5 larvae/d. Relatively high densities of bullfrog tadpoles and crayfish in razorback sucker spawning areas suggest that these nonnative taxa might pose a threat to the recruitment success of this and other imperiled native fish.

Bioaccumulation of lead nitrate in freshwater crayfish (Astacus leptodactylus) tissues under aquaculture conditions.

PubMed

Naghshbandi, N; Zare, S; Heidari, R; Soleimani Palcheglu, S

2007-09-15

The aim of this research was to evaluate the amount of lead in the tissue of Astacus leptodactylus especially in their muscle which the consumed part of their body. In this study the crayfish was exposed to intermediate concentration of lead nitrate (500 microg L(-1)) for periods up to 3 weeks. In the first, second and third weeks bioaccumulation in various tissues was under investigation. The data of toxicological analysis obtained by the method of atomic absorption revealed that the levels of bioaccumulation of metal are different in various tissues of this crayfish. The accumulation of the lead in gills was the highest and in muscles was lowest degree. The amount of heavy metals in the tissues of crayfish was as follow. Gills>exoskeleton>hepatopancreas (digestive glands)>digestive tract>green gland>testis and ovary>muscles.

Conservation status of North American freshwater crayfish (Decapoda: Cambaridae) from the southern United States

USGS Publications Warehouse

Loughman, Zachary J.; Welsh, Stuart A.; Fetzner, James W.; Thoma, Roger F.

2015-01-01

A list is provided of all crayfishes (family Cambaridae) in the southern United States, which includes common names, global conservation status, an alternative review of the conservation status based on the IUCN red list criteria, and state distribution. This list includes 357 native crayfishes, of which 12 (3.4%) are critically endangered, 37 (10.4%) are endangered, 126 (35.3%) are vulnerable, 181 (50.7%) are lower risk, and 1 (0.3%) is not evaluated. The leading factors causing imperilment are restricted ranges caused by anthropogenic impacts from changes in land use, contaminants, invasion by non-indigenous species, and habitat fragmentation. In order to conserve and manage diversity of native crayfish, consistency is needed in determining conservation status and more complete distribution and life history information are needed for about 60% of species.

Effects of clothianidin on aquatic communities: Evaluating the impacts of lethal and sublethal exposure to neonicotinoids

PubMed Central

Miles, Jesse C.; Hua, Jessica; Sepulveda, Maria S.; Krupke, Christian H.

2017-01-01

The widespread usage of neonicotinoid insecticides has sparked concern over their effects on non-target organisms. While research has largely focused on terrestrial systems, the low soil binding and high water solubility of neonicotinoids, paired with their extensive use on the landscape, puts aquatic environments at high risk for contamination via runoff events. We assessed the potential threat of these compounds to wetland communities using a combination of field surveys and experimental exposures including concentrations that are representative of what invertebrates experience in the field. In laboratory toxicity experiments, LC50 values ranged from 0.002 ppm to 1.2 ppm for aquatic invertebrates exposed to clothianidin. However, freshwater snails and amphibian larvae showed high tolerance to the chemical with no mortality observed at the highest dissolvable concentration of the insecticide. We also observed behavioral effects of clothianidin. Water bugs, Belostoma flumineum, displayed a dose-dependent reduction in feeding rate following exposure to clothianidin. Similarly, crayfish, Orconectes propinquus, exhibited reduced responsiveness to stimulus with increasing clothianidin concentration. Using a semi-natural mesocosm experiment, we manipulated clothianidin concentration (0.6, 5, and 352 ppb) and the presence of predatory invertebrates to explore community-level effects. We observed high invertebrate predator mortality with increases in clothianidin concentration. With increased predator mortality, prey survival increased by 50% at the highest clothianidin concentration. Thus, clothianidin contamination can result in a top-down trophic cascade in a community dominated by invertebrate predators. In our Indiana field study, we detected clothianidin (max = 176 ppb), imidacloprid (max = 141 ppb), and acetamiprid (max = 7 ppb) in soil samples. In water samples, we detected clothianidin (max = 0.67 ppb), imidacloprid (max = 0.18 ppb), and thiamethoxam (max = 2,568 ppb). Neonicotinoids were detected in >56% of soil samples and >90% of the water samples, which reflects a growing understanding that neonicotinoids are ubiquitous environmental contaminants. Collectively, our results underscore the need for additional research into the effects of neonicotinoids on aquatic communities and ecosystems. PMID:28334022

Drug-sensitive reward in crayfish: an invertebrate model system for the study of SEEKING, reward, addiction, and withdrawal.

PubMed

Huber, Robert; Panksepp, Jules B; Nathaniel, Thomas; Alcaro, Antonio; Panksepp, Jaak

2011-10-01

In mammals, rewarding properties of drugs depend on their capacity to activate appetitive motivational states. With the underlying mechanisms strongly conserved in evolution, invertebrates have recently emerged as a powerful new model in addiction research. In crayfish natural reward has proven surprisingly sensitive to human drugs of abuse, opening an unlikely avenue of research into the basic biological mechanisms of drug addiction. In a series of studies we first examined the presence of natural reward systems in crayfish, then characterized its sensitivity to a wide range of human drugs of abuse. A conditioned place preference (CPP) paradigm was used to demonstrate that crayfish seek out those environments that had previously been paired with the psychostimulants cocaine and amphetamine, and the opioid morphine. The administration of amphetamine exerted its effects at a number of sites, including the stimulation of circuits for active exploratory behaviors (i.e., SEEKING). A further study examined morphine-induced reward, extinction and reinstatement in crayfish. Repeated intra-circulatory infusions of morphine served as a reward when paired with distinct visual or tactile cues. Morphine-induced CPP was extinguished after repeated saline injections. Following this extinction phase, morphine-experienced crayfish were once again challenged with the drug. The priming injections of morphine reinstated CPP at all tested doses, suggesting that morphine-induced CPP is unrelenting. In an exploration of drug-associated behavioral sensitization in crayfish we concurrently mapped measures of locomotion and rewarding properties of morphine. Single and repeated intra-circulatory infusions of morphine resulted in persistent locomotory sensitization, even 5 days following the infusion. Moreover, a single dose of morphine was sufficient to induce long-term behavioral sensitization. CPP for morphine and context-dependent cues could not be disrupted over a drug free period of 5 days. This work demonstrates that crayfish offer a comparative and complementary approach in addiction research. Serving as an invertebrate animal model for the exposure to mammalian drugs of abuse, modularly organized and experimentally accessible nervous systems render crayfish uniquely suited for studying (1) the basic biological mechanisms of drug effects, (2) to explore how the appetitive/seeking disposition is implemented in a simple neural system, and (3) how such a disposition is related to the rewarding action of drugs of abuse. This work aimed to contribute an evolutionary, comparative context to our understanding of a key component in learning, and of natural reward as an important life-sustaining process. Copyright © 2010 Elsevier Ltd. All rights reserved.

Addition of a new Quedius Steph. (Coleoptera, Staphylinidae) species to the biodiversity of Albertan mixedwood forest, Canada.

PubMed

Jacobs, Jenna M; Bergeron, J A Colin

2017-01-01

Quedius (Raphirus) spencei Jacobs and Bergeron, new species, (Coleoptera: Staphylinidae), is described based on specimens from two localities (type locality: 35 km. E Dixonville, Alberta, Canada) in the Boreal Forest. Male genitalia are illustrated, compared with congeners ( Q. rusticus Smetana and Q. simulator Smetana) in the Aenescens species group, and included in a slightly modified key to the species of Quedius .

Exploratory behavior and withdrawal signs in crayfish: chronic central morphine injections and termination effects.

PubMed

Imeh-Nathaniel, Adebobola; Okon, Marvin; Huber, Robert; Nathaniel, Thomas I

2014-05-01

Functional and evolutionary conservation of neural circuits of reward seeking >is a symbol of survival. It is found in most animals from insects to humans. Exploration is a component of a wide range of drug-elicited behaviors that reflects an appetitive motivational state when animals seek natural rewards such as food, water, and shelter for survival. Not only does the characterization of exploratory behaviors indicate the specific components of appetitive motor patterns, it also reveals how exploratory behavioral patterns are implemented via increased incentive salience of environmental stimuli. The current work demonstrates that novel stimuli appear to directly augment exploration in crayfish, while injections of morphine directly into the brain of crayfish enhanced robust arousal resulting in increased locomotion and exploration of the environment. Elimination of morphine suppressed exploratory motor patterns. Crayfish displayed atypical behavioral changes evident of withdrawal-like states when saline is injected into the brain. With proven evidence of rewarding to the exposure to mammalian drugs of abuse, modularly organized and experimentally accessible nervous system makes crayfish exceptionally suitable for characterizing the central workings of addiction at its key behavioral and neuroanatomic locations. Published by Elsevier B.V.

Use of crayfishes as ecological indicator of water quality in natural lakes and city water grid

NASA Astrophysics Data System (ADS)

Sapunov, Valentin; Fedotov, Valery

2017-04-01

Crayfishes are organisms having strong demands for water quality. Their different species have different ecological limits. Nobel crayfishes Astacus astacus are organisms with narrow ecological limits need clear water that crayfish Pontastacus leptodactylus. Relation between populations of different crayfishes is criteria of water pollution, level of water bodies eutrofication and ecological pressure. Environmental policy of all countries is directed to water supply by drinking water of high quality and preserving the rivers, lakes and seas, suitable for people and wildlife. However, now freshwater reservoirs and water bodies, as well as including centralized drinking water supply, have been exposed to escalating anthropogenic loading, and risk of sudden emergency pollution. Besides, the problem of providing an ecological safety of the population and prevention of threats of ecological crime and terrorism in a zone of drinking water for many countries. The work is devoted to realization and perspectives of use of the biological early warning stations about changes of quality of surface waters, dangerous to a biota, on the basis of bioelectronic systems as elements of environmental monitoring of water areas. Regular monitoring of crayfish population is a way to follow ecological evolution of ponds. Such a monitoring took place in some lakes of Pskov and Leningrad regions. Ecological characters of crayfishes are appropriate for control of water quality in St. Petersburg and Khabarovsk grids. Fore species were used: Procambarus clarcii, Cherax quadricarinatus, A. astacus and P. leptodactilus. The results of the present work and experiments carried out us to conclude that before assessing any concentration of pollutant on water organisms, it is necessary to investigate not only their development, growth and survival, also their adaptive capacity relative to the variation of environmental parameters. Regular monitoring of heart oscillation was base for control of water pollution in real time. Algorithm and equipment for such a monitoring would be demonstrated.

Genome survey sequencing of red swamp crayfish Procambarus clarkii.

PubMed

Shi, Linlin; Yi, Shaokui; Li, Yanhe

2018-06-21

Red swamp crayfish, Procambarus clarkii, presently is an important aquatic commercial species in China. The crayfish is a hot area of research focus, and its genetic improvement is quite urgent for the crayfish aquaculture in China. However, the knowledge of its genomic landscape is limited. In this study, a survey of P. clarkii genome was investigated based on Illumina's Solexa sequencing platform. Meanwhile, its genome size was estimated using flow cytometry. Interestingly, the genome size estimated is about 8.50 Gb by flow cytometry and 1.86 Gb with genome survey sequencing. Based on the assembled genome sequences, total of 136,962 genes and 152,268 exons were predicted, and the predicted genes ranged from 150 to 12,807 bp in length. The survey sequences could help accelerate the progress of gene discovery involved in genetic diversity and evolutionary analysis, even though it could not successfully applied for estimation of P. clarkii genome size.

New distributional records of the stygobitic crayfish Cambarus cryptodytes (Decapoda: Cambaridae) in the Floridan Aquifer System of southwestern Georgia

USGS Publications Warehouse

Fenolio, Dante B.; Niemiller, Matthew L.; Gluesenkamp, Andrew G.; Mckee, Anna; Taylor, Steven J.

2017-01-01

Cambarus cryptodytes (Dougherty Plain Cave Crayfish) is an obligate inhabitant of groundwater habitats (i.e., a stygobiont) with troglomorphic adaptations in the Floridan aquifer system of southwestern Georgia and adjacent Florida panhandle, particularly in the Dougherty Plain and Marianna Lowlands. Documented occurrences of Dougherty Plain Cave Crayfish are spatially distributed as 2 primary clusters separated by a region where few caves and springs have been documented; however, the paucity of humanly accessible karst features in this intermediate region has inhibited investigation of the species' distribution. To work around this constraint, we employed bottle traps to sample for Dougherty Plain Cave Crayfish and other groundwater fauna in 18 groundwater-monitoring wells that access the Floridan aquifer system in 10 counties in southwestern Georgia. We captured 32 Dougherty Plain Cave Crayfish in 9 wells in 8 counties between September 2014 and August 2015. We detected crayfish at depths ranging from 17.9 m to 40.6 m, and established new county records for Early, Miller, Mitchell, and Seminole counties in Georgia, increasing the number of occurrences in Georgia from 8 to 17 sites. In addition, a new US Geological Survey (USGS) Hydrologic Unit Code 8 (HUC8) watershed record was established for the Spring Creek watershed. These new records fill in the distribution gap between the 2 previously known clusters in Georgia and Jackson County, FL. Furthermore, this study demonstrates that deployment of bottle traps in groundwater-monitoring wells can be an effective approach to presence—absence surveys of stygobionts, especially in areas where surface access to groundwater is limited.

Cross-habitat effects shape the ecosystem consequences of co-invasion by a pelagic and a benthic consumer.

PubMed

Fryxell, David C; Diluzio, Amber R; Friedman, Maya A; Menge, Nicklaus A; Palkovacs, Eric P

2016-10-01

Invasive species can have major impacts on ecosystems, yet little work has addressed the combined effects of multiple invaders that exploit different habitats. Two common invaders in aquatic systems are pelagic fishes and crayfishes. Pelagic-oriented fish effects are typically strong on the pelagic food web, whereas crayfish effects are strong on the benthic food web. Thus, co-invasion may generate strong ecological responses in both habitats. We tested the effects of co-invasion on experimental pond ecosystems using two widespread invasive species, one pelagic (western mosquitofish) and one benthic (red swamp crayfish). As expected, mosquitofish had strong effects on the pelagic food web, reducing the abundance of Daphnia and causing a strong trophic cascade (increase in phytoplankton). Crayfish had strong effects on the benthic food web, reducing the abundance of benthic filamentous algae. Yet, we also found evidence for important cross-habitat effects. Mosquitofish treatments reduced the biomass of benthic filamentous algae, and crayfish treatments increased Daphnia and phytoplankton abundance. Combined effects of mosquitofish and crayfish were primarily positively or negatively additive, and completely offsetting for some responses, including gross primary production (GPP). Though co-invasion did not affect GPP, it strongly shifted primary production from the benthos into the water column. Effects on snail abundance revealed an interaction; snail abundance decreased only in the presence of both invaders. These results suggest that cross-habitat effects of co-invaders may lead to a variety of ecological outcomes; some of which may be unpredictable based on an understanding of each invader alone.

Addition of a new Quedius Steph. (Coleoptera, Staphylinidae) species to the biodiversity of Albertan mixedwood forest, Canada

PubMed Central

Jacobs, Jenna M.; Bergeron, J. A. Colin

2017-01-01

Abstract Quedius (Raphirus) spencei Jacobs and Bergeron, new species, (Coleoptera: Staphylinidae), is described based on specimens from two localities (type locality: 35 km. E Dixonville, Alberta, Canada) in the Boreal Forest. Male genitalia are illustrated, compared with congeners (Q. rusticus Smetana and Q. simulator Smetana) in the Aenescens species group, and included in a slightly modified key to the species of Quedius. PMID:28769643

Predator identity and consumer behavior: differential effects of fish and crayfish on the habitat use of a freshwater snail.

PubMed

Turner, Andrew M; Fetterolf, Shelley A; Bernot, Randall J

1999-02-01

Predators can alter the outcome of ecological interactions among other members of the food web through their effects on prey behavior. While it is well known that animals often alter their behavior with the imposition of predation risk, we know less about how other features of predators may affect prey behavior. For example, relatively few studies have addressed the effects of predator identity on prey behavior, but such knowledge is crucial to understanding food web interactions. This study contrasts the behavioral responses of the freshwater snail Physellagyrina to fish and crayfish predators. Snails were placed in experimental mesocosms containing caged fish and crayfish, so the only communication between experimental snails and their predators was via non-visual cues. The caged fish and crayfish were fed an equal number of snails, thereby simulating equal prey mortality rates. In the presence of fish, the experimental snails moved under cover, which confers safety from fish predators. However, in the presence of crayfish, snails avoided benthic cover and moved to the water surface. Thus, two species of predators, exerting the same level of mortality on prey, induced very different behavioral responses. We predict that these contrasting behavioral responses to predation risk have important consequences for the interactions between snails and their periphyton resources.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Naqvi, S.M.; Howell, R.D.; Sholas, M.

The whole-body residues of Cd and Pb in the tissues of Louisiana swamp crayfish (Procambarus clarkii) were determined by flame AAS technique. Test animals were collected from roadside ditches alongside major highways. The water and soil samples were also collected from the same sites. The mean Cd and Pb concentrations in crayfish tissues were 0.46 and 0.07, respectively. The levels of Cd and Pb in the water were 0.09 and 0.04; and in soil were 2.85 and 0.87 mg/1, respectively. The concentration of cadmium was 32 and Pb 12 times more than in the water. The bioaccumulation factors (BF) formore » Cd and Pb in crayfish tissues were 5.1 and 1.7, respectively. Alligator weed (Alternanthera philoxiroides) plants were exposed to 0.5 mg/1 Cd-chloride or Pb-nitrate solutions for 3 wk period, thrice. The mean Pb accumulation in roots was 1.31 mg/1, followed by stem (0.078 mg/1), but Cd only accumulated in root (0.83 mg/1). The BF for Pb and Cd in plant tissues were 14.8 and 16.6, respectively. The uptake of metals was time-dependent. These data suggest that although there is no biomagnification of Cd and Pb from alligator weed to crayfish, both metals readily accumulate in field-collected crayfish and laboratory-exposed alligator weed.« less

Protein modification in the post-mating spermatophore of the signal crayfish Pacifastacus leniusculus: insight into the tyrosine phosphorylation in a non-motile spermatozoon.

PubMed

Niksirat, Hamid; Vancová, Marie; Andersson, Liselotte; James, Peter; Kouba, Antonín; Kozák, Pavel

2016-09-01

After mating, spermatophores of signal crayfish are stored on the body of the female for a period before fertilization. This study compared the post-mating protein profile and pattern of protein tyrosine phosphorylation of the signal crayfish spermatophore to that of the freshly ejaculated spermatophore and found substantial differences. Two major bands of tyrosine-phosphorylated proteins of molecular weights 10 and 50kDa were observed in the freshly ejaculated spermatophore of the signal crayfish. While the tyrosine-phosphorylated protein band with molecular weight 10kDa was formed by protein(s) of similar pH, the band with molecular weight of 50kDa consisted of proteins of varying pH. In the post-mating spermatophore, the band with molecular weight of 50kDa was not detected, and an increase in the level of protein tyrosine phosphorylation was observed in the 10kDa band. The microtubular radial arms of the spermatozoon showed a positive reaction to an anti-tyrosine antibody conjugated with gold particles in both the freshly ejaculated and post-mating spermatophores. In conclusion, the male gamete of the signal crayfish undergoes molecular modification during post-mating storage on the body of the female including changes in the level of protein expression and protein tyrosine phosphorylation. Structural similarity of the radial arms in the crayfish immotile spermatozoon with flagellum, which is the main site of protein tyrosine phosphorylation in the mammalian motile spermatozoa, raises questions regarding evolution and function of such organelles across the animal kingdom that must be addressed in the future studies. Copyright © 2016 Elsevier B.V. All rights reserved.

Phylogenetic species delimitation for crayfishes of the genus Pacifastacus.

PubMed

Larson, Eric R; Castelin, Magalie; Williams, Bronwyn W; Olden, Julian D; Abbott, Cathryn L

2016-01-01

Molecular genetic approaches are playing an increasing role in conservation science by identifying biodiversity that may not be evident by morphology-based taxonomy and systematics. So-called cryptic species are particularly prevalent in freshwater environments, where isolation of dispersal-limited species, such as crayfishes, within dendritic river networks often gives rise to high intra- and inter-specific genetic divergence. We apply here a multi-gene molecular approach to investigate relationships among extant species of the crayfish genus Pacifastacus, representing the first comprehensive phylogenetic study of this taxonomic group. Importantly, Pacifastacus includes both the widely invasive signal crayfish Pacifastacus leniusculus, as well as several species of conservation concern like the Shasta crayfish Pacifastacus fortis. Our analysis used 83 individuals sampled across the four extant Pacifastacus species (omitting the extinct Pacifastacus nigrescens), representing the known taxonomic diversity and geographic distributions within this genus as comprehensively as possible. We reconstructed phylogenetic trees from mitochondrial (16S, COI) and nuclear genes (GAPDH), both separately and using a combined or concatenated dataset, and performed several species delimitation analyses (PTP, ABGD, GMYC) on the COI phylogeny to propose Primary Species Hypotheses (PSHs) within the genus. All phylogenies recovered the genus Pacifastacus as monophyletic, within which we identified a range of six to 21 PSHs; more abundant PSHs delimitations from GMYC and ABGD were always nested within PSHs delimited by the more conservative PTP method. Pacifastacus leniusculus included the majority of PSHs and was not monophyletic relative to the other Pacifastacus species considered. Several of these highly distinct P. leniusculus PSHs likely require urgent conservation attention. Our results identify research needs and conservation priorities for Pacifastacus crayfishes in western North America, and may inform better understanding and management of P. leniusculus in regions where it is invasive, such as Europe and Japan.

Involvement of the crustacean hyperglycemic hormone (CHH) in the physiological compensation of the freshwater crayfish Cherax quadricarinatus to low temperature and high salinity stress.

PubMed

Prymaczok, Natalia C; Pasqualino, Valeria M; Viau, Verónica E; Rodríguez, Enrique M; Medesani, Daniel A

2016-02-01

This study was aimed at determining the role of the crustacean hyperglycemic hormone (CHH) in the physiological compensation to both saline and thermal stress, in the freshwater crayfish Cherax quadricarinatus. By determining the expression of the CHH gene in the eyestalk of juvenile crayfish, we found that maximal induction of CHH was induced at high salinity (10 g/L) and low temperature (20 °C). In order to investigate the role of CHH in the physiological compensation to such stressful conditions, recombinant CHH was supplied to stressed animals. CHH-injected crayfish showed increased hemolymphatic levels of glucose, in accordance with a significant utilization of glycogen reserves from the hepatopancreas. Furthermore, CHH administration allowed stressed animals to regulate hemolymphatic sodium and potassium at more constant levels than controls. Taken together, these results suggest a relevant role of CHH in increasing the energy available intended for processes involved in the physiological compensation of C. quadricarinatus to both saline and thermal stress.

Effects of dietary propolis on the number and size of pleopadal egg, oxidative stress and antioxidant status of freshwater crayfish (Astacus leptodactylus Eschscholtz).

PubMed

Mişe Yonar, Serpil; Köprücü, Kenan; Yonar, Muhammet Enis; Silici, Sibel

2017-09-01

Four different crayfish diets; control, E1, E2 and E3, respectively containing 0, 1, 2 and 4% propolis, were tested to determine the effects of dietary propolis on the number and size of pleopadal egg, and malondialdehyde (MDA) level, superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GSH-Px) activities in the freshwater crayfish (Astacus leptodactylus). The crayfish were kept at 9.6±5.3°C water temperature and fed three times daily during a six month period The pleopodal egg number (from 7 to 9) produced per gram of the body weight and total pleopodal egg number (from 201 to 263) significantly increased (P<0.05) with the dietary propolis supplemantation. However, an increase in the dietary propolis led to a significant decrease (P<0.05) in the pleopodal egg size (from 3.22mm to 2.76mm). MDA level significantly (P<0.05) decreased in the hepatopancreas (from 4.78 to 3.04 nmol/g protein) and ovarium (from 3.52 to 1.98 nmol/g protein) of the crayfish fed with the increased dietary propolis level. On the other hand, an increase in the dietary propolis led to a significant increase (P<0.05) in SOD activities in hepatopancreas (from 21.8 to 41.1U/g protein) and ovarium (from 16.8 to 26.8U/g protein). However, CAT activities significantly decreased (P<0.05) in the hepatopancreas (from 23.8 to 18.9 nmol/g protein) and ovarium (from 21.8 to 17.5 nmol/g protein) of the crayfish fed with the increased dietary propolis level. Similarly, an increase in the dietary propolis caused a significant decrease (P<0.05) in GSH-Px activities in the hepatopancreas (from 21.8 to 41.1U/g protein) and ovarium (from 16.8 to 26.8U/g protein) with the formation of the pleopodal egg. The dietary propolis improves reproductive efficiency in the crayfish and decreases the oxidative stress under controlled hatchery conditions. Copyright © 2017 Elsevier B.V. All rights reserved.

Do predator-prey relationships on the river bed affect fine sediment ingress?

NASA Astrophysics Data System (ADS)

Mathers, Kate; Rice, Stephen; Wood, Paul

2016-04-01

Ecosystem engineers are organisms that alter their physical environment and thereby influence the flow of resources through ecosystems. In rivers, several ecosystem engineers are also important geomorphological agents that modify fluvial sediment dynamics. By altering channel morphology and bed material characteristics, such modifications can affect the availability of habitats for other organisms, with implications for ecosystem health and wider community composition. In this way geomorphological and ecological systems are intimately interconnected. This paper focuses on one element of this intricate abiotic-biotic coupling: the interaction between fine sediment ingress into the river bed and the predator-prey relationships of aquatic organisms living on and in the river bed. Signal crayfish (Pacifastacus leniusculus) have been shown to modify fine sediment fluxes in rivers, but their effect on fine sediment ingress into riverbeds remains unclear. Many macroinvertebrate taxa have adapted avoidance strategies to avoid predation by crayfish, with one example being the freshwater shrimp (Gammarus pulex) which relies on open interstitial spaces within subsurface sediments as a refuge from crayfish predation. Fine sedimentation that fills gravelly frameworks may preclude access to those spaces, therefore leaving freshwater shrimp susceptible to predation. Ex-situ experiments were conducted which sought to examine: i) if freshwater shrimps and signal crayfish, alone and in combination, influenced fine sediment infiltration rates; and ii) whether modifications to substratum composition, specifically the introduction of fine sediment, modified predator-prey interactions. The results demonstrate that crayfish are significant geomorphic agents and that fine sediment ingress rates were significantly enhanced in their presence compared to control conditions or the presence of only freshwater shrimps. The combination of both organisms (i.e. allowing the interaction between predator and prey) resulted in intermediate fine sediment infiltration rates. The results suggest that reductions in prey availability may enhance crayfish foraging behaviour and therefore their impact on fine sediment ingress into river beds. Consequently, as invading species become more established and prey resources are depleted, the implications of invasive crayfish on fine sediment dynamics may become more prominent. These experiments demonstrate the importance of abiotic-biotic coupling in fluvial systems for both geomorphological and ecological understanding.

Conservation status of crayfishes of the United States and Canada

Treesearch

Christopher A. Taylor; Melvin L. Warren; J. F. Fitzpatrick; Horton H. Hobbs; Raymond F. Jezerinac; William L. Pflieger; Henry W. Robinson

1996-01-01

The American Fisheries Society (AFS) Endangered Species Committee herein provides a list of all crayfishes (families and Cambaridae) in the United States and Canada that includes state provincial distributions; a comprehensive review of the conservation status of all taxa; and references on biology, conservation, and...

Resistance of a northwestern crayfish, Pacifastacus leniusculus (Dana), to elevated temperatures

DOE Office of Scientific and Technical Information (OSTI.GOV)

Becker, C.D.; Genoway, R.G.; Merrill, J.A.

1975-04-01

Pacifastacus leniusculus from two populations in Washington State, the central Columbia River and a small tributary, were acclimated at 5/sup 0/C intervals and exposed to elevated temperatures in 48 hour thermal bioassays. The upper lethal temperature for both crayfish populations increased relatively slightly, from about 28.5 to 31.5/sup 0/C, over the entire acclimation range. A rise of 1/sup 0/C in test temperature often represented the difference between zero and total mortality when lethal limits were approached. The ultimate upper lethal temperature was near 32 to 33/sup 0/C. Statistically significant differences in thermal resistance patterns (slope and spacing of regression lines)more » occurred between the two crayfish populations at all acclimation levels, but resistance in terms of eventual mortality was similar for practical purposes. Moulting individuals were particularly susceptible to high temperature stress. Mature, pre-breeding female crayfish from the Columbia River during fall appeared less resistant, and egg-bearing females during winter more resistant, than other individuals. Larger crayfish from the Columbia River were slightly less resistant to elevated temperatures than smaller ones, and females were more resistant than males. The upper temperature triangle for P. leniusculus encompasses an area of 424/sup 0/C/sup 2/. This freshwater decapod is more tolerant of elevated temperatures than native salmonids, but less tolerant than some introduced ''warmwater'' fish.« less

Loss of Genetic Diversity Means Loss of Geological Information: The Endangered Japanese Crayfish Exhibits Remarkable Historical Footprints

PubMed Central

Koizumi, Itsuro; Usio, Nisikawa; Kawai, Tadashi; Azuma, Noriko; Masuda, Ryuichi

2012-01-01

Intra-specific genetic diversity is important not only because it influences population persistence and evolutionary potential, but also because it contains past geological, climatic and environmental information. In this paper, we show unusually clear genetic structure of the endangered Japanese crayfish that, as a sedentary species, provides many insights into lesser-known past environments in northern Japan. Over the native range, most populations consisted of unique 16S mtDNA haplotypes, resulting in significant genetic divergence (overall F ST = 0.96). Owing to the simple and clear structure, a new graphic approach unraveled a detailed evolutionary history; regional crayfish populations were comprised of two distinct lineages that had experienced contrasting demographic processes (i.e. rapid expansion vs. slow stepwise range expansion) following differential drainage topologies and past climate events. Nuclear DNA sequences also showed deep separation between the lineages. Current ocean barriers to dispersal did not significantly affect the genetic structure of the freshwater crayfish, indicating the formation of relatively recent land bridges. This study provides one of the best examples of how phylogeographic analysis can unravel a detailed evolutionary history of a species and how this history contributes to the understanding of the past environment in the region. Ongoing local extinctions of the crayfish lead not only to loss of biodiversity but also to the loss of a significant information regarding past geological and climatic events. PMID:22470505

Occupancy rates of primary burrowing crayfish in natural and disturbed large river bottomlands

USGS Publications Warehouse

Loughman, Zachary J.; Welsh, Stuart A.; Simon, Thomas P.

2012-01-01

Among crayfish, primary burrowing species are the least understood ecologically. Many primary burrowing crayfish inhabit floodplains where forested landscapes have been fragmented by agricultural, industrial, or residential uses. In this study, site occupancy rates (ψ) were modeled for two primary burrowing crayfish, Fallicambarus fodiens (Cottle, 1863) and Cambarus thomai Jezerinac, 1993, from Ohio and Kanawha river floodplains in West Virginia, U.S.A. Fallicambarus fodiens is one of West Virginia’s rarest crayfish, while C. thomai is prevalent in most wetlands along both river floodplains. Occupancy rate modeling incorporated four environmental covariates (forest age, soil type, tree frequency, and land use). Based on presence/absence data, forests with tree ages >100 years (ΔQAICc = 0) and sites with loam soils (ΔQAICc = 1.80) were most likely to harbor F. fodiens populations. For C. thomai, several models were supported owing to model selection uncertainty, but those with the land use covariate had more total model weight (total w i = 0 . 54 ) than all other covariate models. Cambarus thomai rarely occupied industrial/agricultural sites, but were often present in forested and residential sites. Although the influence of covariates on site occupancy differed between species, both taxa readily utilized mature forested habitats when available. Conservation actions for F. fodiens and C. thomai should focus on preserving forested tracts along large river floodplains

A multigear protocol for sampling crayfish assemblages in Gulf of Mexico coastal streams

Treesearch

William R. Budnick; William E. Kelso; Susan B. Adams; Michael D. Kaller

2018-01-01

Identifying an effective protocol for sampling crayfish in streams that vary in habitat and physical/chemical characteristics has proven problematic. We evaluated an active, combined-gear (backpack electrofishing and dipnetting) sampling protocol in 20 Coastal Plain streams in Louisiana. Using generalized linear models and rarefaction curves, we evaluated environmental...

Crayfish Behavior: Observing Arthropods to Learn about Science & Scientific Inquiry

ERIC Educational Resources Information Center

Rop, Charles J.

2010-01-01

This is a set of animal behavior investigations in which students will practice scientific inquiry as they observe crayfish, ask questions, and discuss territoriality, social interactions, and other behaviors. In doing this, they hone their skills of observation, learn to record and analyze data, control for variables, write hypotheses, make…

Procambarus (Girardiella) holifieldi, a new species of crayfish (Decapoda: Cambaridae) from Alabama with a revision of the Hagenianus Group in the subgenus Girardiella

Treesearch

Guenter A. Schuster; Christopher A. Taylor; Susan B. Adams

2015-01-01

Procambarus (Girardiella) holifieldi, new species, is a primary burrowing crayfish from a low-lying field in Perry County, Alabama. It belongs to the Hagenianus Group in the subgenus Girardiella. The new species is morphologically most similar to Procambarus (

Characterization of a double WAP domain-containing protein from the red swamp crayfish Procambarus clarkii

USDA-ARS?s Scientific Manuscript database

Crustaceans express multiple whey acidic protein (WAP) domain containing proteins which are components of host immunity. In the present study, a new double WAP domain containing protein was identified from red swamp crayfish Procambarus clarkii, designated Pc-DWD. The ORF is 387 bp, encoding 128 ami...

D-amphetamine stimulates unconditioned exploration/approach behaviors in crayfish: towards a conserved evolutionary function of ancestral drug reward

PubMed Central

Alcaro, Antonio; Panksepp, Jaak; Huber, Robert

2012-01-01

In mammals, rewarding properties of drugs depend on their capacity to activate a dopamine-mediated appetitive motivational seeking state—a system that allows animals to pursue and find all kinds of objects and events needed for survival. With such states strongly conserved in evolution, invertebrates have recently been developed into a powerful model in addiction research, where a shared ancestral brain system for the acquisition of reward can mediate drug addiction in many species. A conditioned place preference paradigm has illustrated that crayfish seek out environments that had previously been paired with psychostimulant and opioid administration. The present work demonstrates that the administration of d-amphetamine stimulates active explorative behaviors in crayfish through the action of the drug within their head ganglion. Crayfish, with a modularly organized and experimentally accessible, ganglionic nervous system offers a unique model to investigate (1) the fundamental, biological mechanisms of addictive drug reward; (2) how an appetitive/seeking disposition is implemented in a simple neural system, and (3) how it mediates the rewarding actions of major drugs of abuse. PMID:21504757

[Pharmacology of glutamate sensitive synapses (I). Glutamate agonists (author's transl)].

PubMed

Shinozaki, H

1982-04-01

The actions of kainic acid, quisqualic acid, and ibotenic acid on the crayfish neuromuscular junction were described, and it was particularly interesting that the discrepancy between glutamate responses and EJPs was revealed by the use of kainic acid. On the other hand, there is increasing evidence showing that glutamate is an excitatory transmitter at the crayfish neuromuscular junction. At this stage, we are unable as yet to definitively support or reject glutamate's candidacy as the excitatory transmitter at the crayfish neuromuscular junction. The discrepancy revealed by the use of kainic acid may bring up some questions. Certainly, the differential action of kainic acid on the glutamate current and the excitatory synaptic current opens to doubt the transmitter role of glutamate. In the case of the study on a transmitter role for a substance of doubt status, the value of pharmacological studies seems to be greater in disproving than in asserting such the role. However, we have to consider the matter of the extra-junctional receptor postulated on the crayfish postsynaptic membrane as one of the major problems for pharmacological identification.

Exposure of the eggs to 17alpha-methyl testosterone reduced hatching success and growth and elicited teratogenic effects in postembryonic life stages of crayfish.

PubMed

Vogt, Günter

2007-12-30

Testosterone is regularly found in the tissues of decapod crustaceans. Although this vertebrate-type sex hormone is not the principal factor of sex differentiation in crustaceans, it was shown to be capable of acting on the reproductive organs of shrimps and crabs. In the present study I have exposed developing eggs and stage 5 juveniles of the parthenogenetic all female marbled crayfish to 17alpha-methyl testosterone in order to test whether in freshwater crayfish sex can be changed from female to male by this androgen. MT did not elicit sex change, neither when administered during embryonic development nor during juvenile stage 5, the main period of proliferation of the oocytes. However, exposure to 100 microg/L MT from 64% to 84% embryonic development resulted in prolonged embryonic development, reduced hatching success, reduced growth of the juveniles, and severe malformations of the appendages in the juveniles. The marbled crayfish is recommended to be considered for toxicity tests due to its easy culture in the laboratory and its genotypical uniformity.

A global review of freshwater crayfish temperature tolerance, preference, and optimal growth

USGS Publications Warehouse

Westhoff, Jacob T.; Rosenberger, Amanda E.

2016-01-01

Conservation efforts, environmental planning, and management must account for ongoing ecosystem alteration due to a changing climate, introduced species, and shifting land use. This type of management can be facilitated by an understanding of the thermal ecology of aquatic organisms. However, information on thermal ecology for entire taxonomic groups is rarely compiled or summarized, and reviews of the science can facilitate its advancement. Crayfish are one of the most globally threatened taxa, and ongoing declines and extirpation could have serious consequences on aquatic ecosystem function due to their significant biomass and ecosystem roles. Our goal was to review the literature on thermal ecology for freshwater crayfish worldwide, with emphasis on studies that estimated temperature tolerance, temperature preference, or optimal growth. We also explored relationships between temperature metrics and species distributions. We located 56 studies containing information for at least one of those three metrics, which covered approximately 6 % of extant crayfish species worldwide. Information on one or more metrics existed for all 3 genera of Astacidae, 4 of the 12 genera of Cambaridae, and 3 of the 15 genera of Parastacidae. Investigations employed numerous methodological approaches for estimating these parameters, which restricts comparisons among and within species. The only statistically significant relationship we observed between a temperature metric and species range was a negative linear relationship between absolute latitude and optimal growth temperature. We recommend expansion of studies examining the thermal ecology of freshwater crayfish and identify and discuss methodological approaches that can improve standardization and comparability among studies.

Effects of chronic cocaine, morphine and methamphetamine on the mobility, immobility and stereotyped behaviors in crayfish.

PubMed

Imeh-Nathaniel, Adebobola; Rincon, Natalia; Orfanakos, Vasiliki Bessie; Brechtel, Leanne; Wormack, Leah; Richardson, Erika; Huber, Robert; Nathaniel, Thomas I

2017-08-14

The worth of crayfish as a model system for studies of addiction was not previously recognized because a drug-reward phenomenon had not been documented in this model system. In our previous experiments, we demonstrate that the crayfish natural reward pathways are sensitive to human drugs of abuse. This finding supports crayfish as a suitable model to characterize specific behaviors that are relevant in drug addiction research, and the current study builds on our previous findings. The aim of the present study was to investigate unconditioned neurobehavioral effects of repeated treatment regimens using cocaine, morphine, and methamphetamine for three consecutive days. We analyzed mobility, immobility and characterized stereotypic behaviors following intracardial infusions of 2.0μg/g or 10.0μg/g doses of cocaine, morphine, and methamphetamine for three days. The results showed that systemic cocaine, morphine, and methamphetamine increased mobility at a low dose of 2.0μg/g more effectively than a high dose of 10.0μg/g, while simultaneously showing that the high dose exerted a more prominent effect in increasing immobility. Moreover, systemic cocaine, morphine, and methamphetamine injections have discerning effects towards a group of defined unconditioned stereotyped behavioral patterns associated with each drug, rather than a shared universal behavioral effect. These findings provide insight into the behavioral and pharmacological basis responsible for the unconditioned effects of these drugs in crayfish. Copyright © 2017. Published by Elsevier B.V.

Circadian rhythm in melatonin release as a mechanism to reinforce the temporal organization of the circadian system in crayfish.

PubMed

Mendoza-Vargas, Leonor; Báez-Saldaña, Armida; Alvarado, Ramón; Fuentes-Pardo, Beatriz; Flores-Soto, Edgar; Solís-Chagoyán, Héctor

2017-06-01

Melatonin (MEL) is a conserved molecule with respect to its synthesis pathway and functions. In crayfish, MEL content in eyestalks (Ey) increases at night under the photoperiod, and this indoleamine synchronizes the circadian rhythm of electroretinogram amplitude, which is expressed by retinas and controlled by the cerebroid ganglion (CG). The aim of this study was to determine whether MEL content in eyestalks and CG or circulating MEL in hemolymph (He) follows a circadian rhythm under a free-running condition; in addition, it was tested whether MEL might directly influence the spontaneous electrical activity of the CG. Crayfish were maintained under constant darkness and temperature, a condition suitable for studying the intrinsic properties of circadian systems. MEL was quantified in samples obtained from He, Ey, and CG by means of an enzyme-linked immunosorbent assay, and the effect of exogenous MEL on CG spontaneous activity was evaluated by electrophysiological recording. Variation of MEL content in He, Ey, and CG followed a circadian rhythm that peaked at the same circadian time (CT). In addition, a single dose of MEL injected into the crayfish at different CTs reduced the level of spontaneous electrical activity in the CG. Results suggest that the circadian increase in MEL content directly affects the CG, reducing its spontaneous electrical activity, and that MEL might act as a periodical signal to reinforce the organization of the circadian system in crayfish.

Thermal games in crayfish depend on establishment of social hierarchies.

PubMed

Tattersall, Glenn J; Luebbert, Joshua P; LePine, Olivia K; Ormerod, Kiel G; Mercier, A Joffre

2012-06-01

An unequal resource distribution is commonly seen in dominance hierarchies, in which the individual with the higher status is more successful in obtaining the resource. One possible resource is preferred temperature. When situations allow, ectotherms regulate their body temperature by behaviourally selecting different environmental conditions, achieving, when possible, a preferred temperature. Using a shuttlebox, the preferred temperature for Procambarus clarkii was determined to be 23.9°C with upper and lower voluntary escape temperatures of 25.9 and 21.8°C, respectively. If this preferred temperature zone (21.8-25.9°C) was valued as a resource, given the choice between a preferred temperature and a non-preferred temperature, crayfish should compete over the preferred temperature, with the dominant individual of dyadic pairs achieving the preferred temperature more often than the subordinate. Using a dual-choice experimental tank, competition over a binary temperature choice between rank-established paired crayfish was determined under both warm and cold challenge conditions (warm vs preferred temperature and cold vs preferred temperature, respectively). In naive pairings, similar levels of competition over the preferred temperature occurred in both warm and cold challenge trials, as predicted by game theory. In established pairings, however, dominant crayfish gained significantly greater access to preferred temperature in both warm and cold challenge conditions. These results demonstrate that crayfish engage in a cost-benefit assessment during their initial agonistic contests over temperature, but as hierarchies mature, these thermal games are decided by the dominant animal gaining primary access to the temperature resource.

Constraints upon the Response of Fish and Crayfish to Environmental Flow Releases in a Regulated Headwater Stream Network

PubMed Central

Chester, Edwin T.; Matthews, Ty G.; Howson, Travis J.; Johnston, Kerrylyn; Mackie, Jonathon K.; Strachan, Scott R.; Robson, Belinda J.

2014-01-01

In dry climate zones, headwater streams are often regulated for water extraction causing intermittency in perennial streams and prolonged drying in intermittent streams. Regulation thereby reduces aquatic habitat downstream of weirs that also form barriers to migration by stream fauna. Environmental flow releases may restore streamflow in rivers, but are rarely applied to headwaters. We sampled fish and crayfish in four regulated headwater streams before and after the release of summer-autumn environmental flows, and in four nearby unregulated streams, to determine whether their abundances increased in response to flow releases. Historical data of fish and crayfish occurrence spanning a 30 year period was compared with contemporary data (electrofishing surveys, Victoria Range, Australia; summer 2008 to summer 2010) to assess the longer–term effects of regulation and drought. Although fish were recorded in regulated streams before 1996, they were not recorded in the present study upstream or downstream of weirs despite recent flow releases. Crayfish (Geocharax sp. nov. 1) remained in the regulated streams throughout the study, but did not become more abundant in response to flow releases. In contrast, native fish (Gadopsis marmoratus, Galaxias oliros, Galaxias maculatus) and crayfish remained present in unregulated streams, despite prolonged drought conditions during 2006–2010, and the assemblages of each of these streams remained essentially unchanged over the 30 year period. Flow release volumes may have been too small or have operated for an insufficient time to allow fish to recolonise regulated streams. Barriers to dispersal may also be preventing recolonisation. Indefinite continuation of annual flow releases, that prevent the unnatural cessation of flow caused by weirs, may eventually facilitate upstream movement of fish and crayfish in regulated channels; but other human–made dispersal barriers downstream need to be identified and ameliorated, to allow native fish to fulfil their life cycles in these headwater streams. PMID:24647407

Who is the boss? Individual recognition memory and social hierarchy formation in crayfish.

PubMed

Jiménez-Morales, Nayeli; Mendoza-Ángeles, Karina; Porras-Villalobos, Mercedes; Ibarra-Coronado, Elizabeth; Roldán-Roldán, Gabriel; Hernández-Falcón, Jesús

2018-01-01

Under laboratory conditions, crayfish establish hierarchical orders through agonistic encounters whose outcome defines the dominant one and one, or more, submissive animals. These agonistic encounters are ritualistic, based on threats, pushes, attacks, grabs, and avoidance behaviors that include retreats and escape responses. Agonistic behavior in a triad of unfamiliar, size-matched animals is intense on the first day of social interaction and the intensity fades on daily repetitions. The dominant animal keeps its status for long periods, and the submissive ones seem to remember 'who the boss is'. It has been assumed that animals remember and recognize their hierarchical status by urine signals, but the putative substance mediating this recognition has not been reported. The aim of this work was to characterize this hierarchical recognition memory. Triads of unfamiliar crayfish (male animals, size and weight-matched) were faced during standardized agonistic protocols for five consecutive days to analyze memory acquisition dynamics (Experiment 1). In Experiment 2, dominant crayfish were shifted among triads to disclose whether hierarchy depended upon individual recognition memory or recognition of status. The maintenance of the hierarchical structure without behavioral reinforcement was assessed by immobilizing the dominant animal during eleven daily agonistic encounters, and considering any shift in the dominance order (Experiment 3). Standard amnesic treatments (anisomycin, scopolamine or cold-anesthesia) were given to all members of the triads immediately after the first interaction session to prevent individual recognition memory consolidation and evaluate its effect on the hierarchical order (Experiment 4). Acquisition of hierarchical recognition occurs at the first agonistic encounter and agonistic behavior gradually diminishes in the following days; animals keep their hierarchical order despite the inability of the dominant crayfish to attack the submissive ones. Finally, blocking of protein synthesis or muscarinic receptors and cold anesthesia impair memory consolidation. These findings suggest that agonistic encounters induces the acquisition of a robust and lasting social recognition memory in crayfish. Copyright © 2017 Elsevier Inc. All rights reserved.

Hobbseus yalobushensis, a crayfish of intermittent streams: Biotic and habitat associations, life history characteristics, and new localities

Treesearch

Susan B. Adams; Blake A. Davis; Darren A. Miller

2018-01-01

Hobbseus yalobushensis, the Yalobusha rivulet crayfish, is a species of conservation concern because it is known from only six localities in parts of three central Mississippi counties. No studies have focused on the species since its description in 1989. Our objectives were to: (1) identify additional H. yalobushensis...

Accelerated hatching of southern leopard frog (Rana sphenocephala) eggs in response to the presence of a crayfish Procambarus nigrocinctus predator

Treesearch

Daniel Saenz; James B. Johnson; Cory K. Adams; Gage H. Dayton

2003-01-01

Phenotypic plasticity, such as morphological and behavioral changes in response to predators, is common in larval anurans. Less is known about inducible defenses in the embryonic stages of development. We investigated the predation risk imposed by crayfish (Procambarus nigrocinctus) on southern leopard frog (Rana sphenocephala)...

Predicting probability of occurrence and factors affecting distribution and abundance of three Ozark endemic crayfish species at multiple spatial scales

USGS Publications Warehouse

Nolen, Matthew S.; Magoulick, Daniel D.; DiStefano, Robert J.; Imhoff, Emily M.; Wagner, Brian K.

2014-01-01

We found that a range of environmental variables were important in predicting crayfish distribution and abundance at multiple spatial scales and their importance was species-, response variable- and scale dependent. We would encourage others to examine the influence of spatial scale on species distribution and abundance patterns.

Residue analysis of sixty pesticides in red swamp crayfish using QuEChERS with high-performance liquid chromatography-tandem mass spectrometry

USDA-ARS?s Scientific Manuscript database

In this study, a multi-residue analytical method using QuEChERS extraction and dispersive solid-phase extraction (d-SPE) cleanup followed by high-performance liquid chromatography–tandem mass spectrometry (HPLC-MS/MS) was developed for rapid determination of 60 pesticide residues in whole crayfish a...

Constructed microhabitat bundles for sampling fishes and crayfishes in coastal plain streams

Treesearch

Melvin L. Warren; A.L. Sheldon; W.R. Haag

2009-01-01

We investigated fish and crayfish use of standardized, constructed microhabitats (bundles) in three northern Mississippi streams. Cypress Creek and the Little Tallahatchie Canal were channelized and incised and had little woody cover; Puskus Creek was unchannelized and unincised and had abundant woody cover. We constructed three types of bundles (cane, leaf, and string...

Fishes, mussels, crayfishes, and aquatic habitats of the Hoosier-Shawnee ecological assessment area

Treesearch

M. Burr Brooks; Justin T. Sipiorski; Matthew R. Thomas; Kevin S. Cummings; Christopher A. Taylor

2004-01-01

The Hoosier-Shawnee Ecological Assessment Area, part of the Coastal Plain and Interior Low Plateau physiographic provinces, includes 194 native fish species, 76 native mussel species, and 34 native crayfish species. Five of the subregions (e.g., Mississippi Embayment) that make up the assessment area were recently ranked as either globally or bioregionally outstanding...

Conservation status of an imperiled crayfish, Faxonius marchandi Hobbs, 1948 (Decapoda: Cambaridae)

USGS Publications Warehouse

DiStefano, Robert J.; Magoulick, Daniel D.; Flinders, C.A.; Imhoff, Emily M.

2017-01-01

We summarize the distribution, ecology, threats, and conservation status of Faxonius marchandi (Hobbs, 1948), the Mammoth Spring crayfish, a limited-range endemic species to the Spring River drainage of Missouri and Arkansas, USA. The species is known from 51 locations on lower-order perennial and intermittent streams in only the eastern portion of the drainage. Faxonius marchandi is found in larger rocky substrates in shallower, slower-velocity habitats of well-buffered, mineral-rich streams. The invading alien crayfish Faxonius neglectus chaenodactylus (Williams, 1952) is the most likely threat to F. marchandi. These compiled data should serve as a baseline for future comparison, and facilitate discussion about future management, conservation, and research efforts.

Investigating the genetic and epigenetic basis of big biological questions with the parthenogenetic marbled crayfish: A review and perspectives.

PubMed

Vogt, Gunter

2018-03-01

In the last 15 years, considerable attempts have been undertaken to develop the obligately parthenogenetic marbled crayfish Procambarus virginalis as a new model in biology. Its main advantage is the production of large numbers of offspring that are genetically identical to the mother, making this crustacean particularly suitable for research in epigenetics. Now, a draft genome, transcriptome and genome-wide methylome are available opening new windows for research. In this article, I summarize the biological advantages and genomic and epigenetic features of marbled crayfish and, based on first promising data, discuss what this new model could contribute to answering of ''big'' biological questions. Genome mining is expected to reveal new insights into the genetic specificities of decapod crustaceans, the genetic basis of arthropod reproduction, moulting and immunity, and more general topics such as the genetic underpinning of adaptation to fresh water, omnivory, biomineralization, sexual system change, behavioural variation, clonal genome evolution, and resistance to cancer. Epigenetic investigations with the marbled crayfish can help clarifying the role of epigenetic mechanisms in gene regulation, tissue specification, adult stem cell regulation, cell ageing, organ regeneration and disease susceptibility. Marbled crayfish is further suitable to elucidate the relationship between genetic and epigenetic variation, the transgenerational inheritance of epigenetic signatures and the contribution of epigenetic phenotype variation to the establishment of social hierarchies, environmental adaptation and speciation. These issues can be tackled by experiments with highly standardized laboratory lineages, comparison of differently adapted wild populations and the generation of genetically and epigenetically edited strains.

Waterborne outbreak of tularemia associated with crayfish fishing.

PubMed Central

Anda, P.; Segura del Pozo, J.; Díaz García, J. M.; Escudero, R.; García Peña, F. J.; López Velasco, M. C.; Sellek, R. E.; Jiménez Chillarón, M. R.; Sánchez Serrano, L. P.; Martínez Navarro, J. F.

2001-01-01

In 1997, an outbreak of human tularemia associated with hare-hunting in central Spain affected 585 patients. We describe the identification of Francisella tularensis biovar palaearctica in a second outbreak of ulceroglandular tularemia associated with crayfish (Procambarus clarkii) fishing in a contaminated freshwater stream distant from the hare-associated outbreak. The second outbreak occurred 1 year after the first. PMID:11485678

Dainties of the first order

Treesearch

Susan B. Adams

2006-01-01

Crayfish—also known as crawfish, crawdads, mudbugs, and other colorful local names—figure prominently in human societies on several continents. In North America, many people carry fond memories of sitting by a lake, patiently catching enough crayfish on a line to fill a bucket, and later savoring the tails as a tasty, if small, appetizer. Others spent endless summer...

Multiple drivers of decline in the global status of freshwater crayfish (Decapoda: Astacidea).

PubMed

Richman, Nadia I; Böhm, Monika; Adams, Susan B; Alvarez, Fernando; Bergey, Elizabeth A; Bunn, John J S; Burnham, Quinton; Cordeiro, Jay; Coughran, Jason; Crandall, Keith A; Dawkins, Kathryn L; DiStefano, Robert J; Doran, Niall E; Edsman, Lennart; Eversole, Arnold G; Füreder, Leopold; Furse, James M; Gherardi, Francesca; Hamr, Premek; Holdich, David M; Horwitz, Pierre; Johnston, Kerrylyn; Jones, Clive M; Jones, Julia P G; Jones, Robert L; Jones, Thomas G; Kawai, Tadashi; Lawler, Susan; López-Mejía, Marilu; Miller, Rebecca M; Pedraza-Lara, Carlos; Reynolds, Julian D; Richardson, Alastair M M; Schultz, Mark B; Schuster, Guenter A; Sibley, Peter J; Souty-Grosset, Catherine; Taylor, Christopher A; Thoma, Roger F; Walls, Jerry; Walsh, Todd S; Collen, Ben

2015-02-19

Rates of biodiversity loss are higher in freshwater ecosystems than in most terrestrial or marine ecosystems, making freshwater conservation a priority. However, prioritization methods are impeded by insufficient knowledge on the distribution and conservation status of freshwater taxa, particularly invertebrates. We evaluated the extinction risk of the world's 590 freshwater crayfish species using the IUCN Categories and Criteria and found 32% of all species are threatened with extinction. The level of extinction risk differed between families, with proportionally more threatened species in the Parastacidae and Astacidae than in the Cambaridae. Four described species were Extinct and 21% were assessed as Data Deficient. There was geographical variation in the dominant threats affecting the main centres of crayfish diversity. The majority of threatened US and Mexican species face threats associated with urban development, pollution, damming and water management. Conversely, the majority of Australian threatened species are affected by climate change, harvesting, agriculture and invasive species. Only a small proportion of crayfish are found within the boundaries of protected areas, suggesting that alternative means of long-term protection will be required. Our study highlights many of the significant challenges yet to come for freshwater biodiversity unless conservation planning shifts from a reactive to proactive approach.

Neural control of behavioural choice in juvenile crayfish.

PubMed

Liden, William H; Phillips, Mary L; Herberholz, Jens

2010-11-22

Natural selection leads to behavioural choices that increase the animal's fitness. The neuronal mechanisms underlying behavioural choice are still elusive and empirical evidence connecting neural circuit activation to adaptive behavioural output is sparse. We exposed foraging juvenile crayfish to approaching shadows of different velocities and found that slow-moving shadows predominantly activated a pair of giant interneurons, which mediate tail-flips that thrust the animals backwards and away from the approaching threat. Tail-flips also moved the animals farther away from an expected food source, and crayfish defaulted to freezing behaviour when faced with fast-approaching shadows. Under these conditions, tail-flipping, an ineffective and costly escape strategy was suppressed in favour of freezing, a more beneficial choice. The decision to freeze also dominated in the presence of a more desirable resource; however, the increased incentive was less effective in suppressing tail-flipping when paired with slow-moving visual stimuli that reliably evoked tail-flips in most animals. Together this suggests that crayfish make value-based decisions by weighing the costs and benefits of different behavioural options, and they select adaptive behavioural output based on the activation patterns of identifiable neural circuits.

Amine Neurochemistry and Aggression in Crayfish

PubMed Central

Panksepp, Jules B.; Yue, Zhaoxia; Drerup, Catherine; Huber, Robert

2016-01-01

A primary goal of our research is to explore proximate mechanisms important in recruiting adaptive social behaviors. For instance, if one of three different behaviors may be expressed in a particular set of circumstances, how do neurochemical mechanisms bias behavior towards the expression of one act in lieu of the other possibilities? In this article, we review recent results suggesting that serotonin may play such a role in the control of aggression in crayfish. First, we summarize techniques that have been optimized for sensitive characterization of neurochemical profiles in crayfish. Then, borrowing concepts from behavioral ecology, we review a framework for quantitative investigation, which regards behavior as a set of individual decisions, each with a particular probability for occurrence, a motivational context, and controlled by its own distinct neurochemical mechanisms. PMID:12539165

Relative distribution and abundance of fishes and crayfish in 2010 and 2014 prior to saltcedar (Tamarix ssp.) removal in the Amargosa River Canyon, southeastern California

USGS Publications Warehouse

Hereford, Mark E.

2016-07-22

The Amargosa River Canyon, located in the Mojave Desert of southeastern California, contains the longest perennial reach of the Amargosa River. Because of its diverse flora and fauna, it has been designated as an Area of Critical Environmental Concern and a Wild and Scenic River by the Bureau of Land Management. A survey of fishes conducted in summer 2010 indicated that endemic Amargosa River pupfish (Cyprinodon nevadensis amargosae) and speckled dace (Rhinichthys osculus spp.) were abundant and occurred throughout the Amargosa River Canyon. The 2010 survey reported non-native red swamp crayfish (Procambarus clarkii) and western mosquitofish (Gambusia affinis) captures were significantly higher, whereas pupfish captures were lower, in areas dominated by non-native saltcedar (Tamarix ssp.). Based on the 2010 survey, it was hypothesized that the invasion of saltcedar could result in a decrease in native species. In an effort to maintain and enhance native fish populations, the Bureau of Land Management removed saltcedar from a 1,550 meter reach of stream on the Amargosa River in autumn 2014 and autumn 2015. Prior to the removal of saltcedar, a survey of fishes and crayfish using baited minnow traps was conducted in the treatment reach to serve as a baseline for future comparisons with post-saltcedar removal surveys. During the 2014 survey, 1,073 pupfish and 960 speckled dace were captured within the treatment reach. Catch per unit effort of pupfish and speckled dace in the treatment reach was less in 2014 than in 2010, although differences could be owing to seasonal variation in capture probability. Non-native mosquitofish catch per unit effort decreased from 2010 to 2014; however, the catch per unit effort of crayfish increased from 2010 to 2014. Future monitoring efforts of this reach should be conducted at the same time period to account for potential seasonal fluctuations of abundance and distribution of fishes and crayfish. A more robust study design that accounts for variation in capture probability could be implemented to quantify the effects of habitat modifications on abundance of fishes and crayfish.

Differential gene expression profile from haematopoietic tissue stem cells of red claw crayfish, Cherax quadricarinatus, in response to WSSV infection.

PubMed

Liu, Hai-peng; Chen, Rong-yuan; Zhang, Qiu-xia; Peng, Hui; Wang, Ke-jian

2011-07-01

White spot syndrome virus (WSSV) is one of the most important viral pathogens in crustaceans. During WSSV infection, multiple cell signaling cascades are activated, leading to the generation of antiviral molecules and initiation of programmed cell death of the virus infected cells. To gain novel insight into cell signaling mechanisms employed in WSSV infection, we have used suppression subtractive hybridization (SSH) to elucidate the cellular response to WSSV challenge at the gene level in red claw crayfish haematopoietic tissue (Hpt) stem cell cultures. Red claw crayfish Hpt cells were infected with WSSV for 1h (L1 library) and 12h (L12 library), respectively, after which the cell RNA was prepared for SSH using uninfected cells as drivers. By screening the L1 and L12 forward libraries, we have isolated the differentially expressed genes of crayfish Hpt cells upon WSSV infection. Among these genes, the level of many key molecules showed clearly up-regulated expression, including the genes involved in immune responses, cytoskeletal system, signal transduction molecules, stress, metabolism and homestasis related genes, and unknown genes in both L1 and L12 libraries. Importantly, of the 2123 clones screened, 176 novel genes were found the first time to be up-regulated in WSSV infection in crustaceans. To further confirm the up-regulation of differentially expressed genes, the semi-quantitative RT-PCR were performed to test twenty randomly selected genes, in which eight of the selected genes exhibited clear up-regulation upon WSSV infection in red claw crayfish Hpt cells, including DNA helicase B-like, multiprotein bridging factor 1, apoptosis-linked gene 2 and an unknown gene-L1635 from L1 library; coatomer gamma subunit, gabarap protein gene, tripartite motif-containing 32 and an unknown gene-L12-254 from L2 library, respectively. Taken together, as well as in immune and stress responses are regulated during WSSV infection of crayfish Hpt cells, our results also light the significance of cytoskeletal system, signal transduction and other unknown genes in the regulation of antiviral signals during WSSV infection. Copyright © 2011 Elsevier Ltd. All rights reserved.

Population-Level Metrics of Trophic Structure Based on Stable Isotopes and Their Application to Invasion Ecology

PubMed Central

Jackson, Michelle C.; Donohue, Ian; Jackson, Andrew L.; Britton, J. Robert; Harper, David M.; Grey, Jonathan

2012-01-01

Biological invasions are a significant driver of human-induced global change and many ecosystems sustain sympatric invaders. Interactions occurring among these invaders have important implications for ecosystem structure and functioning, yet they are poorly understood. Here we apply newly developed metrics derived from stable isotope data to provide quantitative measures of trophic diversity within populations or species. We then use these to test the hypothesis that sympatric invaders belonging to the same functional feeding group occupy a smaller isotopic niche than their allopatric counterparts. Two introduced, globally important, benthic omnivores, Louisiana swamp crayfish (Procambarus clarkii) and carp (Cyprinus carpio), are sympatric in Lake Naivasha, Kenya. We applied our metrics to an 8-year data set encompassing the establishment of carp in the lake. We found a strong asymmetric interaction between the two invasive populations, as indicated by inverse correlations between carp abundance and measures of crayfish trophic diversity. Lack of isotopic niche overlap between carp and crayfish in the majority of years indicated a predominantly indirect interaction. We suggest that carp-induced habitat alteration reduced the diversity of crayfish prey, resulting in a reduction in the dietary niche of crayfish. Stable isotopes provide an integrated signal of diet over space and time, offering an appropriate scale for the study of population niches, but few isotope studies have retained the often insightful information revealed by variability among individuals in isotope values. Our population metrics incorporate such variation, are robust to the vagaries of sample size and are a useful additional tool to reveal subtle dietary interactions among species. Although we have demonstrated their applicability specifically using a detailed temporal dataset of species invasion in a lake, they have a wide array of potential ecological applications. PMID:22363724

Population-level metrics of trophic structure based on stable isotopes and their application to invasion ecology.

PubMed

Jackson, Michelle C; Donohue, Ian; Jackson, Andrew L; Britton, J Robert; Harper, David M; Grey, Jonathan

2012-01-01

Biological invasions are a significant driver of human-induced global change and many ecosystems sustain sympatric invaders. Interactions occurring among these invaders have important implications for ecosystem structure and functioning, yet they are poorly understood. Here we apply newly developed metrics derived from stable isotope data to provide quantitative measures of trophic diversity within populations or species. We then use these to test the hypothesis that sympatric invaders belonging to the same functional feeding group occupy a smaller isotopic niche than their allopatric counterparts. Two introduced, globally important, benthic omnivores, Louisiana swamp crayfish (Procambarus clarkii) and carp (Cyprinus carpio), are sympatric in Lake Naivasha, Kenya. We applied our metrics to an 8-year data set encompassing the establishment of carp in the lake. We found a strong asymmetric interaction between the two invasive populations, as indicated by inverse correlations between carp abundance and measures of crayfish trophic diversity. Lack of isotopic niche overlap between carp and crayfish in the majority of years indicated a predominantly indirect interaction. We suggest that carp-induced habitat alteration reduced the diversity of crayfish prey, resulting in a reduction in the dietary niche of crayfish. Stable isotopes provide an integrated signal of diet over space and time, offering an appropriate scale for the study of population niches, but few isotope studies have retained the often insightful information revealed by variability among individuals in isotope values. Our population metrics incorporate such variation, are robust to the vagaries of sample size and are a useful additional tool to reveal subtle dietary interactions among species. Although we have demonstrated their applicability specifically using a detailed temporal dataset of species invasion in a lake, they have a wide array of potential ecological applications.

Putting prey back together again: integrating predator-induced behavior, morphology, and life history.

PubMed

Hoverman, Jason T; Auld, Josh R; Relyea, Rick A

2005-07-01

The last decade has seen an explosion in the number of studies exploring predator-induced plasticity. Recently, there has been a call for more comprehensive approaches that can identify functional relationships between traits, constraints on phenotypic responses, and the cost and benefits of alternative phenotypes. In this study, we exposed Helisoma trivolvis, a freshwater snail, to a factorial combination of three resource levels and five predator environments (no predator, one or two water bugs, and one or two crayfish) and examined ten traits including behavior, morphology, and life history. Each predator induced a unique suite of behavioral and morphological responses. Snails increased near-surface habitat use with crayfish but not with water bugs. Further, crayfish induced narrow and high shells whereas water bugs induced wide shells and wide apertures. In terms of life history, both predators induced delayed reproduction and greater mass at reproduction. However, crayfish induced a greater delay in reproduction that resulted in reduced fecundity whereas water bugs did not induce differences in fecundity. Resource levels impacted the morphology of H. trivolvis; snails reared with greater resource levels produced higher shells, narrower shells, and wider apertures. Resource levels also impacted snail life history; lower resources caused longer times to reproduction and reduced fecundity. Based on an analysis of phenotypic correlations, the morphological responses to each predator most likely represent phenotypic trade-offs. Snails could either produce invasion-resistant shells for defense against water bugs or crush-resistant shells for defense against crayfish, but not both. Our use of a comprehensive approach to examine the responses of H. trivolvis has provided important information regarding the complexity of phenotypic responses to different environments, the patterns of phenotypic integration across environments, and the potential costs and benefits associated with plastic traits.

Granulocytes of the red claw crayfish Cherax quadricarinatus can endocytose beads, E. coli and WSSV, but in different ways.

PubMed

Duan, Hu; Jin, Songjun; Zhang, Yan; Li, Fuhua; Xiang, Jianhai

2014-10-01

The hemocytes of the red claw crayfish Cherax quadricarinatus are classified by morphologic observation into the following types: hyalinocytes (H), semi-granulocytes (SG) and granulocytes (G). Density gradient centrifugation with Percoll was developed to separate these three subpopulations of hemocytes. Beads, Escherichia coli, and FITC labeling WSSV were used to investigate the characteristics of granulocytes by using scanning electron microscope, transmission electron microscope, and laser scan confocal microscope. Results showed that granulocytes could phagocytose beads and E. coli by endocytic pathways. WSSV could rely on caveolae-mediated endocytosis to mainly enter into granulocytes. These results could elucidate the mechanism of the innate immunity function of granulocytes, and it also showed the mechanism by which WSSV invaded granulocytes in the red claw crayfish. Copyright © 2014 Elsevier Ltd. All rights reserved.

Sex identification in female crayfish is bimodal

NASA Astrophysics Data System (ADS)

Aquiloni, Laura; Massolo, Alessandro; Gherardi, Francesca

2009-01-01

Sex identification has been studied in several species of crustacean decapods but only seldom was the role of multimodality investigated in a systematic fashion. Here, we analyse the effect of single/combined chemical and visual stimuli on the ability of the crayfish Procambarus clarkii to identify the sex of a conspecific during mating interactions. Our results show that crayfish respond to the offered stimuli depending on their sex. While males rely on olfaction alone for sex identification, females require the combination of olfaction and vision to do so. In the latter, chemical and visual stimuli act as non-redundant signal components that possibly enhance the female ability to discriminate potential mates in the crowded social context experienced during mating period. This is one of the few clear examples in invertebrates of non-redundancy in a bimodal communication system.

Multiple drivers of decline in the global status of freshwater crayfish (Decapoda: Astacidea)

PubMed Central

Richman, Nadia I.; Böhm, Monika; Adams, Susan B.; Alvarez, Fernando; Bergey, Elizabeth A.; Bunn, John J. S.; Burnham, Quinton; Cordeiro, Jay; Coughran, Jason; Crandall, Keith A.; Dawkins, Kathryn L.; DiStefano, Robert J.; Doran, Niall E.; Edsman, Lennart; Eversole, Arnold G.; Füreder, Leopold; Furse, James M.; Gherardi, Francesca; Hamr, Premek; Holdich, David M.; Horwitz, Pierre; Johnston, Kerrylyn; Jones, Clive M.; Jones, Julia P. G.; Jones, Robert L.; Jones, Thomas G.; Kawai, Tadashi; Lawler, Susan; López-Mejía, Marilu; Miller, Rebecca M.; Pedraza-Lara, Carlos; Reynolds, Julian D.; Richardson, Alastair M. M.; Schultz, Mark B.; Schuster, Guenter A.; Sibley, Peter J.; Souty-Grosset, Catherine; Taylor, Christopher A.; Thoma, Roger F.; Walls, Jerry; Walsh, Todd S.; Collen, Ben

2015-01-01

Rates of biodiversity loss are higher in freshwater ecosystems than in most terrestrial or marine ecosystems, making freshwater conservation a priority. However, prioritization methods are impeded by insufficient knowledge on the distribution and conservation status of freshwater taxa, particularly invertebrates. We evaluated the extinction risk of the world's 590 freshwater crayfish species using the IUCN Categories and Criteria and found 32% of all species are threatened with extinction. The level of extinction risk differed between families, with proportionally more threatened species in the Parastacidae and Astacidae than in the Cambaridae. Four described species were Extinct and 21% were assessed as Data Deficient. There was geographical variation in the dominant threats affecting the main centres of crayfish diversity. The majority of threatened US and Mexican species face threats associated with urban development, pollution, damming and water management. Conversely, the majority of Australian threatened species are affected by climate change, harvesting, agriculture and invasive species. Only a small proportion of crayfish are found within the boundaries of protected areas, suggesting that alternative means of long-term protection will be required. Our study highlights many of the significant challenges yet to come for freshwater biodiversity unless conservation planning shifts from a reactive to proactive approach. PMID:25561679

Biochemical response of crayfish Astacus leptodactylus exposed to textile wastewater treated by indigenous white rot fungus Coriolus versicolor.

PubMed

Aksu, Onder; Yildirim, Nuran Cikcikoglu; Yildirim, Numan; Danabas, Durali; Danabas, Seval

2015-02-01

The discharge of textile effluents into the environment without appropriate treatment poses a serious threat for the aquatic organisms. The present study was undertaken to investigate biochemical response of crayfish Astacus leptodactylus exposed to textile wastewater (TW) treated by indigenous white rot fungus Coriolus versicolor. Glutathione S-transferase (GST), cytochrome P450 1A1 (CYP1A1), and acetylcholinesterase (AchE) levels in hepatopancreas and abdomen tissues of crayfish exposed to untreated, treated, and diluted rates (1/10) in both TW during 24 and 96 h were tested. Physiochemical parameters (electrical conductivity (EC), chemical oxygen demand (COD), pH, and total dissolved solid (TDS)) of TW were determined before and after treatment. Physiochemical parameters of TW decreased after treatment. The GST activity and AchE were generally increased, but CYP1A1 activity was decreased in hepatopancreas tissue of crayfish exposed to different kinds of untreated TW. After treatment by indigenous white rot fungus (C. versicolor), GST and CYP1A1 activities were returned to control values, while AchE activities were increasing further. In this study, only GST and CYP1A1 activities of A. leptodactylus confirmed the efficiency of TW treatment with C. versicolor.

Isotopic evidence for methane-based chemosynthesis in the Upper Floridan aquifer food web.

PubMed

Opsahl, Stephen P; Chanton, Jeffrey P

2006-11-01

Anecdotal observations of the Dougherty plain cave crayfish (Cambarus cryptodytes), the Georgia blind cave salamander (Haideotriton wallacei), and albinistic isopods (Caecidotea sp.) at great depths below the land surface and distant from river corridors suggest that obligate aquifer-dwelling (troglobitic) organisms are widely distributed throughout the limestone Upper Floridan aquifer (UFA). One mechanism by which subterranean life can proliferate in an environment void of plant productivity is through a microbial food web that includes chemosynthesis. We examined this possibility in the UFA by measuring the isotopic composition ((13)C, (14)C, and (15)N) of tissues from troglobitic macrofauna. Organisms that were captured by cave divers entering into spring conduits had delta(13)C values that suggested plant matter as a primary food resource (cave crayfish, -24.6 +/- 2.7 per thousand, n = 9). In contrast, delta(13)C values were significantly depleted in organisms retrieved from wells drilled into areas of the UFA remote from spring and sinkhole conduits (cave crayfish -34.7 +/- 9.8 per thousand, n = 10). Depleted (13)C values in crayfish were correlated with radiocarbon (Delta(14)C) depletion relative to modern values. The results suggest that methane-based microbial chemosynthetic pathways support organisms living in the remote interior of the aquifer, at least in part.

Comparative Ultrastructure and Carbohydrate Composition of Gastroliths from Astacidae, Cambaridae and Parastacidae Freshwater Crayfish (Crustacea, Decapoda)

PubMed Central

Luquet, Gilles; Fernández, María S.; Badou, Aïcha; Guichard, Nathalie; Roy, Nathalie Le; Corneillat, Marion; Alcaraz, Gérard; Arias, José L.

2012-01-01

Crustaceans have to cyclically replace their rigid exoskeleton in order to grow.Most of them harden this skeleton by a calcification process. Some decapods (land crabs, lobsters and crayfish) elaborate calcium storage structures as a reservoir of calcium ions in their stomach wall, as so-called gastroliths. For a better understanding of the cyclic elaboration of these calcium deposits, we studied the ultrastructure of gastroliths from freshwater crayfish by using a combination of microscopic and physical techniques. Because sugars are also molecules putatively involved in the elaboration process of these biomineralizations, we also determined their carbohydrate composition. This study was performed in a comparative perspective on crayfish species belonging to the infra-order Astacidea (Decapoda, Malacostraca): three species from the Astacoidea superfamily and one species from the Parastacoidea superfamily. We observed that all the gastroliths exhibit a similar dense network of protein-chitin fibers, from macro- to nanoscale, within which calcium is precipitated as amorphous calcium carbonate. Nevertheless, they are not very similar at the molecular level, notably as regards their carbohydrate composition. Besides glucosamine, the basic carbohydrate component of chitin, we evidenced the presence of other sugars, some of which are species-specific like rhamnose and galacturonic acid whereas xylose and mannose could be linked to proteoglycan components. PMID:24970155

Microhabitat parameters and life-history characteristics of fallicambarus gordonz fitzpatrick, a crayfish associated with pitcher-plant bogs in southern Mississippi

Treesearch

Carol E. Johnston; Chester Figiel

1997-01-01

Fallicambarus gordoni, a crayfish found only in pitcher-plant bogs, is restricted to the DeSoto National Forest, Perry County, Mississippi, U.S.A. The species is active from late fall through late spring, and apparentiy estivates during the summer when bogs are dry. Ovigerous females were found in late fall and winter, and small juveniles were collected in February....

Model for the accumulation of strontium and calcium by recently molted crayfish (Cambarus longulus longerostris Ort.)

DOE Office of Scientific and Technical Information (OSTI.GOV)

SCHURR, J. M.; STAMPER, M. N.

1962-10-01

After molting, crayfish absorbed Sr 85 rapidly; rates of uptake decreased exponentially as an upper limit was approached (T 1/2 = 1 to 2 days). A simple mathematical model attributes this limit to the number of sites available for deposition in the exoskeleton. Deposited ions are relatively immobile until 2 to 4 days prior to the next molt, when some are redistributed to the calcareous gastroliths prior to reuse.

Information Summary, Area of Concern: Grand Calumet River, Indiana

DTIC Science & Technology

1991-03-01

Indiana Harbor and Adjacent Lake Michigan (Source Rl, Table 4) 10 Concentrations of 26 Major, Minor and Trace Elements in Sediments from Indiana Harbor...2 Dec 84 (Source R39, Table 2) 68 Concentrations of Major, Minor , and Trace Elements in Fish and Crayfish from Indiana Harbor and Adjacent Lake...Table 21b) 71 Catch per Unit Effort in Crayfish Traps (Source Rl, Table 21c) 72 Concentratiors of Major, Minor , and Trace Elements in Periphyton and

Aquatic dissipation of triclopyr in Lake Seminole, Georgia

USGS Publications Warehouse

Woodburn, K.B.; Green, W.R.; Westerdahl, H.E.

1993-01-01

A field study was conducted to evaluate the environmental dissipation of triclopyr herbicide under aquatic-use conditions. Three 4-h plots in Lake Seminole, Georgia, were selected for use: one control, one aerial plot, and one subsurface plot; both applications were at the maximum aquatic-use rate of 2.5 mg/L. Water, sediment, plants, fish, clams, and crayfish were all analyzed for residues, and water temperature, oxygen levels, pH, and conductivity were monitored. The half-life for aqueous-phase triclopyr ranged from 0.5 to 3.6 days, and the dissipation in surface and bottom waters was equivalent. The intermediate decay product of triclopyr, 3,5,6-trichloro-2-pyridinol (TCP), had an observed aquatic half-life of less than 1 day. No accumulation of triclopyr or TCP on sediment was observed. The half-life of triclopyr metabolized by aquatic plants averaged 4 days. Fish species did not exhibit any bioconcentration of triclopyr or TCP, with only trace amounts of either compound found in fish tissue. Both clams and crayfish contained detectable residues of triclopyr. The elimination of triclopyr from clam tissue was more rapid, with an observed half-life of 1.5 days, vs 12 days for crayfish; retention of triclopyr in the crayfish carcass (carapace, chelopeds, and gills) may have been an important mechanism. There was no detectable decline in water quality in either treatment plot. ?? 1993 American Chemical Society.

Concentrations of elements in fish fillets, fish muscle plugs, and crayfish from the 2011 Missouri Department of Conservation general contaminant monitoring program

USGS Publications Warehouse

May, Thomas W.; Walther, Michael J.; Brumbaugh, William G.; McKee, Michael J.

2013-01-01

This report presents the results of a contaminant monitoring survey conducted annually by the Missouri Department of Conservation to examine the levels of selected elemental contaminants in fish fillets, fish muscle plugs, and crayfish. Fillet samples of yellow bullhead (Ameiurus natalis), golden redhorse (Moxostoma erythrurum), longear sunfish (Lepomis megalotis), and channel catfish (Ictalurus punctatus) were collected from six sites as part of the Missouri Department of Conservation’s Fish Contaminant Monitoring Program. Fish dorsal muscle plugs were collected from largemouth bass (Micropterus salmoides) at eight of the sites, and crayfish from two sites. Following preparation and analysis of the samples, highlights of the data were as follows: cadmium and lead residues were most elevated in crayfish tissue samples from the Big River at Cherokee Landing, with 1 to 8 micrograms per gram dry weight and 22 to 45 micrograms per gram dry weight, respectively. Some dorsal muscle plugs from largemouth bass collected from Clearwater Lake, Lake St. Louis, Noblett Lake, Hazel Creek Lake, and Harrison County Lake contained mercury residues (1.7 to 4.7 micrograms per gram dry weight) that exceeded the U.S. Environmental Protection Agency Water Quality Criterion of 1.5 micrograms per gram dry weight of fish tissue (equivalent to 0.30 micrograms per gram wet weight).

Comparative cold resistance of three Columbia River organisms. [Thermal stresses, fishes, Crustaceans

DOE Office of Scientific and Technical Information (OSTI.GOV)

Becker, C.H.; Genoway, R.G.; Schneider, M.J.

1977-01-01

Resistance to abrupt and gradual cold shock was determined in bioassays with pumpkinseed (Lepomis gibbosus), rainbow trout (Salmo gairdneri) and a northwestern crayfish (Pacifastacus leniusculus) acclimated to higher temperatures at 5 C increments. Test criteria were median tolerance limits (TLm) for 96-h exposures after abrupt cold shock, and 50% loss of equilibrium (LE50) for decline rates of 18, 15, 10, 5 and 1 C/h during gradual cold shock. Cold resistance depended on original acclimation temperature (AT) and varied among species under both test conditions in the order: pumpkinseed < rainbow trout < crayfish. The lower TLm limit for pumpkinseed wasmore » 12.3 C at 30 C AT, 9.6 C at 25 C AT, 4.5 C at 20 C AT, and 2.7 C at 15 C AT. Rainbow trout at 20, 15 and 10 C AT survived abrupt exposures to cold down to 3.3, 1.4 and 0.5 C, respectively. Crayfish at 25, 20 and 15 C AT survived exposures down to 2.5, 0.4 and 0.0 C, respectively. TLm values were slightly above LE50 values for both fish species but well below for crayfish. Partial adaptation significantly lowered LE values at decline rates below 18 C/h for pumpkinseed, and to a lesser extent for the other two species, thus extending the lower margin of cold resistance.« less

Biological Diversity, Ecological Health and Condition of Aquatic Assemblages at National Wildlife Refuges in Southern Indiana, USA

PubMed Central

Morris, Charles C.; Robb, Joseph R.; McCoy, William

2015-01-01

Abstract The National Wildlife Refuge system is a vital resource for the protection and conservation of biodiversity and biological integrity in the United States. Surveys were conducted to determine the spatial and temporal patterns of fish, macroinvertebrate, and crayfish populations in two watersheds that encompass three refuges in southern Indiana. The Patoka River National Wildlife Refuge had the highest number of aquatic species with 355 macroinvertebrate taxa, six crayfish species, and 82 fish species, while the Big Oaks National Wildlife Refuge had 163 macroinvertebrate taxa, seven crayfish species, and 37 fish species. The Muscatatuck National Wildlife Refuge had the lowest diversity of macroinvertebrates with 96 taxa and six crayfish species, while possessing the second highest fish species richness with 51 species. Habitat quality was highest in the Muscatatuck River drainage with increased amounts of forested habitats compared to the Patoka River drainage. Biological integrity of the three refuges ranked the Patoka NWR as the lowest biological integrity (mean IBI reach scores = 35 IBI points), while Big Oaks had the highest biological integrity (mean IBI reach score = 41 IBI points). The Muscatatuck NWR had a mean IBI reach score of 31 during June, which seasonally increased to a mean of 40 IBI points during summer. Watershed IBI scores and habitat condition were highest in the Big Oaks NWR. PMID:25632261

Invasion biology in non-free-living species: interactions between abiotic (climatic) and biotic (host availability) factors in geographical space in crayfish commensals (Ostracoda, Entocytheridae)

PubMed Central

Mestre, Alexandre; Aguilar-Alberola, Josep A; Baldry, David; Balkis, Husamettin; Ellis, Adam; Gil-Delgado, Jose A; Grabow, Karsten; Klobučar, Göran; Kouba, Antonín; Maguire, Ivana; Martens, Andreas; Mülayim, Ayşegül; Rueda, Juan; Scharf, Burkhard; Soes, Menno; S Monrós, Juan; Mesquita-Joanes, Francesc

2013-01-01

In invasion processes, both abiotic and biotic factors are considered essential, but the latter are usually disregarded when modeling the potential spread of exotic species. In the framework of set theory, interactions between biotic (B), abiotic (A), and movement-related (M) factors in the geographical space can be hypothesized with BAM diagrams and tested using ecological niche models (ENMs) to estimate A and B areas. The main aim of our survey was to evaluate the interactions between abiotic (climatic) and biotic (host availability) factors in geographical space for exotic symbionts (i.e., non-free-living species), using ENM techniques combined with a BAM framework and using exotic Entocytheridae (Ostracoda) found in Europe as model organisms. We carried out an extensive survey to evaluate the distribution of entocytherids hosted by crayfish in Europe by checking 94 European localities and 12 crayfish species. Both exotic entocytherid species found, Ankylocythere sinuosa and Uncinocythere occidentalis, were widely distributed in W Europe living on the exotic crayfish species Procambarus clarkii and Pacifastacus leniusculus, respectively. No entocytherids were observed in the remaining crayfish species. The suitable area for A. sinuosa was mainly restricted by its own limitations to minimum temperatures in W and N Europe and precipitation seasonality in circum-Mediterranean areas. Uncinocythere occidentalis was mostly restricted by host availability in circum-Mediterranean regions due to limitations of P. leniusculus to higher precipitation seasonality and maximum temperatures. The combination of ENMs with set theory allows studying the invasive biology of symbionts and provides clues about biogeographic barriers due to abiotic or biotic factors limiting the expansion of the symbiont in different regions of the invasive range. The relative importance of abiotic and biotic factors on geographical space can then be assessed and applied in conservation plans. This approach can also be implemented in other systems where the target species is closely interacting with other taxa. PMID:24455152

River bank burrowing by invasive crayfish: Spatial distribution, biophysical controls and biogeomorphic significance.

PubMed

Faller, Matej; Harvey, Gemma L; Henshaw, Alexander J; Bertoldi, Walter; Bruno, Maria Cristina; England, Judy

2016-11-01

Invasive species generate significant global environmental and economic costs and represent a particularly potent threat to freshwater systems. The biogeomorphic impacts of invasive aquatic and riparian species on river processes and landforms remain largely unquantified, but have the potential to generate significant sediment management issues within invaded catchments. Several species of invasive (non-native) crayfish are known to burrow into river banks and visual evidence of river bank damage is generating public concern and media attention. Despite this, there is a paucity of understanding of burrow distribution, biophysical controls and the potential significance of this problem beyond a small number of local studies at heavily impacted sites. This paper presents the first multi-catchment analysis of this phenomenon, combining existing data on biophysical river properties and invasive crayfish observations with purpose-designed field surveys across 103 river reaches to derive key trends. Crayfish burrows were observed on the majority of reaches, but burrowing tended to be patchy in spatial distribution, concentrated in a small proportion (<10%) of the length of rivers surveyed. Burrow distribution was better explained by local bank biophysical properties than by reach-scale properties, and burrowed banks were more likely to be characterised by cohesive bank material, steeper bank profiles with large areas of bare bank face, often on outer bend locations. Burrow excavation alone has delivered a considerable amount of sediment to invaded river systems in the surveyed sites (3tkm(-1) impacted bank) and this represents a minimum contribution and certainly an underestimate of the absolute yield (submerged burrows were not recorded). Furthermore, burrowing was associated with bank profiles that were either actively eroding or exposed to fluvial action and/or mass failure processes, providing the first quantitative evidence that invasive crayfish may cause or accelerate river bank instability and erosion in invaded catchments beyond the scale of individual burrows. Copyright © 2016 Elsevier B.V. All rights reserved.

Invasion biology in non-free-living species: interactions between abiotic (climatic) and biotic (host availability) factors in geographical space in crayfish commensals (Ostracoda, Entocytheridae).

PubMed

Mestre, Alexandre; Aguilar-Alberola, Josep A; Baldry, David; Balkis, Husamettin; Ellis, Adam; Gil-Delgado, Jose A; Grabow, Karsten; Klobučar, Göran; Kouba, Antonín; Maguire, Ivana; Martens, Andreas; Mülayim, Ayşegül; Rueda, Juan; Scharf, Burkhard; Soes, Menno; S Monrós, Juan; Mesquita-Joanes, Francesc

2013-12-01

In invasion processes, both abiotic and biotic factors are considered essential, but the latter are usually disregarded when modeling the potential spread of exotic species. In the framework of set theory, interactions between biotic (B), abiotic (A), and movement-related (M) factors in the geographical space can be hypothesized with BAM diagrams and tested using ecological niche models (ENMs) to estimate A and B areas. The main aim of our survey was to evaluate the interactions between abiotic (climatic) and biotic (host availability) factors in geographical space for exotic symbionts (i.e., non-free-living species), using ENM techniques combined with a BAM framework and using exotic Entocytheridae (Ostracoda) found in Europe as model organisms. We carried out an extensive survey to evaluate the distribution of entocytherids hosted by crayfish in Europe by checking 94 European localities and 12 crayfish species. Both exotic entocytherid species found, Ankylocythere sinuosa and Uncinocythere occidentalis, were widely distributed in W Europe living on the exotic crayfish species Procambarus clarkii and Pacifastacus leniusculus, respectively. No entocytherids were observed in the remaining crayfish species. The suitable area for A. sinuosa was mainly restricted by its own limitations to minimum temperatures in W and N Europe and precipitation seasonality in circum-Mediterranean areas. Uncinocythere occidentalis was mostly restricted by host availability in circum-Mediterranean regions due to limitations of P. leniusculus to higher precipitation seasonality and maximum temperatures. The combination of ENMs with set theory allows studying the invasive biology of symbionts and provides clues about biogeographic barriers due to abiotic or biotic factors limiting the expansion of the symbiont in different regions of the invasive range. The relative importance of abiotic and biotic factors on geographical space can then be assessed and applied in conservation plans. This approach can also be implemented in other systems where the target species is closely interacting with other taxa.

Evaluation of physicochemical and physical habitat associations for Cambarus callainus (Big Sandy crayfish), an imperilled crayfish endemic to the Central Appalachians

USGS Publications Warehouse

Loughman, Zachary J.; Welsh, Stuart A.; Sadecky, Nicole M.; Dillard, Zachary W.; Scott, R. Katie

2017-01-01

1. Crayfish represent one of the most imperilled animal groups on the planet. Habitat degradation, destruction and fragmentation, introduction of invasive crayfishes, and a lack of applied biological information have all been identified as agents thwarting crayfish conservation.2. Cambarus callainus was warranted federal protection by the United States Fish and Wildlife Service (USFWS) in April, 2016. As part of the USFWS listing procedure, a survey for C. callainus in the Big Sandy River catchment was conducted to determine points of occurrence with a secondary objective of determining reach level physical habitat and physicochemical correlates of C. callainus presence and absence.3. At each site, physicochemical and physical habitat data were collected to determine the influence of abiotic covariates on the presence of C. callainus. Cambarus callainus presence or absence and associated site covariates were modelled using logistic regression.4. Survey results recorded C. callainus at 39 sites in the Upper Levisa Fork (ULF) and Tug Fork (TF) drainages of the Big Sandy River; no C. callainus were collected in the Lower Levisa Fork (LLF). An additive effects model of physical habitat quality (Basin + Boulder presence/embeddedness) was the only model selected, supporting an association of C. callainus with slab boulders, open interstitial spaces, and moderate to no sedimentation. All sites lacking C. callainus were experiencing some degree of sedimentation. Physicochemical covariates were not supported by the data.5. Results indicated that good quality habitat was lacking in the LLF, but was present in the ULF and TF catchments, with ULF supporting the most robust populations and most suitable habitat. Effective conservation for C. callainus should focus on efforts that limit sedimentation as well as restore good quality instream habitat in the greater Big Sandy catchment.

Negative impacts of elevated nitrate on physiological performance are not exacerbated by low pH.

PubMed

Gomez Isaza, Daniel F; Cramp, Rebecca L; Franklin, Craig E

2018-05-15

Multiple environmental stressors, including nutrient effluents (i.e. nitrates [NO 3 - ]) and altered pH regimes, influence the persistence of freshwater species in anthropogenically disturbed habitats. Independently, nitrate and low pH affect energy allocation by increasing maintenance costs and disrupting oxygen uptake, which ultimately results in impacts upon whole animal performance. However, the interaction between these two stressors has not been characterised. To address this, the effects of nitrate and pH and their interaction on aerobic scope and physiological performance were investigated in the blueclaw crayfish, Cherax destructor. Crayfish were exposed to a 2 × 3 factorial combination, with two pH levels (pH 5.0 and 7.0) and three nitrate concentrations (0, 50 and 100 mg L -1 NO 3 - ). Crayfish were exposed to experimental conditions for 65 days and growth and survival were monitored. Aerobic scope (i.e. maximal - standard oxygen uptake) was measured at six time points (1, 3, 5, 7, 14, and 21 days) during exposure to experimental treatments. Crayfish performance was assessed after 28 days, by measuring chelae strength and whole animal activity capacity via the righting response. Survival was reduced in crayfish exposed to pH 5.0, but there was no exacerbation of this effect by exposure to high nitrate levels. Aerobic scope was compromised by the interaction between low pH and nitrate and resulted in prolonged elevations of standard oxygen uptake rates. Exposure to nitrate alone affected aerobic scope, causing a 59% reduction in maximum oxygen uptake. Reduced aerobic capacity translated to reduced chelae strength and righting capacity. Together, these data show that low pH and elevated nitrate levels reduce aerobic scope and translate to poorer performance in C. destructor, which may have the potential to affect organismal fitness in disturbed habitats. Copyright © 2018 Elsevier B.V. All rights reserved.

A new dwarf crayfish (Decapoda: Cambaridae) from floodplain swamps in central Alabama.

PubMed

Schuster, Guenter A; Kendrick, Michael R

2017-03-05

Cambarellus (Pandicambarus) rotatus, new species, is a dwarf crayfish from floodplain swamps in the Tombigbee and Black Warrior river drainages of Greene, Hale, and Marengo counties, Alabama. The new species is morphologically most similar to Cambarellus (Pandicambarus) lesliei. They differ in a several morphological characters. Cambarellus rotatus, new species, has gonopods that are rotated mesially so that the terminal elements oppose each other, and they have a short C-shaped sperm groove. These are unique features among known species of Cambarellus.

Development of crayfish bio-based plastic materials processed by small-scale injection moulding.

PubMed

Felix, Manuel; Romero, Alberto; Cordobes, Felipe; Guerrero, Antonio

2015-03-15

Protein has been investigated as a source for biodegradable polymeric materials. This work evaluates the development of plastic materials based on crayfish and glycerol blends, processed by injection moulding, as a fully biodegradable alternative to conventional polymer-based plastics. The effect of different additives, namely sodium sulfite or bisulfite as reducing agents, urea as denaturing agent and L-cysteine as cross-linking agent, is also analysed. The incorporation of any additive always yields an increase in energy efficiency at the mixing stage, but its effect on the mechanical properties of the bioplastics is not so clear, and even dampened. The additive developing a greater effect is L-cysteine, showing higher Young's modulus values and exhibiting a remnant thermosetting potential. Thus, processing at higher temperature yields a remarkable increase in extensibility. This work illustrates the feasibility of crayfish-based green biodegradable plastics, thereby contributing to the search for potential value-added applications for this by-product. © 2014 Society of Chemical Industry.

High sequence variability among hemocyte-specific Kazal-type proteinase inhibitors in decapod crustaceans.

PubMed

Cerenius, Lage; Liu, Haipeng; Zhang, Yanjiao; Rimphanitchayakit, Vichien; Tassanakajon, Anchalee; Gunnar Andersson, M; Söderhäll, Kenneth; Söderhäll, Irene

2010-01-01

Crustacean hemocytes were found to produce a large number of transcripts coding for Kazal-type proteinase inhibitors (KPIs). A detailed study performed with the crayfish Pacifastacus leniusculus and the shrimp Penaeus monodon revealed the presence of at least 26 and 20 different Kazal domains from the hemocyte KPIs, respectively. Comparisons with KPIs from other taxa indicate that the sequences of these domains evolve rapidly. A few conserved positions, e.g. six invariant cysteines were present in all domain sequences whereas the position of P1 amino acid, a determinant for substrate specificity, varied highly. A study with a single crayfish animal suggested that even at the individual level considerable sequence variability among hemocyte KPIs produced exist. Expression analysis of four crayfish KPI transcripts in hematopoietic tissue cells and different hemocyte types suggest that some of these KPIs are likely to be involved in hematopoiesis or hemocyte release as they were produced in particular hemocyte types or maturation stages only.

ROS signaling pathways and biological rhythms: perspectives in crustaceans.

PubMed

Fanjul-Moles, Maria Luisa

2013-01-01

This work reviews concepts regarding the endogenous circadian clock and the relationship between oxidative stress (OS), light and entrainment in different organisms including crustaceans, particularly crayfish. In the first section, the molecular control of circadian rhythms in invertebrates, particularly in Drosophila, is reviewed, and this model is contrasted with recent reports on the circadian genes and proteins in crayfish. Second, the redox mechanisms and signaling pathways that participate in the entrainment of the circadian clock in different organisms are reviewed. Finally, the light signals and transduction pathways involved in the entrainment of the circadian clock, specifically in relation to cryptochromes (CRYs) and their dual role in the circadian clock of different animal groups and their possible relationship to the circadian clock and redox mechanisms in crustaceans is discussed. The relationship between metabolism, ROS signals and transcription factors, such as HIF-1 alpha in crayfish, as well as the possibility that HIF-1 alpha participates in the regulation of circadian control genes (ccgs) in crustaceans is discussed.

Prior social experience affects the behavioral and neural responses to acute alcohol in juvenile crayfish.

PubMed

Swierzbinski, Matthew E; Lazarchik, Andrew R; Herberholz, Jens

2017-04-15

The effects of alcohol on society can be devastating, both as an immediate consequence of acute intoxication and as a powerful drug of abuse. However, the neurocellular mechanisms of alcohol intoxication are still elusive, partly because of the complex interactions between alcohol and nervous system function. We found that juvenile crayfish are behaviorally sensitive to acute alcohol exposure and progress through stages that are strikingly similar to those of most other intoxicated organisms. Most surprisingly, we found that the social history of the animals significantly modified the acute effects of alcohol. Crayfish taken from a rich social environment became intoxicated more rapidly than animals that were socially isolated before alcohol exposure. In addition, we found that the modulation of intoxicated behaviors by prior social experience was paralleled on the level of individual neurons. These results significantly improve our understanding of the mechanisms underlying the interplay between social experience, alcohol intoxication and nervous system function. © 2017. Published by The Company of Biologists Ltd.

Subcellular localization of calcium deposits in the noble crayfish Astacus astacus spermatophore: Implications for post-mating spermatophore hardening and spermatozoon maturation.

PubMed

Niksirat, Hamid; Kouba, Antonín

2016-04-01

The freshly ejaculated spermatophore of crayfish undergoes a hardening process during post-mating storage on the body surface of female. The ultrastructural distribution of calcium deposits were studied and compared in freshly ejaculated and post-mating noble crayfish spermatophores, using the oxalate-pyroantimonate technique, to determine possible roles of calcium in post-mating spermatophore hardening and spermatozoon maturation. Small particles of sparsely distributed calcium deposits were visible in the wall of freshly ejaculated spermatophore. Also, large amount of calcium deposits were visible in the membranes of the freshly ejaculated spermatozoon. Five minutes post-ejaculation, granules in the spermatophore wall appeared as porous formations with numerous electron lucent spaces. Calcium deposits were visible within the spaces and scattered in the spermatophore wall matrix, where smaller calcium deposits combined to form globular calcium deposits. Large numbers of the globular calcium deposits were visible in the wall of the post-mating spermatophore. Smaller calcium deposits were detected in the central area of post-mating spermatophore, which contains the sperm mass, and in the extracellular matrix and capsule. While the density of calcium deposits decreased in the post-mating spermatozoon membranes, numerous small calcium deposits appeared in the subacrosomal zone and nucleus. Substantial changes in calcium deposit distribution in the crayfish spermatophore during post-mating storage on the body of female may be involved in the processes of the spermatophore hardening and spermatozoon maturation. © 2016 Wiley Periodicals, Inc.

Antibacterial activity of hemocyanin from red swamp crayfish (Procambarus clarkii).

PubMed

Qin, Zhendong; Babu, V Sarath; Wan, Quanyuan; Muhammad, Asim; Li, Jun; Lan, Jiangfeng; Lin, Li

2018-04-01

Hemocyanins (HMC): the copper-containing respiratory proteins present in invertebrate hemolymph, which plays many essential roles in the immune system. Currently, little is known about the HMC domains of Procambarus clarkii (P. clarkii) and their function in antimicrobial immune response. In this present study, we comparatively studied the expression pattern of native PcHMC with the three recombinant proteins of variable domains of crayfish hemocyanin (PcHMC-N, N-terminal domain of hemocyanin; PcHMC-T, tyrosinase domain of hemocyanin; PcHMC-C, C-terminal domain of hemocyanin). The results showed that three purified recombinant proteins had a strong binding to various bacteria and lipopolysaccharides that further highly agglutinated. The HMCs recombinant proteins showed strong antibacterial activity against V. parahaemolyticus and S. aureus by bacterial growth inhibition, phenoloxidase (PO) and phagocytosis assays. Specifically, rPcHMC1-T and rPcHMC1-C inhibited both the bacteria efficiently, rPcHMC1-T was highly upregulated the PO activity than the other recombinant proteins. Whereas, recombinant proteins pretreated crayfish hemocytes participated in phagocytosis activity, rPcHMC1-N and rPcHMC1-C proteins had a profound effect than the rPcHMC1-T on S. aureus and V. parahaemolyticus phagocytosis. The crayfish hemocyanin domains clearly exhibited antibacterial and phagocytic activities against both the bacteria, suggesting that its variable domains of hemocyanin have the different function on specific pathogen during the assault of pathogens. Copyright © 2018 Elsevier Ltd. All rights reserved.

Integrated shotgun sequencing and bioinformatics pipeline allows ultra-fast mitogenome recovery and confirms substantial gene rearrangements in Australian freshwater crayfishes

PubMed Central

2014-01-01

Background Although it is possible to recover the complete mitogenome directly from shotgun sequencing data, currently reported methods and pipelines are still relatively time consuming and costly. Using a sample of the Australian freshwater crayfish Engaeus lengana, we demonstrate that it is possible to achieve three-day turnaround time (four hours hands-on time) from tissue sample to NCBI-ready submission file through the integration of MiSeq sequencing platform, Nextera sample preparation protocol, MITObim assembly algorithm and MITOS annotation pipeline. Results The complete mitochondrial genome of the parastacid freshwater crayfish, Engaeus lengana, was recovered by modest shotgun sequencing (1.2 giga bases) using the Illumina MiSeq benchtop sequencing platform. Genome assembly using the MITObim mitogenome assembler recovered the mitochondrial genome as a single contig with a 97-fold mean coverage (min. = 17; max. = 138). The mitogenome consists of 15,934 base pairs and contains the typical 37 mitochondrial genes and a non-coding AT-rich region. The genome arrangement is similar to the only other published parastacid mitogenome from the Australian genus Cherax. Conclusions We infer that the gene order arrangement found in Cherax destructor is common to Australian crayfish and may be a derived feature of the southern hemisphere family Parastacidae. Further, we report to our knowledge, the simplest and fastest protocol for the recovery and assembly of complete mitochondrial genomes using the MiSeq benchtop sequencer. PMID:24484414

Predicting wading bird and aquatic faunal responses to ecosystem restoration scenarios

USGS Publications Warehouse

Beerens, James M.; Trexler, Joel C.; Catano, Christopher P.

2017-01-01

In large-scale conservation decisions, scenario planning identifies key uncertainties of ecosystem function linked to ecological drivers affected by management, incorporates ecological feedbacks, and scales up to answer questions robust to alternative futures. Wetland restoration planning requires an understanding of how proposed changes in surface hydrology, water storage, and landscape connectivity affect aquatic animal composition, productivity, and food-web function. In the Florida Everglades, reintroduction of historical hydrologic patterns is expected to increase productivity of all trophic levels. Highly mobile indicator species such as wading birds integrate secondary productivity from aquatic prey (small fishes and crayfish) over the landscape. To evaluate how fish, crayfish, and wading birds may respond to alternative hydrologic restoration plans, we compared predicted small fish density, crayfish density and biomass, and wading bird occurrence for existing conditions to four restoration scenarios that varied water storage and removal of levees and canals (i.e. decompartmentalization). Densities of small fish and occurrence of wading birds are predicted to increase throughout most of the Everglades under all restoration options because of increased flows and connectivity. Full decompartmentalization goes furthest toward recreating hypothesized historical patterns of fish density by draining excess water ponded by levees and hydrating areas that are currently drier than in the past. In contrast, crayfish density declined and species composition shifted under all restoration options because of lengthened hydroperiods (i.e. time of inundation). Under full decompartmentalization, the distribution of increased prey available for wading birds shifted south, closer to historical locations of nesting activity in Everglades National Park.

Flow cytometric analysis of crayfish haemocytes activated by lipopolysaccharides

USGS Publications Warehouse

Cardenas, W.; Dankert, J.R.; Jenkins, J.A.

2004-01-01

Lipopolysaccharides (LPS) from Gram-negative bacteria are strong stimulators of white river crayfish, Procambarus zonangulus, haemocytes in vitro. Following haemocyte treatment with LPS and with LPS from rough mutant R5 (LPS Rc) from Salmonella minnesota, flow cytometric analysis revealed a conspicuous and reproducible decrease in cell size as compared to control haemocytes. These LPS molecules also caused a reduction in haemocyte viability as assessed by flow cytometry with the fluorescent dyes calcein-AM and ethidium homodimer. The onset of cell size reduction was gradual and occurred prior to cell death. Haemocytes treated with LPS from S. minnesota without the Lipid A moiety (detoxified LPS) decreased in size without a reduction of viability. The action of LPS on crayfish haemocytes appeared to be related to the activation of the prophenoloxidase system because phenoloxidase (PO)-specific activity in the supernatants from control and detoxified LPS-treated cells was significantly lower than that from LPS and LPS-Rc treated cells (P < 0.05). Furthermore, addition of trypsin inhibitor to the LPS treatments caused noticeable delays in cell size and viability changes. These patterns of cellular activation by LPS formulations indicated that crayfish haemocytes react differently to the polysaccharide and lipid A moieties of LPS, where lipid A is cytotoxic and the polysaccharide portion is stimulatory. These effects concur with the general pattern of mammalian cell activation by LPS, thereby indicting commone innate immune recognition mechanisms to bacterial antigens between cells from mammals and invertebrates. These definitive molecular approaches used to verify and identify mechanisms of invertbrate haemocyte responses to LPS could be applied with other glycoconjugates, soluble mediators, or xenobiotic compounds.

Electrophysiological Investigation of Different Methods of Anesthesia in Lobster and Crayfish

PubMed Central

Fregin, Torsten; Bickmeyer, Ulf

2016-01-01

Objectives In search for methods of anesthesia of crustaceans, an implanted electrode into lobster and crayfish CNS enabled us to monitor signal propagation in the nerve system of animals undergoing different protocols. Results Cooling (tap water 0°C, sea water -1,8°C) and anesthesia with MgCl2 (10%) were both discarded as anesthetic procedures because responses to external stimuli were still detectable under treatment. Contrarily, bubbling the aquarium water with CO2 can be considered a “partially successful” anesthesia, because signal propagation is inhibited but before that the animals show discomfort. The procedure of “electro-stunning” induces epileptic-form seizures in the crustacean CNS (lobster, crayfish), which overlay but do not mitigate the response to external stimuli. After several minutes the activity declines before the nervous system starts to recover. A feasible way to sacrifice lobsters is to slowly raise the water temperature (1°C min-1), as all electrical activities in the CNS cease at temperatures above ~30°C, whereas below this temperature the animals do not show signs of stress or escape behavior (e.g. tail flips) in the warming water. Conclusion CO2 is efficient to anaesthetize lobster and crayfish but due to low pH in water is stressful to the animals previous to anesthesia. Electrical stunning induces epileptiform seizures but paralyses the animals and leads to a reversible decline of nerve system activity after seizure. Electric stunning or slowly warming just before preparation may meet ethical expectations regarding anaesthesia and to sacrifice crustaceans. PMID:27642755

Electron tomographic analysis of gap junctions in lateral giant fibers of crayfish.

PubMed

Ohta, Yasumi; Nishikawa, Kouki; Hiroaki, Yoko; Fujiyoshi, Yoshinori

2011-07-01

Innexin-gap junctions in crayfish lateral giant fibers (LGFs) have an important role in escape behavior as a key component of rapid signal transduction. Knowledge of the structure and function of characteristic vesicles on the both sides of the gap junction, however, is limited. We used electron tomography to analyze the three-dimensional structure of crayfish gap junctions and gap junctional vesicles (GJVs). Tomographic analyses showed that some vesicles were anchored to innexons and almost all vesicles were connected by thin filaments. High densities inside the GJVs and projecting densities on the GJV membranes were observed in fixed and stained samples. Because the densities inside synaptic vesicles were dependent on the fixative conditions, different fixative conditions were used to elucidate the molecules included in the GJVs. The projecting densities on the GJVs were studied by immunoelectron microscopy with anti-vesicular monoamine transporter (anti-VMAT) and anti-vesicular nucleotide transporter (anti-VNUT) antibodies. Some of the projecting densities were labeled by anti-VNUT, but not anti-VMAT. Three-dimensional analyses of GJVs and excitatory chemical synaptic vesicles (CSVs) revealed clear differences in their sizes and central densities. Furthermore, the imaging data obtained under different fixative conditions and the immunolabeling results, in which GJVs were positively labeled for anti-VNUT but excitatory CSVs were not, support our model that GJVs contain nucleotides and excitatory CSVs do not. We propose a model in which characteristic GJVs containing nucleotides play an important role in the signal processing in gap junctions of crayfish LGFs. Copyright © 2011 Elsevier Inc. All rights reserved.

Accumulation of 14C-naphthalene in the tissues of redhead ducks fed oil-contaminated crayfish

USGS Publications Warehouse

Tarshis, I.B.; Rattner, B.A.

1982-01-01

Crayfish, artificially contaminated with14C-naphthalene-5% water-soluble fraction of No. 2 fuel oil, were force-fed to one-year-old redhead ducks to determine the accumulation of petroleum hydrocarbons. The relative distribution of carbon-14 activity in the gall bladder containing bile, and fat were similar, and significantly greater (P < 0.05) than the activity in the blood, brain, liver, and kidney. There was a significant increase (P < 0.05) in the disintegrations per minute per gram (dpm/g) in the blood, brain, kidney, and liver between days 1 and 3 of feeding, indicating a progressive accumulation of carbon-14 activity (naphthalene and presumably its metabolites). There was no significant effect of sex or the interaction of the duration of feeding and sex on carbon-14 activity in any of the tissues. The low daily dose of petroleum hydrocarbons (a total of approximately 1.25 mg/day) received by the ducks from the crayfish and the relatively short feeding regimen did not cause any overt signs of toxicity in the ducks.

Neuromodulation of reciprocal glutamatergic inhibition between antagonistic motoneurons by 5-hydroxytryptamine (5-HT) in crayfish walking system.

PubMed

Pearlstein, E; Clarac, F; Cattaert, D

1998-01-23

In an in vitro preparation of the crayfish thoracic locomotor system, paired intracellular recordings were performed from antagonistic depressor (Dep) and levator (Lev) motoneurons (MNs) that control the second joint of walking legs. Connections between these two groups of MNs consist mainly of inhibitory connections and weak electrotonic synapses. Injection of depolarizing current into a Lev MN results in a hyperpolarization in a Dep MN, and vice versa. This reciprocal glutamatergic inhibition, is not changed in the presence of the sodium channel blocker tetrodotoxin (TTX) and therefore is likely supported by a direct connection between MNs. By contrast, reciprocal inhibition is largely reduced in the presence of 5-hydroxytryptamine (5-HT; 10 microM). Direct micro-application of glutamate pressure-ejected close to an intracellularly recorded MN, evoked an inhibitory response in that MN, accompanied by a decrease of input resistance. These two effects were dramatically reduced in the presence of 5-HT. Thus 5-HT could be involved in mechanisms of dynamic reconfigurations of the neural network controlling leg movements in crayfish.

Serotonin has opposite effects on the aggressiveness of crayfish, facing either a smaller or a larger rival: alteration of size perception.

PubMed

Bacqué-Cazenave, Julien; Cattaert, Daniel; Delbecque, Jean Paul; Fossat, Pascal

2018-04-26

We injected serotonin (5-HT) in adult male crayfish before pairing them with size-matched non-injected competitors, and we observed dyadic agonistic interactions. Paradoxically, 5-HT elicited opposite behavioral responses if the injected animal was opposed by a smaller or larger rival: the level of aggressiveness of the injected crayfish was higher in front of a larger rival but lower in front of a smaller rival. Our results indicate that the effects of 5-HT on aggressiveness are dependent on the perception of the relative size difference of the opponent. In both cases, however, 5-HT significantly delayed the decision to retreat. We conclude that 5-HT does not primarily act on aggressiveness but rather on the brain centers that integrate risk assessment and/or decision-making, which then modulate the aggressive response. Our study supports a reinterpretation of the role of 5-HT in crustacean agonistic behavior that may be of interest for other animals. © 2018. Published by The Company of Biologists Ltd.

Biotic and abiotic studies on the biological fate, transport and ecotoxicity of toxic and hazardous waste in the Mississippi River basin

DOE Office of Scientific and Technical Information (OSTI.GOV)

Abdelghani, A.; Pramar, Y.; Mandal, T.

1996-05-02

This project assesses the levels of xenobiotics in Devils Swamp and studies their biological fate, transport, ecotoxicity, and potential toxicity to man. This article reports on the following studies: assessment of the acute toxicity of individual xenobiotics and toxicity of organic compounds hexachlorobutadience (HCB) and hexachlorobenzene (HCBD) on juvenile crayfish; determination of the biotic influence of temperature, salinity, pH, oxidation-reduction potential, and sediment composition on the migration of xenobiotics; development of a pharmacokinetics model for xenobiotic absorption and storage, distribution and excretion by fish and crayfish.

The Hydrodynamic Distinctiveness of Living Organisms: Communication in Complex Hydraulic Environments

NASA Astrophysics Data System (ADS)

Johnson, M.

2015-12-01

Animals make decisions about the suitability of habitat and their reaction to other organisms based on the sensory information that they first obtain. This information is transmitted, masked and filtered by fluvial processes, such as turbulent flow. Despite governing how animals interact with the environment, limited attention has been paid to the controls on the propagation of sensory signals through rivers. Some animals interpret hydraulic events and use the characteristics of wakes to sense the presence of other organisms. This implies that at least some animals can differentiate turbulent flow generated by the presence of living organisms from ambient environmental turbulence. We investigate whether there are specific flow characteristics, distinct from the ambient environment, that potentially flag the presence of organisms to other animals. ADV and PIV measurements in a series of laboratory flume experiments quantified the flow around living Signal Crayfish (Pacifastacus leniusculus) and two inanimate objects of equivalent shape and size. Experiments were repeated across a gradient of turbulence intensities generated over nine combinations of flow velocity and relative submergence. Flows downstream of living crayfish were distinct from inanimate objects, with greater turbulent intensities, higher energy in low- to intermediate frequencies, and flow structures that were less coherent in comparison to those measured downstream of inanimate objects. However, the hydrodynamic signature of crayfish became masked as the intensity of ambient turbulence exceeded that generated by living crayfish. These results demonstrate the importance of the fluvial processes in the transmission of sensory information and suggest that the ability of animals to perceive hydraulic signatures is likely to be limited in many situations in rivers. Thus, animals may need to rely on other senses, such as sight or hearing, especially where depth is shallow relative to grain size.

Heavy metals bioaccumulation in selected tissues of red swamp crayfish: An easy tool for monitoring environmental contamination levels.

PubMed

Goretti, E; Pallottini, M; Ricciarini, M I; Selvaggi, R; Cappelletti, D

2016-07-15

In this paper we explored the heavy metal bioaccumulation (Cd, Cu, Pb and Zn) in Procambarus clarkii, a crayfish recently suggested as a potential bioindicator for metals pollution in freshwater systems. The present study is focused on crayfishes populations caught in a heavily polluted industrial and in a reference sites (Central Italy), though the results are generalized with a thorough analysis of literature metadata. In agreement with the literature, the hepatopancreas (Hep, detoxification tissues) of the red swamp crayfish showed a higher concentration of heavy metals in comparison to the abdominal muscle (AbM, not detoxification tissues) in the sites under scrutiny. Hep/AbM concentration ratio was dependent on the specific metal investigated and on its sediment contamination level. Specifically we found that Hep/AbM ratio decreases as follows: Cd (11.7)>Cu (5.5)>Pb (3.6)>Zn (1.0) and Pb (4.34)>Cd (3.66)>Zn (1.69)>Cu (0.87) for the industrial and reference sites, respectively. The analysis of our bioaccumulation data as well as of literature metadata allowed to elaborate a specific contamination index (Toxic Contamination Index, TCI), dependent only on the bioaccumulation data of hepatopancreas and abdominal muscle. In the industrial site, TCI expressed values much higher than the unit for Cd and Cu, confirming that these metals were the main contaminants; in contrast for lower levels of heavy metals, as those observed in the reference site for Cu, Zn and Pb, the index provided values below unit. TCI is proposed as a useful and easy tool to assess the toxicity level of contaminated sites by heavy metals in the environmental management. Copyright © 2016. Published by Elsevier B.V.

Mechanisms That Generate Resource Pulses in a Fluctuating Wetland

PubMed Central

Botson, Bryan A.; Gawlik, Dale E.; Trexler, Joel C.

2016-01-01

Animals living in patchy environments may depend on resource pulses to meet the high energetic demands of breeding. We developed two primary a priori hypotheses to examine relationships between three categories of wading bird prey biomass and covariates hypothesized to affect the concentration of aquatic fauna, a pulsed resource for breeding wading bird populations during the dry season. The fish concentration hypothesis proposed that local-scale processes concentrate wet-season fish biomass into patches in the dry season, whereas the fish production hypothesis states that the amount of dry-season fish biomass reflects fish biomass production during the preceding wet season. We sampled prey in drying pools at 405 sites throughout the Florida Everglades between December and May from 2006–2010 to test these hypotheses. The models that explained variation in dry-season fish biomass included water-level recession rate, wet-season biomass, microtopography, submerged vegetation, and the interaction between wet-season biomass and recession rate. Crayfish (Procambarus spp.) biomass was positively associated with wet-season crayfish biomass, moderate water depth, dense submerged aquatic vegetation, thin flocculent layer and a short interval of time since the last dry-down. Grass shrimp (Palaemonetes paludosus) biomass increased with increasing rates of water level recession, supporting our impression that shrimp, like fish, form seasonal concentrations. Strong support for wet-season fish and crayfish biomass in the top models confirmed the importance of wet-season standing stock to concentrations of fish and crayfish the following dry season. Additionally, the importance of recession rate and microtopography showed that local scale abiotic factors transformed fish production into the high quality foraging patches on which apex predators depended. PMID:27448023

New insights into the acute actions from a high dosage of fluoxetine on neuronal and cardiac function: Drosophila, crayfish and rodent models.

PubMed

Majeed, Zana R; Ritter, Kyle; Robinson, Jonathan; Blümich, Sandra L E; Brailoiu, Eugen; Cooper, Robin L

2015-01-01

The commonly used mood altering drug fluoxetine (Prozac) in humans has a low occurrence in reports of harmful effects from overdose; however, individuals with altered metabolism of the drug and accidental overdose have led to critical conditions and even death. We addressed direct actions of high concentrations on synaptic transmission at neuromuscular junctions (NMJs), neural properties, and cardiac function unrelated to fluoxetine's action as a selective 5-HT reuptake inhibitor. There appears to be action in blocking action potentials in crayfish axons, enhanced occurrences of spontaneous synaptic vesicle fusion events in the presynaptic terminals at NMJs of both Drosophila and crayfish. In rodent neurons, cytoplasmic Ca(2+) rises by fluoxetine and is thapsigargin dependent. The Drosophila larval heart showed a dose dependent effect in cardiac arrest. Acute paralytic behavior in crayfish occurred at a systemic concentration of 2mM. A high percentage of death as well as slowed development occurred in Drosophila larvae consuming food containing 100μM fluoxetine. The release of Ca(2+) from the endoplasmic reticulum in neurons and the cardiac tissue as well as blockage of voltage-gated Na(+) channels in neurons could explain the effects on the whole animal as well as the isolated tissues. The use of various animal models in demonstrating the potential mechanisms for the toxic effects with high doses of fluoxetine maybe beneficial for acute treatments in humans. Future studies in determining how fluoxetine is internalized in cells and if there are subtle effects of these mentioned mechanisms presented with chronic therapeutic doses are of general interest. Copyright © 2015 Elsevier Inc. All rights reserved.

Recovery of Hafnia alvei from diseased brown trout, Salmo trutta L., and healthy noble crayfish, Astacus astacus (L.), in Bulgaria.

PubMed

Orozova, P; Sirakov, I; Chikova, V; Popova, R; Al-Harbi, A H; Crumlish, M; Austin, B

2014-10-01

Hafnia alvei was isolated in Bulgaria from healthy noble crayfish, Astacus astacus (L.), and then from farmed diseased brown trout, Salmo trutta L., with signs of haemorrhagic septicaemia. The isolates were identified initially with conventional phenotyping and commercial Merlin Micronaut and API 20E rapid identification systems, followed by sequencing of the 16S rRNA gene. Hafnia alvei Bt1, Bt2 and Aa4 were of low virulence to rainbow trout and brown trout, although cytotoxicity was demonstrated by Bt1 and Bt2, but not by Aa4. © 2014 John Wiley & Sons Ltd.

Phylogenetic evidence from freshwater crayfishes that cave adaptation is not an evolutionary dead‐end

PubMed Central

Stern, David B.; Breinholt, Jesse; Pedraza‐Lara, Carlos; López‐Mejía, Marilú; Owen, Christopher L.; Bracken‐Grissom, Heather; Fetzner, James W.; Crandall, Keith A.

2017-01-01

Abstract Caves are perceived as isolated, extreme habitats with a uniquely specialized biota, which long ago led to the idea that caves are “evolutionary dead‐ends.” This implies that cave‐adapted taxa may be doomed for extinction before they can diversify or transition to a more stable state. However, this hypothesis has not been explicitly tested in a phylogenetic framework with multiple independently evolved cave‐dwelling groups. Here, we use the freshwater crayfish, a group with dozens of cave‐dwelling species in multiple lineages, as a system to test this hypothesis. We consider historical patterns of lineage diversification and habitat transition as well as current patterns of geographic range size. We find that while cave‐dwelling lineages have small relative range sizes and rarely transition back to the surface, they exhibit remarkably similar diversification patterns to those of other habitat types and appear to be able to maintain a diversity of lineages through time. This suggests that cave adaptation is not a “dead‐end” for freshwater crayfish, which has positive implications for our understanding of biodiversity and conservation in cave habitats. PMID:28804900

Heavy metal speciation and uptake in crayfish and tadpoles

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bundy, K.J.; Berzins, D.; Millet, L.

1996-12-31

Developing valid pollution recording methods is central to assessing environmental damage and remediation. This often is difficult, however, because of speciation and multiphase distribution of contaminants. Polarography, an electroanalytical technique capable of detection and quantification of trace levels of elements and ionic complexes, is a promising method for analyzing environmental samples. Here, polarography has been used to determine lead concentration in water, sediment, bullfrogs, tadpoles, and adsorbed onto kaolin. It has also been used to measure hexavalent chromium concentration in crayfish. This research involves field studies and two laboratory experiments. Studies of a Louisiana swamp have shown lead`s affinity formore » sediment and water particulate phases, rather than being ionically dissolved in the aqueous phase. In swamp bullfrogs, lead was found in greater concentrations in bone compared to muscle. In the first laboratory experiment, lead uptake originating from water and sediment increased in tadpoles as exposure time and concentration increased. Also, this animal`s development was hindered at higher concentrations. The second laboratory experiment exposed crayfish to aqueous hexavalent chromium. Total chromium uptake increased with exposure time and concentration. The chromium tissue abundance was hepatopancreas > gills > muscle. A substantial portion of tissue hexavalent chromium converted to the less toxic trivalent form.« less

How do animals communicate in complex hydrodynamic environments? Linking hydraulics and ecology in rivers.

NASA Astrophysics Data System (ADS)

Johnson, Matthew; Rice, Stephen

2015-04-01

Animals make decisions about the suitability of habitat and their reaction to other organisms based on the sensory information that they first obtain from the environment and other organisms within that environment. Sensory information, such as sounds, scents, vibrations and visual cues, is transported, transmitted, masked and filtered by fluvial processes, such as turbulent flow. Despite the fundamental importance of this information in dictating how animals interact with the environment, only limited attention has been paid to the environmental controls on the propagation of sensory signals and cues through fluvial systems. Aquatic animals use and respond to hydraulic characteristics when navigating their environment and selecting habitat. There is evidence that some animals can also sense the presence of other organisms from the hydraulic characteristics of their wake. This implies that at least some aquatic animals can differentiate between the turbulent flow generated by the presence of living organisms and ambient turbulence generated by the environment. We investigate whether there are specific flow characteristics, distinct from the ambient environment, that potentially flag the presence of organisms to other animals. Acoustic Doppler and Particle Image Velocimetry measurements in a series of laboratory flume experiments quantified the flow around living Signal Crayfish (Pacifastacus leniusculus) and two inanimate objects of equivalent shape and size. Experiments were repeated across a gradient of turbulence intensities generated over nine combinations of flow velocity and relative submergence. Flows downstream of living crayfish were distinct from inanimate objects, with greater turbulent intensities, higher energy in low- to intermediate frequencies, and flow structures that were less coherent in comparison to those measured downstream of inanimate objects. However, the hydrodynamic signature of crayfish became masked as the intensity of ambient turbulence exceeded that generated by living crayfish. This was particularly the case at low relative submergence. These results demonstrate the importance of the fluvial environment in controlling the transmission of sensory information and suggest that the ability of organisms to sense the presence of crayfish from their hydraulic signature is likely to be limited in many situations in rivers. Thus, animals in rivers may have to rely on other senses, such as sight or hearing, especially where depth is low relative to substrate roughness and where velocities are relatively high.

P-type Ca2+ channels mediate excitatory and inhibitory synaptic transmitter release in crayfish muscle.

PubMed

Araque, A; Clarac, F; Buño, W

1994-05-10

The toxin fraction (FTX) and peptide omega-Aga-IVA from the venom of the funnel-web spider Agelenopsis aperta, as well as a synthetic analogue of FTX, specifically block the P-type voltage-dependent Ca2+ channel (VDCC). The effects of these toxins on synaptic transmission were studied in the neuromuscular synapses of the crayfish opener muscle, which has a single excitatory and a single inhibitory motoneuron. FTX selectively and reversibly blocked excitatory and inhibitory postsynaptic currents and potentials in a dose-dependent manner. FTX had no effect on (i) resting and postsynaptic membrane conductance, (ii) postsynaptic L-type VDCC, and (iii) both glutamate- and gamma-aminobutyric acid-induced postsynaptic responses. Mean amplitude and frequency of miniature postsynaptic potentials were unchanged by FTX. The postsynaptic VDCC was inhibited by nifedipine, a selective dihydropyridine antagonist of L-type VDCC, whereas synaptic transmission was unaffected. Transmission was also undisturbed by omega-conotoxin, suggesting that N-type VDCCs are not involved. The peptide omega-Aga-IVA blocked excitatory and inhibitory transmission without affecting postsynaptic VDCC. Synaptic transmission was also blocked by synthetic FTX. We conclude that presynaptic P-type VDCCs are involved in both evoked excitatory and inhibitory transmitter release in crayfish neuromuscular synapses.

P-type Ca2+ channels mediate excitatory and inhibitory synaptic transmitter release in crayfish muscle.

PubMed Central

Araque, A; Clarac, F; Buño, W

1994-01-01

The toxin fraction (FTX) and peptide omega-Aga-IVA from the venom of the funnel-web spider Agelenopsis aperta, as well as a synthetic analogue of FTX, specifically block the P-type voltage-dependent Ca2+ channel (VDCC). The effects of these toxins on synaptic transmission were studied in the neuromuscular synapses of the crayfish opener muscle, which has a single excitatory and a single inhibitory motoneuron. FTX selectively and reversibly blocked excitatory and inhibitory postsynaptic currents and potentials in a dose-dependent manner. FTX had no effect on (i) resting and postsynaptic membrane conductance, (ii) postsynaptic L-type VDCC, and (iii) both glutamate- and gamma-aminobutyric acid-induced postsynaptic responses. Mean amplitude and frequency of miniature postsynaptic potentials were unchanged by FTX. The postsynaptic VDCC was inhibited by nifedipine, a selective dihydropyridine antagonist of L-type VDCC, whereas synaptic transmission was unaffected. Transmission was also undisturbed by omega-conotoxin, suggesting that N-type VDCCs are not involved. The peptide omega-Aga-IVA blocked excitatory and inhibitory transmission without affecting postsynaptic VDCC. Synaptic transmission was also blocked by synthetic FTX. We conclude that presynaptic P-type VDCCs are involved in both evoked excitatory and inhibitory transmitter release in crayfish neuromuscular synapses. Images PMID:7910404

Behavioral Effects of the Fungal Pathogen Batrachochytrium Dendrobatidis on the Crayfish Host Procambarus Alleni

NASA Astrophysics Data System (ADS)

Waggett, R. J.; Virgl, E. J.; McMahon, T. A.

2016-02-01

The chytrid fungus Batrachochytrium dendrobatidis (Bd) is a parasite implicated in local and global amphibian declines. Although it is considered to be an amphibian specialist, co-occurring species such as the crayfish species Procambarus alleni and Procambarus clarkii have been identified as Bd hosts and potential vectors in the spread and transmission of Bd to amphibians. Procambarus alleni is a freshwater crayfish species native to Florida and popular in the aquarium trade due to its distinctive blue coloration. Although many behavioral and physiological studies have been conducted on the congener, Procambarus clarkii, an introduced species found in many niches throughout the United States, few comparative studies have involved P. alleni. Here, we have quantified the escape behavior kinetics of healthy, lab-reared and wild-caught P. alleni (juvenile and adult) using high speed videography and motion analysis. Kinetic parameters analyzed included velocity, acceleration, net to gross displacement ratios (NGDR), response latency, number of thrusts per response and total distance jumped. Further, we exposed wild-caught P. alleni to cultured Bd and quantified the behavioral effects 24 hours and 1 week following exposure. Data on the survival and behavioral changes of P. alleni could provide insight on the potential toxic effects of Bd and the tendency toward Bd transmission.

Hemocyte-lineage marker proteins in a crustacean, the freshwater crayfish, Pacifastacus leniusculus.

PubMed

Wu, Chenglin; Söderhäll, Irene; Kim, Young-A; Liu, Haipeng; Söderhäll, Kenneth

2008-10-01

To identify proteins associated with development of different hemocyte types in the freshwater crayfish Pacifastacus leniusculus, 2-DE followed by MS analysis was carried out with hematopoietic tissue (Hpt) cells, semigranular cells (SGC) and granular cells (GC). Within the hemocyte lineages one two-domain Kazal proteinase inhibitor (KPI) was found to be specific for SGC, while a superoxide dismutase (SOD) was specific for GC at protein as well as at mRNA level. The proliferation cell nuclear antigen (PCNA) was detected at the mRNA level in Hpt cells only. We also provide evidence that SGC and GC most likely differentiate to maturation as separate lineages. We found that after laminarin or lipopolysaccharide (LPS) injection into crayfish, the transcript levels of PCNA and SOD increased in the Hpt cells, whereas the KPI transcript never was present in Hpt regardless of any challenge. RNA interference of PCNA in the Hpt cells led to that most of the cells did not spread or attach to the tissue culture dish. These results suggest that PCNA, KPI and SOD can be used as markers for Hpt cells, SGC and GC, respectively, and in conjunction with these results, a model is proposed how the Hpt responds to a microbial challenge by proliferation and release of Hpt cells.

Lunar-Rhythmic Molting in Laboratory Populations of the Noble Crayfish Astacus astacus (Crustacea, Astacidea): An Experimental Analysis

PubMed Central

Franke, Robert; Hoerstgen-Schwark, Gabriele

2013-01-01

Juvenile noble crayfish, Astacusastacus (Crustacea, Astacidea) in the second year of age were kept in the laboratory for a twelve-month period under continuing “summer conditions” (LD 16:8, 19°C). Molting processes in this population could be synchronized by artificial moonlight cycles. Peaks of exuviations occurred at “new moons”. Males showed a slightly higher degree of synchronization than females. A phase-shift of the artificial lunar cycle in relation to the natural cycle resulted in a corresponding shift of the molting cycle. This clearly demonstrates that changes in the nocturnal light regime provide the primary external information for the lunar-monthly molting rhythm. There is a first indication that lunar photic stimuli do not act directly but as a zeitgeber which entrains an endogenous molting rhythm to the lunar cycle. Moreover, the results of the long-term experiments suggest that the hibernal resting period of A . astacus in the field (no molts between October and April) may also involve some endogenous programming. Continuing artificial summer conditions can delay but not completely suppress this resting period. The adaptive significance of the phenomena and how the findings may be applied to improve the management of crowded crayfish stocks are discussed. PMID:23840899

Glutamate-mediated protection of crayfish glial cells from PDT-induced apoptosis

NASA Astrophysics Data System (ADS)

Rudkovskii, M. V.; Romanenko, N. P.; Berezhnaya, E. V.; Kovaleva, V. D.; Uzdensky, A. B.

2011-03-01

Photodynamic treatment that causes intense oxidative stress and kills cells is currently used in neurooncology. However, along with tumor it damages surrounding healthy neurons and glial cells. In order to study the possible role of glutamate-related signaling pathways in photodynamic injury of neurons and glia, we investigated photodynamic effect of alumophthalocyanine Photosens on isolated crayfish stretch receptor that consists of a single neuron surrounded by glial cells. The laser diode (670 nm, 0.4 W/cm2) was used for dye photoexcitation. Application of glutamate increased photodynamically induced necrosis of neurons and glial cells but significantly decreased glial apoptosis. The natural neuroglial mediator N-acetylaspartylglutamate, which releases glutamate after cleavage in the extracellular space by glutamate carboxypeptidase II, also inhibited photoinduced apoptosis. Inhibition of glutamate carboxypeptidase II, oppositely, enhanced apoptosis of glial cells. These data confirm the anti-apoptotic activity of glutamate. Application of NMDA or inhibition of NMDA receptors by MK801 did not influence photodynamic death of neurons and glial cells that indicated nonparticipation of NMDA receptors in these processes. Inhibition of metabotropic glutamate receptors by AP-3 decreased PDT-induced apoptosis. One can suggest that crayfish neurons naturally secrete NAAG, which being cleaved by GCOP produces glutamate. Glutamate prevents photoinduced apoptosis of glial cells possibly through metabotropic but not ionotropic glutamate receptors.

Removal of sodium inactivation and block of sodium channels by chloramine-T in crayfish and squid giant axons.

PubMed Central

Huang, J. M.; Tanguy, J.; Yeh, J. Z.

1987-01-01

Modification of sodium channels by chloramine-T was examined in voltage clamped internally perfused crayfish and squid giant axons using the double sucrose gap and axial wire technique, respectively. Freshly prepared chloramine-T solution exerted two major actions on sodium channels: (a) an irreversible removal of the fast Na inactivation, and (b) a reversible block of the Na current. Both effects were observed when chloramine-T was applied internally or externally (5-10 mM) to axons. The first effect was studied in crayfish axons. We found that the removal of the fast Na inactivation did not depend on the states of the channel since the channel could be modified by chloramine-T at holding potential (from -80 to -100 mV) or at depolarized potential of -30 mV. After removal of fast Na inactivation, the slow inactivation mechanism was still present, and more channels could undergo slow inactivation. This result indicates that in crayfish axons the transition through the fast inactivated state is not a prerequisite for the slow inactivation to occur. During chloramine-T treatment, a distinct blocking phase occurred, which recovered upon washing out the drug. This second effect of chloramine-T was studied in detail in squid axons. After 24 h, chloramine-T solution lost its ability to remove fast inactivation but retained its blocking action. After removal of the fast Na inactivation, both fresh and aged chloramine-T solutions blocked the Na currents with a similar potency and in a voltage-dependent manner, being more pronounced at lower depolarizing potentials. A similar voltage-dependent block was observed with aged chloramine-T solution in an axon with intact inactivation. In contrast to the action of the fresh solution, the aged chloramine-T solution was found to accelerate the decay of Na currents.These results suggest that chloramine-T solution contains at least two active molecular forms that act at different sites in the Na channel. PMID:2444276

Distribution and establishment of the alien Australian redclaw crayfish, Cherax quadricarinatus, in South Africa and Swaziland

PubMed Central

Zengeya, Tsungai A.; Hoffman, Andries C.; Measey, G. John; Weyl, Olaf L.F.

2017-01-01

Background The Australian redclaw crayfish (Cherax quadricarinatus, von Martens), is native to Australasia, but has been widely translocated around the world due to aquaculture and aquarium trade. Mostly as a result of escape from aquaculture facilities, this species has established extralimital populations in Australia and alien populations in Europe, Asia, Central America and Africa. In South Africa, C. quadricarinatus was first sampled from the wild in 2002 in the Komati River, following its escape from an aquaculture facility in Swaziland, but data on the current status of its populations are not available. Methods To establish a better understanding of its distribution, rate of spread and population status, we surveyed a total of 46 sites in various river systems in South Africa and Swaziland. Surveys were performed between September 2015 and August 2016 and involved visual observations and the use of collapsible crayfish traps. Results Cherax quadricarinatus is now present in the Komati, Lomati, Mbuluzi, Mlawula and Usutu rivers, and it was also detected in several off-channel irrigation impoundments. Where present, it was generally abundant, with populations having multiple size cohorts and containing ovigerous females. In the Komati River, it has spread more than 112 km downstream of the initial introduction point and 33 km upstream of a tributary, resulting in a mean spread rate of 8 km year−1 downstream and 4.7 km year−1 upstream. In Swaziland, estimated downstream spread rate might reach 14.6 km year−1. Individuals were generally larger and heavier closer to the introduction site, which might be linked to juvenile dispersal. Discussion These findings demonstrate that C. quadricarinatus is established in South Africa and Swaziland and that the species has spread, not only within the river where it was first introduced, but also between rivers. Considering the strong impacts that alien crayfish usually have on invaded ecosystems, assessments of its potential impacts on native freshwater biota and an evaluation of possible control measures are, therefore, urgent requirements. PMID:28439454

SIFamide peptides in clawed lobsters and freshwater crayfish (Crustacea, Decapoda, Astacidea): a combined molecular, mass spectrometric and electrophysiological investigation.

PubMed

Dickinson, Patsy S; Stemmler, Elizabeth A; Cashman, Christopher R; Brennan, Henry R; Dennison, Bobbi; Huber, Kristen E; Peguero, Braulio; Rabacal, Whitney; Goiney, Christopher C; Smith, Christine M; Towle, David W; Christie, Andrew E

2008-04-01

Recently, we identified the peptide VYRKPPFNGSIFamide (Val(1)-SIFamide) in the stomatogastric nervous system (STNS) of the American lobster Homarus americanus using matrix-assisted laser desorption/ionization-Fourier transform mass spectrometry (MALDI-FTMS). Given that H. americanus is the only species thus far shown to possess this peptide, and that a second SIFamide isoform, Gly(1)-SIFamide, is broadly conserved in other decapods, including another astacidean, the crayfish Procambarus clarkii, we became interested both in confirming our identification of Val(1)-SIFamide via molecular methods and in determining the extent to which this isoform is conserved within other members of the infraorder Astacidea. Here, we present the identification and characterization of an H. americanus prepro-SIFamide cDNA that encodes the Val(1) isoform. Moreover, we demonstrate via MALDI-FTMS the presence of Val(1)-SIFamide in a second Homarus species, Homarus gammarus. In contrast, only the Gly(1) isoform was detected in the other astacideans investigated, including the lobster Nephrops norvegicus, a member of the same family as Homarus, and the crayfish Cherax quadricarinatus, P. clarkii and Pacifastacus leniusculus, which represent members of each of the extant families of freshwater astacideans. These results suggest that Val(1)-SIFamide may be a genus (Homarus)-specific isoform. Interestingly, both Val(1)- and Gly(1)-SIFamide possess an internal dibasic site, Arg(3)-Lys(4), raising the possibility of the ubiquitously conserved isoform PPFNGSIFamide. However, this octapeptide was not detected via MALDI-FTMS in any of the investigated species, and when applied to the isolated STNS of H. americanus possessed little bioactivity relative to the full-length Val(1) isoform. Thus, it appears that the dodeca-variants Val(1)- and Gly(1)-SIFamide are the sole bioactive isoforms of this peptide family in clawed lobsters and freshwater crayfish.

Identification of an anti-lipopolysacchride factor possessing both antiviral and antibacterial activity from the red claw crayfish Cherax quadricarinatus.

PubMed

Lin, Feng-Yu; Gao, Yan; Wang, Hao; Zhang, Qiu-Xia; Zeng, Chang-Lin; Liu, Hai-Peng

2016-10-01

It is well-known that anti-lipopolysacchride factors (ALFs) are involved in the recognition and elimination of invading pathogens. In this study, the full-length ALF cDNA sequence of the red claw crayfish Cherax quadricarinatus (termed CqALF) was cloned from a suppression subtractive hybridization library constructed using red claw crayfish hematopoietic tissue cell (Hpt cell) cultures following challenge with white spot syndrome virus (WSSV). The full-length cDNA sequence of CqALF was 863 bp, and the open reading frame encoded 123 amino acids with a signal peptide in the N-terminus and a conserved LPS-binding domain. Unlike most ALFs, which are highly expressed in haemocytes, high expression levels of CqALF were detected in epithelium, the stomach and eyestalks, while lower expression was detected in Hpt, nerves, the heart, muscle tissue, gonads, haemocytes, intestines, gills and the hepatopancreas. To further explore the biological activities of CqALF, mature recombinant CqALF protein (rCqALF) was expressed and purified using a eukaryotic expression system, and an antimicrobial activity test was carried out. rCqALF clearly exerted antiviral activity, as evidenced by the severe disruption of the envelope of intact WSSV virions following co-incubation of virions with rCqALF. Additionally, pre-incubation of WSSV with rCqALF resulted in both a significant reduction in WSSV replication in red claw crayfish Hpt cell cultures and an increased survival rate among animals. Furthermore, rCqALF was effective against both Gram-negative bacteria and Gram-positive bacteria, particularly Shigella flexneri and Staphylococcus aureus. A membrane integrity assay suggested that rCqALF was unlikely to disrupt bacterial membrane integrity compared to cecropin P1. Taken together, these data suggest that CqALF may play an important role in immune defence in the crustacean C. quadricarinatus. Copyright © 2016 Elsevier Ltd. All rights reserved.

Seasonal Pattern of Batrachochytrium dendrobatidis Infection and Mortality in Lithobates areolatus: Affirmation of Vredenburg's “10,000 Zoospore Rule”

PubMed Central

Kinney, Vanessa C.; Heemeyer, Jennifer L.; Pessier, Allan P.; Lannoo, Michael J.

2011-01-01

To fully comprehend chytridiomycosis, the amphibian disease caused by the chytrid fungus Batrachochytrium dendrobatidis (Bd), it is essential to understand how Bd affects amphibians throughout their remarkable range of life histories. Crawfish Frogs (Lithobates areolatus) are a typical North American pond-breeding species that forms explosive spring breeding aggregations in seasonal and semipermanent wetlands. But unlike most species, when not breeding Crawfish Frogs usually live singly—in nearly total isolation from conspecifics—and obligately in burrows dug by crayfish. Crayfish burrows penetrate the water table, and therefore offer Crawfish Frogs a second, permanent aquatic habitat when not breeding. Over the course of two years we sampled for the presence of Bd in Crawfish Frog adults. Sampling was conducted seasonally, as animals moved from post-winter emergence through breeding migrations, then back into upland burrow habitats. During our study, 53% of Crawfish Frog breeding adults tested positive for Bd in at least one sample; 27% entered breeding wetlands Bd positive; 46% exited wetlands Bd positive. Five emigrating Crawfish Frogs (12%) developed chytridiomycosis and died. In contrast, all 25 adult frogs sampled while occupying upland crayfish burrows during the summer tested Bd negative. One percent of postmetamorphic juveniles sampled were Bd positive. Zoospore equivalents/swab ranged from 0.8 to 24,436; five out of eight frogs with zoospore equivalents near or >10,000 are known to have died. In summary, Bd infection rates in Crawfish Frog populations ratchet up from near zero during the summer to over 25% following overwintering; rates then nearly double again during and just after breeding—when mortality occurs—before the infection wanes during the summer. Bd-negative postmetamorphic juveniles may not be exposed again to this pathogen until they take up residence in crayfish burrows, or until their first breeding, some years later. PMID:21423745

Allometric relationship of postmolt net ion uptake, ventilation, and circulation in the freshwater crayfish Procambarus clarkii: intraspecific scaling.

PubMed

Zanotto, F P; Wheatly, M G; Reiber, C L; Gannon, A T; Jalles-Filho, E

2004-01-01

There are few intraspecific studies relating physiological parameters to body mass. This study relates scaling of ionic regulation and respiratory parameters with body mass in crayfish (Procambarus clarkii). These animals were chosen because of their direct development, spanning four orders of magnitude in body mass. Usually, these animals are hyperregulators and must maintain hemolymph electrolyte levels above those in the ambient freshwater. This is especially important in the postmolt, when ion imbalance can occur. Maintaining hemolymph ion levels above ambient involves active processes that are independently related to metabolic rate, ventilation, and circulation. Therefore, this study investigates relationships among size and ionic regulation, heart rate, and ventilation in crayfish, spanning a size range of 0.003-24 g. Postmolt net ion uptake of Ca, titratable base, Na, Cl, and NH4 increase with body mass (positive allometry) with slopes of 0.92, 0.79, 0.90, 0.84, and 0.87, respectively. Between 72% and 97% of variation in ionic regulation was related to body mass. The slopes differed from each other for Ca and titratable base but not for Na, Cl, and NH4. For heart rate and ventilation rate, different relationships were derived for animals smaller and larger than 0.01 g (between first and third instar). Animals larger than 0.01 g show a negative allometric relationship between heart rate and body size ([body mass](0.15)), while smaller animals show positive allometry with body size, but only 29% of variation in heart rate is explained by body size alone. For ventilation rates, the negative allometry with body size for animals larger than 0.01 g is present, but less than 15% of variation in ventilation rate is explained by size, while for smaller animals the size dependency disappears. Based on these results, predictions of physiological parameters such as ionic regulation based on body size are useful in crayfish, but estimates of respiratory parameters and body size should be used with caution.

Neuromodulation of activity-dependent synaptic enhancement at crayfish neuromuscular junction.

PubMed

Qian, S M; Delaney, K R

1997-10-17

Action potential-evoked transmitter release is enhanced for many seconds after moderate-frequency stimulation (e.g. 15 Hz for 30 s) at the excitor motorneuron synapse of the crayfish dactyl opener muscle. Beginning about 1.5 s after a train, activity-dependent synaptic enhancement (ADSE) is dominated by a process termed augmentation (G.D. Bittner, D.A. Baxter, Synaptic plasticity at crayfish neuromuscular junctions: facilitation and augmentation, Synapse 7 (1991) 235-243'[4]; K.L. Magleby, Short-term changes in synaptic efficacy, in: G.M. Edelman, L.E. Gall, C.W. Maxwell (Eds.), Synaptic Function, John Wiley and Sons, New York, 1987, pp. 21-56; K.L. Magleby; J.E. Zengel, Augmentation: a process that acts to increase transmitter release at the frog neuromuscular junction, J. Physiol. (Lond.) 257 (1976) 449-470) which decays approximately exponentially with a time constant of about 10 s at 16 degrees C, reflecting the removal of Ca2+ which accumulates during the train in presynaptic terminals (K.R. Delaney, D.W. Tank, R.S. Zucker, Serotonin-mediated enhancement of transmission at crayfish neuromuscular junction is independent of changes in calcium, J. Neurosci. 11 (1991) 2631-2643). Serotonin (5-HT, 1 microM) increases evoked and spontaneous transmitter release several-fold (D. Dixon, H.L. Atwood, Crayfish motor nerve terminal's response to serotonin examined by intracellular microelectrode, J. Neurobiol. 16 (1985) 409-424; J. Dudel, Modulation of quantal synaptic release by serotonin and forskolin in crayfish motor nerve terminals, in: Modulation of Synaptic Transmission and Plasticity in Nervous Systems, G. Hertting, H.-C. Spatz (Eds.), Springer-Verlag, Berlin, 1988; S. Glusman, E.A. Kravitz. The action of serotonin on excitatory nerve terminals in lobster nerve-muscle preparations, J. Physiol. (Lond.) 325 (1982) 223-241). We found that ADSE persists about 2-3 times longer after moderate-frequency presynaptic stimulation in the presence of 5-HT. This slowing of the decay of ADSE by 5-HT was not accompanied by significant changes in the initial amplitude of activity-dependent components of enhancement 1.5 s after the train. Measurements of presynaptic [Ca2+] indicated that the time course of Ca2+ removal from the presynaptic terminals after trains was not altered by 5-HT. Changes in presynaptic action potential shape, resting membrane potential or postsynaptic impedance after trains cannot account for slower recovery of ADSE. Axonal injection of EDTA slows the removal of residual Ca2+ and the decay of synaptic augmentation after trains of action potentials (K.R. Delaney, D.W. Tank, A quantitative measure of the dependence of short-term synaptic enhancement on presynaptic residual calcium, J. Neurosci. 14 (1994) 5885-5902), but has little or no effect on the 5-HT-induced persistence of ADSE. This also suggests that the time course of ADSE in the presence of 5-HT is not determined primarily by residual Ca2+ removal kinetics. The slowing of ADSE recovery after trains by 5-HT reverses with washing in 5-HT-free saline along with the 5-HT-mediated enhancement of release.

Identification of two GH18 chitinase family genes and their use as targets for detection of the crayfish-plague oomycete Aphanomyces astaci

PubMed Central

2009-01-01

Background The oomycete Aphanomyces astaci is regarded as the causative agent of crayfish plague and represents an evident hazard for European crayfish species. Native crayfish populations infected with this pathogen suffer up to 100% mortality. The existence of multiple transmission paths necessitates the development of a reliable, robust and efficient test to detect the pathogen. Currently, A. astaci is diagnosed by a PCR-based assay that suffers from cross-reactivity to other species. We developed an alternative closed-tube assay for A. astaci, which achieves robustness through simultaneous amplification of multiple functionally constrained genes. Results Two novel constitutively expressed members of the glycosyl hydrolase (GH18) gene family of chitinases were isolated from the A. astaci strain Gb04. The primary amino acid sequence of these chitinase genes, termed CHI2 and CHI3, is composed of an N-terminal signal peptide directing the post-translational transport of the protein into the extracellular space, the catalytic GH18 domain, a proline-, serine-, and threonine-rich domain and a C-terminal cysteine-rich putative chitin-binding site. The A. astaci mycelium grown in a pepton-glucose medium showed significant temporal changes in steady-state CHI2 and CHI3 mRNA amounts indicating functional constraint. Their different temporal occurrence with maxima at 48 and 24 hours of incubation for CHI2 and CHI3, respectively, is in accordance with the multifunctionality of GH18 family members. To identify A. astaci-specific primer target sites in these novel genes, we determined the partial sequence homologs in the related oomycetes A. frigidophilus, A. invadans, A. helicoides, A. laevis, A. repetans, Achlya racemosa, Leptolegnia caudata, and Saprolegnia parasitica, as well as in the relevant fungi Fusarium solani and Trichosporon cutaneum. An A. astaci-specific primer pair targeting the novel genes CHI2 and CHI3 as well as CHI1 - a third GH18 family member - was multiplexed with primers targeting the 5.8S rRNA used as an endogenous control. A species was typed unambiguously as A. astaci if two peaks were concomitantly detected by melting curve analysis (MCA). For sensitive detection of the pathogen, but also for quantification of agent levels in susceptible crayfish and carrier crayfish, a TaqMan-probe based real-time PCR (qPCR) assay was developed. It targets the same chitinase genes and allows quantification down to 25 target sequences. Conclusion The simultaneous qualitative detection of multiple sequences by qPCR/MCA represents a promising approach to detect species with elevated levels of genetic variation and/or limited available sequence information. The homogenous closed-tube format, reduced detection time, higher specificity, and the considerably reduced chance of false negative detection achieved by targeting multiple genes (CHI1, CHI2, CHI3, and the endogenous control) at least two of which are subject to high functional constraint, are the major advantages of this multiplex assay compared to other diagnostic methods. Sensitive quantification achieved with TaqMan qPCR facilitates to monitor infection status and pathogen distribution in different tissues and can help prevent disease transmission. PMID:19719847

77 FR 51042 - Endangered Species Recovery Permit Applications

Federal Register 2010, 2011, 2012, 2013, 2014

2012-08-23

..., weigh, mark, voucher, collect tissue, relocate, and release) the Shasta crayfish (Pacifastacus fortis.... TE-034101 Applicant: Naval Facilities Engineering Command Southwest, San Diego, California The...

Flow cytometric characterization of freshwater crayfish hemocytes for the examination of physiological status in wild and captive animals.

PubMed

Taylor, Sean; Landman, Michael J; Ling, Nicholas

2009-09-01

Enumeration of invertebrate hemocytes is a potentially powerful tool for the determination of physiological effects of extrinsic stressors, such as hypoxia, disease, and toxicant exposure. A detailed flow cytometric method of broad application was developed for the objective characterization and enumeration of the hemocytes of New Zealand freshwater crayfish Paranephrops planifrons for the purpose of physiological health assessment. Hemocyte populations were isolated by flow cytometric sorting based on differential light scatter properties followed by morphological characterization via light microscopy and software image analysis. Cells were identified as hyaline, semigranular, and granular hemocytes based on established invertebrate hemocyte classification. A characteristic decrease in nuclear size, an increase in granularity between the hyaline and granular cells, and the eccentric location of nuclei in granular cells were also observed. The granulocyte subpopulations were observed to possess varying degrees of granularity. The developed methodology was used to perform total and differential hemocyte counts from three lake populations and between wild and captive crayfish specimens. Differences in total and differential hemocyte counts were not observed among the wild populations. However, specimens held in captivity for 14 d exhibited a significant 63% reduction in total hemocyte count, whereas the relative hemocyte proportions remained the same. These results demonstrate the utility of this method for the investigation of subacute stressor effects in selected decapod crustaceans.

Crayfish respiration as a function of water oxygenation.

PubMed

Dejours, P; Beekenkamp, H

1977-06-01

Crayfish, Astacus leptodactylus, for several hours breathed water equilibrated either with a hypoxic gas mixture, or air, or oxygen. The hydrostatic pressure in the right epibranchial cavity was recorded and the left epibranchial water sempled from time to time. The higher the water oxygenation, the less the duration of ventilation, the frequency of the scaphognathite beats which ensure water convection, the negative of the water hydrostatic pressure relative to ambient water pressure, and the respired water flow. The water convection per unit quantity of oxygen consumed decreased by a factor of about 20 when the animal passed from hypoxic water at PO2 of 72 torr to hyperoxic water at PO2 of 697 torr. Prolonged hyperoxia, up to 100 days, results in a hypercapnic acidosis of the prebranchial blood. pH decreased about 0.2 unit, PCO2 increased from 2.5 torr to a value of 6 torr, and [HCO-3] from 6 to a value of 9 meq-L-1. This hypercapnic acidosis remained uncompensated during several weeks exposure to hyperoxia. Observations on the fresh water crayfish, a marine crab, and several species of fish, suggest that in aquatic animals (1) the ventilatory activity depends greatly on the degree of water oxygenation: the higher the water oxygenation, the lower the ventilation; (2) the change of ventilation may be accompanied by a new equilibrium of the blood acid-base status, quite different from that observed in normoxia.

On the role of phosphatidylinositol 3-kinase, protein kinase b/Akt, and glycogen synthase kinase-3β in photodynamic injury of crayfish neurons and glial cells.

PubMed

Komandirov, Maxim A; Knyazeva, Evgeniya A; Fedorenko, Yulia P; Rudkovskii, Mikhail V; Stetsurin, Denis A; Uzdensky, Anatoly B

2011-10-01

Photodynamic treatment that causes intense oxidative stress and cell death is currently used in neurooncology. However, along with tumor cells, it may damage healthy neurons and glia. To study the involvement of signaling processes in photodynamic injury or protection of neurons and glia, we used crayfish mechanoreceptor consisting of a single neuron surrounded by glial cells. It was photosensitized with alumophthalocyanine Photosens. Application of specific inhibitors showed that phosphatidylinositol 3-kinase did not participate in photoinduced death of neurons and glia. Akt was involved in photoinduced necrosis but not in apoptosis of neurons and glia. Glycogen synthase kinase-3β participated in photoinduced apoptosis of glial cells and in necrosis of neurons. Therefore, phosphatidylinositol 3-kinase/protein kinase Akt/glycogen synthase kinase-3β pathway was not involved as a whole in photodynamic injury of crayfish neurons and glia but its components, Akt and glycogen synthase kinase-3β, independently and cell specifically regulated death of neurons and glial cells. According to these data, necrosis in this system was a controlled but not a non-regulated cell death mode. The obtained results may be used for the search of pharmacological agents selectively modulating death and survival of normal neurons and glial cells during photodynamic therapy of brain tumors.

High prevalence of multiple paternity in the invasive crayfish species, Procambarus clarkii

PubMed Central

Yue, Gen Hua; Li, Jia Le; Wang, Chun Ming; Xia, Jun Hong; Wang, Gen Lin; Feng, Jian Bing

2010-01-01

Reproductive strategy is a central feature of the ecology of invasive species as it determines the potential for population increase and range expansion. The red swamp crayfish, Procambarus clarkii, has invaded many countries and caused serious problems in freshwater ecosystems. However, little is known about the effects of environmental conditions on crayfish paternity and offspring traits in the wild. We studied these reproductive characteristics of P. clarkii in wild populations from two different habitats (ponds and ditches) in three locations with different environmental conditions in China. Genotyping of 1,436 offspring and 30 mothers of 30 broods was conducted by using four microsatellites. An analysis of genotyping results revealed that gravid females were the exclusive mother of the progeny they tended. Twenty-nine of 30 mothers had mated with multiple (2-4) males, each of which contributed differently to the number of offspring in a brood. The average number of fathers per brood and the number of offspring per brood were similar (P > 0.05) among six sampling sites, indicating that in P. clarkii multiple paternity and offspring number per brood are independent of environmental conditions studied. Indirect benefits from increasing the genetic diversity of broods, male and sperm competition, and cryptic female choice are a possible explanation for the high level multiple paternity and different contribution of fathers to offspring in this species. PMID:20186292

Living Laboratories

ERIC Educational Resources Information Center

Mules, B. R.

1976-01-01

Presented is a review of various methods of keeping live animals, including scorpions, spiders, crabs, crayfish, shrimp, ants, fish, mice, and birds, as well as plants as a school science project/display. (SL)

Na+ current in presynaptic terminals of the crayfish opener cannot initiate action potentials.

PubMed

Lin, Jen-Wei

2016-01-01

Action potential (AP) propagation in presynaptic axons of the crayfish opener neuromuscular junction (NMJ) was investigated by simultaneously recording from a terminal varicosity and a proximal branch. Although orthodromically conducting APs could be recorded in terminals with amplitudes up to 70 mV, depolarizing steps in terminals to -20 mV or higher failed to fire APs. Patch-clamp recordings did detect Na(+) current (INa) in most terminals. The INa exhibited a high threshold and fast activation rate. Local perfusion of Na(+)-free saline showed that terminal INa contributed to AP waveform by slightly accelerating the rising phase and increasing the peak amplitude. These findings suggest that terminal INa functions to "touch up" but not to generate APs. Copyright © 2016 the American Physiological Society.

Glutamatergic postsynaptic block by Pamphobeteus spider venoms in crayfish.

PubMed

Araque, A; Ferreira, W; Lucas, S; Buño, W

1992-01-31

The effects of toxins from venom glands of two south american spiders (Pamphobeteus platyomma and P. soracabae) on glutamatergic excitatory synaptic transmission were studied in the neuromuscular junction of the opener muscle of crayfish. The toxins selectively and reversibly blocked both excitatory postsynaptic currents and potentials in a dose-dependent manner. They also reversibly abolished glutamate-induced postsynaptic membrane depolarization. They had no effect on resting postsynaptic membrane conductance nor on postsynaptic voltage-gated currents. The synaptic facilitation and the frequency of miniature postsynaptic potentials were unaffected by the toxins, indicating that presynaptic events were not modified. Picrotoxin, a selective antagonist of the gamma-aminobutyric acid (GABA)A receptor, did not modify toxin effects. We conclude that both toxins specifically block the postsynaptic glutamate receptor-channel complex.

Cambarus polypilosus, a new species of stream-dwelling crayfish (Decapoda: Cambaridae) from the Western Highland Rim of Tennessee, USA.

PubMed

Loughman, Zachary J; Williams, Bronwyn W

2018-04-03

Cambarus polypilosus sp. nov. is a stream-dwelling crayfish endemic to tributaries in the Buffalo and lower Duck River drainage, and a reach of the lower Tennessee River in the Western Highland Rim of West-Central Tennessee, U.S.A. The new species is closely allied to the three members of the former subgenus Glareocola, but can be differentiated from each by a combination of characters, including body size, coloration, spination, setation, and form I male gonopod morphology. Several meristic measurements and ratios also differentiate C. polypilosus sp. nov. from Cambarus friaufi, to which it is morphologically most similar. Cambarus polypilosus sp. nov. appears to be common in cherty gravel and cobble habitats, where it is typically found in interstices at depths of 0.3 m or more below the substrate surface.

Comparison of diet, reproductive biology, and growth of the pig frog (Rana grylio) from harvested and protected areas of the Florida Everglades

USGS Publications Warehouse

Ugarte, C.A.; Rice, K.G.; Donnelly, M.A.

2007-01-01

Distinct differences in body size exist among three Rana grylio populations in areas of the Florida Everglades that differ in frog harvest pressure and hydroperiod. Frogs from two populations are harvested regularly throughout the year, while those in the third are protected from harvest. We compared seasonal and sex differences in diet, reproduction, and growth across these populations to examine life-history patterns. By volume, crayfish and anurans were the most abundant prey items for all adults across sites. Frogs from drier sites consumed more crayfish than frogs from the wettest site. Anurans were abundant in the diet during the wet season, while crayfish and fish were abundant during the dry season. More frogs with empty stomachs were captured during the wet season than the dry season. Feeding, growth, and fat deposition were greatest during the dry season across all sites. Although females were found in all reproductive stages throughout the year, the highest percentage of females had mature ova during the late dry season and spent ovaries during the early wet season. Individual patterns of growth were similar across all sites and matched historical growth data from the 1950s. Differences in body size among sites were most likely attributable to differential mortality (i.e., harvest pressure, predation) rather than to differences in food access or growth. ?? 2007 by the American Society of Ichthyologists and Herpetologists.

[Regulation of pyloric rhythm by I(A) and I(h) in crayfish stomatogastric ganglion].

PubMed

Kuang, Guo-Hui; Liu, Yi-Hui; Ren, Wei

2012-06-25

The stomatogastric ganglion (STG) of shellfish includes 30 neurons and produces pyloric rhythms. It is the common model to study central pattern generator (CPG). Regulation of pyloric rhythms not only is related to the property of single neurons in STG but also depends on the connections and property of the whole neuronal network. It has been found that transient potassium current (I(A)) and hyperpolarization-activated cation current (I(h)) exist in certain types of neurons of STG. However, roles played by these two currents in maintaining and regulating the pyloric rhythms are unknown. In the present study, in vitro electrophysiological recordings were performed on crayfish STG to examine the role played by I(A) and I(h) in regulation of pyloric rhythm. 4AP (2 mmol/L), a specific inhibitor of I(A), caused a decrease in pyloric cycle (P < 0.01), an increase in PD (pyloric dilator) ratio, a decrease in PY (pyloric) ratio (P < 0.01) and delay of phases of LP and PY firing. ZD7288 (100 μmol/L), a specific inhibitor of I(h), caused a decrease in pyloric cycle (P < 0.01), an increase in PD ratio (P < 0.01), an increase in LP (lateral pyloric) ratio (P < 0.01), a decrease in PY ratio (P < 0.01) and delay of phases of LP and PY firing. These results indicate that I(A) and I(h) play important roles in regulating pyloric rhythms in crayfish STG.

The role of NO synthase isoforms in PDT-induced injury of neurons and glial cells

NASA Astrophysics Data System (ADS)

Kovaleva, V. D.; Berezhnaya, E. V.; Uzdensky, A. B.

2015-03-01

Nitric oxide (NO) is an important second messenger, involved in the implementation of various cell functions. It regulates various physiological and pathological processes such as neurotransmission, cell responses to stress, and neurodegeneration. NO synthase is a family of enzymes that synthesize NO from L-arginine. The activity of different NOS isoforms depends both on endogenous and exogenous factors. In particular, it is modulated by oxidative stress, induced by photodynamic therapy (PDT). We have studied the possible role of NOS in the regulation of survival and death of neurons and surrounding glial cells under photo-oxidative stress induced by photodynamic treatment (PDT). The crayfish stretch receptor consisting of a single identified sensory neuron enveloped by glial cells is a simple but informative model object. It was photosensitized with alumophthalocyanine photosens (10 nM) and irradiated with a laser diode (670 nm, 0.4 W/cm2). Antinecrotic and proapoptotic effects of NO on the glial cells were found using inhibitory analysis. We have shown the role of inducible NO synthase in photoinduced apoptosis and involvement of neuronal NO synthase in photoinduced necrosis of glial cells in the isolated crayfish stretch receptor. The activation of NO synthase was evaluated using NADPH-diaphorase histochemistry, a marker of neurons expressing the enzyme. The activation of NO synthase in the isolated crayfish stretch receptor was evaluated as a function of time after PDT. Photodynamic treatment induced transient increase in NO synthase activity and then slowly inhibited this enzyme.

Electrical and Mechanical Responses in Deep Abdominal Extensor Muscles of Crayfish and Lobster

PubMed Central

Abbott, Bernard C.; Parnas, I.

1965-01-01

Electrical and mechanical studies have been made of the deep abdominal extensor muscles, medial (DEAM) and lateral (DEAL), of crayfish and lobster. The medial muscle responds to direct (intracellular) and indirect stimulation with a transient membrane depolarization which exhibits the properties of a propagated non-decremental action potential but does not overshoot the zero level. The amplitude is about 30 mv in crayfish and 50 mv in lobster. It is followed by a fast all-or-none twitch whose duration at 20°C is 30 to 50 msec. and whose developed tension is 500 gm/cm2 or about half the tetanic value. Membrane potential is K+-dependent and immersion in high K+ induces a brief transient tension rise as in other twitch-type muscles. The action potential and twitch are normal even if all external Na+ is replaced with sucrose but vary with external Ca++, the action potential increasing 8 to 10 mv for a twofold increase in Ca++. The lateral muscle (DEAL) is much slower and responds to intracellular stimulation only with an electrotonic or a local response. Mechanical responses and relaxation speeds are slow with minimal duration of contraction of 0.5 to 2 seconds. Immersion in high K solutions induces large maintained tensions. Sarcomere length in the fast DEAM is uniform and about 2 µ at rest, but in the DEAL speed is less and sarcomere length is greater averaging about 4.5 µ but with a mixed population of fibers. PMID:14324996

Critters in the Classroom.

ERIC Educational Resources Information Center

Smith, Robert W.; Fleisher, Paul

1984-01-01

The use of invertebrates as classroom "pets" can develop students' skills in scientific inquiry and instill respect for science. Few materials are needed for projects involving invertebrates. Suggested activities using snails, crickets, earthworms, crayfish, and guppies are offered. (DF)

South Africa

Atmospheric Science Data Center

2013-04-16

... blooms of phytoplankton caused a rapid reduction in the oxygen concentration of nearshore waters. The lobsters (or crayfish, as they ... known locally) moved toward the breaking surf in search of oxygen, but were stranded by the retreating tide. The Multi-angle Imaging ...

Physiological thermoregulation in a crustacean? Heart rate hysteresis in the freshwater crayfish Cherax destructor.

PubMed

Goudkamp, Jacqueline E; Seebacher, Frank; Ahern, Mark; Franklin, Craig E

2004-07-01

Differential heart rates during heating and cooling (heart rate hysteresis) are an important thermoregulatory mechanism in ectothermic reptiles. We speculate that heart rate hysteresis has evolved alongside vascularisation, and to determine whether this phenomenon occurs in a lineage with vascularised circulatory systems that is phylogenetically distant from reptiles, we measured the response of heart rate to convective heat transfer in the Australian freshwater crayfish, Cherax destructor. Heart rate during convective heating (from 20 to 30 degrees C) was significantly faster than during cooling for any given body temperature. Heart rate declined rapidly immediately following the removal of the heat source, despite only negligible losses in body temperature. This heart rate 'hysteresis' is similar to the pattern reported in many reptiles and, by varying peripheral blood flow, it is presumed to confer thermoregulatory benefits particularly given the thermal sensitivity of many physiological rate functions in crustaceans.

Environmentally relevant concentrations of tramadol and citalopram alter behaviour of an aquatic invertebrate.

PubMed

Buřič, M; Grabicová, K; Kubec, J; Kouba, A; Kuklina, I; Kozák, P; Grabic, R; Randák, T

2018-05-14

Environmental pollution by pharmaceutically active compounds, used in quantities similar to those of pesticides and other organic micropollutants, is increasingly recognized as a major threat to the aquatic environment. These compounds are only partly removed from wastewaters and, despite their low concentrations, directly and indirectly affect behaviour of freshwater organisms in natural habitats. The aim of this study was to behaviourally assess the effects of an opioid painkiller (tramadol) and antidepressant drug (citalopram) on behaviour patterns of a clonal model species, marbled crayfish. Animals exposed to environmentally relevant concentrations of both tested compounds (∼1 μg l -1 ) exhibited significantly lower velocity and shorter distance moved than controls. Crayfish exposed to tramadol spent more time in shelters. Results were obtained by a simple and rapid method recommended as suitable for assessment of behaviour in aquatic organisms exposed to single pollutants and combinations. Copyright © 2018 Elsevier B.V. All rights reserved.

Enamel-like apatite crown covering amorphous mineral in a crayfish mandible

PubMed Central

Bentov, Shmuel; Zaslansky, Paul; Al-Sawalmih, Ali; Masic, Admir; Fratzl, Peter; Sagi, Amir; Berman, Amir; Aichmayer, Barbara

2012-01-01

Carbonated hydroxyapatite is the mineral found in vertebrate bones and teeth, whereas invertebrates utilize calcium carbonate in their mineralized organs. In particular, stable amorphous calcium carbonate is found in many crustaceans. Here we report on an unusual, crystalline enamel-like apatite layer found in the mandibles of the arthropod Cherax quadricarinatus (freshwater crayfish). Despite their very different thermodynamic stabilities, amorphous calcium carbonate, amorphous calcium phosphate, calcite and fluorapatite coexist in well-defined functional layers in close proximity within the mandible. The softer amorphous minerals are found primarily in the bulk of the mandible whereas apatite, the harder and less soluble mineral, forms a wear-resistant, enamel-like coating of the molar tooth. Our findings suggest a unique case of convergent evolution, where similar functional challenges of mastication led to independent developments of structurally and mechanically similar, apatite-based layers in the teeth of genetically remote phyla: vertebrates and crustaceans. PMID:22588301

What vaccination studies tell us about immunological memory within the innate immune system of cultured shrimp and crayfish.

PubMed

Chang, Yu-Hsuan; Kumar, Ramya; Ng, Tze Hann; Wang, Han-Ching

2018-03-01

The possibility of immunological memory in invertebrates is a topic that has recently attracted a lot of attention. Today, even vertebrates are known to exhibit innate immune responses that show memory-like properties, and since these responses are triggered by cells that are involved in the innate immune system, it seems that immune specificity and immune memory do not necessarily require the presence of B cells and T cells after all. This kind of immune response has been called "immune priming" or "trained immunity". In this report, we review recent observations and our current understanding of immunological memory within the innate immune system in cultured shrimp and crayfish after vaccination with live vaccine, killed vaccine and subunit vaccines. We also discuss the possible mechanisms involved in this immune response. Copyright © 2017 Elsevier Ltd. All rights reserved.

A Crayfish Insulin-like-binding Protein

PubMed Central

Rosen, Ohad; Weil, Simy; Manor, Rivka; Roth, Ziv; Khalaila, Isam; Sagi, Amir

2013-01-01

Across the animal kingdom, the involvement of insulin-like peptide (ILP) signaling in sex-related differentiation processes is attracting increasing attention. Recently, a gender-specific ILP was identified as the androgenic sex hormone in Crustacea. However, moieties modulating the actions of this androgenic insulin-like growth factor were yet to be revealed. Through molecular screening of an androgenic gland (AG) cDNA library prepared from the crayfish Cherax quadricarinatus, we have identified a novel insulin-like growth factor-binding protein (IGFBP) termed Cq-IGFBP. Based on bioinformatics analyses, the deduced Cq-IGFBP was shown to share high sequence homology with IGFBP family members from both invertebrates and vertebrates. The protein also includes a sequence determinant proven crucial for ligand binding, which according to three-dimensional modeling is assigned to the exposed outer surface of the protein. Recombinant Cq-IGFBP (rCq-IGFBP) protein was produced and, using a “pulldown” methodology, was shown to specifically interact with the insulin-like AG hormone of the crayfish (Cq-IAG). Particularly, using both mass spectral analysis and an immunological tool, rCq-IGFBP was shown to bind the Cq-IAG prohormone. Furthermore, a peptide corresponding to residues 23–38 of the Cq-IAG A-chain was found sufficient for in vitro recognition by rCq-IGFBP. Cq-IGFBP is the first IGFBP family member shown to specifically interact with a gender-specific ILP. Unlike their ILP ligands, IGFBPs are highly conserved across evolution, from ancient arthropods, like crustaceans, to humans. Such conservation places ILP signaling at the center of sex-related phenomena in early animal development. PMID:23775079

Use of electroreception during foraging by the Australian lungfish.

PubMed

Watt; Evans; Joss

1999-11-01

A diverse range of animals, including elasmobranchs and nonteleost fish, use passive electroreception to locate hidden prey. The Australian lungfish, Neoceratodus forsteri (Krefft 1870), has ampullary organs analogous in form to the electroreceptors of other nonteleost fish. Afferents from these ampullae project to regions in the brain that are known to process electrosensory information in other species, suggesting that N. forsteri possesses an electric sense that may be used during prey location. To explore this hypothesis directly, we first characterized food-locating behaviour in N. forsteri and then conducted an experiment designed to quantify the effects of manipulating electrical and olfactory stimuli from live prey. A small crayfish, Cherax destructor, was housed in a specially constructed chamber hidden beneath the substrate, which prevented emission of chemical, mechanical and visual cues, but allowed transmission of bioelectric fields. Control treatments included presentation of electrically shielded prey, a dead crayfish and an empty chamber. In some treatments, a competing olfactory signal was presented simultaneously at the other end of the test tank to assess the relative salience of this sensory modality. The lungfish responded to the crayfish in the unshielded chamber with accurate and sustained feeding movements, even with a competing olfactory signal. By contrast, the abolition of electrical cues in the three control treatments reduced the accuracy and frequency of feeding movements in the vicinity of the target chamber. These results show that N. forsteri is capable of perceiving the weak electric fields surrounding living animals, and suggest that it uses this information when foraging to locate prey hidden from view. Copyright 1999 The Association for the Study of Animal Behaviour.

Crayfish Self-Administer Amphetamine in a Spatially Contingent Task.

PubMed

Datta, Udita; van Staaden, Moira; Huber, Robert

2018-01-01

Natural reward is an essential element of any organism's ability to adapt to environmental variation. Its underlying circuits and mechanisms guide the learning process as they help associate an event, or cue, with the perception of an outcome's value. More generally, natural reward serves as the fundamental generator of all motivated behavior. Addictive plant alkaloids are able to activate this circuitry in taxa ranging from planaria to humans. With modularly organized nervous systems and confirmed vulnerabilities to human drugs of abuse, crayfish have recently emerged as a compelling model for the study of the addiction cycle, including psychostimulant effects, sensitization, withdrawal, reinstatement, and drug reward in conditioned place preference paradigms. Here we extend this work with the demonstration of a spatially contingent, operant drug self-administration paradigm for amphetamine. When the animal enters a quadrant of the arena with a particular textured substrate, a computer-based control system delivers amphetamine through an indwelling fine-bore cannula. Resulting reward strength, dose-response, and the time course of operant conditioning were assessed. Individuals experiencing the drug contingent on their behavior, displayed enhanced rates of operant responses compared to that of their yoked (non-contingent) counterparts. Application of amphetamine near the supra-esophageal ganglion elicited stronger and more robust increases in operant responding than did systemic infusions. This work demonstrates automated implementation of a spatially contingent self-administration paradigm in crayfish, which provides a powerful tool to explore comparative perspectives in drug-sensitive reward, the mechanisms of learning underlying the addictive cycle, and phylogenetically conserved vulnerabilities to psychostimulant compounds.

Crayfish Self-Administer Amphetamine in a Spatially Contingent Task

PubMed Central

Datta, Udita; van Staaden, Moira; Huber, Robert

2018-01-01

Natural reward is an essential element of any organism’s ability to adapt to environmental variation. Its underlying circuits and mechanisms guide the learning process as they help associate an event, or cue, with the perception of an outcome’s value. More generally, natural reward serves as the fundamental generator of all motivated behavior. Addictive plant alkaloids are able to activate this circuitry in taxa ranging from planaria to humans. With modularly organized nervous systems and confirmed vulnerabilities to human drugs of abuse, crayfish have recently emerged as a compelling model for the study of the addiction cycle, including psychostimulant effects, sensitization, withdrawal, reinstatement, and drug reward in conditioned place preference paradigms. Here we extend this work with the demonstration of a spatially contingent, operant drug self-administration paradigm for amphetamine. When the animal enters a quadrant of the arena with a particular textured substrate, a computer-based control system delivers amphetamine through an indwelling fine-bore cannula. Resulting reward strength, dose-response, and the time course of operant conditioning were assessed. Individuals experiencing the drug contingent on their behavior, displayed enhanced rates of operant responses compared to that of their yoked (non-contingent) counterparts. Application of amphetamine near the supra-esophageal ganglion elicited stronger and more robust increases in operant responding than did systemic infusions. This work demonstrates automated implementation of a spatially contingent self-administration paradigm in crayfish, which provides a powerful tool to explore comparative perspectives in drug-sensitive reward, the mechanisms of learning underlying the addictive cycle, and phylogenetically conserved vulnerabilities to psychostimulant compounds.

Nerve membrane ion channels as the target site of environmental toxicants

DOE Office of Scientific and Technical Information (OSTI.GOV)

Narahashi, T.

1987-04-01

There are many environmentally important chemicals which exhibit potent effects on the nervous system. Since nerve excitation takes place in a fraction of a second, electrophysiological methods provide the authors with the most straightforward approach to the study of the mechanisms of action of environmental toxicants on the nervous system. Aquatic animals such as crayfish, lobster, squid, and marine snails represent extremely useful materials for such electrophysiological studies, because much of the authors knowledge of nerve excitation is derived from those animals. Nerve excitation takes place as a result of opening and closing of ion channels of the membrane. Thesemore » functions are independent of metabolic energy, and can be measured most effectively by voltage clamp techniques as applied to the giant axons of the crayfish and the squid. Patch clamp techniques developed during the past 10 years have added a new dimension to the electrophysiological investigation. These techniques allow them to measure the activity of individual ion channels, thereby making it possible to analyze the interaction of toxic molecules directly with single ion channels. Examples are given summarizing electrophysiological studies of environmental neurotoxicants. The abdominal nerve cords and neuromuscular preparations isolated from the crayfish are convenient materials for bioassay of certain environmental toxicants such as pyrethroids, chlorinated hydrocarbons, and other insecticides. Only a small fraction of the flux through the sodium channel, less than 1%, must be modified by pyrethroids for the animal to develop symptoms of poisoning. Such a toxicological application from channel to animal is important is understanding the potent toxic effect.« less

78 FR 57385 - Pesticide Emergency Exemptions; Agency Decisions and State and Federal Agency Crisis Declarations

Federal Register 2010, 2011, 2012, 2013, 2014

2013-09-18

... species of Caribbean crazy ant; November 1, 2012, to November 1, 2015. Specific exemption: EPA authorized... invasive Red Swamp Crayfish; November 26, 2012 to September 30, 2013. Specific exemption: EPA authorized...

Transmission of Microsporidian Parasites of Mosquitoes.

DTIC Science & Technology

1983-03-01

spiders, beetle larvae, and phantom midges. 2) Feeding spores to crayfish, dragonfly larvae, damselfly larvae, water scorpions, beetles , Anopheles...use of an indirect enzyme-linked immunosorbent assay to detect baculovirus in larvae and adults of Oryctes rhinoceros from Tonga J. Gen. Virol., 47

ENANTIOMERIC COMPOSITION OF CHIRAL POLYCHLORINATED BIPHENYL ATROPISOMERS IN AQUATIC AND RIPARIAN BIOTA

EPA Science Inventory

The enantiomeric composition of polychlorinated biphenyl (PCB) atropisomers was measured in river and riparian biota (fish, bivalves, crayfish, water snakes, barn swallows) from selected sites throughout the United States by using chiral gas chromatography/mass spectrometry. Nonr...

Relative abundance and distribution of fishes and crayfish at Ash Meadows National Wildlife Refuge, Nye County, Nevada, 2007-08

USGS Publications Warehouse

Scoppettone, G. Gary; Rissler, Peter; Johnson, Danielle; Hereford, Mark

2011-01-01

This study provides baseline data of native and non-native fish populations in Ash Meadows National Wildlife Refuge (NWR), Nye County, Nevada, that can serve as a gauge in native fish enhancement efforts. In support of Carson Slough restoration, comprehensive surveys of Ash Meadows NWR fishes were conducted seasonally from fall 2007 through summer 2008. A total of 853 sampling stations were created using Geographic Information Systems and National Agricultural Imagery Program. In four seasons of sampling, Amargosa pupfish (genus Cyprinodon) was captured at 388 of 659 stations. The number of captured Amargosa pupfish ranged from 5,815 (winter 2008) to 8,346 (summer 2008). The greatest success in capturing Amargosa pupfish was in warm water spring-pools with temperature greater than 25 degrees C, headwaters of warm water spring systems, and shallow (depths less than 10 centimeters) grassy marshes. In four seasons of sampling, Ash Meadows speckled dace (Rhinichthys osculus nevadesis) was captured at 96 of 659 stations. The number of captured Ash Meadows speckled dace ranged from 1,009 (summer 2008) to 1,552 (winter 2008). The greatest success in capturing Ash Meadows speckled dace was in cool water spring-pools with temperature less than 20 degrees C and in the high flowing water outflows. Among 659 sampling stations within the range of Amargosa pupfish, red swamp crayfish (Procambarus clarkii) was collected at 458 stations, western mosquitofish (Gambusia affinis) at 374 stations, and sailfin molly (Poecilia latipinna) at 128 stations. School Springs was restored during the course of this study. Prior to restoration of School Springs, maximum Warm Springs Amargosa pupfish (Cyprinodon nevadensis pectoralis) captured from the six springs of the Warm Springs Complex was 765 (fall 2007). In four seasons of sampling, Warm Springs Amargosa pupfish were captured at 85 of 177 stations. The greatest success in capturing Warm Springs Amargosa pupfish when co-occurring with red swamp crayfish and western mosquitofish was in water with temperature greater than 26 degrees C near the springhead, and in shallow (depths less than 10 centimeters) grassy marshes. Among 177 sampling stations within the range of Warm Springs Amargosa pupfish, red swamp crayfish were collected at 96 stations and western mosquitofish were collected at 49 stations. Removal of convict cichlid (Amatitlania nigrofasciata) from Fairbanks Spring was followed by a substantial increase in Ash Meadows Amargosa pupfish (Cyprinodon nevadensis mionectes) captures from 910 pre-removal to 3,056 post-removal. Red swamp crayfish was continually removed from Bradford 1 Spring, which seemed to cause an increase in the speckled dace population. Restoration of Kings Pool and Jackrabbit Springs promoted the success of native fishes with the greatest densities in restored reaches. Ongoing restoration of Carson Slough and its tributaries, as well as control and elimination of invasive species, is expected to increase abundance and distribution of Ash Meadows' native fish populations. Further analysis of data from this study will help determine the habitat characteristic(s) that promote native species and curtail non-native species.

Interdisciplinarity to reconstruct historical introductions: solving the status of cryptogenic crayfish.

PubMed

Clavero, Miguel; Nores, Carlos; Kubersky-Piredda, Susanne; Centeno-Cuadros, Alejandro

2016-11-01

Anciently introduced species can be confounded with native species because introduction pre-dates the first species inventories or because of the loss of the collective memory of the introductions. The term 'cryptogenic species' denotes species of unknown or unclear status (native versus non-native) in a given territory, and disciplinary approaches are often insufficient for solving their true status. Here, we follow an integrative, multidisciplinary approach to solve the status of a cryptogenic species, proposing that building on evidence from multiple disciplines can produce robust and clarifying insights. We undertook an exhaustive review of information on a putatively native crayfish (Austropotamobius italicus) in Spain. The reviewed information included taxonomy, genetics and phylogeography, history, archaeology, linguistics, biogeography, ecology, symbiotic organisms and even gastronomy and pharmacy. The knowledge produced by different scientific disciplines converges to indicate that A. italicus is a non-native species in Spain. Historical documents even identify the first introduction event: crayfish were shipped from Italy to Spain in 1588 as a diplomatic gift from Francesco I de' Medici to King Philip II of Spain. Previous discussions on the status of A. italicus focussed on inconclusive and often confusing genetic results and excluded the rich and clarifying evidence available from other approaches and disciplines. Interdisciplinarity is an often-invoked but rarely implemented practice in an academic environment that increasingly promotes narrow-focussed specialization. Our review shows that the integration of disciplines can surpass disciplinary approaches in solving scientific controversies. Our results have straightforward implications for strategies to conserve biological diversity in Spain and Europe, urging a debate on the appropriateness of devoting conservation efforts to non-native species. © 2015 Cambridge Philosophical Society.

[Effect of white spot syndrome virus envelope protein Vp28 expressed in silkworm (Bombyx mori) pupae on disease resistence in Procambarus clarkii].

PubMed

Wei, Ke Qiang; Xu, Zi Rong

2005-06-01

The vaccine made of recombinant envelope protein (rVp28) of white spot syndrome virus (WSSV) expressed in silkworm (Bombyx mori) pupae using a baculovirus vector was used to investigate the efficacy of oral administration on WSSV disease resistance of Procambarus clarkii. Vaccine was mixed with diet at a ratio of 2% (w/w), and Procambarus clarkii were orally administered throughout 75 days. Vaccination with rVP28 showed the significantly higher cumulative survival compared with positive and negative control (P < 0.05) following an oral challenge on the 35th day post-vaccination (dpv), with PRP values 54.16% and 59.26%, respectively. rVP28 induced higher resistance via IM (intramuscular) injection challenge with WSSV stock, with PRP value of 46.12% and 49.99%, respectively. The survivors were subsequently re-challenged on the 55th dpv. rVP28 induced the significantly higher resistance to oral re-challenge (P < 0.05), with both PRP values 55.80% and 63.16%, respectively. rVP28 induced higher resistance to IM injection re-challenge, with both PRP values 31.25%. A DIG labeled WSSV DNA probe was used to detect WSSV by in situ hybridization. The positive cells were observed in epithelial cells of stomach, hepatopancreas and gut of the infected control crayfish, while negative reaction were observed in the tissues of survivors-vaccinated. These results indicated that vaccination of crayfish with recombinant protein had significant effect on oral infection, and had higher resistance against intramuscular injection challenge. This suggested the protection against WSSV could be induced in crayfish by recombinant protein rVp28 expressed in silkworm pupae.

Inhibition of acetylcholinesterase activity in the central nervous system of the red swamp crayfish, Procambarus clarkii, by mercury, cadmium, and lead

DOE Office of Scientific and Technical Information (OSTI.GOV)

Devi, M.; Fingerman, M.

The toxicological, physiological and biochemical responses of aquatic crustaceans to heavy metals have been reported by several investigators. Levels of glucose, lactic acid, sodium, potassium, aspartate aminotransferase and alanine aminotransferase in the blood of the crab Scylla serrata increased, while glycogen levels in hepatopancreas and muscle decreased after a four-week exposure to mercuric chloride. In fiddler crab, Uca pugilator, enzyme activity was observed to decrease in the hepatopancreas but increased in abdominal muscle after 48 hr cadmium exposure. In the red swamp crayfish, Procambarus clarkii, exposed for 96 hr to cadmium, glutahione (GSH) level and GSH S-transferase activity deceased inmore » the midgut. In crayfish Astacus astacus exposed to sublethal concentrations of lead and cadmium, oxidative enzyme (succine dehydrogenase and NADPH-cytochrome P450 reductase) activities in gills and hepatopancrease decreased. Acetylcholinesterase (AChE) inhibition by organophosphates and organocarbamates in various crustaceans has bee reported. In vivo cadmium exposure caused increases in esterase activities, but mercury exposure decreases these activities in the hepatopancreas of the shrimp Callianassa tyrrhena. The freshwater crab, Barytelphusa guerini, exposed to 0.6 ppm cadmium showed reduced oxygen consumption throughout the experiment whereas AChE activity increased after 4 days but decreased after 15 days. The authors wanted to determine the effects of cadmium, lead and mercury on AChE activity in central nervous tissue of Procambarus clarkii. This enzyme has the potential for serving both as a biochemical indicator of toxic stress and a sensitive parameter for testing water for the presence of toxicants. These three biologically silent metals have, according to Schweinsberg and Karsa great toxicological significance to humans because their use is widespread. 14 refs., 4 figs.« less

A three-domain Kazal-type serine proteinase inhibitor exhibiting domain inhibitory and bacteriostatic activities from freshwater crayfish Procambarus clarkii.

PubMed

Li, Xin-Cang; Wang, Xian-Wei; Wang, Zong-Heng; Zhao, Xiao-Fan; Wang, Jin-Xing

2009-12-01

In crustaceans, Kazal-type serine proteinase inhibitors in hemolymph are believed to function as regulators of the host-defense reactions or inhibitors against proteinases from microorganisms. In this study, we report a Kazal-type serine proteinase inhibitor, named hcPcSPI1, from freshwater crayfish (Procambarus clarkii). We found that hcPcSPI1 is composed of a putative signal peptide, an RGD motif, and three tandem Kazal-type domains with the domain P1 residues L, L and E, respectively. Mainly, hcPcSPI1 was detected in hemocytes as well as in the heart, gills, and intestine at both the mRNA and protein levels. Quantitative real-time PCR analysis showed that hcPcSPI1 in hemocytes was upregulated by the stimulation of Esherichia coli (8099) or became decreased after a white spot syndrome virus (WSSV) challenge. In addition, hcPcSPI1 and its three independent domains were overexpressed and purified to explore their potential functions. All four proteins inhibited subtilisin A and proteinase K, but not alpha-chymotypsin or trypsin. Recombinant hcPcSPI1 could firmly attach to Gram-negative bacteria E. coli and Klebsiella pneumoniae; Gram-positive bacteria Bacillus subtilis, Bacillus thuringiensis and Staphylococcus aureus; fungi Candida albicans and Saccharomyce cerevisiae, and only domain 1 was responsible for the binding to E. coli and S. aureus. In addition, recombinant hcPcSPI1 was also found to possess bacteriostatic activity against the B. subtilis and B. thuringiensis. Domains 2 and 3 contributed mainly to these bacteriostatic activities. All results suggested that hcPcSPI1 might play important roles in the innate immunity of crayfish.

Systematics and position of Nephrops among the lobsters.

PubMed

Tshudy, Dale

2013-01-01

This chapter presents and explains the position of Nephrops norvegicus in the classification of lobsters. Covered, in order, are systematic classification of Nephrops, taxonomic history of Nephrops, and analysis of Nephrops in nephropid phylogeny. The genus Nephrops was erected by Leach in 1814 and has a long and interesting taxonomic history. Prior to 1972, Nephrops was known by 14 Recent species. All but one of these, N. norvegicus, were removed to a new genus, Metanephrops, by Jenkins (1972). Today, N. norvegicus is still the only known living representative of the genus. Similarly, Nephrops is known by only one fossil species, the Miocene Nephrops kvistgaardae, although several other fossil species have been previously referred to this genus. Nephrops, along with the other familiar and commercially important marine clawed lobsters, is referred to Family Nephropidae, one of 17 marine clawed lobster families arrayed in 3 infraorders, 6 families each in the Astacidea and Glypheidea and 5 in the Polychelida. Infraorder Astacidea includes the Superfamily Nephropoidea, as well as the lesser known 'reef lobsters' of the Superfamily Enoplometopoidea, and the freshwater crayfish, Superfamily Astacoidea. In phylogenetic analyses, the freshwater crayfish form a sister group to the Nephropoidea. It is interpreted that freshwater crayfish evolved from nephropoid lobsters, but from which lobster group is uncertain. The taxonomic placement of N. norvegicus is stable at all levels, from species on up. Despite that, the phylogenetic relationships of Nephrops to other nephropid genera are unsettled due to conflicting results in morphological and molecular analyses. Currently, new morphological characters and new genes are being analysed in the hope of elucidating nephropid phylogeny. Copyright © 2013 Elsevier Ltd. All rights reserved.

Identification of a crustacean β-1,3-glucanase related protein as a pattern recognition protein in antibacterial response.

PubMed

Chai, Lian-Qin; Meng, Jing-Hui; Gao, Jie; Xu, Yi-Hui; Wang, Xian-Wei

2018-06-02

Prophenoloxidase (proPO) activating system is an important immune response for arthropods. β-1, 3-glucanase related protein (previously named as lipopolysaccharide and β-1, 3-glucan binding protein (LGBP) in crustaceans) is a typical pattern recognition receptor family involved in the proPO activation by recognizing the invading microbes. In this study, we pay special attention to a bacteria-induced β-1,3-glucanase related protein from red swamp crayfish Procambarus clarkii, an important aquaculture specie in China. This protein, designated PcBGRP, was found a typical member of crustacean BGRP family with the glucanase-related domain and the characteristic motifs. PcBGRP was expressed in hemcoyes and hepatopancreas, and its expression could be induced by the carbohydrate and bacteria stimulants. The induction by lipopolysaccharide (LPS) and β-1,3-glucan (βG) was more significant than by peptidoglycan (PG). The response of PcBGRP to the native Gram-negative bacterial pathogen Aeromonas hydrophila was more obvious than to Gram-positive bacteria. Using RNA interference and recombinant protein, PcBGRP was found to protect crayfish from A. hydrophila infection revealed by the survival test and morphological analysis. A mechanism study found PcBGRP could bind LPS and βG in a dose-dependent manner, and the LPS recognizing ability determined the Gram-negative bacterium binding activity of PcBGRP. PcBGRP was found to enhance the PO activation both in vitro and in vivo, and the protective role was related to the PO activating ability of PcBGRP. This study emphasized the role of BGRP family in crustacean immune response, and provided new insight to the immunity of red swamp crayfish which suffered serious disease during the aquaculture in China. Copyright © 2018 Elsevier Ltd. All rights reserved.

Maintenance of long-term adaptation of synaptic transmission requires axonal transport following induction in an identified crayfish motoneuron.

PubMed

Nguyen, P V; Atwood, H L

1992-03-01

Motoneurons can adapt to altered levels of electrical activity by effecting semi-permanent changes in their neuromuscular synaptic physiology. In the present study, we tested the hypothesis that maintenance of activity-dependent long-term adaptation of synaptic transmission in a crayfish abdominal extensor motoneuron (phasic axon 3) required axonal transport following induction. Intact crayfish were chronically wired for periodic in vivo stimulation of axon 3. Periodic unilateral stimulation for 3-5 consecutive days (2 h/day) induced long-term adaptation (LTA) of neuromuscular synaptic transmission in axon 3. Initial EPSP amplitudes (measured at 0.1 Hz) were significantly reduced to approximately 40% of contralateral control amplitudes over a 7-day poststimulation period. Additionally, synaptic depression during 5 Hz test stimulation of axon 3 was significantly less in chronically stimulated neurons: excitatory postsynaptic potential (EPSP) amplitudes measured after 20 min of 5 Hz test stimulation (final EPSPs) were significantly larger in conditioned neurons than in unstimulated controls. The depression of initial EPSP amplitudes persisted for 7 days postinduction, while the increased synaptic stamina persisted for 4 days but was absent at 7 days postinduction. Axotomy of axon 3 following induction of LTA had no effect on long-term maintenance of the activity-induced reduction in initial EPSP amplitudes. Initial EPSP amplitudes in conditioned, axotomized neurons were still reduced to 42% of control amplitudes over the 7-day postinduction period. In contrast, postinduction axotomy of axon 3 elicited an accelerated decay of the enhanced synaptic stamina. Following axotomy, final EPSP amplitudes were significantly larger in conditioned neurons for only 1 day poststimulation.(ABSTRACT TRUNCATED AT 250 WORDS)

Mechanism to preserve phrenic nerve function during photosensitization reaction: drug uptake and photosensitization reaction effect on electric propagation

NASA Astrophysics Data System (ADS)

Takahashi, Haruka; Hamada, Risa; Ogawa, Emiyu; Arai, Tsunenori

2018-02-01

To study a mechanism of phrenic nerve preservation phenomena during a photosensitization reaction, we investigated an uptake of talaporfin sodium and photosensitization reaction effect on an electric propagation. Right phrenic nerve was completely preserved after superior vena cava isolations using the photosensitization reaction in canine animal experiments, in spite of adjacent myocardium was electrically blocked. We predicted that low drug uptake and/or low photosensitization reaction effect on the nerve might be a mechanism of that phenomena. To investigate uptake to various nerve tissue, a healthy extracted crayfish ventral nerve cord and an extracted porcine phrenic nerve were immersed in 20 μg/ml talaporfin sodium solution for 0-240 min. The mean talaporfin sodium fluorescence brightness increased depending on the immersion time. This brightness saturated around the immersion time of 120 min. We found that talaporfin sodium uptake inside the perineurium which directly related to the electric propagation function was lower than that of outside in the porcine phrenic nerve. To investigate photosensitization reaction effect on electric propagation, the crayfish nerve was immersed into the same solution for 15 min and irradiated by a 663 nm laser light with 120 mW/cm2. Since we found the action potential disappeared when the irradiation time was 25-65 s, we consider that the crayfish nerve does not tolerant to the photosensitization reaction on electric propagation function at atmospheric pressure. From these results, we think that the low uptake of talaporfin sodium inside the perineurium and low oxygen partial pressure of nerve might be the possible mechanism to preserve phrenic nerve in vivo.

Response of phase I and II detoxification enzymes, glutathione, metallothionein and acetylcholine esterase to mercury and dimethoate in signal crayfish (Pacifastacus leniusculus).

PubMed

Gunderson, Mark P; Nguyen, Brandon T; Cervantes Reyes, Juan C; Holden, Laura L; French, John M T; Smith, Brandon D; Lineberger, Connor

2018-05-30

Metals and pesticides are common pollutants and the modulation of biomarkers can indicate sub-lethal influences on the physiology of organisms inhabiting impacted aquatic systems. We examined the effects of mercury and the organophosphate pesticide dimethoate on EROD, MROD, glutathione S-transferase (GST), acetylcholine esterase (AChE), metallothionein (MT) and glutathione (GSH) in the signal crayfish (Pacifastacus leniusculus). Crayfish were injected with mercury chloride or dimethoate (0.3, 0.6, 0.9 μg kg -1 ) and dissected after 72 h. EROD activity in the hepatopancreas did not change in response to mercury chloride treatment but exhibited a dose dependent decrease at all concentrations of dimethoate tested. MROD (hepatopancreas) exhibited a significant decrease at the 0.9 μg kg -1 treatment for both chemicals. GST (hepatopancreas) demonstrated a significant dose dependent decrease at all concentrations of both mercury chloride and dimethoate. AChE (tail muscle) decreased at the 0.6 and 0.9 μg kg -1 concentrations of dimethoate and 0.9 μg kg -1 mercury chloride. In gill tissue, MT increased in response to 0.3 and 0.6 μg kg -1 of mercury chloride but no effect was observed at the 0.9 μg kg -1 concentration of mercury chloride or any concentrations of dimethoate tested. MT did not change in response to mercury or dimethoate in tail tissue. Furthermore, neither chemical modulated GSH concentrations. Our results indicate that, apart from GSH, these markers are sensitive to the pollutants tested and that animals exposed in the wild are potentially compromised in their ability to detoxify environmental contaminants and carry out normal cellular processes. Copyright © 2018 Elsevier Ltd. All rights reserved.

In situ molecular NMR picture of bioavailable calcium stabilized as amorphous CaCO3 biomineral in crayfish gastroliths

PubMed Central

Akiva-Tal, Anat; Kababya, Shifi; Balazs, Yael S.; Glazer, Lilah; Berman, Amir; Sagi, Amir; Schmidt, Asher

2011-01-01

Bioavailable calcium is maintained by some crustaceans, in particular freshwater crayfish, by stabilizing amorphous calcium carbonate (ACC) within reservoir organs—gastroliths, readily providing the Ca2+ needed to build a new exoskeleton. Despite the key scientific and biomedical importance of the in situ molecular-level picture of biogenic ACC and its stabilization in a bioavailable form, its description has eluded efforts to date. Herein, using multinuclear NMR, we accomplish in situ molecular-level characterization of ACC within intact gastroliths of the crayfish Cherax quadricarinatus. In addition to the known CaCO3, chitin scaffold and inorganic phosphate (Pi), we identify within the gastrolith two primary metabolites, citrate and phosphoenolpyruvate (PEP) and quantify their abundance by applying solution NMR techniques to the gastrolith “soluble matrix.” The long-standing question on the physico-chemical state of ACC stabilizing, P-bearing moieties within the gastrolith is answered directly by the application of solid state rotational-echo double-resonance (REDOR) and transferred-echo double-resonance (TEDOR) NMR to the intact gastroliths: Pi and PEP are found molecularly dispersed throughout the ACC as a solid solution. Citrate carboxylates are found < 5 Å from a phosphate (intermolecular C⋯P distance), an interaction that must be mediated by Ca2+. The high abundance and extensive interactions of these molecules with the ACC matrix identify them as the central constituents stabilizing the bioavailable form of calcium. This study further emphasizes that it is imperative to characterize the intact biogenic CaCO3. Solid state NMR spectroscopy is shown to be a robust and accessible means of determining composition, internal structure, and molecular functionality in situ. PMID:21873244

Mississippi River Navigation System. Environmental Evaluations of Proposed Mooring Facilities.

DTIC Science & Technology

1982-03-01

crayfish, oligochetes, nematodes , snails, clams, mussels and tubifex worms. Fish commonly found in the Kentucky River and tributaries are carp, drum...Arkansas portion of the basin. Cotton, soybeans, and rice predominate, with peaches, grapes , cattle, pasture and poultry as major farm products above

Mitochondrial genomes and comparative genomics of Aphanomyces astaci and Aphanomyces invadans

USDA-ARS?s Scientific Manuscript database

The genus Aphanomyces (Saprolegniales, Oomycetes) includes species with variety of ecologies from saprotrophs to plant and animal parasites. Two important species in this genus are Aphanomyces astaci that causes the crayfish plague and its close relative, Aphanomyces invadans, which causes the epizo...

Food habits of the raccoon in eastern Texas

USGS Publications Warehouse

Baker, R.H.; Newman, C.C.; Wilke, F.

1945-01-01

The food habits of raccoons were studied along the Neches River in three counties of eastern Texas in 1940-42. Field studies mere supplemented by laboratory analyses of 344 scats collected in all months and of 23 stomachs and 11 intestines obtained in winter. Acorns and crayfish constitute more than half of the yearly diet and both are consumed in considerable amount at all seasons. Persimmons and grapes were utilized heavily when available and other fruits in smaller amounts. Insects and other invertebrates formed an important part of the diet. Vertebrates were eaten sparingly but species of water snakes were preyed upon as were winter and spring concentrations of water fowl.....Raccoons were found to concentrate in timbered river bottoms during the winter and spring, feeding largely on acorns and crayfish. Under these conditions they are readily trapped. In the summer and autumn the populations appear to be dispersed through the uplands as well as bottomlands in search of seasonal foods.

Wildlife hazards from Furadan 3G applications to rice in Texas

USGS Publications Warehouse

Flickinger, Edward L.; King, K.A.; Stout, W.F.; Mohn, M.M.

1980-01-01

Mortality of birds, fish, frogs, crayfish, earthworms, and nontarget insects occurred in rice fields after treatments of Furadan 3G granules in 3 Texas counties in 1970 and 1973-75. Three western sandpipers (Ereunetes mauri), 1 pectoral sandpiper (Erolia melanotos), and 2 red-winged blackbirds (Agelaius phoeniceus) were found dead or moribund between 17 and 24 hours after treatment. Cricket frogs (Acris crepitans blanchardi) were intoxicated 15 minutes post-treatment, and mosquito fish (Gambusia affinis) showed effects 1 hour post-treatment. Mortality of mosquito fish, Gulf menhaden (Brevoortia patronus), Atlantic croaker (Micropogon undulatus), and European carp (Cyprinus carpio) usually occurred between 24 and 28 hours after treatment. Mortality of frogs, crayfish, and nontarget insects generally occurred in rice field water between 1 and 45 hours after treatment. Mortality of earthworms in soil persisted for 52 hours. As a replacement for aldrin in Texas rice fields, Furadan 3G appeared to cause Iess mortality of birds than aldrin, but Furadan 3G was toxic to birds, fish, and invertebrates.

Extracellular Recording of Light Responses from Optic Nerve Fibers and the Caudal Photoreceptor in the Crayfish

PubMed Central

Nesbit, Steven C.; Van Hoof, Alexander G.; Le, Chi C.; Dearworth, James R.

2015-01-01

Few laboratory exercises have been developed using the crayfish as a model for teaching how neural processing is done by sensory organs that detect light stimuli. This article describes the dissection procedures and methods for conducting extracellular recording from light responses of both the optic nerve fibers found in the animal’s eyestalk and from the caudal photoreceptor located in the ventral nerve cord. Instruction for ADInstruments’ data acquisition system is also featured for the data collection and analysis of responses. The comparison provides students a unique view on how spike activities measured from neurons code image-forming and non-image-forming processes. Results from the exercise show longer latency and lower frequency of firing by the caudal photoreceptor compared to optic nerve fibers to demonstrate evidence of different functions. After students learn the dissection, recording procedure, and the functional anatomy, they can develop their own experiments to learn more about the photoreceptive mechanisms and the sensory integration of modalities by these light-responsive interneurons. PMID:26557793

A Novel Chitin Binding Crayfish Molar Tooth Protein with Elasticity Properties

PubMed Central

Tynyakov, Jenny; Bentov, Shmuel; Abehsera, Shai; Khalaila, Isam; Manor, Rivka; Katzir Abilevich, Lihie; Weil, Simy; Aflalo, Eliahu D.; Sagi, Amir

2015-01-01

The molar tooth of the crayfish Cherax quadricarinatus is part of the mandible, and is covered by a layer of apatite (calcium phosphate). This tooth sheds and is regenerated during each molting cycle together with the rest of the exoskeleton. We discovered that molar calcification occurs at the pre-molt stage, unlike calcification of the rest of the new exoskeleton. We further identified a novel molar protein from C. quadricarinatus and cloned its transcript from the molar-forming epithelium. We termed this protein Cq-M13. The temporal level of transcription of Cq-M13 in an NGS library of molar-forming epithelium at different molt stages coincides with the assembly and mineralization pattern of the molar tooth. The predicted protein was found to be related to the pro-resilin family of cuticular proteins. Functionally, in vivo silencing of the transcript caused molt cycle delay and a recombinant version of the protein was found to bind chitin and exhibited elastic properties. PMID:26010981

Different spatial distributions of sodium channels in the slowly and rapidly adapting stretch receptor neuron of the crayfish.

PubMed

Lin, J H; Rydqvist, B

1999-06-05

Inward Na+ currents were studied, using a two-microelectrode intracellular voltage-clamp technique, in the slowly adapting (SA) and rapidly adapting (RA) stretch receptor neurons of the crayfish after the axons were cut at different distances from the soma. In the SA neuron, inward Na+ currents were recorded in the soma even when the axon was cut as close as 100 microm from the center of the soma, indicating the presence of Na+ channels in these parts. Also, two populations of Na+ channels seem to exist in the SA neuron. In the RA neuron, only minute Na+ currents were observed if the axon was shorter than 250 microm. The results strongly indicate that the voltage-gated Na+ channels in the SA and RA neurons have different distributions and that the difference in the spatial distribution of Na+ channel types may be important for the difference in firing properties in the two types of neurons. Copyright 1999 Elsevier Science B.V.

Inhibition of mechanotransducer currents in crayfish sensory neuron by CGS 9343B, a calmodulin antagonist.

PubMed

Lin, J H; Rydqvist, B

2000-05-26

The effects of CGS 9343B (zaldaride maleate), a calmodulin antagonist, on mechanosensitive channels were examined in crayfish slowly adapting sensory neurons using the two-electrode voltage clamp technique. In addition to its inhibition of voltage-gated Na(+) and K(+) currents, CGS 9343B (<30 microM) blocked reversibly the receptor current in a dose-dependent and voltage-dependent manner with a dissociation constant (K(d)) of 26.8 microM. The time course of the block was 265 s. Within the extension range of 3-30%, the reduction in receptor current was stimulus-independent and the gating mechanisms were not affected. Extracellular Ca(2+) was not necessary for its blocking effects. No changes in passive muscle tension were observed in the presence of 20 microM CGS 9343B. These results suggest that CGS 9343B, as a calmodulin antagonist, can also block mechanosensitive channels, possibly by being incorporated into the lipid membrane and/or interacting with the channel protein.

Outdoor Biology Instructional Strategies Trial Edition. Set II.

ERIC Educational Resources Information Center

Fairwell, Kay, Ed.; And Others

The 24 activities in the Outdoor Biology Instructional Strategies (OBIS) Trial Edition Set II use living organisms such as crabs, birds, crayfish, lichens, and insects to investigate biological interrelationships, organism behavior, and species density to promote greater environmental and sensory awareness. The activities, designed primarily for…

Food preferences of captive wild raccoons, Procyon lotor, from east Texas

Treesearch

James F. Taulman; James H. Williamson

1994-01-01

We offered a random assortment of six foods to nine captive raccoons (Procyon lotor) during 10 days in February 1991 and to 10 raccoons during 9 days in January 1992; persimmon (Diospyros virginianus); southern red oak acorn (Quercus falacata); chicken egg; crayfish (Cambarus bartoni);...

Environmental Quality of Upper Honey Creek: A Preliminary Assessment.

DTIC Science & Technology

1981-01-01

chironomid pupae and " Plecoptera ", which consisted of stoneflies that were too damaged for further identification. Adult and larval beetles were...11 bbei amie1 13 15 32 153 22 leopoda (mow bugs) Aselluet (forbeal) 12 3 oapoda (crayfish) ftocabue acutus acutug Plecoptera (stoneflies) 3 1 1

Two new freshwater eutardigrade species from Sicily.

PubMed

Pilato, Giovanni; Sabella, Giorgio; Lisi, Oscar

2015-02-11

Two new species of freshwater Eutardigrada are described from Sicily: Isohypsibius rusticus sp. nov. and Isohypsibius zappalai sp. nov. The former species has eye spots, ornamented body surface with many, variously sized tubercles; bucco-pharyngeal apparatus of the Isohypsibius type; pharyngeal bulb with apophyses and two rod-shaped macroplacoids; microplacoid absent; claws, of the Isohypsibius type, well developed, with long and thin common basal portion; main branches of all claws without free accessory points; very thin lunules present; cuticular bars on the legs absent. Isohypsibius zappalai sp. nov. has eye spots; entire body surface with small tubercles rounded in shape, fairly uniformly sized and tending to form transverse lines; bucco-pharyngeal apparatus of the Isohypsibius type, pharyngeal bulb with apophyses and two macroplacoids; microplacoid absent; claws of the Isohypsibius type, well developed, with long common basal portion and both main and secondary branches with a wide proximal portion. Main branches of all claws with accessory points; small, flexible lunules present; cuticular bars on the legs absent.

76 FR 59835 - Endangered and Threatened Wildlife and Plants; Partial 90-Day Finding on a Petition To List 404...

Federal Register 2010, 2011, 2012, 2013, 2014

2011-09-27

... the Florida cave crayfish twice in its list of 404 species, once at the species level, Procambarus... population levels, and current and projected trends; and (e) Past and ongoing conservation measures for the... Florida rainbow snake (Farancia erytrogramma seminola), Sarah's hydroptila caddisfly (Hydroptila sarahae...

Determination of chromium in treated crayfish, Procambarus clarkii, by electrothermal ASS: study of chromium accumulation in different tissues

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hernandez, F.; Diaz, J.; Medina, J.

1986-06-01

In the present study, the authors investigated the accumulation of chromium in muscle, hepatopancreas, antennal glands, and gills of Procambarus clarkii (Girard) from Lake Albufera following Cr(VI)-exposure. Determinations of chromium were made by using Electrothermal Atomic Absorption Spectroscopy and the standard additions method.

Recolonization by warmwater fishes and crayfishes after severe drought in upper coastal plain hill streams

Treesearch

Susan B. Adams; Melvin L. Warren

2005-01-01

Extreme hydrologic disturbance, such as a supraseasonal drought, can dramatically influence aquatic communities. Documentation of the responses of aquatic communities after such disturbances provides insight into the timing, order, and mechanisms of recolonization. Postdisturbance recolonization of streams depends on many factors, including the region and...

Swainson's hawk predation on dragonflies in Argentina

Treesearch

D. Craig Rudolph; Charles D. Fisher

1993-01-01

Swainson’s Hawks (Buteo swainsoni) have a diverse diet consisting of mammals, birds, reptiles, amphibians, and a wide array of invertebrates (Bent 1937, Dunkle 1977, Schmutz et al. 1980, Bednatz 1988, Steenhof and Kochert 1985). A number of observations document extensive feeding on invertebrates, including crayfish (White 1966), crickets (White 1966...

Biology. USMES Beginning "How To" Set.

ERIC Educational Resources Information Center

Agro, Sally; And Others

In this set of two booklets for primary grades, students learn how to make a home for their animals (amphibians, insects, fish, crayfish) and a home for their rodents (hamsters, guinea pigs, gerbils, mice). The major emphasis in all Unified Sciences and Mathematics for Elementary Schools (USMES) units is on open-ended, long-range investigations of…

Regina rigida (glossy crayfish snake)

Treesearch

David A. Steen; James A. Stiles; Sierra H. Stiles; Craig Guyer; Josh B. Pierce; D. Craig Rudolph; Lora L. Smith

2011-01-01

The overland movements and upland habitat use of wetland-associated reptiles has important conservation implications (Semlitsch and Bodie 2003. Conserv. BioI. 17:1219-1228). However, for many species, particularly snakes, we lack a basic understanding of spatial ecology and habitat use. Regina rigida is a poorly known species for which "observations of any kind...

Female freshwater crayfish adjust egg and clutch size in relation to multiple male traits

PubMed Central

Galeotti, Paolo; Rubolini, Diego; Fea, Gianluca; Ghia, Daniela; Nardi, Pietro A; Gherardi, Francesca; Fasola, Mauro

2006-01-01

Females may invest more in reproduction if they acquire mates of high phenotypic quality, because offspring sired by preferred partners may be fitter than offspring sired by non-preferred ones. In this study, we tested the differential maternal allocation hypothesis in the freshwater crayfish, Austropotamobius italicus, by means of a pairing experiment aimed at evaluating the effects of specific male traits (body size, chelae size and chelae asymmetry) on female primary reproductive effort. Our results showed that females laid larger but fewer eggs for relatively small-sized, large-clawed males, and smaller but more numerous eggs for relatively large-sized, small-clawed males. Chelae asymmetry had no effects on female reproductive investment. While the ultimate consequences of this pattern of female allocation remain unclear, females were nevertheless able to adjust their primary reproductive effort in relation to mate characteristics in a species where inter-male competition and sexual coercion may mask or obscure their sexual preferences. In addition, our results suggest that female allocation may differentially affect male characters, thus promoting a trade-off between the expression of different male traits. PMID:16600888

Demonstration of nitric oxide synthase activity in crustacean hemocytes and anti-microbial activity of hemocyte-derived nitric oxide.

PubMed

Yeh, Feng-Ching; Wu, Su-Hua; Lai, Chi-Yung; Lee, Chi-Ying

2006-05-01

We determined the biochemical characteristics of nitric oxide synthase (NOS) in hemocytes of the crayfish Procambarus clarkii and investigated the roles of hemocyte-derived NO in host defense. Biochemical analysis indicated the presence of a Ca2+ -independent NOS activity, which was elevated by lipopolysaccharide (LPS) treatment. When bacteria (Staphylococcus aureus) and hemocytes were co-incubated, adhesion of bacteria to hemocytes was observed. NO donor sodium nitroprusside (SNP) significantly increased the numbers of hemocytes to which bacteria adhered. Similarly, LPS elicited bacterial adhesion and the LPS-induced adhesion was prevented by NOS inhibitor NG-monomethyl-L-arginine (L-NMMA). Finally, plate count assay demonstrated that addition of LPS to the hemocytes/bacteria co-incubation resulted in a significant decrease in bacterial colony forming unit (CFU), and that L-NMMA reversed the decreasing effect of LPS on CFU. The combined results demonstrate the presence of a Ca2+ -independent LPS-inducible NOS activity in crayfish hemocytes and suggest that hemocyte-derived NO is involved in promoting bacterial adhesion to hemocytes and enhancing bactericidal activity of hemocytes.

A flow cytometric approach to the study of crustacean cellular immunity

USGS Publications Warehouse

Cardenas, W.; Jenkins, J.A.; Dankert, J.R.

2000-01-01

Responses of hemocytes from the crayfish Procambarus zonangulus to stimulation by fungal cell walls (Zymosan A) were measured by flow cytometry. Changes in hemocyte physical characteristics were assessed flow cytometrically using forward- and sidescatter light parameters, and viability was measured by two-color fluorescent staining with calcein-AM and ethidium homodimer 1. The main effects of zymosan A on crayfish hemocytes were reduction in cell size and viability compared to control mixtures (hemocytes in buffer only). Adding diethyldithiocarbamic acid, an inhibitor of phenoloxidase, to hemocyte to zymosan mixtures delayed the time course of cell size reduction and cell death compared to zymosan-positive controls. The inclusion of trypsin inhibitor in reaction mixtures further delayed the reduction in hemocyte size and cell death, thereby indicating that a proteolytic cascade, along with prophenoloxidase activation, played a key role in generating signal molecules which mediate these cellular responses. In addition to traditional methods such as microscopy and protein chemistry, flow cytometry can provide a simple, reproducible, and sensitve method for evaluating invertebrate hemocyte responses to immunological stimuli.

Shared phylogeographic patterns between the ectocommensal flatworm Temnosewellia albata and its host, the endangered freshwater crayfish Euastacus robertsi

PubMed Central

Schmidt, Daniel J.; Ponniah, Mark; Carini, Giovannella; Blair, David; Hughes, Jane M.

2014-01-01

Comparative phylogeography of commensal species may show congruent patterns where the species involved share a common history. Temnosewellia is a genus of flatworms, members of which live in commensal relationships with host freshwater crustaceans. By constructing phylogenetic trees based on mitochondrial COI and 28S nuclear ribosomal gene sequences, this study investigated how evolutionary history has shaped patterns of intraspecific molecular variation in two such freshwater commensals. This study concentrates on the flatworm Temnosewellia albata and its critically endangered crayfish host Euastacus robertsi, which have a narrow climatically-restricted distribution on three mountaintops. The genetic data expands upon previous studies of Euastacus that suggested several vicariance events have led to the population subdivision of Euastacus robertsi. Further, our study compared historical phylogeographic patterning of these species. Our results showed that phylogeographic patterns shared among these commensals were largely congruent, featuring a shared history of limited dispersal between the mountaintops. Several hypotheses were proposed to explain the phylogeographic points of differences between the species. This study contributes significantly to understanding evolutionary relationships of commensal freshwater taxa. PMID:25279257

A pilot study testing a natural and a synthetic Molluscicide for controlling invasive apple snails (Pomacea maculata)

USGS Publications Warehouse

Olivier, Heather M.; Jenkins, Jill A.; Berhow, Mark; Carter, Jacoby

2016-01-01

Pomacea maculata (formerly P. insularum), an apple snail native to South America, was discovered in Louisiana in 2008. These snails strip vegetation, reproduce at tremendous rates, and have reduced rice production and caused ecosystem changes in Asia. In this pilot study snails were exposed to two molluscicides, a tea (Camellia sinensis) seed derivative (TSD) or niclosamide monohydrate (Pestanal®, 2′,5-dichloro-4′-nitrosalicylanilide, CAS #73360-56-2). Mortality was recorded after exposure to high or low concentrations (0.03 and 0.015 g/L for TSD, 1.3 and 0.13 mg/L for niclosamide). The TSD induced 100 % mortality at both concentrations. Niclosamide caused 100 % and 17 % mortality at high and low concentrations respectively. These molluscicides were also tested on potential biocontrol agents, the red swamp crayfish (Procambarus clarkii) and redear sunfish (Lepomis microlophus). No crayfish mortalities occurred at either concentration for either chemical, but sunfish experienced 100 % mortality with TSD (0.03 g/L), and 21 % mortality with niclosamide (0.13 mg/L).

Application of D-Crustacean Hyperglycemic Hormone Induces Peptidases Transcription and Suppresses Glycolysis-Related Transcripts in the Hepatopancreas of the Crayfish Pontastacus leptodactylus — Results of a Transcriptomic Study

PubMed Central

De Moro, Gianluca; Gerdol, Marco; Guarnaccia, Corrado; Mosco, Alessandro; Pallavicini, Alberto; Giulianini, Piero Giulio

2013-01-01

The crustacean Hyperglycemic Hormone (cHH) is a neuropeptide present in many decapods. Two different chiral isomers are simultaneously present in Astacid crayfish and their specific biological functions are still poorly understood. The present study is aimed at better understanding the potentially different effect of each of the isomers on the hepatopancreatic gene expression profile in the crayfish Pontastacus leptodactylus, in the context of short term hyperglycemia. Hence, two different chemically synthesized cHH enantiomers, containing either L- or D-Phe3, were injected to the circulation of intermolt females following removal of their X organ-Sinus gland complex. The effects triggered by the injection of the two alternate isomers were detected after one hour through measurement of circulating glucose levels. Triggered changes of the transcriptome expression profile in the hepatopancreas were analyzed by RNA-seq. A whole transcriptome shotgun sequence assembly provided the assumedly complete transcriptome of P. leptodactylus hepatopancreas, followed by RNA-seq analysis of changes in the expression level of many genes caused by the application of each of the hormone isomers. Circulating glucose levels were much higher in response to the D-isoform than to the L-isoform injection, one hour from injection. Similarly, the RNA-seq analysis confirmed a stronger effect on gene expression following the administration of D-cHH, while just limited alterations were caused by the L-isomer. These findings demonstrated a more prominent short term effect of the D-cHH on the transcription profile and shed light on the effect of the D-isomer on specific functional gene groups. Another contribution of the study is the construction of a de novo assembly of the hepatopancreas transcriptome, consisting of 39,935 contigs, that dramatically increases the molecular information available for this species and for crustaceans in general, providing an efficient tool for studying gene expression patterns in this organ. PMID:23840318

Eradication of invasive Tamarix ramosissima along a desert stream increases native fish density

USGS Publications Warehouse

Kennedy, T.A.; Finlay, J.C.; Hobbie, S.E.

2005-01-01

Spring ecosystems of the western United States have high conservation value, particularly because of the highly endemic, and often endangered, fauna that they support. Refuges now protect these habitats from many of the human impacts that once threatened them, but invasive species often persist. Invasive saltcedar is ubiquitous along streams, rivers, and spring ecosystems of the western United States, yet the impact of saltcedar invasion on these ecosystems, or ecosystem response to its removal, have rarely been quantified. Along Jackrabbit Spring, a springbrook in Nevada that supports populations of two endangered fish (Ash Meadows pupfish and Ash Meadows speckled dace) as well as several exotic aquatic consumers, we quantified the response of aquatic consumers to largescale saltcedar removal and identified the mechanism underlying consumer response to the removal. Clearing saltcedar from the riparian zone increased densities of native pupfish and exotic screw snails, but decreased the density of exotic crayfish. Positive effects of saltcedar removal on pupfish and snails occurred because saltcedar heavily shades the stream, greatly reducing the availability of algae for herbivores. This was confirmed by analyses of potential organic matter sources and consumer 13C: pupfish and snails, along with native dace and exotic mosquitofish, relied heavily on algae-derived carbon and not saltcedar-derived carbon. By contrast, crayfish ??13C values mirrored algae ??13C during summer, but in winter indicated reliance on allochthonous saltcedar litter that dominated organic inputs in saltcedar reaches and on algae-derived carbon where saltcedar was absent. The seasonal use of saltcedar by crayfish likely explains its negative response to saltcedar removal. Clearing saltcedar effectively restored the springbrook of Jackrabbit Spring to the conditions characteristic of native vegetation sites. Given the high conservation value of spring ecosystems and the potential conservation benefits of saltcedar removal that this research highlights, eradicating saltcedar from spring ecosystems of the western United States should clearly be a management priority. ?? 2005 by the Ecological Society of America.

Herbivore Preference for Native vs. Exotic Plants: Generalist Herbivores from Multiple Continents Prefer Exotic Plants That Are Evolutionarily Naïve

PubMed Central

Morrison, Wendy E.; Hay, Mark E.

2011-01-01

Enemy release and biotic resistance are competing, but not mutually exclusive, hypotheses addressing the success or failure of non-native plants entering a new region. Enemy release predicts that exotic plants become invasive by escaping their co-adapted herbivores and by being unrecognized or unpalatable to native herbivores that have not been selected to consume them. In contrast, biotic resistance predicts that native generalist herbivores will suppress exotic plants that will not have been selected to deter these herbivores. We tested these hypotheses using five generalist herbivores from North or South America and nine confamilial pairs of native and exotic aquatic plants. Four of five herbivores showed 2.4–17.3 fold preferences for exotic over native plants. Three species of South American apple snails (Pomacea sp.) preferred North American over South American macrophytes, while a North American crayfish Procambarus spiculifer preferred South American, Asian, and Australian macrophytes over North American relatives. Apple snails have their center of diversity in South America, but a single species (Pomacea paludosa) occurs in North America. This species, with a South American lineage but a North American distribution, did not differentiate between South American and North American plants. Its preferences correlated with preferences of its South American relatives rather than with preferences of the North American crayfish, consistent with evolutionary inertia due to its South American lineage. Tests of plant traits indicated that the crayfish responded primarily to plant structure, the apple snails primarily to plant chemistry, and that plant protein concentration played no detectable role. Generalist herbivores preferred non-native plants, suggesting that intact guilds of native, generalist herbivores may provide biotic resistance to plant invasions. Past invasions may have been facilitated by removal of native herbivores, introduction of non-native herbivores (which commonly prefer native plants), or both. PMID:21394202

Social control of unreliable signals of strength in male but not female crayfish, Cherax destructor.

PubMed

Walter, Gregory M; van Uitregt, Vincent O; Wilson, Robbie S

2011-10-01

The maintenance of unreliable signals within animal populations remains a highly controversial subject in studies of animal communication. Crustaceans are an ideal group for studying unreliable signals of strength because their chela muscles are cryptically concealed beneath an exoskeleton, making it difficult for competitors to visually assess an opponent's strength. In this study, we examined the importance of social avenues for mediating the possible advantages gained by unreliable signals of strength in crustaceans. To do this, we investigated the factors that determine social dominance and the relative importance of signalling and fighting during aggressive encounters in male and female freshwater crayfish, Cherax destructor. Like other species of crayfish, we expected substantial variation in weapon force for a given weapon size, making the assessment of actual fighting ability of an opponent difficult from signalling alone. In addition, we expected fighting would be used to ensure that individuals that are weak for their signal (i.e. chela) size would not achieve higher than expected dominance. For both male and female C. destructor, we found large variation in the actual force of their chela for any given weapon size, indicating that it is difficult for competitors to accurately assess an opponent's force on signal size alone. For males, these unreliable signals of strength were controlled socially through increased levels of fighting and a decreased reliance on signalling, thus directly limiting the benefits accrued to individuals employing high-quality signals (large chelae) with only low resource holding potential. However, in contrast to our predictions, we found that females primarily relied on signalling to settle disputes, resulting in unreliable signals of strength being routinely used to establish dominance. The reliance by females on unreliable signals to determine dominance highlights our poor current understanding of the prevalence and distribution of dishonesty in animal communication.

Burrowing activity in channel levees: impact of the invasive red swamp crayfish Procambarus clarkii

NASA Astrophysics Data System (ADS)

Solari, L.; Bendoni, M.; Consumi, L.; Haubrock, P.; Inghilesi, A.; Mazza, G.; Torrini, M.; Tricarico, E.

2016-12-01

The effect of animal burrowing, as an example of bioturbation on the stability of river levees has been recently raised to the scientific community as a consequence of the levee collapses of Secchia and Foenna rivers in Italy (Camici et al., 2010, 2014; Orlandini et al., 2015). Indeed, these authors showed that the presence of animal burrows is crucial in promoting the collapse of the bank. The American red swamp Crayfish Procambarus clarkii is an invasive species in Europe, mostly introduced for commercial purposes related to livestock. It is rapidly spreading throughout the Italian peninsula due to its plasticity, dispersal capability and high reproduction rate (Souty-Grosset et al., 2016). As well as the negative effects on local biodiversity, it damages the levees of the irrigation channel leading to disastrous collapses, relevant repairing and maintenance costs. In this work, we present an experimental activity where specimens of P. clarkii were monitored while burrowing into a small-scale physical model of an earthen levee, coupled with the mathematical modelling of the variations induced by the burrows on the seepage flow patterns through the levee.Preliminary results show the burrowing structure was quite irregular. Generally, crayfish start burrowing under the water level, developing tunnels (diameter ranging 4-7cm) both horizontally and heading upward, also above the water level. Some tunnels showed one or more circular chambers. The highest burrowing activity was observed during the experiments carried out in summer, when the species has a peak of maximum activity due to the higher temperature. Mathematical modelling shows that, for given boundary conditions and experimental duration, the presence of burrows in the levee raises the phreatic line. Critical conditions for levee integrity may be associated either to the internal erosion and stability of the system of tunnels and to the emergence of the phreatic line of the landside of the levee slope. These aspects are currently under investigation.

Melanization and Pathogenicity in the Insect, Tenebrio molitor, and the Crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3

PubMed Central

Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M.; Söderhäll, Kenneth

2010-01-01

Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS), bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core) is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT) containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the proPO system and as virulence factors for this bacterium. PMID:21206752

Physical data and biological data for algae, aquatic invertebrates, and fish from selected reaches on the Carson and Truckee rivers, Nevada and California, 1993-97

USGS Publications Warehouse

Lawrence, S.J.; Seiler, R.L.

2002-01-01

This report, a product of the National Water- Quality Assessment Program, is a compilation of physical data and biological data for algae, aquatic invertebrates, and fish collected in the Carson and Truckee River Basins, Nevada and California. Most of the data were collected between 1993 and 1996 at selected reaches on the Carson and Truckee Rivers. Algae and aquatic invertebrate samples were collected from cobble riffles, submerged woody-snag habitats, and from depositional areas such as pools. Between 1993 and 1996, fish and crayfish were collected from all wadeable habitats at each of seven basic-fixed sites using either electroshocking methods or seining. Additional fish and crayfish were collected at one site on the Truckee River in 1997. Fish were identified to species, measured for total and standard length, checked for anomalies, and weighed at the collection site. Fish were returned to the stream after measurements were taken. Measurements of water depth, stream velocity, determinations of substrate type and substrate embeddedness were made at each sampling site. Algae and aquatic invertebrate samples were sent to the U.S. Geological Survey National Water-Quality Laboratory for identification and enumeration. A total of 103 semi-quantitative and 55 qualitative algae samples were collected at 20 river reaches on the Carson and Truckee Rivers between 1993 and 1996. These samples represent algae in cobble riffles, on submerged woody snags, and on sediment surfaces in depositional areas. In those 158 samples, 514 algal species, varieties, or forms were identified. Of the 8 algal phyla represented, the diatoms (Phylum Bacillariophyta) were the most abundant with 351 species, varieties, or forms. The green algae (Phylum Chlorophyta) were next in abundance with 108 species, varieties, or forms followed by the blue-green algae (Phylum Cyanophyta) with 41 species, varieties, or forms. A total of 49 semi-quantitative aquatic invertebrate samples were collected at 27 river reaches on the Carson and Truckee Rivers between 1993 and 1996. These samples represent invertebrates in cobble riffles and on submerged woody snags. In those 49 samples, members of 6 phyla were identified. Roundworms were identified only to phylum (Nematoda) and free-living flatworms and snails were identified only to class (Turbellaria and Gastroda). Organisms were identified as belonging to 19 invertebrate orders. Most of the invertebrates that could be identified to genus or species belonged in the orders Ephemeroptera, Plecoptera, and Trichoptera of the arthropod class Insecta. Fish and crayfish populations in the Carson and Truckee Rivers were sampled 29 times between 1993 and 1997. These collections resulted in the identification of 18 fish species and one endemic crayfish species. Twelve of the 18 fish species identified are not native to the Carson and Truckee River Basins.

Purification, Characterization and Analysis of the Allergenic Properties of Myosin Light Chain in Procambarus clarkia.

USDA-ARS?s Scientific Manuscript database

Myosin light chain (MLC) plays a vital role in cell and muscle functions and has been identified as an allergen in close species. In this study, MLC with the molecular mass of 18kDa was purified from crayfish (Procambarus clarkii) muscle fibrils. Its physicochemical characterization showed that the...

The influence of predator threat on the timing of a life-history switch point: predator-induced hatching in the southern leopard frog (Rana sphenocephala)

Treesearch

James B. Johnson; Daniel Saenz; Cory K. Adams; Richard N. Conner

2003-01-01

Abstract: We tested the hypotheses that potential egg predators, crayfish Procambarus nigrocinctus and dytiscid Cybister sp. larvae, would accelerate the timing of hatching and that a larval predator, dragonfly naiad Anax junius, would delay hatching in the southern leopard frog (Rana...

76 FR 79209 - Proposed Safe Harbor Agreement for the Shasta Crayfish in Cassel, Shasta County, CA

Federal Register 2010, 2011, 2012, 2013, 2014

2011-12-21

... occur in the future during routine maintenance of a water intake pipe on the south side of the pond.... Background Under a safe harbor agreement, participating landowners voluntarily undertake management... flow. The water from the spring is ponded by a levee that was originally built in the early 20th...

Triosephosphate isomerase and filamin C share common epitopes as novel allergens of Procambarus clarkii

USDA-ARS?s Scientific Manuscript database

Triosephosphate isomerase (TIM) is a key enzyme in glycolysis and has been identified as an allergen in saltwater products. In this study, TIM with a molecular mass of 28 kDa was purified from the freshwater crayfish (Procambarus clarkii) muscle. A 90-kDa protein that showed IgG/IgE cross-reactivity...

Multiple drivers of decline in the global status of freshwater crayfish (Decapoda:Astacidea)

Treesearch

Nadia I. Richman; Monika Böhm; Susan B. Adams; Fernando Alvarez; Elizabeth A. Bergey; John J. S. Bunn; Quinton Burnham; Jay Cordeiro; Jason Coughran; Keith A. Crandall; Kathryn L. Dawkins; Robert J. DiStefano; Niall E. Doran; Lennart Edsman; Arnold G. Eversole; Leopold Füreder; James M. Furse; Francesca Gherardi; Premek Hamr; David M. Holdich; Pierre Horwitz; Kerrylyn Johnston; Clive M. Jones; Julia P. G. Jones; Robert L. Jones; Thomas G. Jones; Tadashi Kawai; Susan Lawler; Marilu López-Mejía; Rebecca M. Miller; Carlos Pedraza-Lara; Julian D. Reynolds; Alastair M. M. Richardson; Mark B. Schultz; Guenter A. Schuster; Peter J. Sibley; Catherine Souty-Grosset; Christopher A. Taylor; Roger F. Thoma; Jerry Walls; Todd S. Walsh; Ben Cohen

2015-01-01

Rates of biodiversity loss are higher in freshwater ecosystems than in most terrestrial or marine ecosystems, making freshwater conservation a priority. However, prioritization methods are impeded by insufficient knowledge on the distribution and conservation status of freshwater taxa, particularly invertebrates. We evaluated the extinction risk of the world’s 590...

Investigating Issues in the Laboratory: The Behavior of Red Swamp Crayfish as an Invasive Species

ERIC Educational Resources Information Center

Hewitt, Krissi M.; Kayes, Lori J.; Hubert, David; Chouinard, Adam

2014-01-01

Recent reform initiatives in undergraduate biology call for curricula that prepare students for dealing with real-world issues and making important links between science and society. In response to this call, we have developed an issues-based laboratory module that uses guided inquiry to integrate the concepts of animal behavior and population…

Animals from the Outside In, Science (Experimental): 5314.01.

ERIC Educational Resources Information Center

Kleinman, David Z.

Presented is an outline of a basic course (low level) in biology for students whose interest and background are very limited. The study and dissection of earthworm, crayfish, perch, and bird are included. A detailed study of the frog is undertaken as a representative of the animal kingdom. Performance objectives are presented, as well as a course…

Crayfish use of trash versus natural cover in incised, sand-bed streams

Treesearch

Susan B. Adams

2014-01-01

Historic land use changes and subsequent river channelization created deeply incised, unstable stream channels largely devoid of natural cover throughout the Yazoo River basin, Mississippi, USA. Large trash (e.g., televisions, toilets, car parts) dumped in streams provided shelter for some aquatic fauna. To determine whether trash served as a surrogate for natural...

Children's Ideas about Animal Adaptations: An Action Research Project

ERIC Educational Resources Information Center

Endreny, Anna Henderson

2006-01-01

In this paper, I describe the action research I conducted in my third-grade science classrooms over the course of two years. In order to gain an understanding of my third-grade students' ideas about animal adaptations and how the teaching of a unit on crayfish influenced these ideas, I used clinical interviews, observations, and written…

Biomimetics and astronomical X-ray optics

NASA Astrophysics Data System (ADS)

Hudec, R.; Remisova, K.

2017-07-01

Some sea and water animals have strange mirror eyes which have (or might have) potential application in science and technology in general and in X—ray astrophysics in particular. While the principles of mirror eyes of decapods (lobsters, crayfishes) are already applied in space and ground—based imaging experiments, the mirror eyes of specific fishes are still very little investigated.

Use of historically fishless high-mountain lakes and streams by neartic River Otters (Lontra canadensis) in California

Treesearch

Justin M. Garwood; Roland A. Knapp; Karen L. Pope; Robert L. Grasso; Michael L. Magnuson; Jeff R. Maurer

2013-01-01

In California, River Otters (Lontra canadensis) are most commonly associated with food-rich lowland aquatic habitats where they forage primarily on fish and crustaceans. Their distribution in high-elevation montane regions of the state, areas in which fish and crayfish were absent historically, is largely unknown.We compiled occurrence records of...

Heading which way? Y-maze chemical assays: not all crustaceans are alike

NASA Astrophysics Data System (ADS)

Kenning, Matthes; Lehmann, Philipp; Lindström, Magnus; Harzsch, Steffen

2015-09-01

In a world full of chemicals, many crustaceans rely on elaborate olfactory systems to guide behaviors related to finding food or to assess the presence of conspecifics and predators. We analyzed the responses of the isopod Saduria entomon to a range of stimuli by which the animal is likely to encounter in its natural habitat using a Y-maze bioassay. In order to document the efficiency of the experimental design, the same bioassay was used to test the behavior of the crayfish Procambarus fallax whose ability to track odors is well documented. The crayfish performed well in the Y-maze and were able to locate the source of a food-related odor with high fidelity. The isopod S. entomon reacted indifferently or with aversion to most of the stimuli applied. In 1800 trials, only four out of 15 different stimuli yielded statistically significant results, and only one odorant was found to be significantly attractive. The findings raise several questions whether the stimuli presented and/or the experimental setup used represents an ecologically relevant situation for S. entomon. In each instance, our experiments illustrate that established methods cannot be readily transferred from one species to another.

Proteomic analysis by iTRAQ in red claw crayfish, Cherax quadricarinatus, hematopoietic tissue cells post white spot syndrome virus infection.

PubMed

Jeswin, Joseph; Xie, Xiao-lu; Ji, Qiao-lin; Wang, Ke-jian; Liu, Hai-peng

2016-03-01

To elucidate proteomic changes of Hpt cells from red claw crayfish, Cherax quadricarinatus, we have carried out isobaric tags for relative and absolute quantitation (iTRAQ) of cellular proteins at both early (1 hpi) and late stage (12 hpi) post white spot syndrome virus (WSSV) infection. Protein database search revealed 594 protein hits by Mascot, in which 17 and 30 proteins were present as differentially expressed proteins at early and late viral infection, respectively. Generally, these differentially expressed proteins include: 1) the metabolic process related proteins in glycolysis and glucogenesis, DNA replication, nucleotide/amino acid/fatty acid metabolism and protein biosynthesis; 2) the signal transduction related proteins like small GTPases, G-protein-alpha stimulatory subunit, proteins bearing PDZ- or 14-3-3-domains that help holding together and organize signaling complexes, casein kinase I and proteins of the MAP-kinase signal transduction pathway; 3) the immune defense related proteins such as α-2 macroglobulin, transglutaminase and trans-activation response RNA-binding protein 1. Taken together, these protein information shed new light on the host cellular response against WSSV infection in a crustacean cell culture. Copyright © 2016 Elsevier Ltd. All rights reserved.

White spot syndrome virus inactivation study by using gamma irradiation

NASA Astrophysics Data System (ADS)

Heidareh, Marzieh; Sedeh, Farahnaz Motamedi; Soltani, Mehdi; Rajabifar, Saeed; Afsharnasab, Mohammad; Dashtiannasab, Aghil

2014-09-01

The present study was conducted to investigate the effect of gamma irradiation on white spot syndrome virus (WSSV). White spot syndrome virus is a pathogen of major economic importance in cultured penaeid shrimp industries. White spot disease can cause mortalities reaching 100% within 3-10 days of gross signs appearing. During the period of culture, immunostimulant agents and vaccines may provide potential methods to protect shrimps from opportunistic and pathogenic microrganisms. In this study, firstly, WSSV was isolated from infected shrimp and then multiplied in crayfish. WSSV was purified from the infected crayfish haemolymph by sucrose gradient and confirmed by transmission electron microscopy. In vivo virus titration was performed in shrimp, Penaeus semisulcatus. The LD50 of live virus stock was calculated 10 5.4/mL. Shrimp post-larvae (1-2 g) were treated with gamma-irradiated (different doses) WSSV (100 to 10-4 dilutions) for a period of 10 days. The dose/survival curve for irradiated and un-irradiated WSSV was drawn; the optimum dose range for inactivation of WSSV and unaltered antigenicity was obtained 14-15 kGy. This preliminary information suggests that shrimp appear to benefit from treatment with gammairradiated WSSV especially at 14-15 KGy.

Plasticity as Phenotype: G x E Interaction in a Freshwater Snail

NASA Astrophysics Data System (ADS)

Brunkow, P. E.; Calloway, S. A.

2005-05-01

Plasticity in morphological development allows species to accommodate environmental variation experienced during growth; however, genetic variation for phenotypic plasticity per se has been relatively under-studied. We utilized the well-documented plastic response of shell development to predator cues in a freshwater snail to quantify genetic variation for plasticity in growth rate and shell shape. Field-caught pairs of snails reproduced in the laboratory to create families of full siblings, which were then divided and allowed to grow in control and predator cue treatments. Predator (crayfish) cues had significant effects on both size-corrected growth rate and shell shape; family identity also significantly affected both final shell shape and growth rate. The interaction between predator treatment and family identity significantly affected snail growth rate but not final shell shape, suggesting genetic variation in the plastic response to predator cues for a physiological variable (growth rate) but not for a variable known to mechanically reduce the risk of predation (shell shape), at least in this population of snails. The possibility that risk of multiple modes of predation (i.e., both fish and crayfish) in some populations might maintain genetic variation in morphological plasticity is discussed.

SPERMIOGENESIS IN THE CRAYFISH (PROCAMBARUS CLARKII)

PubMed Central

Moses, Montrose J.

1961-01-01

The sperm of the crayfish, Procambarus clarkii, is relatively simple among decapod sperm and was described in the first paper of this series (28). The present paper details the development of this sperm as followed with the light and electron microscopes. The process is divided into six stages for purposes of description. The main points of interest discussed are the absence of mitochondria or mitochondrial derivatives in the mature sperm, the development of a complex acrosome in the absence of highly organized characteristic Golgi apparatus but in the presence of small stacks of annulate lamellae, and the changes in the nucleus. Of the latter, the elaborate convoluted sheets of membrane that are extensions of the nuclear envelope are unique. The nucleus undergoes unusual changes in size and shape that are accompanied by several phases of organization of the chromatin. In the mature sperm the nucleus is empty-appearing and notably lacking in any apparent high degree of order. The entire development of the sperm is consonant with the idea that the fate of the mitochondria and centrioles, structures that figure prominently in the elaborate architecture of flagellate sperm, is associated with the lack of a flagellum. PMID:13773055

Effects of Caffeine on Crayfish Muscle Fibers

PubMed Central

Chiarandini, Dante J.; Reuben, John P.; Brandt, Philip W.; Grundfest, Harry

1970-01-01

Contractions are evoked in single muscle fibers of crayfish by intracellular as well as extracellular applications of caffeine. Responses to external applications in concentrations above 2 mM could be induced indefinitely. With concentrations above 5 mM the caffeine-induced responses were highly repeatable. Tensions were transient even when the caffeine remained in the bath. There was no change in resting potential, but during the contraction the effective resistance decreased about 10%. A number of factors (change in pH, Ca, K, and Cl) modified the responses. The time course of the tension was greatly prolonged when the transverse tubular system (TTS) was s swollen and was again shortened when the TTS was caused to shrink. An increased permeability to Ca induced by caffeine was evidenced by the transformation of the normally graded electrical responses to Ca spikes, which are insensitive to tetrodotoxin. The overshoot is a function of both external Ca and caffeine. A 10-fold change in Ca changed the overshoot by 19 mv in the presence of 10 mM caffeine and by 29 mv in 80 mM caffeine. The role of the increased permeability to Ca for caffeine-induced contractions will be analyzed in the accompanying paper. PMID:5443468

Mitochondrial phylogeography of New Zealand freshwater crayfishes, Paranephrops spp.

PubMed

Apte, S; Smith, P J; Wallis, G P

2007-05-01

Tectonic movement at the boundary of the Indo-Australian and Pacific Plates during the Miocene and Pliocene is recognized as a driving force for invertebrate speciation in New Zealand. Two endemic freshwater crayfish (koura) species, Paranephrops planifrons White 1842 and Paranephrops zealandicus White 1842, represent good model taxa to test geological hypotheses because, due to their low dispersal capacity and life history, geographical restriction of populations may be caused by vicariant processes. Analysis of a mitochondrial DNA marker (cytochrome oxidase subunit I) reveals not two, but three major koura lineages. Contrary to expectation, the cryptic West Coast group appears to be more closely related to P. zealandicus than to P. planifrons and has diverged earlier than the final development (Late Pleistocene) of Cook Strait. Our date estimates suggest that koura lineage diversification probably coincided with early to mid-Alpine orogeny in the mid-Pliocene. Estimates of node ages and the phylogenies are inconsistent with both ancient Oligocene and recent postglacial Pleistocene range expansion, but suggest central to north colonization of North Island and west to east movement in South Island during mid- to late Pliocene. Crypsis and paraphyly of the West Coast group suggest that morphological characters presently used to classify koura species could be misleading.

Fungal Transformation of Tree Stumps into a Suitable Resource for Xylophagous Beetles via Changes in Elemental Ratios

PubMed Central

Filipiak, Michał; Sobczyk, Łukasz; Weiner, January

2016-01-01

The elements present in dead pine stumps inhabited by larvae of wood-boring beetles (Stictoleptura rubra, Arhopalus rusticus and Chalcophora mariana) were analyzed over the initial (first 5 years; a chronosequence) stages of wood decay. The quantities of N, P, K, Ca, Mg, Fe, Zn, Mn, Cu and Na (but not S) increased with increases in the content of ergosterol (used as a proxy for the amount of fungal tissue). In fact, the amounts of P, N, K, Fe and Cu presented marked increases. These findings show that fungi stoichiometrically rearrange dead wood by importing externally occurring nutrients to decaying stumps. During the first years of wood decay, the ratios of C to other elements decrease substantially, but differently, for various elements, whereas the N:Fe, N:Cu, N:P and N:K ratios remain relatively stable. Therefore, the stoichiometric mismatch between xylophages and their food is greatly reduced. By changing the nutritional stoichiometry of dead wood, fungi create a nutritional niche for wood-eaters, and these changes enable the development of xylophages.

40 CFR 180.361 - Pendimethalin; tolerances for residues.

Code of Federal Regulations, 2013 CFR

2013-07-01

... greens, subgroup 5B 0.20 Carrot 0.5 Citrus, oil 0.5 Corn, field, forage 0.1 Corn, field, grain 0.1 Corn, field, stover 0.1 Corn, pop, grain 0.1 Corn, sweet, forage 0.1 Corn, sweet, kernel plus cob with husks removed 0.1 Corn, sweet, stover 0.1 Cotton, gin byproducts 3.0 Cotton, undelinted seed 0.1 Crayfish 0.05...

40 CFR 180.361 - Pendimethalin; tolerances for residues.

Code of Federal Regulations, 2014 CFR

2014-07-01

... greens, subgroup 5B 0.20 Carrot 0.5 Citrus, oil 0.5 Corn, field, forage 0.1 Corn, field, grain 0.1 Corn, field, stover 0.1 Corn, pop, grain 0.1 Corn, sweet, forage 0.1 Corn, sweet, kernel plus cob with husks removed 0.1 Corn, sweet, stover 0.1 Cotton, gin byproducts 3.0 Cotton, undelinted seed 0.1 Crayfish 0.05...

Transmission of Microsporidian Parasites of Mosquitoes.

DTIC Science & Technology

1983-06-01

aquatic animals in a 19. spore suspension, including ostracods, amphipods, spiders, beetle larvae, and phantom midges, 2) Feeding spores to crayfish...dragonfly larvae, damselfly larvae, water scorpions, beetles , Anopheles larvae, snails, and sosquitofish. In experiment 1, no germination was seen. In... rhinoceros from Tonga. J. Gen. Virol. 47, 431-438. Ohtaki, T. and C.M. Williams. 1970. Inactivation of -- ecdysone and cyas- terone by larvae of the flesh fly

40 CFR 180.274 - Propanil; tolerances for residues.

Code of Federal Regulations, 2012 CFR

2012-07-01

... (3, 4-DCA) in or on the following food commodities: Commodity Parts per million Cattle, fat 0.10 Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0...

40 CFR 180.274 - Propanil; tolerances for residues.

Code of Federal Regulations, 2014 CFR

2014-07-01

... (3, 4-DCA) in or on the following food commodities: Commodity Parts per million Cattle, fat 0.10 Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0...

40 CFR 180.274 - Propanil; tolerances for residues.

Code of Federal Regulations, 2013 CFR

2013-07-01

... (3, 4-DCA) in or on the following food commodities: Commodity Parts per million Cattle, fat 0.10 Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0...

To signal or not to signal? Chemical communication by urine-borne signals mirrors sexual conflict in crayfish

PubMed Central

2010-01-01

Background Sexual selection theory predicts that females, being the limiting sex, invest less in courtship signals than males. However, when chemical signals are involved it is often the female that initiates mating by producing stimuli that inform about sex and/or receptivity. This apparent contradiction has been discussed in the literature as 'the female pheromone fallacy'. Because the release of chemical stimuli may not have evolved to elicit the male's courtship response, whether these female stimuli represent signals remains an open question. Using techniques to visualise and block release of urine, we studied the role of urine signals during fighting and mating interactions of crayfish (Pacifastacus leniusculus). Test individuals were blindfolded to exclude visual disturbance from dye release and artificial urine introduction. Results Staged female-male pairings during the reproductive season often resulted in male mating attempts. Blocking female urine release in such pairings prevented any male courtship behaviour. Artificial introduction of female urine re-established male mating attempts. Urine visualisation showed that female urine release coincides with aggressive behaviours but not with female submissive behaviour in reproductive interactions as well as in intersexual and intrasexual fights. In reproductive interactions, females predominately released urine during precopulatory aggression; males subsequently released significantly less urine during mating than in fights. Conclusions Urine-blocking experiments demonstrate that female urine contains sex-specific components that elicit male mating behaviour. The coincidence of chemical signalling and aggressive behaviour in both females and males suggests that urine release has evolved as an aggressive signal in both sexes of crayfish. By limiting urine release to aggressive behaviours in reproductive interactions females challenge their potential mating partners at the same time as they trigger a sexual response. These double messages should favour stronger males that are able to overcome the resistance of the female. We conclude that the difference between the sexes in disclosing urine-borne information reflects their conflicting interests in reproduction. Males discontinue aggressive urine signalling in order to increase their chances of mating. Females resume urine signalling in connection with aggressive behaviour, potentially repelling low quality or sexually inactive males while favouring reproduction with high quality males. PMID:20353555

Marcellus and mercury: Assessing potential impacts of unconventional natural gas extraction on aquatic ecosystems in northwestern Pennsylvania.

PubMed

Grant, Christopher J; Weimer, Alexander B; Marks, Nicole K; Perow, Elliott S; Oster, Jacob M; Brubaker, Kristen M; Trexler, Ryan V; Solomon, Caroline M; Lamendella, Regina

2015-01-01

Mercury (Hg) is a persistent element in the environment that has the ability to bioaccumulate and biomagnify up the food chain with potentially harmful effects on ecosystems and human health. Twenty-four streams remotely located in forested watersheds in northwestern PA containing naturally reproducing Salvelinus fontinalis (brook trout), were targeted to gain a better understanding of how Marcellus shale natural gas exploration may be impacting water quality, aquatic biodiversity, and Hg bioaccumulation in aquatic ecosystems. During the summer of 2012, stream water, stream bed sediments, aquatic mosses, macroinvertebrates, crayfish, brook trout, and microbial samples were collected. All streams either had experienced hydraulic fracturing (fracked, n = 14) or not yet experienced hydraulic fracturing (non-fracked, n = 10) within their watersheds at the time of sampling. Analysis of watershed characteristics (GIS) for fracked vs non-fracked sites showed no significant differences (P > 0.05), justifying comparisons between groups. Results showed significantly higher dissolved total mercury (FTHg) in stream water (P = 0.007), lower pH (P = 0.033), and higher dissolved organic matter (P = 0.001) at fracked sites. Total mercury (THg) concentrations in crayfish (P = 0.01), macroinvertebrates (P = 0.089), and predatory macroinvertebrates (P = 0.039) were observed to be higher for fracked sites. A number of positive correlations between amount of well pads within a watershed and THg in crayfish (r = 0.76, P < 0.001), THg in predatory macroinvertebrates (r = 0.71, P < 0.001), and THg in brook trout (r = 0.52, P < 0.01) were observed. Stream-water microbial communities within the Deltaproteobacteria also shared a positive correlation with FTHg and to the number of well pads, while stream pH (r = -0.71, P < 0.001), fish biodiversity (r = -0.60, P = 0.02), and macroinvertebrate taxa richness (r = -0.60, P = 0.01) were negatively correlated with the number of well pads within a watershed. Further investigation is needed to better elucidate relationships and pathways of observed differences in stream water chemistry, biodiversity, and Hg bioaccumulation, however, initial findings suggest Marcellus shale natural gas exploration is having an effect on aquatic ecosystems.

40 CFR 180.274 - Propanil; tolerances for residues.

Code of Federal Regulations, 2010 CFR

2010-07-01

... Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0.05 Horse, meat byproducts 1.0 Milk 0.05 Poultry, fat 0.05 Poultry, meat 0.10 Poultry, meat byproducts...

Optimization of the incubation time and temperature for spermatozoa extraction in freshwater crayfish Pontastacus leptodactylus (Eschscholtz, 1823).

PubMed

Farhadi, Ardavan; Harlıoğlu, Muzaffer Mustafa; Gür, Seyfettin; Acısu, Tutku Can

2018-06-01

Determination and control of spermatozoa quality in crustacean aquaculture is an important issue for successful and controlled reproduction. Investigation of spermatozoa number in spermatophores is a basic and common parameter for determining the reproductive quality in farmed decapods. In the present study, spermatozoa extraction from spermatophores located in the ductus deferens was conducted in Pontastacus leptodactylus using different incubation times and temperatures. The results indicate that the duration of incubation and temperature affected (P < 0.05) spermatozoa extraction. Greater temperatures (40 and 75 °C) resulted in a reduction (P < 0.05) in number of extracted spermatozoa. In contrast, more spermatozoa were extracted when the 4 and 23 °C temperatures were imposed. After 4 h of incubation, the number of extracted spermatozoa were greatest in number at 23 °C. In conclusion, the greater numbers of crayfish spermatozoa can be obtained when the ductus deferens containing spermatophores is incubated at 23 °C for 4 h as compared with other temperatures and incubation durations. The results of present study are useful for assessing spermatozoa quality in aquaculture as well as the extraction of spermatozoa for research purposes. Copyright © 2018 Elsevier B.V. All rights reserved.

Calcium transport mechanism in molting crayfish revealed by microanalysis

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mizuhira, V.; Ueno, M.

1983-01-01

Crayfish provide a good model in which to study the transport mechanism of Ca ions. During the molting stage, decalcified Ca ions are transferred into the blood and accumulate in the gastrolith epithelium, after which a gastrolith is formed on the surface of the epithelium. The gastrolith is dissolved in the stomach after molting, and the Ca is reabsorbed and redistributed throughout the newly formed exoskeleton. We studied the mechanism of Ca transport by cytochemical precipitation of Ca ions and by electron microanalysis, including X-ray microanalysis (EDX) and electron energy-loss spectroscopy (EELS), with a computer. In EDX analysis, the finemore » precipitates of K-antimonate in the gastrolith mitochondria clearly defined Ca with antimony; we also observed a large amount of Ca-oxalate in the mitochondria, and Ca-K X-ray pulses were clearly defined. Ca-K X-rays were also detected from fresh freeze-substituted mitochondria. Finally, we succeeded in taking a Ca-L EELS image from the mitochondria of fresh freeze-substituted thin sections. Only a very small amount of Ca was detected from the cell membrane and other organelles. Ca-adenosine triphosphatase (ATPase) and Mg-ATPase activity was also very clearly demonstrated in the mitochondria. These enzymes may play an important role in Ca metabolism.« less

Photodynamic injury of isolated crayfish neuron and surrounding glial cells: the role of p53

NASA Astrophysics Data System (ADS)

Sharifulina, S. A.; Uzdensky, A. B.

2015-03-01

The pro-apoptotic transcription factor p53 is involved in cell responses to injurious impacts. Using its inhibitor pifithrin- α and activators tenovin-1, RITA and WR-1065, we studied its potential participation in inactivation and death of isolated crayfish mechanoreceptor neuron and satellite glial cells induced by photodynamic treatment, a strong inducer of oxidative stress. In dark, p53 activation by tenovin-1 or WR-1065 shortened activity of isolated neurons. Tenovin-1 and WR-1065 induced apoptosis of glial cells, whereas pifithrin-α was anti-apoptotic. Therefore, p53 mediated glial apoptosis and suppression of neuronal activity after axotomy. Tenovin-1 but not other p53 modulators induced necrosis of axotomized neurons and surrounding glia, possibly, through p53-independent pathway. Under photodynamic treatment, p53 activators tenovin-1 and RITA enhanced glial apoptosis indicating the pro-apoptotic activity of p53. Photoinduced necrosis of neurons and glia was suppressed by tenovin-1 and, paradoxically, by pifithrin-α. Modulation of photoinduced changes in the neuronal activity and necrosis of neurons and glia was possibly p53-independent. The different effects of p53 modulators on neuronal and glial responses to axotomy and photodynamic impact were apparently associated with different signaling pathways in neurons and glial cells.

Nitric oxide-mediated intersegmental modulation of cycle frequency in the crayfish swimmeret system.

PubMed

Yoshida, Misaki; Nagayama, Toshiki; Newland, Philip

2018-05-21

Crayfish swimmerets are paired appendages located on the ventral side of each abdominal segment that show rhythmic beating during forward swimming produced by central pattern generators in most abdominal segments. For animals with multiple body segments and limbs, intersegmental coordination of central pattern generators in each segment is crucial for the production of effective movements. Here we develop a novel pharmacological approach to analyse intersegmental modulation of swimmeret rhythm by selectively elevating nitric oxide levels and reducing them with pharmacological agents, in specific ganglia. Bath application of L-arginine, the substrate NO synthesis, increased the cyclical spike responses of the power-stroke motor neurons. By contrast the NOS inhibitor, L-NAME decreased them. To determine the role of the different local centres in producing and controlling the swimmeret rhythm, these two drugs were applied locally to two separate ganglia following bath application of carbachol. Results revealed that there was both ascending and descending intersegmental modulation of cycle frequency of the swimmeret rhythm in the abdominal ganglia and that synchrony of cyclical activity between segments of segments was maintained. We also found that there were gradients in the strength effectiveness in modulation, that ascending modulation of the swimmeret rhythm was stronger than descending modulation. © 2018. Published by The Company of Biologists Ltd.

Contraction produced by intracellular injection of calcium, strontium, and barium in the single crayfish muscle fibers.

PubMed

Matsumura, M; Mashima, H

1976-01-01

Ca ions were ionophoretically injected through an intracellular microelectrode into the single muscle fiber of a crayfish, and the resulting contraction sphere was observed under a microscope and photographed with a movie camera. The minimum contraction produced by the threshold current involved usually three or four, sometimes two, sarcomers on both sides of the injecting pipette but contraction involving only one sarcomere was not observered. The rheobase of the Ca-injecting current was 3.2 X 10(-9) A. The strength-duration curves were determined for Ca-, Sr-, and Ba-injecting currents; all fitted a similar hyperbolic equation. The threshold amount of Ca above rheobasic injection was 2.1 X 10(-15)mol, and the ratios between threshold amounts were Ca: Sr: Ba=1: 1.9: 3.0. The effects of Ca and Sr were additive for the contraction. More current was required for the Ca-injection to produce the contraction in the K-depolarized-or 15mM-procaine-treated muscle, although less current was sufficient for the muscle treated with 0.5-1.0 mM of caffeine. The participation of the Ca-induced Ca release mechanism in the contraction produced by Ca injection and the role of Sr or Ba as a substitute for Ca were discussed.

Life History Variation in Invading Applesnails (Pomacea canaliculata) May Pose Ecological Threats to Wetlands

NASA Astrophysics Data System (ADS)

Marfurt, R. K.; Boland, B. B.; Burks, R. L.

2005-05-01

In native habitats, channeled applesnails (Pomacea canaliculata) graze periphyton. However, casual observations from introduced populations suggest these invaders show variation in feeding ecology, predator response and life history strategies. Attempts to predict this consumer influence on ecosystem function suffer from a lack of basic data. We tested how salinity affected snail mortality. Both adults and hatchlings tolerated salinity levels up to 8 ppt. Adult feeding on lettuce increased significantly at 8 ppt compared to 0 ppt (p = 0.002), while hatchling consumption of algae did not vary (p = 0.284). To see how these consumers responded to predators from the invaded ecosystem, we tested behavioural responses to predatory cues from fish, turtles, crayfish and adult applesnails. Results indicated that fish and crayfish prompted similar predator-avoidance behaviors in hatchlings (p's < 0.05) and that hatchling response changed over time. Consumption rates of juvenile redear sunfish did not vary (x2, p > 0.05) between native (ramshorn) and exotic applesnails, whereas adult fish consumed more applesnails (x2, p < 0.001). Our current efforts focus on examining if predator presence or macrophyte choice alters applesnail feeding rates. Research providing insight into the basic ecology of applesnails can foster management efforts at the ecosystem scale.

A Review of Cyanobacterial Odorous and Bioactive Metabolites: Impacts and Management Alternatives in Aquaculture

DTIC Science & Technology

2008-05-06

concentrations (i.e., basic conditions). Cyanobacteria are also well adapted to high-light and low-light conditions. Cyanobacteria benefit from photosynthetic...including the foot, gonads, or whole body of gastropods , the foot or whole body of Table 2 Maximum accumulation of cyanobacterial toxins in the tissues...Evidence suggests that gastropods , bivalves and crayfish provide a greater risk than fish to human consumers as they accumulate higher concentrations

Crayfish neuromuscular facilitation activated by constant presynaptic action potentials and depolarizing pulses

PubMed Central

Zucker, Robert S.

1974-01-01

1. Experiments were conducted to test the hypothesis that facilitation of transmitter release in response to repetitive stimulation of the exciter motor axon to the crayfish claw opener muscle is due to an increase in the amplitude or duration of the action potential in presynaptic terminals. No consistent changes were found in the nerve terminal potential (n.t.p.) recorded extracellularly at synaptic sites on the surface of muscle fibres. 2. Apparent changes in n.t.p. are attributed to three causes. (i) Some recordings are shown to be contaminated by non-specific muscle responses which grow during facilitation. (ii) Some averaged n.t.p.s exhibit opposite changes in amplitude and duration which suggest a change in the synchrony of presynaptic nerve impulses at different frequencies. (iii) Some changes in n.t.p. are blocked by γ-methyl glutamate, an antagonist of the post-synaptic receptor, which suggests that these changes are caused by small muscle movements. 3. The only change in n.t.p. believed to represent an actual change in the intracellular signal is a reduction in n.t.p. amplitude to the second of two stimuli separated by a brief interval. 4. Tetra-ethyl ammonium ions increase synaptic transmission about 20% and prolong the n.t.p. about 15%. This result suggests that an increase in n.t.p. large enough to increase transmission by the several hundred per cent occurring during facilitation would be detected. 5. The nerve terminals are electrically excitable, and most synaptic sites have a diphasic or triphasic n.t.p., which suggests that the motor neurone terminals are actively invaded by nerve impulses. 6. When nerve impulses are blocked in tetrodotoxin, depolarization of nerve terminals increases the frequency of miniature excitatory junctional potentials (e.j.p.s), and a phasic e.j.p. can be evoked by large, brief depolarizing pulses. Responses to repetitive or paired depolarizations of constant amplitude and duration exhibit a facilitation similar to that of e.j.p.s evoked by nerve impulses. 7. It is concluded that facilitation in the crayfish claw opener is not due to a change in the presynaptic action potential, but is due to some change at a later step in the depolarization—secretion process. PMID:4153766

Crayfish neuromuscular facilitation activated by constant presynaptic action potentials and depolarizing pulses.

PubMed

Zucker, R S

1974-08-01

1. Experiments were conducted to test the hypothesis that facilitation of transmitter release in response to repetitive stimulation of the exciter motor axon to the crayfish claw opener muscle is due to an increase in the amplitude or duration of the action potential in presynaptic terminals. No consistent changes were found in the nerve terminal potential (n.t.p.) recorded extracellularly at synaptic sites on the surface of muscle fibres.2. Apparent changes in n.t.p. are attributed to three causes.(i) Some recordings are shown to be contaminated by non-specific muscle responses which grow during facilitation.(ii) Some averaged n.t.p.s exhibit opposite changes in amplitude and duration which suggest a change in the synchrony of presynaptic nerve impulses at different frequencies.(iii) Some changes in n.t.p. are blocked by gamma-methyl glutamate, an antagonist of the post-synaptic receptor, which suggests that these changes are caused by small muscle movements.3. The only change in n.t.p. believed to represent an actual change in the intracellular signal is a reduction in n.t.p. amplitude to the second of two stimuli separated by a brief interval.4. Tetra-ethyl ammonium ions increase synaptic transmission about 20% and prolong the n.t.p. about 15%. This result suggests that an increase in n.t.p. large enough to increase transmission by the several hundred per cent occurring during facilitation would be detected.5. The nerve terminals are electrically excitable, and most synaptic sites have a diphasic or triphasic n.t.p., which suggests that the motor neurone terminals are actively invaded by nerve impulses.6. When nerve impulses are blocked in tetrodotoxin, depolarization of nerve terminals increases the frequency of miniature excitatory junctional potentials (e.j.p.s), and a phasic e.j.p. can be evoked by large, brief depolarizing pulses. Responses to repetitive or paired depolarizations of constant amplitude and duration exhibit a facilitation similar to that of e.j.p.s evoked by nerve impulses.7. It is concluded that facilitation in the crayfish claw opener is not due to a change in the presynaptic action potential, but is due to some change at a later step in the depolarization-secretion process.

Incidence and Management Costs of Freshwater Aquatic Nuisance Species at Projects Operated by the U.S. Army Corps of Engineers

DTIC Science & Technology

2010-07-01

the occurrence of ANS impacts (Yes or No) from freshwater algae, large aquatic plants, fish, zebra mussels, Asiatic clams, water fleas, crayfish...2005. Freshwater aquatic nuisance species impacts and management costs and benefits at federal water resources projects. ERDC/TN ANSRP-06-3...ER D C/ EL T R- 10 -1 3 Aquatic Nuisance Species Research Program Incidence and Management Costs of Freshwater Aquatic Nuisance Species

Vitellogenin levels in hemolymph, ovary and hepatopancreas of the freshwater crayfish Cherax quadricarinatus (Decapoda: Parastacidae) during the reproductive cycle.

PubMed

Ferré, Lilian E; Medesani, Daniel A; García, C Fernando; Grodzielski, Matías; Rodríguez, Enrique M

2012-03-01

The freshwater crayfish Cherax quadricarinatus is a tropical species of great interest for aquaculture. Vitellogenin (Vg), a lipoprotein precursor of the vitellum accumulated in spawned eggs, can be synthesized in the ovary and/or hepatopancreas of most crustaceans, being the hemolymph the way for transporting Vg throughout the reproductive cycle. Concentration of Vg in hemolymph, ovary and hepatopancreas of Cherax quadricarinatus adult females was measured by means of ELISA, specifically developed after purifying the native Vg. Measurements were made at four periods of the reproductive cycle: pre-reproductive, mid-reproductive, late reproductive and post-reproductive. Besides, both hepatosomatic (HSI) and gonadosomatic (GSI) indexes were determined in each period. Significant variations in Vg levels were detected in both hemolymph and hepatopancreas, being the highest values observed during the mid-reproductive period. Besides, such variations were positively correlated to the HSI. A positive correlation between Vg levels in hepatopancreas and ovary was also seen. These results support previous evidences about the central role of the hepatopancreas as a site of Vg synthesis in the studied species, together with the relevancy of hemolymph for transporting Vg from the hepatopancreas to the ovary. For aquaculture purposes, Vg monitoring in hemolymph could be used as a non-injurious method, to check the reproductive activity of C. quadricarinatus females.

Inferring Invasion History of Red Swamp Crayfish (Procambarus clarkii) in China from Mitochondrial Control Region and Nuclear Intron Sequences

PubMed Central

Li, Yanhe; Guo, Xianwu; Chen, Liping; Bai, Xiaohui; Wei, Xinlan; Zhou, Xiaoyun; Huang, Songqian; Wang, Weimin

2015-01-01

Identifying the dispersal pathways of an invasive species is useful for adopting the appropriate strategies to prevent and control its spread. However, these processes are exceedingly complex. So, it is necessary to apply new technology and collect representative samples for analysis. This study used Approximate Bayesian Computation (ABC) in combination with traditional genetic tools to examine extensive sample data and historical records to infer the invasion history of the red swamp crayfish, Procambarus clarkii, in China. The sequences of the mitochondrial control region and the proPOx intron in the nuclear genome of samples from 37 sites (35 in China and one each in Japan and the USA) were analyzed. The results of combined scenarios testing and historical records revealed a much more complex invasion history in China than previously believed. P. clarkii was most likely originally introduced into China from Japan from an unsampled source, and the species then expanded its range primarily into the middle and lower reaches and, to a lesser extent, into the upper reaches of the Changjiang River in China. No transfer was observed from the upper reaches to the middle and lower reaches of the Changjiang River. Human-mediated jump dispersal was an important dispersal pathway for P. clarkii. The results provide a better understanding of the evolutionary scenarios involved in the rapid invasion of P. clarkii in China. PMID:26132567

Adult neurogenesis in the central olfactory pathway of dendrobranchiate and caridean shrimps: New insights into the evolution of the deutocerebral proliferative system in reptant decapods.

PubMed

Wittfoth, Christin; Harzsch, Steffen

2018-04-16

Persistent neurogenesis in the central olfactory pathway characterizes many reptant decapods such as lobsters, crayfish and crabs. In these animals, the deutocerebral proliferative system generates new neurons which integrate into the neuronal network of the first order processing neuropil of the olfactory system, the deutocerebral chemosensory lobes (also called olfactory lobes). However, differences concerning the phenotype and the mechanisms that drive adult neurogenesis were reported in crayfish versus spiny lobsters. While numerous studies have focussed on these mechanisms and regulation of adult neurogenesis, investigations about the phylogenetic distribution are missing. To contribute an evolutionary perspective on adult neurogenesis in decapods, we investigated two representatives of basally diverging lineages, the dendrobranchiate Penaeus vannamei and the caridean Crangon crangon using the thymidine analogue Bromodeoxyuridine (BrdU) as marker for the S phase of cycling cells. Compared to reptant decapods, our results suggest a simpler mechanism of neurogenesis in the adult brain of dendrobranchiate and caridean shrimps. Observed differences in the rate of proliferation and spatial dimensions are suggested to correlate with the complexity of the olfactory system. We assume that a more complex and mitotically more active proliferative system in reptant decapods evolved with the emergence of another processing neuropil, the accessory lobes. This article is protected by copyright. All rights reserved. © 2018 Wiley Periodicals, Inc.

Chicken-type lysozyme functions in the antibacterial immunity in red swamp crayfish, Procambarus clarkii.

PubMed

Liao, Tian-Jiang; Gao, Jie; Wang, Jin-Xing; Wang, Xian-Wei

2018-08-01

Lysozymes possess antibacterial activities, making them crucial defense proteins in innate immunity. In this study, a chicken-type (c-type) lysozyme (designated PcLyzc) was cloned and characterized from red swamp crayfish Procambarus clarkii. The full-length cDNA had an open reading frame of 435 base pairs encoding a polypeptide of 144 amino acid residues. Multiple alignments and phylogenetic analysis revealed that PcLyzc shared high similarity to the other known invertebrate c-type lysozymes. PcLyzc transcripts were steadily expressed in a wide range of tissues in healthy crayfish, and were prominently up-regulated in the hepatopancreas and gills after Vibrio anguillarum or Aeromonas hydrophila challenge. Recombinant PcLyzc showed inhibitory activity in vitro against both Gram-positive bacteria, including Staphylococcus aureus, Micrococcus luteus and Bacillus thuringiensis, and Gram-negative bacteria, including A. hydrophila, V. anguillarum and Escherichia coli. By overexpressing PcLyzc through introducing exogenous recombinant protein, or silencing PcLyzc expression through injecting double strand RNA, it was found that PcLyzc could help eliminate the invading bacteria in crayfish hemolymph and could protect crayfish from death, possibly by promoting the hemocytic phagocytosis. These results indicated that PcLyzc played a role in the antibacterial immunity of crustaceans, and laid a foundation of developing new therapeutic agents in aquaculture. Copyright © 2018 Elsevier Ltd. All rights reserved.

Direct Age Determination of a Subtropical Freshwater Crayfish (Redclaw, Cherax quadricarinatus) Using Ossicular Growth Marks

PubMed Central

Leland, Jesse C.; Bucher, Daniel J.; Coughran, Jason

2015-01-01

Recent studies have reported that crustacean age determination is possible. We applied a direct ageing method (i.e. transverse cross sectioning of gastric ossicles) to a subtropical freshwater crayfish (Cherax quadricarinatus) sourced from an aquaculture population. Growth mark periodicity and the potential for chronological depositions were investigated by staining C. quadricarinatus with calcein and examining their ossicles a year later. Pterocardiac ossicles were superior to other ageing structures (i.e. other ossicles and eyestalks) and produced repeatable between-reader counts (87% were corroborated and 13% varied by ±1). C. quadricarinatus size-at-age data (for an aquaculture population) was described by a von Bertalanffy growth equation (L ∞ = 32 mm occipital carapace length; K = 0.64; t 0 = –0.18; R2 = 0.81). Ossicular growth marks did not correspond to moult history. The calcein stain was retained over an annual cycle comprising multiple moults, demonstrating that pterocardiac ossicles retain chronological information. The maximum age (3+) corroborated other indirectly-obtained longevity estimates for C. quadricarinatus. Multiple lines of evidence indicate that the growth marks in C. quadricarinatus ossicles are probably deposited annually during winter. The ability to extract age information from subtropical decapods provides substantial opportunities for advancing fisheries and conservation research globally, but further research is needed to provide a definitive validation and elucidate the mechanism governing the accrual of ossicular growth marks. PMID:26309228

MARS: A protein family involved in the formation of vertical skeletal elements.

PubMed

Abehsera, Shai; Peles, Shani; Tynyakov, Jenny; Bentov, Shmuel; Aflalo, Eliahu D; Li, Shihao; Li, Fuhua; Xiang, Jianhai; Sagi, Amir

2017-05-01

Vertical organizations of skeletal elements are found in various vertebrate teeth and invertebrate exoskeletons. The molecular mechanism behind the development of such structural organizations is poorly known, although it is generally held that organic matrix proteins play an essential role. While most crustacean cuticular organizations exhibit horizontal chitinous layering, a typical vertical organization is found towards the surface of the teeth in the mandibles of the crayfish Cherax quadricarinatus. Candidate genes encoding for mandible-forming structural proteins were mined in C. quadricarinatus molt-related transcriptomic libraries by using a binary patterning approach. A new protein family, termed the Mandible Alanine Rich Structural (MARS) protein family, with a modular sequence design predicted to form fibers, was found. Investigations of spatial and temporal expression of the different MARS genes suggested specific expression in the mandibular teeth-forming epithelium, particularly during the formation of the chitinous vertical organization. MARS loss-of-function RNAi experiments resulted in the collapse of the organization of the chitin fibers oriented vertically to the surface of the crayfish mandibular incisor tooth. A general search of transcriptomic libraries suggested conservation of MARS proteins across a wide array of crustaceans. Our results provide a first look into the molecular mechanism used to build the complex crustacean mandible and into the specialized vertical structural solution that has evolved in skeletal elements. Copyright © 2017 Elsevier Inc. All rights reserved.

Information to support to monitoring and habitat restoration on Ash Meadows National Wildlife Refuge

USGS Publications Warehouse

Scoppettone, G. Gary

2013-01-01

The Ash Meadows National Wildlife Refuge staff focuses on improving habitat for the highest incidence of endemic species for an area of its size in the continental United States. Attempts are being made to restore habitat to some semblance of its pre-anthropogenic undisturbed condition, and to provide habitat conditions to which native plant and animal species have evolved. Unfortunately, restoring the Ash Meadows’ Oases to its pre-anthropogenic undisturbed condition is almost impossible. First, there are constraints on water manipulation because there are private holdings within the refuge boundary; second, there has been at least one species extinction—the Ash Meadows pool fish (Empetrichthys merriami). It is also quite possible that thermal endemic invertebrate species were lost before ever being described. Perhaps the primary obstacle to restoring Ash Meadows to its pre-anthropogenic undisturbed conditions is the presence of invasive species. However, invasive species, such as red swamp crayfish (Procambarus clarki) and western mosquitofish (Gambusia affinis), are a primary driving force in restoring Ash Meadows’ spring systems, because under certain habitat conditions they can all but replace native species. Returning Ash Meadows’ physical landscape to some semblance of its pre-anthropogenic undisturbed condition through natural processes may take decades. Meanwhile, the natural dissolution of concrete and earthen irrigation channels threatens to allow cattail marshes to flourish instead of spring-brooks immediately downstream of spring discharge. This successional stage favors non-native crayfish and mosquitofish over the native Amargosa pupfish (Cyprinodon nevadensis). Thus, restoration is needed to control non-natives and to promote native species, and without such intervention the probability of native fish reduction or loss, is anticipated. The four studies in this report are intended to provide information for restoring native fish habitat and for monitoring native fish populations in relation to restoration efforts on the Ash Meadows National Wildlife Refuge. There are no precise records on conditions of each of the spring systems prior to anthropogenic alteration; however, fostering conditions that favor native over non-natives will be key to habitat restoration. Information regarding native species carbon source is needed to create habitat that favors native species, thus habitat restoration fostering food stuff consumed by native species should be considered in restoration efforts. In compiling data for the first part of this report, we tracked carbon source for native and non-native species at four stations along the Jackrabbit Spring system. Thus, we were able to contrast carbon source in warm- and cool-water habitats. Habitat in Jackrabbit Spring was improved for native fishes in 2007. The second paper in this report focuses on native fish populations in Jackrabbit Spring system pre- and post-restoration. Much of the Ash Meadows Oases is marsh habitat where non-native red swamp crayfish and western mosquitofish are often abundant, to the detriment of non-natives. Because marsh habitat is broadly represented in the Ash Meadows landscape, establishing marsh habitat most conducive to the native fishes is important to the restoration effort, and the third paper addresses marsh habitat type with the relative abundance of fishes and crayfish. There are previous years of monitoring Ash Meadows’ native fish populations, but not all monitoring occurred at the same time of year. Desert-fish populations sometimes undergo seasonal fluctuation, so it might not be valid to compare population trends using difference seasons. For report four, we tracked a closed population of Amargosa pupfish (Cyprinodon nevadensis) year round to track seasonal trends. Knowledge of seasonal trends is important in tracking changes of populations pre- and post-restoration.

Phase I Marine Archeological Remote Sensing Survey of the Proposed Mississippi River Sand Borrow Sites for the Louisiana Coastal Area Barrier Shoreline Restoration Project, Plaquemines Parish, Louisiana

DTIC Science & Technology

2008-09-01

massive, organically-rich, clayey silts and silty clays that contain ostracods, the remains of fiddler crabs and crayfish, and gastropods such as...that big game hunting was a dominant adaptive strategy in the southeast is less certain because of the regional environmental...evidence suggests that a degree of continuity existed between the adaptations of prehistoric peoples living in northern forests and those who lived in

Case Study Application of the Biodiversity Security Index to Ranking Feasibility Studies for Ecosystem Restoration Projects of the U.S. Army Corps of Engineers

DTIC Science & Technology

2016-04-01

determinations are more common for certain invertebrates , such as gastropods (snails), but the taxonomy is improving rapidly. The RSI approach to resource...arrow for invertebrate animals. Check the box for Mollusca. Then check to make sure your status and location criteria remain the same, search for the...mollusk list and store. Go back to invertebrate animals and select the down arrow for “Crustacea”. Then select crayfish, isopods, amphipods, and

Left-right asymmetry in firing rate of extra-retinal photosensitive neurons in the crayfish.

PubMed

Pacheco-Ortiz, José A; Sánchez-Hernández, Juan C; Rodríguez-Sosa, Leonardo; Calderón-Rosete, Gabina; Villagran-Vargas, Edgar

2018-01-01

The purpose of this paper is to explore the firing rate of the caudal photoreceptors (CPRs) from the sixth abdominal ganglion of the crayfish Cherax quadricarinatus. We use simultaneous extracellular recordings on left and right CPR in the isolated ganglion (n = 10). The CPRs showed an asymmetry in the spontaneous activity and light-induced response. In darkness, we observed one subgroup (70%) in which the left CPR (CPR-L) and right CPR (CPR-R) had spontaneous firing rates with a median of 18 impulses/s and 6 impulses/s, respectively. In another subgroup (20%), the CPR-R had a median of 15 impulses/s and the CPR-L had 8 impulses/s. In both groups, the differences were significant. Furthermore, the CPRs showed an asymmetrical photoresponse induced by a pulse of white light (700 Lux, 4 s). In one subgroup (30%), the CPR-L showed light-induced activity with a median of 73%, (interquartile range, IQR = 51), while the CPR-R had a median of 41%, (IQR = 47). In another subgroup (70%), the CPR-R showed a median of 56%, (IQR = 51) and the CPR-L had a median of 42%, (IQR = 46). In both groups, the differences were significant. Moreover, we observed a differential effect of temperature on CPR activity. These results suggest a functional asymmetry in both activities from left and right CPRs. These CPR activity fluctuations may modulate the processing of information by the nervous system.

Photodynamic damage of glial cells in crayfish ventral nerve cord

NASA Astrophysics Data System (ADS)

Kolosov, M. S.; Duz, E.; Uzdensky, A. B.

2011-03-01

Photodynamic therapy (PDT) is a promising method for treatment of brain tumors, the most of which are of glial origin. In the present work we studied PDT-mediated injury of glial cells in nerve tissue, specifically, in abdominal connectives in the crayfish ventral nerve cord. The preparation was photosensitized with alumophthalocyanine Photosens and irradiated 30 min with the diode laser (670 nm, 0.1 or 0.15 W/cm2). After following incubation in the darkness during 1- 10 hours it was fluorochromed with Hoechst 33342 and propidium iodide to reveal nuclei of living, necrotic and apoptotic cells. The chain-like location of the glial nuclei allowed visualization of those enveloping giant axons and blood vessels. The level of glial necrosis in control preparations was about 2-5 %. Apoptosis was not observed in control preparations. PDT significantly increased necrosis of glial cells to 52 or 67 % just after irradiation with 0.1 or 0.15 W/cm2, respectively. Apoptosis of glial cells was observed only at 10 hours after light exposure. Upper layers of the glial envelope of the connectives were injured stronger comparing to deep ones: the level of glial necrosis decreased from 100 to 30 % upon moving from the connective surface to the plane of the giant axon inside the connective. Survival of glial cells was also high in the vicinity of blood vessels. One can suggest that giant axons and blood vessels protect neighboring glial cells from photodynamic damage. The mechanism of such protective action remains to be elucidated.

Ultrastructural and functional characterization of circulating hemocytes from the freshwater crayfish Astacus leptodactylus: cell types and their role after in vivo artificial non-self challenge.

PubMed

Giulianini, Piero Giulio; Bierti, Manuel; Lorenzon, Simonetta; Battistella, Silvia; Ferrero, Enrico Antonio

2007-01-01

The freshwater crayfish Astacus leptodactylus (Eschscholtz, 1823) is an important aquacultured decapod species as well as an invasive species in some European countries. In the current investigation we characterized the different classes of circulating blood cells in A. leptodactylus by means of light and electron microscopy analysis and we explored their reaction to different latex beads particles in vivo by total and differential cell counts at 0.5, 1, 2 and 4h after injections. We identified hemocytes by granule size morphometry as hyaline hemocytes with no or rare tiny granules, small granule hemocytes, unimodal medium diameter granule hemocytes and both small and large granule containing hemocytes. The latter granular hemocytes showed the strongest phenoloxidase l-DOPA reactivity both in granules and cytoplasm. A. leptodactylus respond to foreign particles with strong cellular immune responses. All treatments elicited a total hemocyte increase with a conspicuous recruitment of large granule containing hemocytes. All hemocyte types mounted some phagocytic response but the small granule hemocytes were the only ones involved in phagocytic response to all foreign particles with the highest percentages. These results (1) depict the variability in decapod hemocyte functional morphology; (2) identify the small granule hemocyte as the major phagocytic cell; (3) suggest that the rather rapid recruitment of large granule hemocyte in all treatments plays a relevant role by this hemocyte type in defense against foreign particles, probably in nodule formation.

Growth, condition, diet, and consumption rates of northern pike in three Arizona reservoirs

USGS Publications Warehouse

Flinders, J.M.; Bonar, Scott A.

2008-01-01

Northern pike (Esox lucius L.) introductions are controversial in the western United States due to suspected impacts they might have on established sport fisheries and potential illegal introductions. Tbree Arizona reservoirs, Parker Canyon Lake, Upper Lake Mary and Long Lake were sampled to examine the diet, consumption dynamics, and growth of northern pike. Northern pike diets varied by season and reservoir. In Parker Canyon Lake, diets were dominated by rainbow trout in winter and spring and bluegill and green sunfish in the fall. In Long Lake the northern pike ate crayfish in spring and early summer and switched to young of the year common carp in summer and fall. Black crappie, golden shiners, and crayfish were the major prey in Upper Lake Mary during spring, but they switched to stocked rainbow trout in the fall. Northern pike growth was in the high range of growth reported throughout the United States. Estimated northern pike specific consumption rate (scr) of rainbow trout (g/g/d ?? 10-6) was greatest in Upper Lake Mary (scr = 329.1 ?? 23.7 g/g/d ?? 10-6) where stocked fingerling (280 mm TL) rainbow trout stocked in Long Lake (scr = 1.4 ?? 0.1 g/g/d ?? 10-6) and Parker Canyon Lake (scr = 287.2 ?? 15.1 g/g/d ?? 10-6) where catchable-sized rainbow trout were stocked. Managers should consider the cost-benefits of stocking fish >200 mm TL in lakes containing northern pike. ?? Copyright by the North American Lake Management Society 2008.

Environmental covariates associated with Cambarus veteranus (Decapoda: Cambaridae), an imperiled Appalachian crayfish endemic to West Virginia, USA

USGS Publications Warehouse

Loughman, Zachary J.; Welsh, Stuart A.; Sadecky, Nicole M.; Dillard, Zachary W.; Scott, R. Katie

2016-01-01

Cambarus veteranus Faxon, 1914, a narrow endemic crayfish native to the Upper Guyandotte River Basin (UGB) in West Virginia, USA, was petitioned in 2014 by the United States Fish and Wildlife Service to be listed as endangered, but a status survey was recommended to determine if listing was warranted. During May and June 2015, surveys were undertaken across the UGB to determine the current distribution of the species. A total of 71 sites were sampled, including all streams where the species was previously recorded, as well as semi-randomly selected streams, with 1-9 125 m long sites sampled per wadeable stream. Physiochemical and physical habitat data (based on the Qualitative Habitat Evaluation Index, QHEI) were obtained at each site to determine abiotic factors that were associated with the presence of C. veteranus. Site detection or non-detection of C. veteranus and associated site covariates were modeled using logistic regression to determine covariates associated with the presence of the species. Cambarus veteranus was present in both the Pinnacle Creek and Clear Fork/Laurel Fork watersheds at 10 sites, but it was not observed in the remaining 61 sites. An additive effects model with conductivity and QHEI was selected as the best approximating model. Cambarusveteranus was associated with lower than average UGB conductivity (379 µS) and high (>80) QHEI score. All sites where C. veteranus was not detected had higher conductivity and/or lower QHEI scores.

The role of contamination history and gender on the genotoxic responses of the crayfish Procambarus clarkii to a penoxsulam-based herbicide.

PubMed

Costa, Ricardo; Pereira, Joana Luísa; Santos, Maria Ana; Pacheco, Mário; Guilherme, Sofia

2018-06-04

The responses of non-target organisms to pesticide exposure are still poorly explored in what concerns the development of adjustments favouring population success. Owing to the vital role of DNA integrity, it is important to identify genome-maintenance skills and their determinant factors. Thus, the major aims of the present study were: (i) to assess the genotoxicity of the penoxsulam-based herbicide (Viper ® ) to the crayfish Procambarus clarkii; (ii) to understand the influence of gender and contamination history in the genotoxic responses following exposure to this herbicide; (iii) to investigate the damage mechanisms involved in putative adjustments shown by P. clarkii. Two populations were tested, one from a reference site and the other from a historically contaminated site. Specimens from both populations were exposed to Viper ® , considering environmentally relevant penoxsulam concentrations (20 and 40 µg L -1 ) and to a model genotoxicant (EMS). Comet assay was adopted to assess the genetic damage in gills. The results disclosed the genotoxicity of the herbicide to crayfish (a non-target organism). Additionally, organisms exposed to the highest concentration of penoxsulam signalized the influence of factor "population" towards the genotoxic pressure (measured as effective DNA breaks): P2 males from the historically impacted population displayed a significantly higher susceptibly (by up to 53.98%) when compared to control, while the homologous group from the reference population presented levels similar to its respective control. When DNA lesion-repair enzymes were considered, DNA oxidation patterns suggested an increased ability of this gender (39.75% lower than negative control) to deal with this particular type of damage, namely considering pyrimidines oxidation. It is worth remarking that the influence of the exposure history on the protection/vulnerability to the penoxsulam-based herbicide was only evident in males, despite depending on the type of DNA damage: when the non-specific damage was considered, organisms from the impacted population seemed to be more vulnerable while regarding to the oxidative damage, males from the impacted population appeared to be more protected than organisms that have never been exposed to penoxsulam. Overall, the influence of factors "gender" and "contamination history" was demonstrated as well as its dependence on DNA damage type was evident. EMS groups did not present the differences between populations, reinforcing the agent-specific adjustment hypothesis.These findings highlighted the importance of considering differential physiological backgrounds in ecogenotoxicological analysis, hence favouring the elaboration of more plausible and holistic approaches integrating the environmental risk assessment of pesticides.

Cavitary mass lesion and recurrent pneumothoraces due to Paragonimus kellicotti infection: North American paragonimiasis.

PubMed

Castilla, Elias A; Jessen, Robert; Sheck, David N; Procop, Gary W

2003-08-01

North American paragonimiasis is well described in omnivorous and carnivorous animals on this continent. Humans are rarely infected, largely because of dietary customs, but are at risk for infection if raw or undercooked crayfish are consumed. We describe a patient with a pleuropulmonary infection due to Paragonimus kellicotti that presented as recurrent pneumothoraces and a cavitary lesion. This is the first case of North American paragonimiasis in which the diagnosis was based on the morphology of the eggs present in histologic sections.

Hemocyanin with phenoloxidase activity in the chitin matrix of the crayfish gastrolith.

PubMed

Glazer, Lilah; Tom, Moshe; Weil, Simy; Roth, Ziv; Khalaila, Isam; Mittelman, Binyamin; Sagi, Amir

2013-05-15

Gastroliths are transient extracellular calcium deposits formed by the crayfish Cherax quadricarinatus von Martens on both sides of the stomach wall during pre-molt. Gastroliths are made of a rigid chitinous organic matrix, constructed as sclerotized chitin-protein microfibrils within which calcium carbonate is deposited. Although gastroliths share many characteristics with the exoskeleton, they are simpler in structure and relatively homogeneous in composition, making them an excellent cuticle-like model for the study of cuticular proteins. In searching for molt-related proteins involved in gastrolith formation, two integrated approaches were employed, namely the isolation and mass spectrometric analysis of proteins from the gastrolith matrix, and 454-sequencing of mRNAs from both the gastrolith-forming and sub-cuticular epithelia. SDS-PAGE separation of gastrolith proteins revealed a set of bands at apparent molecular masses of 75-85 kDa; mass spectrometry data matched peptide sequences from the deduced amino acid sequences of seven hemocyanin transcripts. This assignment was then examined by immunoblot analysis using anti-hemocyanin antibodies, also used to determine the spatial distribution of the proteins in situ. Apart from contributing to oxygen transport, crustacean hemocyanins were previously suggested to be involved in several aspects of the molt cycle, including hardening of the new post-molt exoskeleton via phenoloxidation. The phenoloxidase activity of gastrolith hemocyanins was demonstrated. It was also noted that hemocyanin transcript expression during pre-molt was specific to the hepatopancreas. Our results thus reflect a set of functionally versatile proteins, expressed in a remote metabolic tissue and dispersed via the hemolymph to perform different roles in various organs and structures.

Calcium binding to Procambarus clarkii sarcoplasmic calcium binding protein splice variants.

PubMed

Rohrback, Suzanne E; Wheatly, Michele G; Gillen, Christopher M

2015-01-01

Sarcoplasmic calcium binding protein (SCP) is a high-affinity calcium buffering protein expressed in muscle of crayfish and other invertebrates. In previous work, we identified three splice variants of Procambarus clarkii SCP (pcSCP1a, pcSCP1b, and pcSCP1c) that differ in a 37 amino acid region that lies mainly between the 2nd and 3ed EF-hand calcium binding domain. To evaluate the function of the proteins encoded by the pcSCP1 transcripts, we produced recombinant pcSCP1 and used tryptophan fluorescence to characterize calcium binding. Tryptophan fluorescence of pcSCP1a decreased in response to increased calcium, while tryptophan fluorescence of the pcSCP1b and pcSCP1c variants increased. We estimated calcium binding constants and Hill coefficients with two different equations: the standard Hill equation and a modified Hill equation that accounts for contributions from two different tryptophans. The approaches gave similar results. Steady-state calcium binding constants (Kd) ranged from 2.7±0.7×10(-8)M to 5.6±0.1×10(-7)M, consistent with previous work. Variants displayed significantly different apparent calcium affinities, which were decreased in the presence of magnesium. Calcium Kd was lowest for pcSCP1a and highest for pcSCP1c. Site-directed mutagenesis of pcSCP1c residues to the amino acids of pcSCP1b decreased the calcium Kd, identifying residues outside the EF-hand domains that contribute to calcium binding in crayfish SCP. Copyright © 2014 Elsevier Inc. All rights reserved.

PcToll3 was involved in anti-Vibrio response by regulating the expression of antimicrobial peptides in red swamp crayfish, Procambarus clarkii.

PubMed

Lan, Jiang-Feng; Wei, Shun; Wang, Yu-Qing; Dai, Yun-Jia; Tu, Jia-Gang; Zhao, Li-Juan; Li, Xin-Cang; Qin, Qi-Wei; Chen, Nan; Lin, Li

2016-10-01

Tolls and Toll-like receptors (TLRs) play an important role in host immune defenses by regulating the expression of antimicrobial peptides (AMPs) and cytokines, but the functional differences of crustacean Tolls from Drosophila Tolls or Mammal TLRs are largely unknown. A novel Toll receptor, named PcToll3, was identified from red swamp crayfish, Procambarus clarkii. It was widely expressed in all detected tissues, and its transcript in hemocytes was up-regulated at 12 h after Vibrio parahemolyticus (Vibrio) injection or at 24 h post white spot syndrome virus (WSSV) challenge. After knockdown of PcToll3, the activity of bacterial clearance was inhibited, and the expression levels of AMPs including Crustin1 (Cru1), Anti-lippopolysaccharide factor 1 (ALF1), and Lysozymes1 (Lys1), which could be up-regulated by Vibrio, were all affected. Meanwhile, PcToll3 silencing influenced the expression of myeloid differentiation factor 88 (PcMyd88), tumor necrosis factor-associated factor 6 (PcTRAF6), and PcDorsal, which were the counterparts of Drosophila Toll signaling pathway. Interestingly, PcToll3 silencing inhibited translocation of PcDorsal from cytoplasm to nucleus. Furthermore, the knockdown of PcDorsal also impaired the expression of AMPs after Vibrio challenge. Hence, we concluded that, besides participating in antiviral immunity, PcToll3 might also regulate the expression of Cru1 and Lys1 to participate in anti-Vibrio immune responses by promoting PcDorsal translocation into nucleus. Copyright © 2016 Elsevier Ltd. All rights reserved.

Identification and characterization of two arasin-like peptides in red swamp crayfish Procambarus clarkii.

PubMed

Chai, Lian-Qin; Li, Wan-Wan; Wang, Xian-Wei

2017-11-01

Antimicrobial peptides (AMPs) are small effectors in host defense by directly targeting microorganisms or by indirectly modulating immune responses. In the present study, two arasin like AMPs, named as Pc-arasin1 and Pc-arasin2, were identified in red swamp crayfish Procambarus clarkii with sequence similarity to the arasins found in Hyas araneus. Both Pc-arasins consisted of signal peptide, N-terminal proline-rich region and C-terminal region containing four conserved cysteine residues. The similarity of two Pc-arasins was 44.44%, and Pc-arasin2 contained several additional residues in the N-terminus. Multiple alignment of arasin family suggested the conservation of the C-terminus and the variation of the N-terminus of Pc-arasins. Both AMPs were found hemocytes-specific, and the expression could be induced the challenge of bacteria, espeacially by the pathogenic bacterium Aeromonas hydrophila. Knockdown of each Pc-arasin expression by double strand RNA would suppress the host immunity against A. hydrophila, and the commercially synthetic Pc-arasins could rescue the knockdown consequence. Both synthetic peptide showed broad antimicrobial activity towards 3 Gram-positive bacterium and 3 Gram-negative bacterium, and the minimal inhibitory concentrations varied from 6.25 μM to 50 μM. These results presented new data about the sequence, expression and function of arasin family, and emphasized the role of this family in host immune response against bacterial pathogens. The characterization of Pc-arasins also provided potential of therapeutic agent development for disease control in aquaculture based on these two newly identified AMPs. Copyright © 2017 Elsevier Ltd. All rights reserved.

A three-dimensional flexible microprobe array for neural recording assembled through electrostatic actuation.

PubMed

Chen, Chang-Hsiao; Chuang, Shih-Chang; Su, Huan-Chieh; Hsu, Wei-Lun; Yew, Tri-Rung; Chang, Yen-Chung; Yeh, Shih-Rung; Yao, Da-Jeng

2011-05-07

We designed, fabricated and tested a novel three-dimensional flexible microprobe to record neural signals of a lateral giant nerve fiber of the escape circuit of an American crayfish. An electrostatic actuation folded planar probes into three-dimensional neural probes with arbitrary orientations for neuroscientific applications. A batch assembly based on electrostatic forces simplified the fabrication and was non-toxic. A novel fabrication for these three-dimensional flexible probes used SU-8 and Parylene technology. The mechanical strength of the neural probe was great enough to penetrate into a bio-gel. A flexible probe both decreased the micromotion and alleviated tissue encapsulation of the implant caused by chronic inflammation of tissue when an animal breathes or moves. The cortex consisted of six horizontal layers, and the neurons of the cortex were arranged in vertical structures; the three-dimensional microelectrode arrays were suitable to investigate the cooperative activity for neurons in horizontal separate layers and in vertical cortical columns. With this flexible probe we recorded neural signals of a lateral giant cell from an American crayfish. The response amplitude of action potentials was about 343 µV during 1 ms period; the average recorded data had a ratio of signal to noise as great as 30.22 ± 3.58 dB. The improved performance of this electrode made feasible the separation of neural signals according to their distinct shapes. The cytotoxicity indicated a satisfactory biocompatibility and non-toxicity of the flexible device fabricated in this work. © The Royal Society of Chemistry 2011

Rhabdomyolysis After Cooked Seafood Consumption (Haff Disease) in the United States vs China

PubMed Central

Diaz, James H.

2015-01-01

Background Haff disease is a syndrome of myalgia and rhabdomyolysis that occurs after eating cooked seafood. Methods For this descriptive analytical article, a literature search identified the scientific articles on Haff disease and/or rhabdomyolysis after eating cooked seafood in the United States and China. Analysis of those articles focused on identifying the seafood vectors of Haff disease, describing the most commonly recurring clinical and laboratory manifestations of Haff disease, and comparing the Haff disease toxidrome with other similar seafood-borne toxidromes. Statistically significant differences were determined using unpaired t tests and Fisher exact tests. Results Twenty-nine confirmed cases of Haff disease were identified in the United States, and 60 cases were identified in China during 1984-2014. Most of the US cases followed consumption of buffalo fish, and most of the Chinese cases followed consumption of freshwater pomfret. However, Haff disease also followed consumption of the same species of boiled crayfish (Procambarus clarkii) in the United States (n=9) and China (n=6). US patients with crayfish-transmitted Haff disease reported significantly more nausea with and without vomiting, chest pain, body and back pain, dyspnea, and diaphoresis than the Chinese patients and were more frequently misdiagnosed as having myocardial infarctions. Conclusion The bioaccumulation of a new, heat-stable freshwater and/or brackish/saltwater algal toxin, similar to palytoxin but primarily myotoxic and not neurotoxic, is suspected of causing Haff disease. At present, only the rapid identification of the seafood vectors of Haff disease will limit disease outbreaks and prevent further cases. PMID:26130980

Don't be Half-Educated About Haff Disease in Louisiana.

PubMed

Diaz, James

2015-01-01

Cases of Haff disease, a syndrome of severe myalgia and rhabdomyolysis, have been reported after eating cooked fish in Europe and the US. A retrospective review of US cases was conducted to identify seafood vectors, describe presenting manifestations, and compare the Haff disease toxidrome with other seafood-borne toxidromes. Internet search engines were queried to identify all US reports of Haff disease. The case definition of Haff disease required cooked seafood ingestion history within 24 hours and markedly elevated serum creatine kinase (CK) with CK-muscle/brain (MB) fraction < 5 percent. Twenty-six cases of Haff disease were reported in the US over 30 years, 1984-2014, with spring-summer occurrences. The mean age of cases was 54.8 years without gender difference. Most cases (58 percent) followed consumption of cooked buffalo fish, Ictiobus cyprinellus, (n = 15); other cases followed consumption of boiled crayfish in Louisiana (n = 9) and baked salmon in North Carolina (n = 2). California and Louisiana accounted for most cases (n = 18, p = 0.012). Following mean incubation periods of eight hours; the most common presenting manifestations included vomiting, myalgia, muscle rigidity, chest pain mimicking myocardial infarction, diaphoresis, dyspnea, and brown urine indicating myoglobinuria. Most patients recovered within 2-5 days. Haff disease may follow the consumption of freshwater buffalo fish, freshwater crayfish, and saltwater Atlantic salmon. The bioconcentration of a new, unidentified heat-stable, freshwater and/or brackish/saltwater algal myotoxin in seafood, similar to palytoxin, is suspected of causing Haff disease. Experimental animals fed toxic buffalo fish developed rhabdomyolysis with myoglobinuria.

Circulation of copper in the biotic compartments of a freshwater dammed reservoir.

PubMed

Vinot, I; Pihan, J C

2005-01-01

This study concerns a chronic copper release in an aquatic ecosystem: Mirgenbach reservoir; which is characterized by high salinity, conductivity and hardness, a eutrophic state and a high temperature. To study the bioavailability of copper in the biotic compartments, the sampling covered the entire food chain (phyto- and zooplankton, macroalgae, aquatic plants, crustaceans, mollusks, and fish). Of the organisms present, the filter feeder Dreissena polymorpha, the detritivorous Bithynia tentaculata and Orconectes limosus were most contaminated by copper. The level of copper found in fish was the lowest. Body copper concentrations recorded in the present study show large variability between species even in some that are closely related. In most cases, however, the metal handling strategy, feeding habits, morphology and ecology can, at least partially, explain the metal content recorded. Pollution factors have been used to assess the state of contamination of the food chain. This study showed finally that the copper in the lake is bioavailable and bioaccumulated by organisms up to high levels and some effects of long-term toxicity of copper on benthic community and planktonic biomass were pointed out.

Ohio Aquatic Gap Analysis-An Assessment of the Biodiversity and Conservation Status of Native Aquatic Animal Species

USGS Publications Warehouse

Covert, S. Alex; Kula, Stephanie P.; Simonson, Laura A.

2007-01-01

The goal of the GAP Analysis Program is to keep common species common by identifying those species and habitats that are not yet adequately represented in the existing matrix of conservation lands. The Gap Analysis Program (GAP) is sponsored by the Biological Resources Discipline of the U.S. Geological Survey (USGS). The Ohio Aquatic GAP (OH-GAP) is a pilot project that is applying the GAP concept to aquatic-specifically, riverine-data. The mission of GAP is to provide regional assessments of the conservation status of native animal species and to facilitate the application of this information to land-management activities. OH-GAP accomplished this through * mapping aquatic habitat types, * mapping the predicted distributions of fish, crayfish, and bivalves, * documenting the presence of aquatic species in areas managed for conservation, * providing GAP results to the public, planners, managers, policy makers, and researchers, and * building cooperation with multiple organizations to apply GAP results to state and regional management activities. Gap analysis is a coarse-scale assessment of aquatic biodiversity and conservation; the goal is to identify gaps in the conservation of native aquatic species. It is not a substitute for biological field studies and monitoring programs. Gap analysis was conducted for the continuously flowing streams in Ohio. Lakes, reservoirs, wetlands, and the Lake Erie islands were not included in this analysis. The streams in Ohio are in the Lake Erie and Ohio River watersheds and pass through six of the level III ecoregions defined by Omernik: the Eastern Corn Belt Plains, Southern Michigan/Northern Indiana Drift Plains, Huron/Erie Lake Plain, Erie Drift Plains, Interior Plateau, and the Western Allegheny Plateau. To characterize the aquatic habitats available to Ohio fish, crayfish, and bivalves, a classification system needed to be developed and mapped. The process of classification includes delineation of areas of relative homogeneity and labeling these areas using categories defined by the classification system. The variables were linked to the 1:100,000-scale streams of the National Hydrography Dataset of the USGS. Through discussions with Ohio aquatic experts, OH-GAP identified eight separate enduring physical features which, when combined, form the physical habitat type: * Shreve link (a measure of stream size) * Downstream Shreve link (a measure of stream connectivity and size) * Sinuosity * Gradient * Bedrock * Stream temperature * Character of glacial drift * Glacial-drift thickness Potential distribution models were developed for 130 fish, 70 bivalve, and 17 native crayfish species. These models are based on 5,686 fish, 4,469 crayfish, and 2,899 freshwater bivalve (mussels and clams) sampling locations, the variables describing the physical habitat types, and variables indicating the major drainage basins and Omernik's Level III ecoregion. All potential species distributions are displayed and analyzed at the 14-digit hydrologic unit (14-HUs), or subwatershed, level. Mainland Ohio contains 1,749 14-HUs. All statistics and conclusions, as well as spatial data, are discussed and presented in terms of these units. The Ohio Aquatic Gap Analysis Project compiled a map of public and private conservation lands and OH-GAP classified the lands into four status categories (status 1 through status 4) by the degree of protection offered based on management practices. A status of 1 denotes the highest, most permanent level of maintenance, and status 4 represents the lowest level of biodiversity management, or unknown status. The results of this mapping show that only about 3.7 percent of the state's land (4.3 percent if lakes and reservoirs are also included) is protected for conservation, either publicly or privately. Of this total, state agencies control about 52 percent, and Federal agencies control about 29 percent. Conservation areas that presently protect

Neuroprotective effects of Lepidium meyenii (Maca).

PubMed

Pino-Figueroa, Alejandro; Nguyen, Diane; Maher, Timothy J

2010-06-01

The neuroprotective activity of the plant Lepidium meyenii (Maca) was studied in two experimental models: in vitro and in vivo. Crayfish neurons were pretreated with vehicle or the pentane extract from Maca, subjected to H(2)O(2), and their viability determined microscopically and chemically. A significant concentration-neuroprotective effect relationship was demonstrated. The pentane extract was then administered intravenously to rats prior to and following middle cerebral artery occlusion. While infarct volumes were decreased for the lower dose, higher doses increased infarct volumes compared to controls. These results suggest a potential application of Maca as a neuroprotectant.

Prevalence of a potentially lethal parasite of wading birds in natural and agricultural wetlands in south Louisiana

USGS Publications Warehouse

Luent, Margaret C.; Collins, Melissa; Jeske, Clinton; Leberg, Paul

2012-01-01

Gambusia affinis (Western Mosquitofish) were sampled from 18 sites representing marsh, forested wetlands, and agricultural wetlands in south Louisiana to determine distribution and infection parameters of Eustrongylides ignotus, a potentially lethal nematode parasite of wading birds, (n = 400 per site). Overall, prevalence of infection was 0.3%, with significantly higher prevalence in agricultural wetlands than in marshes or swamps. Our findings are similar to work in Florida suggesting parasite prevalence is higher in disturbed wetlands, and suggest that birds foraging in crayfish ponds and rice fields may be at increased risk of exposure.

KSC-08pd4127

NASA Image and Video Library

2008-12-23

CAPE CANAVERAL, Fla. – A great egret preens its feathers while standing in the shallow water of a pond in the Merritt island National Wildlife Refuge, which borders NASA's Kennedy Space Center in Florida. The breed feeds alone, stalking fish, frogs, snakes and crayfish in shallow water. They inhabit freshwater and salt marshes, marshy ponds and tidal flats. The center shares a boundary with the refuge that includes salt-water estuaries, brackish marshes, hardwood hammocks and pine flatwoods. The diverse landscape provides habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. Photo credit: NASA/Jim Grossmann

Yolk proteins during ovary and egg development of mature female freshwater crayfish (Cherax quadricarinatus).

PubMed

Serrano-Pinto, Vania; Vazquez-Boucard, Celia; Villarreal-Colmenares, Humberto

2003-01-01

Vitellins from ovaries and eggs at different stages of development in freshwater crayfish (Cherax quadricarinatus) were examined by chromatography, PAGE and SDS-PAGE. With these methods, two forms of vitellin (Vt1 and Vt2) were observed in ovaries and eggs (stages I and V). In ovaries in secondary vitellogenesis, native molecular mass was 470 (Vt1) and 440 (Vt2) kDa. The electrophoretic pattern of the eggs proved to be more complex. The protein molecular mass depend on the development stage of the egg: stage I, 650 kDa (Vt1) and 440 kDa (Vt2); stage V, 390 kDa (Vt1) and 340 kDa (Vt2). The identified vitellins appear to be lipo-glycocarotenoprotein. A similar vitellin polypeptide composition was observed in the two forms of vitellin from ovaries and eggs in stage V. In ovaries the SDS-PAGE analysis showed four subunits with molecular weights of approximately 180, 120, 95 and 80 kDa (Vt1 and Vt2). The polypeptide composition in the two forms of vitellins in stage I and stage III eggs were different at 195, 190, 130 and 110 kDa (Vt1) and 116 and 107 kDa (Vt2). On the other hand, in stage V eggs, 110, 95, 87 and 75 kDa (Vt1 and Vt2) were identified. Two antibodies (Ab1 and Ab2) were prepared against the purified proteins of stage V eggs and their specificity was demonstrated by radial immunoprecipitation, and Western blotting analysis. Two forms of vitellins were also found in stage V eggs after chromatography on Sepharose CL-2B column and hydroxylapatite and polyacrylamide gel electrophoresis.

Understanding the dynamical control of animal movement

NASA Astrophysics Data System (ADS)

Edwards, Donald

2008-03-01

Over the last 50 years, neurophysiologists have described many neural circuits that transform sensory input into motor commands, while biomechanicians and behavioral biologists have described many patterns of animal movement that occur in response to sensory input. Attempts to link these two have been frustrated by our technical inability to record from the necessary neurons in a freely behaving animal. As a result, we don't know how these neural circuits function in the closed loop context of free behavior, where the sensory and motor context changes on a millisecond time-scale. To address this problem, we have developed a software package, AnimatLab (www.AnimatLab.com), that enables users to reconstruct an animal's body and its relevant neural circuits, to link them at the sensory and motor ends, and through simulation, to test their ability to reproduce appropriate patterns of the animal's movements in a simulated Newtonian world. A Windows-based program, AnimatLab consists of a neural editor, a body editor, a world editor, stimulus and recording facilities, neural and physics engines, and an interactive 3-D graphical display. We have used AnimatLab to study three patterns of behavior: the grasshopper jump, crayfish escape, and crayfish leg movements used in postural control, walking, reaching and grasping. In each instance, the simulation helped identify constraints on both nervous function and biomechanical performance that have provided the basis for new experiments. Colleagues elsewhere have begun to use AnimatLab to study control of paw movements in cats and postural control in humans. We have also used AnimatLab simulations to guide the development of an autonomous hexapod robot in which the neural control circuitry is downloaded to the robot from the test computer.

Evaluation of seven aquatic sampling methods for amphibians and other aquatic fauna

USGS Publications Warehouse

Gunzburger, M.S.

2007-01-01

To design effective and efficient research and monitoring programs researchers must have a thorough understanding of the capabilities and limitations of their sampling methods. Few direct comparative studies exist for aquatic sampling methods for amphibians. The objective of this study was to simultaneously employ seven aquatic sampling methods in 10 wetlands to compare amphibian species richness and number of individuals detected with each method. Four sampling methods allowed counts of individuals (metal dipnet, D-frame dipnet, box trap, crayfish trap), whereas the other three methods allowed detection of species (visual encounter, aural, and froglogger). Amphibian species richness was greatest with froglogger, box trap, and aural samples. For anuran species, the sampling methods by which each life stage was detected was related to relative length of larval and breeding periods and tadpole size. Detection probability of amphibians varied across sampling methods. Box trap sampling resulted in the most precise amphibian count, but the precision of all four count-based methods was low (coefficient of variation > 145 for all methods). The efficacy of the four count sampling methods at sampling fish and aquatic invertebrates was also analyzed because these predatory taxa are known to be important predictors of amphibian habitat distribution. Species richness and counts were similar for fish with the four methods, whereas invertebrate species richness and counts were greatest in box traps. An effective wetland amphibian monitoring program in the southeastern United States should include multiple sampling methods to obtain the most accurate assessment of species community composition at each site. The combined use of frogloggers, crayfish traps, and dipnets may be the most efficient and effective amphibian monitoring protocol. ?? 2007 Brill Academic Publishers.

Predator Diversity Effects in an Exotic Freshwater Food Web

PubMed Central

Naddafi, Rahmat; Rudstam, Lars G.

2013-01-01

Cascading trophic interactions are often defined as the indirect effects of a predator on primary producers through the effect of the predator on herbivores. These effects can be both direct through removal of herbivores [density-mediated indirect interactions (DMIIs)] or indirect through changes in the behavior of the herbivores [trait-mediated indirect interactions (TMIIs)]. How the relative importance of these two indirect interactions varies with predator diversity remains poorly understood. We tested the effect of predator diversity on both TMIIs and DMIIs on phytoplankton using two competitive invasive dreissenid mussel species (zebra mussel and quagga mussel) as the herbivores and combinations of one, two or all three species of the predators pumpkinseed sunfish, round goby, and rusty crayfish. Predators had either direct access to mussels and induced both TMII and DMII, or no direct access and induced only TMII through the presence of risk cues. In both sets of treatments, the predators induced a trophic cascade which resulted in more phytoplankton remaining with predators present than with only mussels present. The trophic cascade was weaker in three-predator and two-predator treatments than in one-predator treatments when predators had direct access to dreissenids (DMIIs and TMIIs). Crayfish had higher cascading effects on phytoplankton than both pumpkinseed and round goby. Increased predator diversity decreased the strength of DMIIs but had no effect on the strength of TMIIs. The strength of TMIIs was higher with zebra than quagga mussels. Our study suggests that inter-specific interference among predators in multi-species treatments weakens the consumptive cascading effects of predation on lower trophic levels whereas the importance of predator diversity on trait mediated effects depends on predator identity. PMID:23991126

Plastic Responses of a Sessile Prey to Multiple Predators: A Field and Experimental Study

PubMed Central

Hirsch, Philipp Emanuel; Cayon, David; Svanbäck, Richard

2014-01-01

Background Theory predicts that prey facing a combination of predators with different feeding modes have two options: to express a response against the feeding mode of the most dangerous predator, or to express an intermediate response. Intermediate phenotypes protect equally well against several feeding modes, rather than providing specific protection against a single predator. Anti-predator traits that protect against a common feeding mode displayed by all predators should be expressed regardless of predator combination, as there is no need for trade-offs. Principal Findings We studied phenotypic anti-predator responses of zebra mussels to predation threat from a handling-time-limited (crayfish) and a gape-size-limited (roach) predator. Both predators dislodge mussels from the substrate but diverge in their further feeding modes. Mussels increased expression of a non-specific defense trait (attachment strength) against all combinations of predators relative to a control. In response to roach alone, mussels showed a tendency to develop a weaker and more elongated shell. In response to crayfish, mussels developed a harder and rounder shell. When exposed to either a combination of predators or no predator, mussels developed an intermediate phenotype. Mussel growth rate was positively correlated with an elongated weaker shell and negatively correlated with a round strong shell, indicating a trade-off between anti-predator responses. Field observations of prey phenotypes revealed the presence of both anti-predator phenotypes and the trade-off with growth, but intra-specific population density and bottom substrate had a greater influence than predator density. Conclusions Our results show that two different predators can exert both functionally equivalent and inverse selection pressures on a single prey. Our field study suggests that abiotic factors and prey population density should be considered when attempting to explain phenotypic diversity in the wild. PMID:25517986

Facilitation through Buffer Saturation: Constraints on Endogenous Buffering Properties

PubMed Central

Matveev, Victor; Zucker, Robert S.; Sherman, Arthur

2004-01-01

Synaptic facilitation (SF) is a ubiquitous form of short-term plasticity, regulating synaptic dynamics on fast timescales. Although SF is known to depend on the presynaptic accumulation of Ca2+, its precise mechanism is still under debate. Recently it has been shown that at certain central synapses SF results at least in part from the progressive saturation of an endogenous Ca2+ buffer (Blatow et al., 2003), as proposed by Klingauf and Neher (1997). Using computer simulations, we study the magnitude of SF that can be achieved by a buffer saturation mechanism (BSM), and explore its dependence on the endogenous buffering properties. We find that a high SF magnitude can be obtained either by a global saturation of a highly mobile buffer in the entire presynaptic terminal, or a local saturation of a completely immobilized buffer. A characteristic feature of BSM in both cases is that SF magnitude depends nonmonotonically on the buffer concentration. In agreement with results of Blatow et al. (2003), we find that SF grows with increasing distance from the Ca2+ channel cluster, and increases with increasing external Ca2+, [Ca2+]ext, for small levels of [Ca2+]ext. We compare our modeling results with the experimental properties of SF at the crayfish neuromuscular junction, and find that the saturation of an endogenous mobile buffer can explain the observed SF magnitude and its supralinear accumulation time course. However, we show that the BSM predicts slowing of the SF decay rate in the presence of exogenous Ca2+ buffers, contrary to experimental observations at the crayfish neuromuscular junction. Further modeling and data are required to resolve this aspect of the BSM. PMID:15111389

State-changes in the swimmeret system: a neural circuit that drives locomotion

PubMed Central

Tschuluun, N.; Hall, W. M.; Mulloney, B.

2009-01-01

Summary The crayfish swimmeret system undergoes transitions between a silent state and an active state. In the silent state, no patterned firing occurs in swimmeret motor neurons. In the active state, bursts of spikes in power stroke motor neurons alternate periodically with bursts of spikes in return stroke motor neurons. In preparations of the isolated crayfish central nervous system (CNS), the temporal structures of motor patterns expressed in the active state are similar to those expressed by the intact animal. These transitions can occur spontaneously, in response to stimulation of command neurons, or in response to application of neuromodulators and transmitter analogues. We used single-electrode voltage clamp of power-stroke exciter and return-stroke exciter motor neurons to study changes in membrane currents during spontaneous transitions and during transitions caused by bath-application of carbachol or octopamine (OA). Spontaneous transitions from silence to activity were marked by the appearance of a standing inward current and periodic outward currents in both types of motor neurons. Bath-application of carbachol also led to the development of these currents and activation of the system. Using low Ca2+–high Mg2+ saline to block synaptic transmission, we found that the carbachol-induced inward current included a direct response by the motor neuron and an indirect component. Spontaneous transitions from activity to silence were marked by disappearance of the standing inward current and the periodic outward currents. Bath-application of OA led promptly to the disappearance of both currents, and silenced the system. OA also acted directly on both types of motor neurons to cause a hyperpolarizing outward current that would contribute to silencing the system. PMID:19880720

State-changes in the swimmeret system: a neural circuit that drives locomotion.

PubMed

Tschuluun, N; Hall, W M; Mulloney, B

2009-11-01

The crayfish swimmeret system undergoes transitions between a silent state and an active state. In the silent state, no patterned firing occurs in swimmeret motor neurons. In the active state, bursts of spikes in power stroke motor neurons alternate periodically with bursts of spikes in return stroke motor neurons. In preparations of the isolated crayfish central nervous system (CNS), the temporal structures of motor patterns expressed in the active state are similar to those expressed by the intact animal. These transitions can occur spontaneously, in response to stimulation of command neurons, or in response to application of neuromodulators and transmitter analogues. We used single-electrode voltage clamp of power-stroke exciter and return-stroke exciter motor neurons to study changes in membrane currents during spontaneous transitions and during transitions caused by bath-application of carbachol or octopamine (OA). Spontaneous transitions from silence to activity were marked by the appearance of a standing inward current and periodic outward currents in both types of motor neurons. Bath-application of carbachol also led to the development of these currents and activation of the system. Using low Ca(2+)-high Mg(2+) saline to block synaptic transmission, we found that the carbachol-induced inward current included a direct response by the motor neuron and an indirect component. Spontaneous transitions from activity to silence were marked by disappearance of the standing inward current and the periodic outward currents. Bath-application of OA led promptly to the disappearance of both currents, and silenced the system. OA also acted directly on both types of motor neurons to cause a hyperpolarizing outward current that would contribute to silencing the system.

A cytokine-like factor astakine accelerates the hemocyte production in Pacific oyster Crassostrea gigas.

PubMed

Li, Yiqun; Jiang, Shuai; Li, Meijia; Xin, Lusheng; Wang, Lingling; Wang, Hao; Qiu, Limei; Song, Linsheng

2016-02-01

Astakine has been reported to be a hematopoietic growth factor of prokineticin homolog firstly found in arthropods freshwater crayfish Pacifastacus leniusculus. In the present study, an astakine homologous gene was identified from Pacific oyster Crassostrea gigas (designated CgAstakine). The full length cDNA of CgAstakine encoded a polypeptide of 103 amino acids containing a prokineticin (PK) domain homologous to that in astakine from freshwater crayfish P. leniusculus. The deduced amino acid sequence of CgAstakine shared higher similarity with those of other invertebrate astakines than prokineticins from vertebrates. The mRNA of CgAstakine was highly expressed in hepatopancreas and adductor muscle of oyster, while the CgAstakine protein was mainly distributed in hepatopancreas, gill and hemocytes. The mRNA expression of CgAstakine in hemocytes was significantly increased (p < 0.01) and maintained at a high level from 3 h to 9 h after Vibrio anguillarum challenge. After the oyster hemocytes were incubated with 5 μg/mL recombinant CgAstakine protein (rCgAstakine) for 24 h in vitro, the proliferation of hemocytes was significantly increased to 1.89 fold of that in control group (p < 0.05). Moreover, the total count of oyster hemocytes was significantly upregulated (2.45 fold of that in control group, p < 0.05) at 12 h after the oysters were received an injection of rCgAstakine (0.5 μg/g). These results collectively indicated that CgAstakine could modulate the hemocytes proliferation both in vitro and in vivo, and probably involved in the hematopoietic process fighting against the invasion of foreign pathogens. Copyright © 2015 Elsevier Ltd. All rights reserved.

Cholesterol-Independent Effects of Methyl-β-Cyclodextrin on Chemical Synapses

PubMed Central

Ormerod, Kiel G.; Coorssen, Jens R.; Mercier, A. Joffre

2012-01-01

The cholesterol chelating agent, methyl-β-cyclodextrin (MβCD), alters synaptic function in many systems. At crayfish neuromuscular junctions, MβCD is reported to reduce excitatory junctional potentials (EJPs) by impairing impulse propagation to synaptic terminals, and to have no postsynaptic effects. We examined the degree to which physiological effects of MβCD correlate with its ability to reduce cholesterol, and used thermal acclimatization as an alternative method to modify cholesterol levels. MβCD impaired impulse propagation and decreased EJP amplitude by 40% (P<0.05) in preparations from crayfish acclimatized to 14°C but not from those acclimatized to 21°C. The reduction in EJP amplitude in the cold-acclimatized group was associated with a 49% reduction in quantal content (P<0.05). MβCD had no effect on input resistance in muscle fibers but decreased sensitivity to the neurotransmitter L-glutamate in both warm- and cold-acclimatized groups. This effect was less pronounced and reversible in the warm-acclimatized group (90% reduction in cold, P<0.05; 50% reduction in warm, P<0.05). MβCD reduced cholesterol in isolated nerve and muscle from cold- and warm-acclimatized groups by comparable amounts (nerve: 29% cold, 25% warm; muscle: 20% cold, 18% warm; P<0.05). This effect was reversed by cholesterol loading, but only in the warm-acclimatized group. Thus, effects of MβCD on glutamate-sensitivity correlated with its ability to reduce cholesterol, but effects on impulse propagation and resulting EJP amplitude did not. Our results indicate that MβCD can affect both presynaptic and postsynaptic properties, and that some effects of MβCD are unrelated to cholesterol chelation. PMID:22590538

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bean, Bruce Palmer

The effects of ether and halothane on membrane currents in the voltage clamped crayfish giant axon membrane were investigated. Concentrations of ether up to 300 mM and of halothane up to 32 mM had no effect on resting potential or leakage conductance. Ether and halothane reduced the size of sodium currents without changing the voltage dependence of the peak currents or their reversal potential. Ether and halothane also produced a reversible, dose-dependent speeding of sodium current decay at all membrane potentials. Ether reduced the time constants for inactivation, and also shifted the midpoint of the steady-state inactivation curve in themore » hyperpolarizing direction. Potassium currents were smaller with ether present, with no change in the voltage dependence of steady-state currents. The activation of potassium channels was faster with ether present. There was no apparent change in the capacitance of the crayfish giant axon membrane with ether concentrations of up to 100 mM. Experiments on sodium channel inactivation kinetics were performed using 4-aminopyridine to block potassium currents. Sodium currents decayed with a time course generally fit well by a single exponential. The time constant of decay was a steep function of voltage, especially in the negative resistance region of the peak current vs voltage relation.The time course of inactivation was very similar to that of the decay of the current at the same potential. The measurement of steady-state inactivation curves with different test pulses showed no shifts along the voltage asix. The voltage-dependence of the integral of sodium conductance was measured to test models of sodium channel inactivation in which channels must open before inactivating; the results appear inconsistent with some of the simplest cases of such models.« less

Expression of the reproductive female-specific vitellogenin gene in endocrinologically induced male and intersex Cherax quadricarinatus crayfish.

PubMed

Shechter, Asaf; Aflalo, Eliahu D; Davis, Claytus; Sagi, Amir

2005-07-01

In oviparous females, the synthesis of the yolk precursor vitellogenin is an important step in ovarian maturation and oocyte development. In decapod Crustacea, including the red-claw crayfish (Cherax quadricarinatus), this reproductive process is regulated by inhibitory neurohormones secreted by the endocrine X-organ-sinus gland (XO-SG) complex. In males, the C. quadricarinatus vitellogenin gene (CqVg), although present, is not expressed under normal conditions. We show here that endocrine manipulation by removal of the XO-SG complex from male animals induced CqVg transcription. The CqVg gene was expressed differentially during the molt cycle in these induced males: no expression was seen in the intermolt stages, but expression was occasionally detected in the premolt stages and always detected in the early postmolt stages. Relative quantitation with a real-time reverse transcriptase-polymerase chain reaction showed that expression of CqVg in induced early postmolt males was an order of magnitude lower than that in reproductive females, a finding that was consistent with RNA in situ hybridization results. The SDS-PAGE of high-density lipoproteins from the hemolymph of endocrinologically induced early postmolt males did not show the typical vitellogenin-related polypeptide profile found in reproductive females. On the other hand, removal of the XO-SG complex from intersex individuals, which are chromosomally female but functionally male and possess an arrested female reproductive system, induced the expression, translation, and release of CqVg products into the hemolymph, as was the case for vitellogenic females. The expression of CqVg in endocrinologically manipulated molting males and intersex animals provides an inducible model for the investigation and understanding of the endocrine regulation of CqVg expression and translation in Crustacea as well as the relationship between the endocrine axes regulating molt and reproduction.

Effects of urbanization on the distribution and abundance of amphibians and invasive species in southern California streams

USGS Publications Warehouse

Riley, S.P.D.; Busteed, G.T.; Kats, L.B.; Vandergon, T.L.; Lee, L.F.S.; Dagit, R.G.; Kerby, J.L.; Fisher, R.N.; Sauvajot, R.M.

2005-01-01

Urbanization negatively affects natural ecosystems in many ways, and aquatic systems in particular. Urbanization is also cited as one of the potential contributors to recent dramatic declines in amphibian populations. From 2000 to 2002 we determined the distribution and abundance of native amphibians and exotic predators and characterized stream habitat and invertebratecommunities in 35 streams in an urbanized landscape north of Los Angeles (U.S.A.). We measured watershed development as the percentage of area within each watershed occupied by urban land uses. Streams in more developed watersheds often had exotic crayfish (Procambarus clarkii) and fish, and had fewer native species such as California newts (Taricha torosa) and California treefrogs (Hyla cadaverina). These effects seemed particularly evident above 8% development, a result coincident with other urban stream studies that show negative impacts beginning at 10-15% urbanization. For Pacific treefrogs (H. regilla), the most widespread native amphibian, abundance was lower in the presence of exotic crayfish, although direct urbanization effects were not found. Benthic macroinvertebrate communities were also less diverse in urban streams, especially for sensitive species. Faunal community changes in urban streams may be related to changes in physical stream habitat, such as fewer pool and more run habitats and increased water depth and flow, leading to more permanent streams. Variation in stream permanence was particularly evident in 2002, a dry year when many natural streams were dry but urban streams were relatively unchanged. Urbanization has significantly altered stream habitat in this region and may enhance invasion by exotic species and negatively affect diversity and abundance of native amphibians. ??2005 Society for Conservation Biology.

Involvement of the PI3K/Akt/GSK3β pathway in photodynamic injury of neurons and glial cells

NASA Astrophysics Data System (ADS)

Komandirov, M. A.; Knyazeva, E. A.; Fedorenko, Y. P.; Rudkovskii, M. V.; Stetsurin, D. A.; Uzdensky, A. B.

2010-10-01

Photodynamic treatment causes intense oxidative stress and kills cells. It is currently used in neurooncology. However, along with tumor it damages surrounding healthy neuronal and glial cells. In order to study the possible role of the phosphatidylinositol 3-kinase/protein kinase Akt/glycogen synthase kinase-3β signaling pathway in photodynamic damage to normal neurons and glia, we used isolated crayfish stretch receptor that consists only of a single neuron surrounded by glial cells. It was photosensitized with alumophthalocyanine Photosens (100 nM). The laser diode (670nm, 0.4W/cm2) was used as a light source. Application of specific inhibitors of the enzymes involved in this pathway showed that phosphatidylinositol 3-kinase did not participate in photoinduced death of neurons and glia. Protein kinase Akt was involved in photoinduced necrosis but not in apoptosis of neurons and glia. Glycogen synthase kinase-3β participated in photoinduced apoptosis of glial cells and in necrosis of neurons. Therefore, the phosphatidylinositol 3-kinase/protein kinase Akt/glycogen synthase kinase-3β pathway was not involved as a whole in photodynamic injury of crayfish neurons and glial cells but its components, protein kinase Akt and glycogen synthase kinase-3β, independently and cell-specifically regulated photoinduced death of neurons and glial cells. These data showed that in this system necrosis was not non-regulated and catastrophic mode of cell death. It was controlled by some signaling proteins. The obtained results may be used for search of pharmacological agents that selectively modulate injury of normal neurons and glial cells during photodynamic therapy of brain tumors.

Involvement of the PI3K/Akt/GSK3β pathway in photodynamic injury of neurons and glial cells

NASA Astrophysics Data System (ADS)

Komandirov, M. A.; Knyazeva, E. A.; Fedorenko, Y. P.; Rudkovskii, M. V.; Stetsurin, D. A.; Uzdensky, A. B.

2011-03-01

Photodynamic treatment causes intense oxidative stress and kills cells. It is currently used in neurooncology. However, along with tumor it damages surrounding healthy neuronal and glial cells. In order to study the possible role of the phosphatidylinositol 3-kinase/protein kinase Akt/glycogen synthase kinase-3β signaling pathway in photodynamic damage to normal neurons and glia, we used isolated crayfish stretch receptor that consists only of a single neuron surrounded by glial cells. It was photosensitized with alumophthalocyanine Photosens (100 nM). The laser diode (670nm, 0.4W/cm2) was used as a light source. Application of specific inhibitors of the enzymes involved in this pathway showed that phosphatidylinositol 3-kinase did not participate in photoinduced death of neurons and glia. Protein kinase Akt was involved in photoinduced necrosis but not in apoptosis of neurons and glia. Glycogen synthase kinase-3β participated in photoinduced apoptosis of glial cells and in necrosis of neurons. Therefore, the phosphatidylinositol 3-kinase/protein kinase Akt/glycogen synthase kinase-3β pathway was not involved as a whole in photodynamic injury of crayfish neurons and glial cells but its components, protein kinase Akt and glycogen synthase kinase-3β, independently and cell-specifically regulated photoinduced death of neurons and glial cells. These data showed that in this system necrosis was not non-regulated and catastrophic mode of cell death. It was controlled by some signaling proteins. The obtained results may be used for search of pharmacological agents that selectively modulate injury of normal neurons and glial cells during photodynamic therapy of brain tumors.

Relative abundance and distribution of fishes within an established Area of Critical Environmental Concern, of the Amargosa River Canyon and Willow Creek, Inyo and San Bernardino Counties, California

USGS Publications Warehouse

Scoppettone, G. Gary; Hereford, Mark E.; Rissler, Peter H.; Johnson, Danielle M.; Salgado, Antonio

2011-01-01

The Amargosa River Canyon of San Bernardino and Inyo County, California, has been designated by the Bureau of Land Management as an Area of Critical Environmental Concern, due in part to its unique flora and fauna. As a task of the Area of Critical Environmental Concern implementation plan, a survey of native fishes was conducted from June 21 to August 12, 2010. Geographic Information System tools were used to map sampling locations, which were spaced at 50-meter intervals. Global Positioning Systems were used to locate sampling stations, and stations with adequate water for successful trapping were sampled with baited minnow traps. Amargosa River pupfish (Cyprinodon nevadensis amargosae) and speckled dace (Rhinichthys osculus spp.) were widespread throughout Armargosa River Canyon. Throughout the study area 8,558 pupfish were captured at 194 stations; 3,472 speckled dace were captured at 210 stations; 238 red-swamp crayfish (Procambarus clarkia) were captured at 83 stations; and 1,095 western mosquitofish (Gambusia affinus) were captured at 110 stations. Pupfish were most abundant in open water habitat with native riparian vegetation, and they were significantly less abundant where the stream was completely covered by cattails or where saltcedar (Tamarix sp.) dominated the riparian corridor. There was no relationship between stream cover and speckled dace distribution. Non-native western mosquitofish and red-swamp crayfish densities were significantly higher in stream reaches dominated by saltcedar. The continued spread of saltcedar threatens to negatively affect pupfish and potentially reduce speckled dace abundance throughout the Amargosa River Canyon. This study can serve as baseline information for observing native fish populations in the future, as related to potential changes to the Amargosa River Canyon ecosystem.

Food of alewives, yellow perch, spottail shiners, trout-perch, and slimy and fourhorn sculpins in southeastern Lake Michigan

USGS Publications Warehouse

Wells, LaRue

1980-01-01

Stomachs of 1,064 alewives (Alosa pseudoharengus), 1,103 yellow perch (Perca flavescens), 246 spottail shiners (Notropis hudsonius), 288 trout-perch (Percopsis omiscomaycus), 454 slimy sculpins (Cottus cognatus), and 562 fourhorn sculpins (Myoxocephalus quadricornis) from Lake Michigan were examined for food contents. Fish were sampled primarily from March to November and nearly all were caught at the bottom in the southeastern part of the lake near Saugatuck, Michigan. Depths of capture (m) were: alewives, 5 to 110; yellow perch, 5 to 26; spottail shiners, 5 to 31; trout-perch, 9 to 46; slimy sculpins, 31 to 91; and fourhorn sculpins, 73 to 110. Alewives, particularly those less than 140 mm long, fed chiefly on zooplankton; Pontoporeia usually constituted most of the rest of the food, although Mysis and immature midges were occasionally eaten in considerable quantity. Yellow perch ate primarily Pontoporeia, fish eggs, Mysis, and crayfish; Pontoporeia was consumed most heavily by perch less than 250 mm long and those in relatively deep water, fish (mainly slimy sculpins) by those 200 mm long or longer, Mysis by those in deep water, and crayfish by those on rocky bottom. Spottail shiners fed most commonly on immature midges, Pontoporeia, zooplankton, fingernail clams, and (in July only) fish eggs; immature midges were eaten mainly by shiners in shallow water; and Pontoporeia by those in deeper areas. The diet of trout-perch was strongly dominated by Pontoporeia and immature midges. Slimy sculpins ate Pontoporeia almost exclusively. Fourhorn sculpins fed almost entirely on Mysis and Pontoporeia; Pontoporeia was particularly important in the diet of the larger fish.

[Russian and foreign legal-standards bases for guaranteeing the parasitic safety of raw produce and food products].

PubMed

Lovgalev, A S

1998-01-01

The paper analyzes the standard legal and methodological assurance of the quality and safety of animal food raw materials and foodstuffs (meat, meat products, fish, shellfish, crayfish and their processing products) by the parasitic purity rates according the requirements under the Russian Federation's laws "On Sanitary and Epidemiological Well-Being of the Population", "On Protection of Consumer's Rights", "On Certification of Products and Services", those of SanPiN, such as 2.3.2.560-96 "Sanitary Requirements for the Quality and Safety of Food Raw Materials and Foodstuffs" and 3.2.569-96 "Prevention of Parasitic Diseases in the Russian Federation".

Late summer food habits of three heron species in northeastern Louisiana

USGS Publications Warehouse

Niethammer, K.R.; Kaiser, M.S.

1983-01-01

Yellow-crowned Night-Herons (Nycticorax violaceus), Little Blue Herons (Egretta caerulea), and Green-backed Herons (Butorides striatus) collected in northeastern Louisiana from July-September 1980 exhibited different diets. Yellow-crowned Night-Herons fed mostly on crayfish (74% by weight) and Green-backed Herons fed primarily on fish (93% by weight). The diet of Little Blue Herons was diverse, including fish (61%), crustaceans (11%), insects (13%), and arachnids (14%). Yellow-crowned Night-Herons captured larger prey than did either of the smaller herons. Green-backed Herons took larger prey and a greater range of prey sizes than did the larger Little Blue Herons.

Cherax snowden, a new species of crayfish (Crustacea, Decapoda, Parastacidae) from the Kepala Burung (Vogelkop) Peninsula in Irian Jaya (West Papua), Indonesia

PubMed Central

Lukhaup, Christian; Panteleit, Jörn; Schrimpf, Anne

2015-01-01

Abstract A new species, Cherax snowden sp. n., from the Oinsok River Drainage, Sawiat District in the central part of the Kepala Burung (Vogelkop) Peninsula, West Papua, Indonesia, is described, figured and compared with the closest related species, Cherax holthuisi Lukhaup & Pekny, 2006. This species is collected and exported for ornamental purposes and its commercial name in the pet trade is “orange tip” or “green orange tip”. Both species may be easily distinguished morphologically or by using sequence divergence, which is substantial, for considering Cherax snowden sp. n. to be a new species. PMID:26448698

KSC-08pd4121

NASA Image and Video Library

2008-12-22

CAPE CANAVERAL, Fla. – Near NASA's Kennedy Space Center in Florida, a pied-billed Grebe swims on a pond in the Merritt island National Wildlife Refuge. The normal black band on its bill is lacking in winter. The most common grebe in eastern North America, the pied-billed Grebe inhabits marshes and ponds, eating small fish, crustaceans, especially crayfish, and aquatic insects. The center shares a boundary with the refuge that includes salt-water estuaries, brackish marshes, hardwood hammocks and pine flatwoods. The diverse landscape provides habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. Photo credit: NASA/Jim Grossmann

Proteomic analysis of the crayfish gastrolith chitinous extracellular matrix reveals putative protein complexes and a central role for GAP 65.

PubMed

Glazer, Lilah; Roth, Ziv; Weil, Simy; Aflalo, Eliahu D; Khalaila, Isam; Sagi, Amir

2015-10-14

Chitin is a major component of arthropod cuticles, where it forms a three-dimensional network that constitutes the scaffold upon which cuticles form. The chitin fibers that form this network are closely associated with specific structural proteins, while the cuticular matrix contains many additional structural, enzymatic and other proteins. We study the crayfish gastrolith as a simple model for the assembly of calcified cuticular structures, with particular focus on the proteins involved in this process. The present study integrates a gastrolith-forming epithelium transcriptomic library with data from mass spectrometry analysis of proteins extracted from the gastrolith matrix to obtain a near-complete picture of gastrolith protein content. Using native protein separation we identified 24 matrix proteins, of which 14 are novel. Further analysis led to discovery of three putative protein complexes, all containing GAP 65 the most abundant gastrolith structural protein. Using immunological methods we further studied the role of GAP 65 in the gastrolith matrix and forming epithelium, as well as in the newly identified protein complexes. We propose that gastrolith matrix construction is a sequential process in which protein complexes are dynamically assembled and disassembled around GAP 65, thus changing their functional properties to perform each step in the construction process. The scientific interest on which this study is based arises from three main features of gastroliths: (1) Gastroliths possess partial analogy to cuticles both in structural and molecular properties, and may be regarded, with the appropriate reservations (see Introduction), as simple models for cuticle assembly. At the same time, gastroliths are terminally assembled during a well-defined period, which can be controlled in the laboratory, making them significantly easier to study than cuticles. (2) Gastroliths, like the crayfish exoskeleton, contain stable amorphous calcium carbonate (ACC) rather than crystalline calcite. The biological mechanism for the stabilization of a naturally unstable, but at the same time biologically highly available, calcium carbonate polymorph is of great interest from the pharmaceutical point of view. (3) The gastrolith organic matrix is based on a highly structured chitin network that interacts with a variety of substances. This biologically manipulated, biodegradable structure is in itself of biotechnological and pharmaceutical potential. A growing body of evidence indicates that proteins play central roles in all above aspects of gastrolith construction. This study offers the first comprehensive screening of gastrolith proteins, and we believe that the analysis presented in this work can not only help reveal basic biological questions regarding assembly of mineralized and non-mineralized cuticular structures, but may also serve as basis for applied research in the fields of agriculture (e.g. cuticle-based pest management), health (e.g. bioavailable calcium supplements and biodegradable drug carriers) and materials science (e.g. non-toxic scaffolds for water purification). Copyright © 2015. Published by Elsevier B.V.

FURTHER STUDY OF SOMA, DENDRITE, AND AXON EXCITATION IN SINGLE NEURONS

PubMed Central

Eyzaguirre, Carlos; Kuffler, Stephen W.

1955-01-01

The present investigation continues a previous study in which the soma-dendrite system of sensory neurons was excited by stretch deformation of the peripheral dendrite portions. Recording was done with intracellular leads which were inserted into the cell soma while the neuron was activated orthodromically or antidromically. The analysis was also extended to axon conduction. Crayfish, Procambarus alleni (Faxon) and Orconectes virilis (Hagen), were used. 1. The size and time course of action potentials recorded from the soma-dendrite complex vary greatly with the level of the cell's membrane potential. The latter can be changed over a wide range by stretch deformation which sets up a "generator potential" in the distal portions of the dendrites. If a cell is at its resting unstretched equilibrium potential, antidromic stimulation through the axon causes an impulse which normally overshoots the resting potential and decays into an afternegativity of 15 to 20 msec. duration. The postspike negativity is not followed by an appreciable hyperpolarization (positive) phase. If the membrane potential is reduced to a new steady level a postspike positivity appears and increases linearly over a depolarization range of 12 to 20 mv. in various cells. At those levels the firing threshold of the cell for orthodromic discharges is generally reached. 2. The safety factor for conduction between axon and cell soma is reduced under three unrelated conditions, (a) During the recovery period (2 to 3 msec.) immediately following an impulse which has conducted fully over the cell soma, a second impulse may be delayed, may invade the soma partially, or may be blocked completely. (b) If progressive depolarization is produced by stretch, it leads to a reduction of impulse height and eventually to complete block of antidromic soma invasion, resembling cathodal block, (c) In some cells, when the normal membrane potential is within several millivolts of the relaxed resting state, an antidromic impulse may be blocked and may set up within the soma a local potential only. The local potential can sum with a second one or it may sum with potential changes set up in the dendrites, leading to complete invasion of the soma. Such antidromic invasion block can always be relieved by appropriate stretch which shifts the membrane potential out of the "blocking range" nearer to the soma firing level. During the afterpositivity of an impulse in a stretched cell the membrane potential may fall below or near the blocking range. During that period another impulse may be delayed or blocked. 3. Information regarding activity and conduction in dendrites has been obtained indirectly, mainly by analyzing the generator action under various conditions of stretch. The following conclusions have been reached: The large dendrite branches have similar properties to the cell body from which they arise and carry the same kind of impulses. In the finer distal filaments of even lightly depolarized dendrites, however, no axon type all-or-none conduction occurs since the generator potential persists to a varying degree during antidromic invasion of the cell. With the membrane potential at its resting level the dendrite terminals contribute to the prolonged impulse afternegativity of the soma. 4. Action potentials in impaled axons and in cell bodies have been compared. It is thought that normally the over-all duration of axon impulses is shorter. Local activity during reduction of the safety margin for conduction was studied. 5. An analysis was made of high frequency grouped discharges which occasionally arise in cells. They differ in many essential aspects from the regular discharges set up by the generator action. It is proposed that grouped discharges occur only when invasion of dendrites is not synchronous, due to a delay in excitation spread between soma and dendrites. Each impulse in a group is assumed to be caused by an impulse in at least one of the large dendrite branches. Depolarization of dendrites abolishes the grouped activity by facilitating invasion of the large dendrite branches. PMID:13252238

Chitin: Formation of Helically Structured Chitin/CaCO3 Hybrids through an Approach Inspired by the Biomineralization Processes of Crustacean Cuticles (Small 38/2015).

PubMed

Matsumura, Shunichi; Kajiyama, Satoshi; Nishimura, Tatsuya; Kato, Takashi

2015-10-01

Biomineral-inspired hybrids forming helically ordered structures are developed by T. Kato and co-workers on page 5127. These helical hybrids consist of liquid-crystalline chitin and CaCO3 . They resemble the structures of crustacean cuticles such as the exoskeleton of a lobster or crayfish. These hybrids are formed through CaCO3 crystallization on the liquidcrystalline chitin templates. Polymer-stabilized amorphous CaCO3 is incorporated into the liquid-crystalline chitin templates. This approach is useful for the development of new hierarchical hybrid materials from abundant natural resources. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The functional organization of the crayfish lamina ganglionaris. I. Nonspiking monopolar cells.

PubMed

Wang-Bennett, L T; Glantz, R M

1987-06-01

The light responses of the second order lamina monopolar neurons were examined in the crayfish compound eye. Single cartridge monopolar neurons (M1-M4) exhibited nonspiking hyperpolarizing light responses; for M1, M3 and M4 the transient 'on' response operated over the same intensity range as the receptor, 3.5 log units. M2 operated in a much narrower intensity range (1.5 log unit). The 'on' responses were associated with a 19% increase in conductance. The hyperpolarizing 'on' response can be reversed at 18 mV below the resting membrane potential. The half-angular sensitivity width of monopolar cells (in partially dark-adapted eyes) is 15 degrees X 8 degrees (horizontal by vertical). Off axis stimuli elicit attenuated hyperpolarizing responses associated with a diminished conductance increase or depolarizing responses associated with a net decrease in conductance. The latter result is consistent with the presynaptic inhibition of a 'back-ground' transmitter release which normally persists in the dark. Lateral inhibition is elicited from the area immediately surrounding the excitatory field, and it is associated with diminished transient responses and an accelerated decay of the response. Inhibitory stimuli decrease the conductance change associated with the hyperpolarizing response. The surround stimuli can also elicit depolarizing 'off' responses with reversal potentials positive to the membrane resting potential. It is concluded that the rapidly repolarizing monopolar cell response is modulated by both pre- and postsynaptic inhibitory mechanisms. A compartment model indicates that signal attenuation along a 500 microns length of monopolar cell axon is 22-34%. Simulation of steady-state signal transmission suggests that passive (decremental) conduction is sufficient to convey 66 to 78% of the monopolar cell signal from lamina to medulla. The current-voltage relation in current clamp is linear over the physiological operating range, and there is no evidence for rectification. Hyperpolarization of single monopolar cells (M1-M4) provides a polysynaptic excitatory signal to the medullary sustaining fibers.

The development of 10 novel polymorphic microsatellite markers through next generation sequencing and a preliminary population genetic analysis for the endangered Glenelg spiny crayfish, Euastacus bispinosus.

PubMed

Miller, Adam D; Van Rooyen, Anthony; Sweeney, Oisín F; Whiterod, Nick S; Weeks, Andrew R

2013-07-01

The Glenelg spiny crayfish, Euastacus bispinosus, is an iconic freshwater invertebrate of south eastern Australia and listed as 'endangered' under the Environment Protection and Biodiversity Conservation Act 1999, and 'vulnerable' under the International Union for Conservation of Nature's Red List. The species has suffered major population declines as a result of over-fishing, low environmental flows, the introduction of invasive fish species and habitat degradation. In order to develop an effective conservation strategy, patterns of gene flow, genetic structure and genetic diversity across the species distribution need to be clearly understood. In this study we develop a suite of polymorphic microsatellite markers by next generation sequencing. A total of 15 polymorphic loci were identified and 10 characterized using 22 individuals from the lower Glenelg River. We observed low to moderate genetic variation across most loci (mean number of alleles per locus = 2.80; mean expected heterozygosity = 0.36) with no evidence of individual loci deviating significantly from Hardy-Weinberg equilibrium. Marker independence was confirmed with tests for linkage disequilibrium, and analyses indicated no evidence of null alleles across loci. Individuals from two additional sites (Crawford River, Victoria; Ewens Ponds Conservation Park, South Australia) were genotyped at all 10 loci and a preliminary investigation of genetic diversity and population structure was undertaken. Analyses indicate high levels of genetic differentiation among sample locations (F ST = 0.49), while the Ewens Ponds population is genetically homogeneous, indicating a likely small founder group and ongoing inbreeding. Management actions will be needed to restore genetic diversity in this and possibly other at risk populations. These markers will provide a valuable resource for future population genetic assessments so that an effective framework can be developed for implementing conservation strategies for E. bispinosus.

Comparative molecular analyses of select pH- and osmoregulatory genes in three freshwater crayfish Cherax quadricarinatus, C. destructor and C. cainii.

PubMed

Ali, Muhammad Y; Pavasovic, Ana; Dammannagoda, Lalith K; Mather, Peter B; Prentis, Peter J

2017-01-01

Systemic acid-base balance and osmotic/ionic regulation in decapod crustaceans are in part maintained by a set of transport-related enzymes such as carbonic anhydrase (CA), Na + /K + -ATPase (NKA), H + -ATPase (HAT), Na + /K + /2Cl - cotransporter (NKCC), Na + /Cl - /HCO[Formula: see text] cotransporter (NBC), Na + /H + exchanger (NHE), Arginine kinase (AK), Sarcoplasmic Ca +2 -ATPase (SERCA) and Calreticulin (CRT). We carried out a comparative molecular analysis of these genes in three commercially important yet eco-physiologically distinct freshwater crayfish , Cherax quadricarinatus, C. destructor and C. cainii , with the aim to identify mutations in these genes and determine if observed patterns of mutations were consistent with the action of natural selection. We also conducted a tissue-specific expression analysis of these genes across seven different organs, including gills, hepatopancreas, heart, kidney, liver, nerve and testes using NGS transcriptome data. The molecular analysis of the candidate genes revealed a high level of sequence conservation across the three Cherax sp. Hyphy analysis revealed that all candidate genes showed patterns of molecular variation consistent with neutral evolution. The tissue-specific expression analysis showed that 46% of candidate genes were expressed in all tissue types examined, while approximately 10% of candidate genes were only expressed in a single tissue type. The largest number of genes was observed in nerve (84%) and gills (78%) and the lowest in testes (66%). The tissue-specific expression analysis also revealed that most of the master genes regulating pH and osmoregulation (CA, NKA, HAT, NKCC, NBC, NHE) were expressed in all tissue types indicating an important physiological role for these genes outside of osmoregulation in other tissue types. The high level of sequence conservation observed in the candidate genes may be explained by the important role of these genes as well as potentially having a number of other basic physiological functions in different tissue types.

Increasing Potential Risk of a Global Aquatic Invader in Europe in Contrast to Other Continents under Future Climate Change

PubMed Central

Liu, Xuan; Guo, Zhongwei; Ke, Zunwei; Wang, Supen; Li, Yiming

2011-01-01

Background Anthropogenically-induced climate change can alter the current climatic habitat of non-native species and can have complex effects on potentially invasive species. Predictions of the potential distributions of invasive species under climate change will provide critical information for future conservation and management strategies. Aquatic ecosystems are particularly vulnerable to invasive species and climate change, but the effect of climate change on invasive species distributions has been rather neglected, especially for notorious global invaders. Methodology/Principal Findings We used ecological niche models (ENMs) to assess the risks and opportunities that climate change presents for the red swamp crayfish (Procambarus clarkii), which is a worldwide aquatic invasive species. Linking the factors of climate, topography, habitat and human influence, we developed predictive models incorporating both native and non-native distribution data of the crayfish to identify present areas of potential distribution and project the effects of future climate change based on a consensus-forecast approach combining the CCCMA and HADCM3 climate models under two emission scenarios (A2a and B2a) by 2050. The minimum temperature from the coldest month, the human footprint and precipitation of the driest quarter contributed most to the species distribution models. Under both the A2a and B2a scenarios, P. clarkii shifted to higher latitudes in continents of both the northern and southern hemispheres. However, the effect of climate change varied considerately among continents with an expanding potential in Europe and contracting changes in others. Conclusions/Significance Our findings are the first to predict the impact of climate change on the future distribution of a globally invasive aquatic species. We confirmed the complexities of the likely effects of climate change on the potential distribution of globally invasive species, and it is extremely important to develop wide-ranging and effective control measures according to predicted geographical shifts and changes. PMID:21479188

Phylogeny and Evolutionary Patterns in the Dwarf Crayfish Subfamily (Decapoda: Cambarellinae)

PubMed Central

Pedraza-Lara, Carlos; Doadrio, Ignacio; Breinholt, Jesse W.; Crandall, Keith A.

2012-01-01

The Dwarf crayfish or Cambarellinae, is a morphologically singular subfamily of decapod crustaceans that contains only one genus, Cambarellus. Its intriguing distribution, along the river basins of the Gulf Coast of United States (Gulf Group) and into Central México (Mexican Group), has until now lacked of satisfactory explanation. This study provides a comprehensive sampling of most of the extant species of Cambarellus and sheds light on its evolutionary history, systematics and biogeography. We tested the impact of Gulf Group versus Mexican Group geography on rates of cladogenesis using a maximum likelihood framework, testing different models of birth/extinction of lineages. We propose a comprehensive phylogenetic hypothesis for the subfamily based on mitochondrial and nuclear loci (3,833 bp) using Bayesian and Maximum Likelihood methods. The phylogenetic structure found two phylogenetic groups associated to the two main geographic components (Gulf Group and Mexican Group) and is partially consistent with the historical structure of river basins. The previous hypothesis, which divided the genus into three subgenera based on genitalia morphology was only partially supported (P = 0.047), resulting in a paraphyletic subgenus Pandicambarus. We found at least two cases in which phylogenetic structure failed to recover monophyly of recognized species while detecting several cases of cryptic diversity, corresponding to lineages not assigned to any described species. Cladogenetic patterns in the entire subfamily are better explained by an allopatric model of speciation. Diversification analyses showed similar cladogenesis patterns between both groups and did not significantly differ from the constant rate models. While cladogenesis in the Gulf Group is coincident in time with changes in the sea levels, in the Mexican Group, cladogenesis is congruent with the formation of the Trans-Mexican Volcanic Belt. Our results show how similar allopatric divergence in freshwater organisms can be promoted through diverse vicariant factors. PMID:23155379

The Lipopolysaccharide and β-1,3-Glucan Binding Protein Gene Is Upregulated in White Spot Virus-Infected Shrimp (Penaeus stylirostris)

PubMed Central

Roux, Michelle M.; Pain, Arnab; Klimpel, Kurt R.; Dhar, Arun K.

2002-01-01

Pattern recognition proteins such as lipopolysaccharide and β-1,3-glucan binding protein (LGBP) play an important role in the innate immune response of crustaceans and insects. Random sequencing of cDNA clones from a hepatopancreas cDNA library of white spot virus (WSV)-infected shrimp provided a partial cDNA (PsEST-289) that showed similarity to the LGBP gene of crayfish and insects. Subsequently full-length cDNA was cloned by the 5′-RACE (rapid amplification of cDNA ends) technique and sequenced. The shrimp LGBP gene is 1,352 bases in length and is capable of encoding a polypeptide of 376 amino acids that showed significant similarity to homologous genes from crayfish, insects, earthworms, and sea urchins. Analysis of the shrimp LGBP deduced amino acid sequence identified conserved features of this gene family including a potential recognition motif for β-(1→3) linkage of polysaccharides and putative RGD cell adhesion sites. It is known that LGBP gene expression is upregulated in bacterial and fungal infection and that the binding of lipopolysaccharide and β-1,3-glucan to LGBP activates the prophenoloxidase (proPO) cascade. The temporal expression of LGBP and proPO genes in healthy and WSV-challenged Penaeus stylirostris shrimp was measured by real-time quantitative reverse transcription-PCR, and we showed that LGBP gene expression in shrimp was upregulated as the WSV infection progressed. Interestingly, the proPO expression was upregulated initially after infection followed by a downregulation as the viral infection progressed. The downward trend in the expression of proPO coincided with the detection of WSV in the infected shrimp. Our data suggest that shrimp LGBP is an inducible acute-phase protein that may play a critical role in shrimp-WSV interaction and that the WSV infection regulates the activation and/or activity of the proPO cascade in a novel way. PMID:12072514

Physico-chemical properties of instant ogbono (Irvingia gabonensis) mix powder

PubMed Central

Bamidele, Oluwaseun P; Ojedokun, Omotayo S; Fasogbon, Beatrice M

2015-01-01

The main objective of the research is to develop a recipe of instant dry soup mix for easy preparation of ogbono soup. Instant ogbono mix powder was processed using common locally ingredients. Dika kernel powder, dried ugwu leaf, crayfish, stock fish, and a mixture of locust bean, onion, seasoning and Cameroon powder were formulated at different ratios to find the best acceptable ogbono mix powder. The samples were subjected to proximate, functional, vitamin, mineral, and sensory analyses. The formulated sample D with the highest ratio of crayfish and stock fish had the highest value of protein and carbohydrate (24.13 and 35.61%, respectively). The control sample (100% dika kernel powder) was low in moisture content (6.20%) but high in crude fat, other samples followed in this order (control > A > B > C > D) for crude fat. Ash, crude fiber, and carbohydrate showed a significant difference (P < 0.05) in all the samples. The functional properties of the sample showed a significant difference (P < 0.05) in all the samples with the control having the highest value for the water absorption, swelling capacity, and bulk density which may be due to the high crude fiber and low moisture content recorded for the control sample in the proximate analysis. The mineral content of all the samples were higher than the control with phosphorous having the highest value and iron the least value. Vitamin C was the main dominating vitamin in the sample followed by vitamin B2, vitamin A, and vitamin B3. The sensory evaluation revealed that 100% dika kernel powder gave a good attribute of the soup but with less nutritional composition, while some formulated samples showed a similar attribute with higher nutritional value. Sample A with the highest overall acceptability had the best attribute of ogbono soup. Instant ogbono mix powder has higher nutritional value and easy to cook. PMID:26288723

Faunal assemblages and multi-scale habitat patterns in headwater tributaries of the South Fork Trinity River - an unregulated river embedded within a multiple-use landscape

USGS Publications Warehouse

Welsh, H.H.; Hodgson, G.R.; Duda, J.J.; Emlen, J.M.

2010-01-01

Headwaters can represent 80% of stream kilometers in a watershed, and they also have unique physical and biological properties that have only recently been recognized for their importance in sustaining healthy functioning stream networks and their ecological services. We sampled 60 headwater tributaries in the South Fork Trinity River, a 2,430 km2, mostly forested, multiple-use watershed in northwestern California. Our objectives were: (1) to differentiate unique headwater types using 69 abiotic and vegetation variables measured at three spatial scales, and then to reduce these to informative subsets; (2) determine if distinct biota occupied the different tributary types; (3) determine the environmental attributes associated with the presence and abundance of these biotic assemblages; and (4) using niche modeling, determine key attribute thresholds to illustrate how these biota could be employed as metrics of system integrity and ecological services. Several taxa were sufficiently abundant and widespread to use as bio-indicators: the presence and abundance of steelhead trout (Oncorhynchus mykiss), herpetofauna (reptile and amphibian) species richness, and signal crayfish (Pacifastacus leniusculus) represented different trophic positions, value as commercial resources (steelhead), sensitivity to environmental stress (amphibians), and indicators of biodiversity (herpetofauna species richness). Herpetofauna species richness did not differ, but abundances of steelhead trout, signal crayfish, and amphibian richness all differed significantly among tributary types. Niche models indicated that distribution and abundance patterns in both riparian and aquatic environments were associated with physical and structural attributes at multiple spatial scales, both within and around reaches. The bio-indicators responded to unique sets of attributes, reflecting the high environmental heterogeneity in headwater tributaries across this large watershed. These niche attributes represented a wide range of headwater environments, indicating responses to a number of natural and anthropogenic conditions, and demonstrated the value of using a suite of bio-indicators to elucidate watershed conditions, and to examine numerous disturbances that may influence ecological integrity.

How to Make a Beetle Out of Wood: Multi-Elemental Stoichiometry of Wood Decay, Xylophagy and Fungivory

PubMed Central

Filipiak, Michał; Weiner, January

2014-01-01

The majority of terrestrial biomass is wood, but the elemental composition of its potential consumers, xylophages, differs hugely from that of wood. This causes a severe nutritional imbalance. We studied the stoichiometric relationships of 11 elements (C, N, P, K, Ca, Mg, Fe, Zn, Mn, Cu, Na) in three species of pine-xylem-feeding insects, Stictoleptura rubra, Arhopalus rusticus (Coleoptera, Cerambycidae) and Chalcophora mariana (Coleoptera, Buprestidae), to elucidate their mechanisms of tissue growth and to match their life histories to their dietary constraints. These beetles do not differ from other Coleoptera in their absolute elemental compositions, which are approximately 1000 (N), 100 (P, Cu) and 50 (K, Na) times higher than in dead but undecayed pine wood. This discrepancy diminishes along the wood decay gradient, but the elemental concentrations remain higher by an order of magnitude in beetles than in highly decayed wood. Numerical simulation of the life history of S. rubra shows that feeding on nutrient-poor undecayed wood would extend its development time to implausible values, whereas feeding on highly decomposed wood (heavily infected with fungi) would barely balance its nutritional budget during the long development period of this species. The changes in stoichiometry indicate that the relative change in the nutrient levels in decaying wood cannot be attributed solely to carbon loss resulting from decomposer respiration: the action of fungi substantially enriches the decaying wood with nutritional elements imported from the outside of the system, making it a suitable food for wood-eating invertebrates. PMID:25536334

How to make a beetle out of wood: multi-elemental stoichiometry of wood decay, xylophagy and fungivory.

PubMed

Filipiak, Michał; Weiner, January

2014-01-01

The majority of terrestrial biomass is wood, but the elemental composition of its potential consumers, xylophages, differs hugely from that of wood. This causes a severe nutritional imbalance. We studied the stoichiometric relationships of 11 elements (C, N, P, K, Ca, Mg, Fe, Zn, Mn, Cu, Na) in three species of pine-xylem-feeding insects, Stictoleptura rubra, Arhopalus rusticus (Coleoptera, Cerambycidae) and Chalcophora mariana (Coleoptera, Buprestidae), to elucidate their mechanisms of tissue growth and to match their life histories to their dietary constraints. These beetles do not differ from other Coleoptera in their absolute elemental compositions, which are approximately 1000 (N), 100 (P, Cu) and 50 (K, Na) times higher than in dead but undecayed pine wood. This discrepancy diminishes along the wood decay gradient, but the elemental concentrations remain higher by an order of magnitude in beetles than in highly decayed wood. Numerical simulation of the life history of S. rubra shows that feeding on nutrient-poor undecayed wood would extend its development time to implausible values, whereas feeding on highly decomposed wood (heavily infected with fungi) would barely balance its nutritional budget during the long development period of this species. The changes in stoichiometry indicate that the relative change in the nutrient levels in decaying wood cannot be attributed solely to carbon loss resulting from decomposer respiration: the action of fungi substantially enriches the decaying wood with nutritional elements imported from the outside of the system, making it a suitable food for wood-eating invertebrates.

Public health assessment for McCormick and Baxter Creosoting Company (Portland), Portland, Multnomah County, Oregon, Region 10. Cerclis No. ORD009020603. Final report

DOE Office of Scientific and Technical Information (OSTI.GOV)

NONE

1995-06-13

The McCormick and Baxter Creosoting site is located on the Willamette River in Portland, Oregon. ATSDR considers the site to have been a public health hazard for former plant workers because of past ingestion exposure to arsenic, creosote, pentachlorophenol, polychlorinated dibenzodioxins, and dibenzofurans at levels of public health concern. The site also poses an ongoing and future public health hazard because people might encounter hazardous chemicals along the shoreline on or near the site at levels that can damage the skin, as was reported to have happened to two boys. Finally, dioxin levels would pose a public health hazard ifmore » people subsist on crayfish and suckers contaminated with polychlorinated dibenzodioxins and dibenzofurans.« less

A General Model of Synaptic Transmission and Short-Term Plasticity

PubMed Central

Pan, Bin; Zucker, Robert S.

2011-01-01

SUMMARY Some synapses transmit strongly to action potentials (APs), but weaken with repeated activation; others transmit feebly at first, but strengthen with sustained activity. We measured synchronous and asynchronous transmitter release at “phasic” crayfish neuromuscular junctions (NMJs) showing depression and at facilitating “tonic” junctions, and define the kinetics of depression and facilitation. We offer a comprehensive model of presynaptic processes, encompassing mobilization of reserve vesicles, priming of docked vesicles, their association with Ca2+ channels, and refractoriness of release sites, while accounting for data on presynaptic buffers governing Ca2+ diffusion. Model simulations reproduce many experimentally defined aspects of transmission and plasticity at these synapses. Their similarity to vertebrate central synapses suggests that the model might be of general relevance to synaptic transmission. PMID:19477155

Interspecific differences in susceptibility to competition and predation in a species-pair of larval amphibians

USGS Publications Warehouse

Walls, S.C.; Taylor, D.G.; Wilson, C.M.

2002-01-01

Fundamental issues in the study of predator-prey interactions include addressing how prey coexist with their predators and, moreover, whether predators promote coexistence among competing prey. We conducted a series of laboratory experiments with a freshwater assemblage consisting of two predators that differed in their foraging modes (a crayfish, Procambarus sp., and the western mosquitofish, Gambusia affinis) and their prospective anuran prey (tadpoles of the narrow-mouthed toad, Gastrophryne carolinensis, and the squirrel treefrog, Hyla squirella). We examined whether competition occurs within and between these two prey species and, if so, whether the non-lethal presence of predators alters the outcome of competitive interactions. We also asked whether the two species of prey differ in their susceptibility to the two types of predators and whether interspecific differences in predator avoidance behavior might account for this variation. Our results indicated that Gastrophryne was a stronger competitor than Hyla; at high densities, Gastrophryne reduced the body size of both congeners and conspecifics, as well as the proportion of surviving conspecifics that metamorphosed. However, the presence of mosquitofish did not alter the outcome of this competition, nor did either type of predator affect the density-dependent responses of Gastrophryne. In laboratory foraging trials, the number of tadpoles of each prey species that was killed, but not completely consumed by mosquitofish, was similar for Gastrophryne and Hyla. Yet, significantly more individuals of Gastrophryne than of Hyla were the first prey eaten by mosquitofish; there was no difference in the number of individuals of each species eaten by crayfish. Overall, more individuals of Gastrophryne than of Hyla were killed and completely eaten by mosquitofish at the end of the experiment. The two species of prey did not differ in their spatial avoidance of either type of predator, suggesting that this behavior did not play a significant role in the differential vulnerability of the prey to predation. By reducing the abundance of G. carolinensis, the potential exists for predators, such as mosquitofish, to ameliorate this species' competitive impact on other species. In this way, predators may promote coexistence of species within some assemblages of amphibians.

Comparative molecular analyses of select pH- and osmoregulatory genes in three freshwater crayfish Cherax quadricarinatus, C. destructor and C. cainii

PubMed Central

Pavasovic, Ana; Dammannagoda, Lalith K.; Mather, Peter B.; Prentis, Peter J.

2017-01-01

Systemic acid-base balance and osmotic/ionic regulation in decapod crustaceans are in part maintained by a set of transport-related enzymes such as carbonic anhydrase (CA), Na+/K+-ATPase (NKA), H+-ATPase (HAT), Na+/K+/2Cl− cotransporter (NKCC), Na+/Cl−/HCO\\documentclass[12pt]{minimal} \\usepackage{amsmath} \\usepackage{wasysym} \\usepackage{amsfonts} \\usepackage{amssymb} \\usepackage{amsbsy} \\usepackage{upgreek} \\usepackage{mathrsfs} \\setlength{\\oddsidemargin}{-69pt} \\begin{document} }{}${}_{3}^{-}$\\end{document}3− cotransporter (NBC), Na+/H+ exchanger (NHE), Arginine kinase (AK), Sarcoplasmic Ca+2-ATPase (SERCA) and Calreticulin (CRT). We carried out a comparative molecular analysis of these genes in three commercially important yet eco-physiologically distinct freshwater crayfish, Cherax quadricarinatus, C. destructor and C. cainii, with the aim to identify mutations in these genes and determine if observed patterns of mutations were consistent with the action of natural selection. We also conducted a tissue-specific expression analysis of these genes across seven different organs, including gills, hepatopancreas, heart, kidney, liver, nerve and testes using NGS transcriptome data. The molecular analysis of the candidate genes revealed a high level of sequence conservation across the three Cherax sp. Hyphy analysis revealed that all candidate genes showed patterns of molecular variation consistent with neutral evolution. The tissue-specific expression analysis showed that 46% of candidate genes were expressed in all tissue types examined, while approximately 10% of candidate genes were only expressed in a single tissue type. The largest number of genes was observed in nerve (84%) and gills (78%) and the lowest in testes (66%). The tissue-specific expression analysis also revealed that most of the master genes regulating pH and osmoregulation (CA, NKA, HAT, NKCC, NBC, NHE) were expressed in all tissue types indicating an important physiological role for these genes outside of osmoregulation in other tissue types. The high level of sequence conservation observed in the candidate genes may be explained by the important role of these genes as well as potentially having a number of other basic physiological functions in different tissue types. PMID:28852583

Transients in the inhibitory driving of neurons and their postsynaptic consequences.

PubMed

Segundo, J P; Stiber, M; Altshuler, E; Vibert, J F

1994-09-01

The presynaptic fiber at an inhibitory synapse on a pacemaker neuron was forced to generate transients, defined here as spike trains with a trend, unceasingly accelerating or slowing. Experiments were on isolated crayfish stretch receptor organs. Spike train analyses used tools and notions from conventional point processes and from non-linear dynamics. Pre- and postsynaptic discharges contrasted clearly in terms of rates and interspike intervals. The inhibitory train evolved monotonically and smoothly, following tightly the simple prescribed curves; it was uniform, exhibiting throughout a single and simple discharge form (i.e. interval patterning). The inhibited postsynaptic train alternately accelerated and slowed, not following tightly any simple curve; it was heterogeneous, exhibiting in succession several different and often complex discharge forms, and switching abruptly from one to another. The inhibited trains depended on the inhibitory transient's span, range and average slope. Accordingly, transients separated (not cuttingly) into categories with prolonged spans (over 1 s) and slow slopes (around 1/s2) and those with short spans (under 1 s) and fast slopes (around 30/s2). Special transients elicited postsynaptic discharges that reproduced it faithfully, e.g. accelerated with the transient and proportionately; no transient elicited postsynaptic discharges faithful to its mirror image. Crayfish synapses are prototypes, so these findings should be expected in any other junction, as working hypotheses at least. Implications involve the operation of neural networks, including the role of distortions and their compensation, and the underlying mechanisms. Transients have received little attention, most work on synaptic coding concentrating on stationary discharges. Transients are inherent to the changing situations that pervade everyday life, however, and their biological importance is self-evident. The different discharges encountered during a transient had strong similarities to the stationary forms reported for different pacemaker drivings that are called locking, intermittency, erratic and stammering; they were, in fact, trendy versions of these. Such forms appear with several synaptic drivings in the same order along the presynaptic rate scale; they may constitute basic building blocks for synaptic operation. In terms of non-linear science, it is as if the attractors postulated for stationary drivings remained strongly influential during the transients, though affected by the rate of change.

Circulation of Dirofilaria repens, Setaria tundra, and Onchocercidae species in Hungary during the period 2011-2013.

PubMed

Kemenesi, Gábor; Kurucz, Kornélia; Kepner, Anett; Dallos, Bianka; Oldal, Miklós; Herczeg, Róbert; Vajdovics, Péter; Bányai, Krisztián; Jakab, Ferenc

2015-11-30

Dirofilaria repens and recently Dirofilaria immitis are known to be endemic in Hungary. Since there is no related research on Dirofilaria carrier mosquito species from Hungary, we conducted a three-year mosquito surveillance study between 2011 and 2013. During the study period we examined 23,139 female mosquitoes with a generic filaria-specific TaqMan PCR assay, and characterized them by sequencing a 500 bp segment of 12S rRNA. An important result of our study was the detection of Setaria tundra and D. repens along with an unidentified Onchocercidae nematode. D. repens is known to be endemic in Hungary, however, the detection of S. tundra in all sampling sites throughout the study period indicates for the first time the endemicity of this parasite in Hungary. The Onchocercidae sp. nematode showed 95% nucleotide identity with previously detected unidentified nematodes from Germany, indicating a broader geographical distribution of this nematode in Europe. D. immitis specific DNA was not detected among the screened mosquitoes in this study. Here we report 11 mosquito species as potential vector organisms for local filarial infections, including Aedes vexans, Ochlerotatus annulipes, Ochlerotatus sticticus, Coquillettidia richiardii, Anopheles hyrcanus and Ochlerotatus rusticus. Dirofilaria development unit was calculated and the potential transmission period was estimated, which ranged between 65 and 113 days between sampling seasons. A relatively high infection rate (36.8%) was identified, which is a notable finding for veterinary and human health professionals. Moreover, the results of our study widen the group of possible mosquito vector species for D. repens and S. tundra in Central Europe. Copyright © 2015 Elsevier B.V. All rights reserved.

Relative abundance and distribution of fishes and crayfish at Ash Meadows National Wildlife Refuge, Nye County, Nevada, 2010-11

USGS Publications Warehouse

Scoppettone, G.G.; Johnson, D.M.; Hereford, M.E.; Rissler, Peter; Fabes, Mark; Salgado, Antonio; Shea, Sean

2012-01-01

Habitat restoration that favors native species can help control non-native species (McShane and others, 2004; Scoppettone and others, 2005; Kennedy and others, 2006). Restoration of Carson Slough and its tributaries present an opportunity to promote habitat types that favor native species over non-natives. Historically, the majority of Ash Meadows spring systems were tributaries to Carson Slough. In 2007 and 2008, a survey of Ash Meadows spring systems was conducted to generate baseline information on the distribution of fishes throughout AMNWR (Scoppettone and others, 2011b). In this study, we conducted a follow-up survey with emphasis on upper Carson Slough. This permitted us to gauge the early effects of spring system restoration on fish populations and to generate further baseline data relevant to future restoration efforts. 

A belted kingfisher flies above KSC

NASA Technical Reports Server (NTRS)

1999-01-01

A belted kingfisher soars over the Merritt Island National Wildlife Refuge, which shares a boundary with Kennedy Space Center. The pigeon-sized, blue-gray male is identified by the blue-gray breast band; females show a chestnut belly band. The belted kingfisher ranges throughout the United States and Canada, wintering south to Panama and the West Indies. They dive into the water for fish and may also take crabs, crayfish, salamanders, lizards, mice and insects. The 92,000-acre refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.

A new genus and species of entocytherid ostracod (Ostracoda: Entocytheridae) from the John Day River Basin of Oregon, U.S.A., with a key to genera of the subfamily Entocytherinae.

PubMed

Weaver, Patricia G; Williams, Bronwyn W

2017-06-07

Targeted sampling efforts by the authors for the signal crayfish, Pacifastacus leniusculus, from its native range in the John Day River Basin, Oregon, U.S.A. yielded entocytherid ostracods with a male copulatory complex so clearly different from other entocytherines that a new genus, Aurumcythere gen. nov. is proposed to receive them. This newly proposed, apparently nonsclerotized, genus with hook and spur-like prominences of the posteroventral end of the peniferum is the first new genus of the subfamily Entocytherinae named since Hobbs & Peters described Aphelocythere (= Waltoncythere) in 1977. Aurumcythere gen. nov. represents only the second genus of entocytherid known from the Pacific Northwest. Lack of sclerotization in Aurumcythere gen. nov. provides new insight into poorly understood mating behaviors of entocytherid ostracods.

Mercury accumulation in biota of Thunder Creek, Saskatchewan

DOE Office of Scientific and Technical Information (OSTI.GOV)

Munro, D.J.; Gummer, W.D.

Collection of biological organisms was undertaken to investigate the bioaccumulation of mercury in the food chain, the results of which are reported. Two sites were selected on Thunder Creek; the control or background site, site number 2, is located approximately 2.5 km upstream, from site number 1. The selection of organisms for analysis was based on the presence and abundance of each at both locations. Only crayfish (Orconcetes virilis) pearl dace (Semotilus margarita) and brook stickleback (Culaea inconstans) were found to be sufficiently abundant. The importance of the data obtained is the significant difference in concentration between the upstream andmore » downstream sites on Thunder Creek. This difference shows that more mercury is available to the biological community at site number 1 than at site number 2 confirming that mercury in the contaminated sediments is being methylated and taken up into the food chain.« less

Aquatic Nuisance Species Locator

EPA Pesticide Factsheets

Data in this map has been collected by the United States Geological Survey's Nonindigenous Aquatic Species program located in Gainesville, Florida (http://nas.er.usgs.gov/default.aspx). This dataset may have some inaccuracies and is only current to June 15, 2012. The species identified in this dataset are not inclusive of all aquatic nuisance species, but rather a subset identified to be at risk for transport by recreational activities such as boating and angling. Additionally, the locations where organisims have been identified are also not inclusive and should be treated as a guide. Organisms are limited to the following: American bullfrog, Asian clam, Asian shore crab, Asian tunicate, Australian spotted jellyfish, Chinese mitten crab, New Zealand mudsnail, Colonial sea squirt, Alewife, Bighead carp, Black carp, Flathead catfish, Grass carp, Green crab, Lionfish, Northern snakehead, Quagga mussel, Round Goby, Ruffe, Rusty crayfish, Sea lamprey, Silver carp, Spiny water flea, Veined rapa whelk, Zebra mussel

Food web dynamics in a seasonally varying wetland

USGS Publications Warehouse

DeAngelis, D.L.; Trexler, J.C.; Donalson, D.D.

2008-01-01

A spatially explicit model is developed to simulate the small fish community and its underlying food web, in the freshwater marshes of the Everglades. The community is simplified to a few small fish species feeding on periphyton and invertebrates. Other compartments are detritus, crayfish, and a piscivorous fish species. This unit food web model is applied to each of the 10,000 spatial cells on a 100 x 100 pixel landscape. Seasonal variation in water level is assumed and rules are assigned for fish movement in response to rising and falling water levels, which can cause many spatial cells to alternate between flooded and dry conditions. It is shown that temporal variations of water level on a spatially heterogeneous landscape can maintain at least three competing fish species. In addition, these environmental factors can strongly affect the temporal variation of the food web caused by top-down control from the piscivorous fish.

A kingfisher perches on a branch

NASA Technical Reports Server (NTRS)

1999-01-01

A belted kingfisher perches on a twig in the Merritt Island National Wildlife Refuge, which shares a boundary with the Kennedy Space Center. The pigeon-sized, blue-gray male is identified by the blue-gray breast band; females show a chestnut belly band. The belted kingfisher ranges throughout the United States and Canada, wintering south to Panama and the West Indies. They dive into the water for fish and may also take crabs, crayfish, salamanders, lizards, mice and insects. The 92,000-acre refuge is a habitat for more than 310 species of birds, 25 mammals, 117 fishes and 65 amphibians and reptiles. The marshes and open water of the refuge also provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds.

Quantifying foodweb interactions with simultaneous linear equations: Stable isotope models of the Truckee River, USA

USGS Publications Warehouse

Saito, L.; Redd, C.; Chandra, S.; Atwell, L.; Fritsen, C.H.; Rosen, Michael R.

2007-01-01

Aquatic foodweb models for 2 seasons (relatively high- [March] and low-flow [August] conditions) were constructed for 4 reaches on the Truckee River using ??13C and ??15N data from periphyton, macroinvertebrate, and fish samples collected in 2003 and 2004. The models were constructed with isotope values that included measured periphyton signatures and calculated mean isotope values for detritus and seston as basal food sources of each food web. The pseudo-optimization function in Excel's Solver module was used to minimize the sum of squared error between predicted and observed stable-isotope values while simultaneously solving for diet proportions for all foodweb consumers and estimating ??13C and ??15N trophic enrichment factors. This approach used an underdetermined set of simultaneous linear equations and was tested by running the pseudo-optimization procedure for 500 randomly selected sets of initial conditions. Estimated diet proportions had average standard deviations (SDs) of 0.03 to 0.04??? and SDs of trophic enrichment factors ranged from <0.005 to 0.05??? based on the results of the 500 runs, indicating that the modeling approach was very robust. However, sensitivity analysis of calculated detritus and seston ??13C and ??15N values indicated that the robustness of the approach is dependent on having accurate measures of all observed foodweb-component ??13c and ??15N values. Model results from the 500 runs using the mean isotope values for detritus and seston indicated that upstream food webs were the simplest, with fewer feeding groups and trophic interactions (e.g., 21 interactions for 10 feeding groups), whereas food webs for the reach downstream of the Reno-Sparks metropolitan area were the most complex (e.g., 58 interactions for 16 feeding groups). Nonnative crayfish were important omnivores in each reach and drew energy from multiple sources, but appeared to be energetic dead ends because they generally were not consumed. Predatory macroinvertebrate diets varied along the river and affected estimated trophic positions of fish that consumed them. Differences in complexity and composition of the food webs appeared to be related to season, but could also have been caused by interactions with nonnative species, especially invasive crayfish. ?? 2007 by The North American Benthological Society.

Antimicrobial proteins: From old proteins, new tricks.

PubMed

Smith, Valerie J; Dyrynda, Elisabeth A

2015-12-01

This review describes the main types of antimicrobial peptides (AMPs) synthesised by crustaceans, primarily those identified in shrimp, crayfish, crab and lobster. It includes an overview of their range of microbicidal activities and the current landscape of our understanding of their gene expression patterns in different body tissues. It further summarises how their expression might change following various types of immune challenges. The review further considers proteins or protein fragments from crustaceans that have antimicrobial properties but are more usually associated with other biological functions, or are derived from such proteins. It discusses how these unconventional AMPs might be generated at, or delivered to, sites of infection and how they might contribute to crustacean host defence in vivo. It also highlights recent work that is starting to reveal the extent of multi-functionality displayed by some decapod AMPs, particularly their participation in other aspects of host protection. Examples of such activities include proteinase inhibition, phagocytosis, antiviral activity and haematopoiesis. Copyright © 2015 Elsevier Ltd. All rights reserved.

Trade-offs between salinity preference and antipredator behaviour in the euryhaline sailfin molly Poecilia latipinna.

PubMed

Tietze, S M; Gerald, G W

2016-05-01

Salinity preference and responses to predatory chemical cues were examined both separately and simultaneously in freshwater (FW) and saltwater (SW)-acclimated sailfin mollies Poecilia latipinna, a euryhaline species. It was hypothesized that P. latipinna would prefer FW over SW, move away from chemical cues from a crayfish predator, and favour predator avoidance over osmoregulation when presented with both demands. Both FW and SW-acclimated P. latipinna preferred FW and actively avoided predator cues. When presented with FW plus predator cues v. SW with no cues, P. latipinna were more often found in FW plus predator cues. These results raise questions pertaining to the potential osmoregulatory stress of salinity transitions in euryhaline fishes relative to the potential fitness benefits and whether euryhalinity is utilized for predator avoidance. This study sheds light on the potential benefits and consequences of being salt tolerant or intolerant and complicates the understanding of the selection pressures that have favoured the different osmoregulatory mechanisms among fishes. © 2016 The Fisheries Society of the British Isles.

A Genetic Approach to Spanish Populations of the Threatened Austropotamobius italicus Located at Three Different Scenarios

PubMed Central

Matallanas, Beatriz; Callejas, Carmen; Ochando, M. Dolores

2012-01-01

Spanish freshwater ecosystems are suffering great modification and some macroinvertebrates like Austropotamobius italicus, the white-clawed crayfish, are threatened. This species was once widely distributed in Spain, but its populations have shown a very strong decline over the last thirty years, due to different factors. Three Spanish populations of this crayfish—from different scenarios—were analysed with nuclear (microsatellites) and mitochondrial markers (COI and 16S rDNA). Data analyses reveal the existence of four haplotypes at mitochondrial level and polymorphism for four microsatellite loci. Despite this genetic variability, bottlenecks were detected in the two natural Spanish populations tested. In addition, the distribution of the mitochondrial haplotypes and SSR alleles show a similar geographic pattern and the genetic differentiation between these samples is mainly due to genetic drift. Given the current risk status of the species across its range, this diversity offers some hope for the species from a management point of view. PMID:22645491

Trade-offs between salinity preference and antipredator behaviour in the euryhaline sailfin molly Poecilia latipinna

PubMed Central

TIETZE, S. M.; GERALD, G. W.

2016-01-01

Salinity preference and responses to predatory chemical cues were examined both separately and simultaneously in freshwater (FW) and saltwater (SW)-acclimated sailfin mollies Poecilia latipinna, a euryhaline species. It was hypothesized that P. latipinna would prefer FW over SW, move away from chemical cues from a crayfish predator, and favour predator avoidance over osmoregulation when presented with both demands. Both FW and SW-acclimated P. latipinna preferred FW and actively avoided predator cues. When presented with FW plus predator cues v. SW with no cues, P. latipinna were more often found in FW plus predator cues. These results raise questions pertaining to the potential osmoregulatory stress of salinity transitions in euryhaline fishes relative to the potential fitness benefits and whether euryhalinity is utilized for predator avoidance. This study sheds light on the potential benefits and consequences of being salt tolerant or intolerant and complicates the understanding of the selection pressures that have favoured the different osmoregulatory mechanisms among fishes. PMID:27001481

DOE Office of Scientific and Technical Information (OSTI.GOV)

Kem, W.; Dunn, B.; Parten, B.

A 5000 dalton polypeptide neurotoxin (Sh-NI) purified by G50 Sephadex, P-cellulose, and SP-Sephadex chromatography was homogeneous by isoelectric focusing. Sh-NI was highly toxic to crayfish (LD/sub 50/ 0.6 ..mu..g/kg) but without effect upon mice at 15,000 ..mu..g/kg (i.p. injection). The reduced, /sup 3/H-carboxymethylated toxin and its fragments were subjected to automatic Edman degradation and the resulting PTH-amino acids were identified by HPLC, back hydrolysis, and scintillation counting. Peptides resulting from proteolytic (clostripain, staphylococcal protease) and chemical (tryptophan) cleavage were sequenced. The sequence is: AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK. This sequence differs considerably from the homologous Anemonia and Anthopleura toxins; many of the identical residuesmore » (6 half-cystines, G9, P10, R13, G19, G29, W30) are probably critical for folding rather than receptor recognition. However, the Sh-NI sequence closely resembles Radioanthus macrodactylus neurotoxin III and r. paumotensis II. The authors propose that Sh-NI and related Radioanthus toxins act upon a different site on the sodium channel.« less

System-Wide Significance of Predation on Juvenile Salmonids in the Columbia and Snake River Reservoirs : Annual Report of Research 1991.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Shively, R.S.

1991-01-01

We indexed consumption rates of northern squawfish (Ptychoch oregonensis) preying upon juvenile salmonids in four lower Snake River reservoirs. Stomach contents were also collected from smallmouth bass (Micropterus dolomieui), channel catfish (Ictaluris gunctatus), and walleye (Stizostedion vitreum). Northern squawfish digestive tracts were analyzed and the overall diet (% weight) was dominated by fish and crustaceans. Examination of stomach contents smallmouth bass showed that crustaceans (primarily crayfish) dominated their diets. Overall, the consumption rate of juvenile salmonids by smallmouth bass was low. The northern squawfish consumption index (CI) at Snake River locations ranged from zero at all mid-reservoir locations to 1.2more » at Lower Granite forebay. In John Day Reservoir, CI values ranged from 0.5 to 1.9 in May and from 0.9 to 3.0 in July. Consumption index values were highest in forebay and tailrace areas, and were slightly higher in BRZs than in non-restricted zones.« less

Diets, equipment, and techniques for maintaining crawfish in the laboratory

USGS Publications Warehouse

Tarshis, I.B.; Avault, James W.

1978-01-01

One commercial and 4 laboratory prepared extruded, water-stable diets were fed 3 times a week in 1-g portions to juvenile male and female White River crawfish, Procambarus acutus acutus (Girard), for 10 weeks. The. binding material in the laboratory preparation was alginate (Kelgin), whereas that in the commercial preparation was starch. No statistically significant weight differences developed between the groups of crawfish at the end of the 10-week period; all 5 diets were found satisfactory for feeding and maintaining P. acutus acutus in the laboratory, and all test crawfish survived throughout the experimental period. Weight gains were highest in a diet containing 50.5% protein; intermediate in those fed a diet with 46.0% protein; and lowest in those fed diets with 31.7 or 36.3% protein. Crawfish fed the commercial preparation of one of the 46.0% protein diets showed a slightly but not significantly higher weight gain than those fed the laboratory preparation of the diet. In an evaluation of the water stability of 5 commercially prepared animal chow diets and the commercial extruded diet, 2 of the commercial diets disintegrated after one hour exposure in water and the other 3 became bloated after one hour and remained on the surface throughout the 24-hour test. The commercial extruded diet maintained its water stability for the full 24 hours. The commercial preparation of the 46.0% protein diet was successfully used under laboratory conditions for feeding and maintaining the following crawfishes: Cambarellus shufeldtii (Faxon), Cambarus acuminatus Faxon, Orconectes limosus (Rafinesque), O. virilis (Hagen), Procambarus clarkii (Girard), and P. spiculifer (Le conte). In longevity experiments Cambarus diogenes diogenes Girard and Procambarus hinei (Ortmann) now have survived for 8 months on this diet in the laboratory.

A cone-shaped 3D carbon nanotube probe for neural recording.

PubMed

Su, Huan-Chieh; Lin, Chia-Min; Yen, Shiang-Jie; Chen, Yung-Chan; Chen, Chang-Hsiao; Yeh, Shih-Rung; Fang, Weileun; Chen, Hsin; Yao, Da-Jeng; Chang, Yen-Chung; Yew, Tri-Rung

2010-09-15

A novel cone-shaped 3D carbon nanotube (CNT) probe is proposed as an electrode for applications in neural recording. The electrode consists of CNTs synthesized on the cone-shaped Si (cs-Si) tip by catalytic thermal chemical vapor deposition (CVD). This probe exhibits a larger CNT surface area with the same footprint area and higher spatial resolution of neural recording compared to planar-type CNT electrodes. An approach to improve CNT characteristics by O(2) plasma treatment to modify the CNT surface will be also presented. Electrochemical characterization of O(2) plasma-treated 3D CNT (OT-CNT) probes revealed low impedance per unit area (∼64.5 Ω mm(-2)) at 1 kHz and high specific capacitance per unit area (∼2.5 mF cm(-2)). Furthermore, the OT-CNT probes were employed to record the neural signals of a crayfish nerve cord. Our findings suggest that OT-CNT probes have potential advantages as high spatial resolution and superb electrochemical properties which are suitable for neural recording applications. Copyright 2010 Elsevier B.V. All rights reserved.

Do Decapod Crustaceans Have Nociceptors for Extreme pH?

PubMed Central

Puri, Sakshi; Faulkes, Zen

2010-01-01

Background Nociception is the physiological detection of noxious stimuli. Because of its obvious importance, nociception is expected to be widespread across animal taxa and to trigger robust behaviours reliably. Nociception in invertebrates, such as crustaceans, is poorly studied. Methodology/Principal Findings Three decapod crustacean species were tested for nociceptive behaviour: Louisiana red swamp crayfish (Procambarus clarkii), white shrimp (Litopenaeus setiferus), and grass shrimp (Palaemonetes sp.). Applying sodium hydroxide, hydrochloric acid, or benzocaine to the antennae caused no change in behaviour in the three species compared to controls. Animals did not groom the stimulated antenna, and there was no difference in movement of treated individuals and controls. Extracellular recordings of antennal nerves in P. clarkii revealed continual spontaneous activity, but no neurons that were reliably excited by the application of concentrated sodium hydroxide or hydrochloric acid. Conclusions/Significance Previously reported responses to extreme pH are either not consistently evoked across species or were mischaracterized as nociception. There was no behavioural or physiological evidence that the antennae contained specialized nociceptors that responded to pH. PMID:20422026

Coherent signal amplification in bistable nanomechanical oscillators by stochastic resonance

NASA Astrophysics Data System (ADS)

Badzey, Robert L.; Mohanty, Pritiraj

2005-10-01

Stochastic resonance is a counterintuitive concept: the addition of noise to a noisy system induces coherent amplification of its response. First suggested as a mechanism for the cyclic recurrence of ice ages, stochastic resonance has been seen in a wide variety of macroscopic physical systems: bistable ring lasers, superconducting quantum interference devices (SQUIDs), magnetoelastic ribbons and neurophysiological systems such as the receptors in crickets and crayfish. Although fundamentally important as a mechanism of coherent signal amplification, stochastic resonance has yet to be observed in nanoscale systems. Here we report the observation of stochastic resonance in bistable nanomechanical silicon oscillators. Our nanomechanical systems consist of beams that are clamped at each end and driven into transverse oscillation with the use of a radiofrequency source. Modulation of the source induces controllable switching of the beams between two stable, distinct states. We observe that the addition of white noise causes a marked amplification of the signal strength. Stochastic resonance in nanomechanical systems could have a function in the realization of controllable high-speed nanomechanical memory cells, and paves the way for exploring macroscopic quantum coherence and tunnelling.

Banks Lake Fishery Evaluation Project Annual Report : Fiscal Year 2008 (March 1, 2008 to February 1, 2009).

DOE Office of Scientific and Technical Information (OSTI.GOV)

Polacek, Matt

2009-07-15

The Washington Department of Fish and Wildlife implemented the Banks Lake Fishery Evaluation Project (BLFEP) in September 2001 with funds from the Bonneville Power Administration, and continued project tasks in 2008. The objective was to evaluate factors that could limit kokanee in Banks Lake, including water quality, prey availability, harvest, and acute predation during hatchery releases. Water quality parameters were collected twice monthly from March through November. Banks Lake water temperatures began to increase in May and stratification was apparent by July. By late August, the thermocline had dropped to 15 meters deep, with temperatures of 21-23 C in themore » epilimnion and 16-19 C in the hypolimnion. Dissolved oxygen levels were generally above 8 mg/L until August when they dropped near or below 5 mg/L deeper than 20-meters. Secchi depths ranged from 3.2 to 6.2 meters and varied spatially and temporally. Daphnia and copepod densities were the highest in May and June, reaching densities of 26 copepods/liter and 9 Daphnia/liter. Fish surveys were conducted in July and October 2008 using boat electrofishing, gill netting, and hydroacoustic surveys. Lake whitefish (71%) and yellow perch (16%) dominated the limnetic fish assemblage in the summer, while lake whitefish (46%) and walleye (22%) were the most abundant in gill net catch during the fall survey. Piscivore diets switched from crayfish prior to the release of rainbow trout to crayfish and rainbow trout following the release. The highest angling pressure occurred in May, when anglers were primarily targeting walleye and smallmouth bass. Boat anglers utilized Steamboat State Park more frequently than any other boat ramp on Banks Lake. Shore anglers used the rock jetty at Coulee City Park 45% of the time, with highest use occurring from November through April. Ice fishing occurred in January and February at the south end of the lake. An estimated total of 4,397 smallmouth bass, 11,106 walleye, 371 rainbow trout, and 509 yellow perch were harvested from Banks Lake in 2008. No kokanee were reported in the creel; however, local reports indicated that anglers were targeting and catching kokanee. The economic benefit of the Banks Lake fishery was estimated at $2,288,005 during 2008. Abundance estimates from the hydroacoustic survey in July were 514,435 lake whitefish and 10,662 kokanee, with an overall abundance estimate of 626,061 limnetic fish greater than 100 mm. When comparing spring fry, fall fingerling and yearling net pen release strategies of kokanee, 95% were of hatchery origin, with the highest recaptures coming from the fall fingerling release group.« less

Calcium phosphate mineralization is widely applied in crustacean mandibles.

PubMed

Bentov, Shmuel; Aflalo, Eliahu D; Tynyakov, Jenny; Glazer, Lilah; Sagi, Amir

2016-02-24

Crustaceans, like most mineralized invertebrates, adopted calcium carbonate mineralization for bulk skeleton reinforcement. Here, we show that a major part of the crustacean class Malacostraca (which includes lobsters, crayfishes, prawns and shrimps) shifted toward the formation of calcium phosphate as the main mineral at specified locations of the mandibular teeth. In these structures, calcium phosphate is not merely co-precipitated with the bulk calcium carbonate but rather creates specialized structures in which a layer of calcium phosphate, frequently in the form of crystalline fluorapatite, is mounted over a calcareous "jaw". From a functional perspective, the co-existence of carbonate and phosphate mineralization demonstrates a biomineralization system that provides a versatile route to control the physico-chemical properties of skeletal elements. This system enables the deposition of amorphous calcium carbonate, amorphous calcium phosphate, calcite and apatite at various skeletal locations, as well as combinations of these minerals, to form graded composites materials. This study demonstrates the widespread occurrence of the dual mineralization strategy in the Malacostraca, suggesting that in terms of evolution, this feature of phosphatic teeth did not evolve independently in the different groups but rather represents an early common trait.

Assessment of microcystin distribution and biomagnification in tissues of aquatic food web compartments from a shallow lake and evaluation of potential risks to public health.

PubMed

Papadimitriou, Theodoti; Kagalou, Ifigenia; Stalikas, Constantinos; Pilidis, Georgios; Leonardos, Ioannis D

2012-05-01

The objectives of this study were: (1) to examine the distribution and bioaccumulation of microcystins in the main components of the food web (phytoplankton, zooplankton, crayfish, shrimp, mussel, snail, fish, frog) of Lake Pamvotis (NW Greece), (2) to investigate the possibility of microcystin biomagnification and (3) to evaluate the potential threat of the contaminated aquatic organisms to human health. Significant microcystin concentrations were detected in all the aquatic organisms during two different periods, with the higher concentrations observed in phytoplankton and the lower in fish species and frogs. This is the first study reporting microcystin accumulation in the body of the freshwater shrimp Atyaephyra desmsaresti, in the brain of the fish species common carp (Cyprinus carpio) and in the skin of the frog Rana epirotica. Although there was no evidence for microcystin biomagnification, the fact that microcystins were found in lake water and in the tissues of aquatic organisms, suggests that serious risks to animal and public health are possible to occur. In addition, it is likely to be unsafe to consume aquatic species harvested in Lake Pamvotis due to the high-concentrations of accumulated microcystins.

On the role of adenylate cyclase, tyrosine kinase, and tyrosine phosphatase in the response of nerve and glial cells to photodynamic impact

NASA Astrophysics Data System (ADS)

Kolosov, Mikhail S.; Bragin, D. E.; Dergacheva, Olga Y.; Vanzha, O.; Oparina, L.; Uzdensky, Anatoly B.

2004-08-01

The role of different intercellular signaling pathways involving adenylate cyclase (AC), receptor tyrosine kinase (RTK), tyrosine and serine/threonine protein phosphatases (PTP or PP, respectively) in the response of crayfish mechanoreceptor neuron (MRN) and surrounding glial cells to photodynamic effect of aluminum phthalocyanine Photosens have been studied. AC inhibition by MDL-12330A decreased neuron lifetime, whereas AC activation by forskolin increase it. Thus, increase in cAMP produced by activated AC protects SRN against photodynamic inactivation. Similarly, RTK inhibition by genistein decreased neuron lifetime, while inhibition of PTP or PP that remove phosphate groups from proteins, prolonged neuronal activity. AC inhibition reduced photoinduced damage of the plasma membrane, and, therefore, necrosis in neuronal and glial cells. RTK inhibition protected only neurons against PDT-induced membrane permeabilization while glial cells became lesser permeable under ortovanadate-mediated PTP inhibition. AC activation also prevented PDT-induced apoptosis in glial cells. PP inhibition enhanced apoptotic processes in photosensitized glial cells. Therefore, both intercellular signaling pathways involving AC and TRK are involved in the maintenance of neuronal activity, integrity of the neuronal and glial plasma membranes and in apoptotic processes in glia under photosensitization.

Quantitative food web analysis supports the energy-limitation hypothesis in cave stream ecosystems.

PubMed

Venarsky, Michael P; Huntsman, Brock M; Huryn, Alexander D; Benstead, Jonathan P; Kuhajda, Bernard R

2014-11-01

Energy limitation has long been the primary assumption underlying conceptual models of evolutionary and ecological processes in cave ecosystems. However, the prediction that cave communities are actually energy-limited in the sense that constituent populations are consuming all or most of their resource supply is untested. We assessed the energy-limitation hypothesis in three cave streams in northeastern Alabama (USA) by combining measurements of animal production, demand, and resource supplies (detritus, primarily decomposing wood particles). Comparisons of animal consumption and detritus supply rates in each cave showed that all, or nearly all, available detritus was required to support macroinvertebrate production. Furthermore, only a small amount of macroinvertebrate prey production remained to support other predatory taxa (i.e., cave fish and salamanders) after accounting for crayfish consumption. Placing the energy demands of a cave community within the context of resource supply rates provided quantitative support for the energy-limitation hypothesis, confirming the mechanism (limited energy surpluses) that likely influences the evolutionary processes and population dynamics that shape cave communities. Detritus-based surface ecosystems often have large detrital surpluses. Thus, cave ecosystems, which show minimal surpluses, occupy the extreme oligotrophic end of the spectrum of detritus-based food webs.

Diet dynamics of the adult piscivorous fish community in Spirit Lake, Iowa, USA 1995-1997

USGS Publications Warehouse

Liao, H.; Pierce, C.L.; Larscheid, J.G.

2002-01-01

Diets of adults of six important piscivorous fish species, black crappie Pomoxis nigromaculatus, largemouth bass Micropterus salmoides, northern pike Esox lucius, smallmouth bass Micropterus dolomieui, walleye Stizostedion vitreum, and yellow perch Perca flavescens were quantified in Spirit Lake, Iowa, USA from May to October in 1995-1997. Forty-one prey taxa were found in the diets of these species, including 19 species of fish. The most important prey taxa overall were yellow perch, amphipods and dipterans. Diets of northern pike and walleye were dominated by yellow perch. Largemouth bass diets included large percentages of both yellow perch and black bullhead Ameiurus melas. Smallmouth bass diets included large percentages of both yellow perch and crayfish. Black crappie and yellow perch diets were dominated by invertebrates, primarily amphipods and dipterans. There were pronounced differences in diets among species, among size classes within species and over time. Most of the dominant prey taxa we documented in the diets of piscivorous species were in accordance with previous studies, but a few deviated significantly from expectations. Many of the temporal diet changes were asynchronous among piscivorous species and size classes, suggesting different responses to common prey resources over time.

Calcium phosphate mineralization is widely applied in crustacean mandibles

PubMed Central

Bentov, Shmuel; Aflalo, Eliahu D.; Tynyakov, Jenny; Glazer, Lilah; Sagi, Amir

2016-01-01

Crustaceans, like most mineralized invertebrates, adopted calcium carbonate mineralization for bulk skeleton reinforcement. Here, we show that a major part of the crustacean class Malacostraca (which includes lobsters, crayfishes, prawns and shrimps) shifted toward the formation of calcium phosphate as the main mineral at specified locations of the mandibular teeth. In these structures, calcium phosphate is not merely co-precipitated with the bulk calcium carbonate but rather creates specialized structures in which a layer of calcium phosphate, frequently in the form of crystalline fluorapatite, is mounted over a calcareous “jaw”. From a functional perspective, the co-existence of carbonate and phosphate mineralization demonstrates a biomineralization system that provides a versatile route to control the physico-chemical properties of skeletal elements. This system enables the deposition of amorphous calcium carbonate, amorphous calcium phosphate, calcite and apatite at various skeletal locations, as well as combinations of these minerals, to form graded composites materials. This study demonstrates the widespread occurrence of the dual mineralization strategy in the Malacostraca, suggesting that in terms of evolution, this feature of phosphatic teeth did not evolve independently in the different groups but rather represents an early common trait. PMID:26906263

Effects of varying inter-limb spacing to limb length ratio in metachronal swimming

NASA Astrophysics Data System (ADS)

Lai, Hong Kuan; Merkel, Rachael; Santhanakrishnan, Arvind

2016-11-01

Crustaceans such as shrimp, krill and crayfish swim by rhythmic paddling of four to five pairs of closely spaced limbs. Each pair is phase-shifted in time relative to the neighboring pair, resulting in a metachronal wave that travels in the direction of animal motion. The broad goal of this study is to investigate how the mechanical design of the swimming limbs affect scalability of metachronal swimming in terms of limb-based Reynolds number (Re). A scaled robotic model of metachronal paddling was developed, consisting of four pairs of hinged acrylic plates actuated using stepper motors that were immersed in a rectangular tank containing water-glycerin fluid medium. 2D PIV measurements show that the propulsive jets transition from being primarily horizontal (thrust-producing direction) at Re of order 10 to angled vertically at Re of order 100. The ratio of inter-limb spacing to limb length among metachronal swimming organisms ranges between 0.2 to 0.65. 2D PIV will be used to examine the jets generated between adjacent limbs for varying inter-limb spacing to limb length ratios. The effect of increasing this ratio to beyond the biologically observed range will be discussed.

Freshwater decapod crustaceans (Palaemonidae, Cambaridae) of the Savannah River Plant, South Carolina

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hobbs, H.H. III; Thorp, J.H.; Anderson, G.E.

Decapod crustaceans (specifically crayfishes and freshwater shrimps) are quite numerous in the drainages of the southeastern United States and occupy an extremely important niche in aquatic systems. As predators they act as disturbance components on benthic freshwater communities and may serve an integral position in the early stages of detrital decomposition. They constitute an important prey item in the diets of a wide variety of terrestrial and aquatic vertebrate predators, including game fishes, such as Micropterus salmoides (La Crepede) and other centrarchids. Researchers at the Savannah River Plant (SRP) employ these crustaceans in studies of the effects of thermal andmore » heavy metal pollution on survival and behavior, as well as in investigations of the fates of heavy metals and radioactive pollution in freshwater environments. A common problem to these studies is the uncertainty of species determinations, and it is our intent to present an illustrated dichotomous key to the decapod crustaceans found in the aquatic habitats of the SRP. In addition, each species is treated separately with reference to specific taxonomic characters, ecology, life history, color patterns, etc. A brief discussion of collecting techniques, preservation and preparation and equipment needed for identification also is presented.« less

Diverse Distributions of Extraocular Opsins in Crustaceans, Cephalopods, and Fish.

PubMed

Kingston, Alexandra C N; Cronin, Thomas W

2016-11-01

Non-visual and extraocular photoreceptors are common among animals, but current understanding linking molecular pathways to physiological function of these receptors is lacking. Opsin diversity in extraocular tissues suggests that many putative extraocular photoreceptors utilize the "visual" phototransduction pathway-the same phototransduction pathway as photoreceptors within the retina dedicated to light detection for image sensing. Here, we provide a brief overview of the current understanding of non-visual and extraocular photoreceptors, and contribute a synopsis of several novel putative extraocular photoreceptors that use both visual and non-visual phototransduction pathways. Crayfish, cephalopods, and flat fish express opsins in diverse tissues, suggesting the presence of extraocular photoreceptors. In most cases, we find that these animals use the same phototransduction pathway that is utilized in the retinas for image-formation. However, we also find the presence of non-visual phototransduction components in the skin of flounders. Our evidence suggests that extraocular photoreceptors may employ a number of phototransduction pathways that do not appear to correlate with purpose or location of the photoreceptor. © The Author 2016. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

Some like it hot: Thermal tolerance and oxygen supply capacity in two eurythermal crustaceans.

PubMed

Ern, Rasmus; Huong, Do Thi Thanh; Phuong, Nguyen Thanh; Madsen, Peter Teglberg; Wang, Tobias; Bayley, Mark

2015-06-01

Thermal sensitivity of the cardiorespiratory oxygen supply capacity has been proposed as the cardinal link underlying the upper boundary of the temperature niche in aquatic ectotherms. Here we examined the evidence for this link in two eurythermal decapods, the Giant tiger shrimp (Penaeus monodon) and the European crayfish (Astacus astacus). We found that both species have a temperature resistant cardiorespiratory system, capable of maintaining oxygen delivery up to their upper critical temperature (Tcrit). In neither species was Tcrit reduced in hypoxia (60% air saturation) and both species showed an exponential increase in heart and gill ventilation rates up to their Tcrit. Further, failure of action potential conduction in preparations of A. astacus motor neurons coincided with Tcrit, indicating that compromised nervous function may provide the underlying determinant for Tcrit rather than oxygen delivery. At high temperatures, absolute aerobic scope was maintained in P. monodon, but reduced in A. astacus. However, A. astacus also displayed reduced exercise intensity indicating that impaired muscle performance with resulting reduced tissue oxygen demand may explain the reduced scope rather than insufficient oxygen supply capacity. This interpretation agrees with early literature on aquatic ectotherms, correlating loss of nervous function with impaired locomotion as temperatures approach Tcrit.

The temperature-productivity squeeze: Constraints on brook trout growth along an Appalachian river continuum

USGS Publications Warehouse

Petty, J. Todd; Thorne, David; Huntsman, Brock M.; Mazik, Patricia M.

2014-01-01

We tested the hypothesis that brook trout growth rates are controlled by a complex interaction of food availability, water temperature, and competitor density. We quantified trout diet, growth, and consumption in small headwater tributaries characterized as cold with low food and high trout density, larger tributaries characterized as cold with moderate food and moderate trout density, and large main stems characterized as warm with high food and low trout density. Brook trout consumption was highest in the main stem where diets shifted from insects in headwaters to fishes and crayfish in larger streams. Despite high water temperatures, trout growth rates also were consistently highest in the main stem, likely due to competitively dominant trout monopolizing thermal refugia. Temporal changes in trout density had a direct negative effect on brook trout growth rates. Our results suggest that competition for food constrains brook trout growth in small streams, but access to thermal refugia in productive main stem habitats enables dominant trout to supplement growth at a watershed scale. Brook trout conservation in this region should seek to relieve the “temperature-productivity squeeze,” whereby brook trout productivity is constrained by access to habitats that provide both suitable water temperature and sufficient prey.

Morphological and molecular data for three species of the Microphallidae (Trematoda: Digenea) in Australia, including the first descriptions of the cercariae of Maritrema brevisacciferum Shimazu et Pearson, 1991 and Microphallus minutus Johnston, 1948.

PubMed

Kudlai, Olena; Cutmore, Scott C; Cribb, Thomas H

2015-09-16

Cercariae and metacercariae of three species of the Microphallidae Travassos, 1920 were found in snails and crustaceans from tributaries of the Brisbane River, Queensland, Australia. Specimens of Maritrema brevisacciferum Shimazu et Pearson, 1991 and Microphallus minutus Johnston, 1948, which have previously been reported in Queensland, were found as cercariae in the tateid gastropod Posticobia brazieri (Smith) and as metacercariae of M. brevisacciferum in the atyid shrimp Caridina indistincta Calman and of M. minutus in the parastacid crayfish Cherax dispar Reik. Combined analysis of morphological and molecular data, based on newly generated ITS2 and partial 28S rDNA data, linked cercariae and metacercariae for both species. This is the first report of the first intermediate hosts of M. brevisacciferum and M. minutus. Infections of another unidentified microphallid metacercariae, Microphallidae gen. sp., were found in P. brazieri and C. indistincta. The sequences of metacercarial isolates from both hosts were identical. The data on the Microphallidae from Australia and species that develop in freshwater invertebrates were examined in detail.

Conservation status of freshwater gastropods of Canada and the United States

USGS Publications Warehouse

Johnson, Paul D.; Bogan, Arthur E.; Brown, Kenneth M.; Burkhead, Noel M.; Cordeiro, James R.; Garner, Jeffrey T.; Hartfield, Paul D.; Lepitzki, Dwayne A.; Mackie, Gerry L.; Pip, Eva; Tarpley, Thomas A.; Tiemann, Jeremy S.; Whelan, Nathan V.; Strong, Ellen E.

2013-01-01

This is the first American Fisheries Society conservation assessment of freshwater gastropods (snails) from Canada and the United States by the Gastropod Subcommittee (Endangered Species Committee). This review covers 703 species representing 16 families and 93 genera, of which 67 species are considered extinct, or possibly extinct, 278 are endangered, 102 are threatened, 73 are vulnerable, 157 are currently stable, and 26 species have uncertain taxonomic status. Of the entire fauna, 74% of gastropods are imperiled (vulnerable, threatened, endangered) or extinct, which exceeds imperilment levels in fishes (39%) and crayfishes (48%) but is similar to that of mussels (72%). Comparison of modern to background extinction rates reveals that gastropods have the highest modern extinction rate yet observed, 9,539 times greater than background rates. Gastropods are highly susceptible to habitat loss and degradation, particularly narrow endemics restricted to a single spring or short stream reaches. Compilation of this review was hampered by a paucity of current distributional information and taxonomic uncertainties. Although research on several fronts including basic biology, physiology, conservation strategies, life history, and ecology are needed, systematics and curation of museum collections and databases coupled with comprehensive status surveys (geographic limits, threat identification) are priorities.

Altered impulse activity modifies synaptic physiology and mitochondria in crayfish phasic motor neurons.

PubMed

Nguyen, P V; Atwood, H L

1994-12-01

1. Crayfish phasic motor synapses produce large initial excitatory postsynaptic potentials (EPSPs) that fatigue rapidly during high-frequency stimulation. Periodic in vivo stimulation of an identified phasic abdominal extensor motor neuron (axon 3) induced long-term adaptation (LTA) of neuromuscular transmission: initial EPSP amplitude became smaller and synaptic depression was significantly reduced. We tested the hypothesis that activity-induced synaptic fatigue-resistance seen during LTA was dependent upon, or correlated with, mitochondrial oxidative competence. 2. Periodic unilateral conditioning stimulation of axon 3 entering each of two adjacent homologous abdominal segments (segments 2 and 3) increased the synaptic stamina in both "conditioned" axons; mean final EPSP amplitudes, recorded after 20 min of 5-Hz test stimulation, were significantly larger than those measured with the same protocol from contralateral unstimulated axons. 3. During 5-Hz test stimulation of the conditioned axon 3 of segment 3, acute superfusion with 0.8 mM dinitrophenol or 20 mM sodium azide [inhibitors of oxidative adenosinetriphosphate (ATP) synthesis] produced increased synaptic depression. Drug-free saline superfusion of the conditioned axon 3 of segment 2 in these same animals did not affect the increased synaptic fatigue resistance seen in this segment. Thus both successful induction (in axon 3 of saline-perfused segment 2) and attenuation (in axon 3 of drug-perfused segment 3) of the increased synaptic stamina can be demonstrated with this twin-segment conditioning protocol. 4. Confocal microscopic imaging of mitochondrial rhodamine-123 (Rh123) fluorescence was used to assess relative oxidative competence of conditioned and unconditioned phasic axons. Conditioned phasic axons showed significantly higher mean mitochondrial Rh123 fluorescence than contralateral unstimulated axons. In the same preparations that showed increased postconditioning Rh123 fluorescence, the synaptic fatigue resistance measured from conditioned axon 3 was also significantly greater than that recorded from contralateral unstimulated axon 3. 5. Axotomy of the phasic extensor nerve root (containing axon 3), before in vivo conditioning stimulation of its decentralized segment, prevented induction of both the increased synaptic stamina in axon 3 and the enhanced mitochondrial fluorescence in decentralized motor axons of the nerve root. Hence, induction of both changes requires axonal transport of materials between the soma and the motor synapses of axon 3. 5. Axotomy of the phasic extensor nerve root (containing axon 3), before in vivo conditioning stimulation of its decentralized segment, Prevented induction of both the increased synaptic stamina in axon 3 and the enhanced mitochondrial fluorescence in decentralized motor axons of the nerve root Hence, induction of both changes requires axonal transport of materials between the soma and the motor synapses of axon 3 6. Because mitochondrial Rh123 fluorescence is primarily dependent upon the oxidative activity of these organelles, our findings suggest that conditioning stimulation of phasic extensor axon 3 increases its mitochondrial oxidative competence and that the enhanced synaptic stamina seen during LTA in axon 3 is correlated with, and dependent upon, oxidative activity.(ABSTRACT TRUNCATED AT 400 WORDS)

Simultaneous determination of UV-filters and estrogens in aquatic invertebrates by modified quick, easy, cheap, effective, rugged, and safe extraction and liquid chromatography tandem mass spectrometry.

PubMed

He, Ke; Timm, Anne; Blaney, Lee

2017-08-04

Ultraviolet-filters (UV-filters) and estrogens have attracted increased attention as contaminants of emerging concern (CECs) due to their widespread occurrence in the environment. Most of these CECs are hydrophobic and have the potential to accumulate in aquatic organisms. To date, co-analysis of UV-filters and estrogens has not been reported due, in part, to the complex environmental matrices. Here, a multi-residue method has been developed for simultaneous determination of five UV-filters and three estrogens in tissue from aquatic and marine organisms. The procedure involved a modified Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) extraction with a novel reverse-solid-phase extraction (reverse-SPE) cleanup in place of dispersive-SPE, followed by liquid chromatography tandem mass spectrometry (LC-MS/MS) analysis. The tissue mass, acetonitrile content, and salt conditions for QuEChERS extraction, along with the reverse-SPE cartridge material and elution conditions, were thoroughly investigated and optimized. Five UV-filters (i.e., 3-(4-methylbenzylidene) camphor, benzophenone-3, ethylhexylmethoxycinnamate, homosalate, and octocrylene) and three estrogens (i.e., estrone, 17β-estradiol, and 17α-ethinylestradiol) were simultaneously analyzed by taking advantage of wrong-way-round ionization in LC-MS/MS. The optimized analytical protocol exhibited good recoveries (>80%) for target compounds and enabled their detection at concentrations as low as 0.2ng/g in 50mg tissue samples. The method was applied to determine concentrations of target analytes in four invertebrates (i.e., Orconectes virilis, Procambarus clarkii, Crassostrea virginica, and Ischadium recurvum). All eight target analytes were detected at least once in the tissue samples, with the highest concentration being 399ng/g of homosalate in O. virilis. These results highlight the ubiquitous bioaccumulation of CECs in aquatic and marine invertebrates. Copyright © 2017 Elsevier B.V. All rights reserved.

Fast calcium transients translate the distribution and conduction of neural activity in different regions of a single sensory neuron.

PubMed

Purali, Nuhan

2017-09-01

In the present study, cytosolic calcium concentration changes were recorded in response to various forms of excitations, using the fluorescent calcium indicator dye OG-BAPTA1 together with the current or voltage clamp methods in stretch receptor neurons of crayfish. A single action potential evoked a rise in the resting calcium level in the axon and axonal hillock, whereas an impulse train or a large saturating current injection would be required to evoke an equivalent response in the dendrite region. Under voltage clamp conditions, amplitude differences between axon and dendrite responses vanished completely. The fast activation time and the modulation of the response by extracellular calcium concentration changes indicated that the evoked calcium transients might be mediated by calcium entry into the cytosol through a voltage-gated calcium channel. The decay of the responses was slow and sensitive to extracellular sodium and calcium concentrations as well as exposure to 1-10 mM NiCl 2 and 10-500 µM lanthanum. Thus, a sodium calcium exchanger and a calcium ATPase might be responsible for calcium extrusion from the cytosol. Present results indicate that the calcium indicator OG-BAPTA1 might be an efficient but indirect way of monitoring regional membrane potential differences in a single neuron.

The effect of the lectin from Cherax quadricarinatus on its granular hemocytes.

PubMed

Sánchez-Salgado, José Luis; Pereyra, Mohamed Alí; Agundis, Concepción; Vivanco-Rojas, Oscar; Rosales, Carlos; Pascual, Cristina; Alpuche-Osorno, Juan José; Zenteno, Edgar

2018-06-01

In crustaceans, lectins and hemocytes of the innate immune system provide the first line of defense. Although evidence points to the potential role of lectins in regulating hemocyte activity, the processes underlying the lectin activation have not been evaluated. In the present study, the receptor for CqL, a humoral lectin from Cherax quadricarinatus specific for galactose/sialic acid, was identified in a granular subset of hemocytes. The CqL receptor (CqLR) is a 490-kDa glycoprotein, composed of four identical 120-kDa subunits. As shown by immunohistochemistry, CqL at 7.5 μg/mL as optimal dose, after 2 min, induced, specifically on granular hemocytes, increased phosphorylation of serine (152%), threonine (192%), and tyrosine (242%) as compared with non-treated hemocytes; moreover, CqL induced increased generation of reactive oxygen species (ROS). Specific kinase inhibitors showed inhibition (P < 0.001) of ROS production induced by CqL. These results strongly suggest that CqL actively participated in the generation of ROS through kinases induced by a CqLR in a subset of granular hemocytes of the crayfish C. quadricarinatus. The results provide strong evidence that CqL activates, through specific granular hemocytes, receptors that modulate cellular functions in C. quadricarinatus. Copyright © 2018 Elsevier Ltd. All rights reserved.

Dietary specifications reflect the feeding behaviour of the European otter (Lutra lutra) in "Strandzha" Natural Park (Bulgaria)

NASA Astrophysics Data System (ADS)

Natchev, Nikolay; Petkov, Zahari; Dashev, Georgi; Atanasova, Ivanka; Chipev, Nesho

2015-12-01

Within the scope of the present study a field survey in the area of "Strandzha" Natural Park in south-east Bulgaria was carried out. The main goal of the investigation was to gain more detailed information on the diet of the European otters (Lutra lutra) that inhabit the park. As indicators for the presence of the mustelids a set of standard procedures, such as footprints tracking and inspecting the terrain for otter spraints were used. A total of 204 excrements were found, measured, documented and then disintegrated in water. The food rests in the faeces were investigated and the diet of the local population was documented. On the base of the results we separated the excrements into six groups and analysed the relations between the contents of the spraints and the characteristics of the habitat where they were found. We discovered a clear tendency toward piscivory in the middle and down streams of the studied rivers in the Natural Park. In the upper streams, otters relied almost exclusively on invertebrates like bivalves and crayfish as food source. The fact, that even suboptimal habitats, which offered invariable menu, were exploited by the otters is an indication for the stability of the local population.

Modulation and detection of single neuron activity using spin transfer nano-oscillators

NASA Astrophysics Data System (ADS)

Algarin, Jose Miguel; Ramaswamy, Bharath; Venuti, Lucy; Swierzbinski, Matthew; Villar, Pablo; Chen, Yu-Jin; Krivorotov, Ilya; Weinberg, Irving N.; Herberholz, Jens; Araneda, Ricardo; Shapiro, Benjamin; Waks, Edo

2017-09-01

The brain is a complex network of interconnected circuits that exchange electrical signals with each other. These electrical signals provide insight on how neural circuits code information, and give rise to sensations, thoughts, emotions and actions. Currents methods to detect and modulate these electrical signals use implanted electrodes or optical fields with light sensitive dyes in the brain. These techniques require complex surgeries or suffer low resolution. In this talk we explore a new method to both image and stimulate single neurons using spintronics. We propose using a Spin Transfer Nano-Oscillators (STNOs) as a nanoscale sensor that converts neuronal action potentials to microwave field oscillations that can be detected wirelessly by magnetic induction. We will describe our recent proof-of-concept demonstration of both detection and wireless modulation of neuronal activity using STNOs. For detection we use electrodes to connect a STNO to a lateral giant crayfish neuron. When we stimulate the neuron, the STNO responds to the neuronal activity with a corresponding microwave signal. For modulation, we stimulate the STNOs wirelessly using an inductively coupled solenoid. The STNO rectifies the induced microwave signal to produce a direct voltage. This direct voltage from the STNO, when applied in the vicinity of a mammalian neuron, changes the frequency of electrical signals produced by the neuron.

Critical control points of complementary food preparation and handling in eastern Nigeria.

PubMed Central

Ehiri, J. E.; Azubuike, M. C.; Ubbaonu, C. N.; Anyanwu, E. C.; Ibe, K. M.; Ogbonna, M. O.

2001-01-01

OBJECTIVE: To investigate microbial contamination and critical control points (CCPs) in the preparation and handling of complementary foods in 120 households in Imo state, Nigeria. METHODS: The Hazard Analysis Critical Control Point (HACCP) approach was used to investigate processes and procedures that contributed to microbial contamination, growth and survival, and to identify points where controls could be applied to prevent or eliminate these microbiological hazards or reduce them to acceptable levels. Food samples were collected and tested microbiologically at different stages of preparation and handling. FINDINGS: During cooking, all foods attained temperatures capable of destroying vegetative forms of food-borne pathogens. However, the risk of contamination increased by storage of food at ambient temperature, by using insufficiently high temperatures to reheat the food, and by adding contaminated ingredients such as dried ground crayfish and soybean powder at stages where no further heat treatment was applied. The purchasing of contaminated raw foodstuffs and ingredients, particularly raw akamu, from vendors in open markets is also a CCP. CONCLUSION: Although an unsafe environment poses many hazards for children's food, the hygienic quality of prepared food can be assured if basic food safety principles are observed. When many factors contribute to food contamination, identification of CCPs becomes particularly important and can facilitate appropriate targeting of resources and prevention efforts. PMID:11417038

Effects of prey density, temperature and predator diversity on nonconsumptive predator-driven mortality in a freshwater food web.

PubMed

Veselý, Lukáš; Boukal, David S; Buřič, Miloš; Kozák, Pavel; Kouba, Antonín; Sentis, Arnaud

2017-12-22

Nonconsumptive predator-driven mortality (NCM), defined as prey mortality due to predation that does not result in prey consumption, is an underestimated component of predator-prey interactions with possible implications for population dynamics and ecosystem functioning. However, the biotic and abiotic factors influencing this mortality component remain largely unexplored, leaving a gap in our understanding of the impacts of environmental change on ecological communities. We investigated the effects of temperature, prey density, and predator diversity and density on NCM in an aquatic food web module composed of dragonfly larvae (Aeshna cyanea) and marbled crayfish (Procambarus fallax f. virginalis) preying on common carp (Cyprinus carpio) fry. We found that NCM increased with prey density and depended on the functional diversity and density of the predator community. Warming significantly reduced NCM only in the dragonfly larvae but the magnitude depended on dragonfly larvae density. Our results indicate that energy transfer across trophic levels is more efficient due to lower NCM in functionally diverse predator communities, at lower resource densities and at higher temperatures. This suggests that environmental changes such as climate warming and reduced resource availability could increase the efficiency of energy transfer in food webs only if functionally diverse predator communities are conserved.

Photodynamic therapy-induced nitric oxide production in neuronal and glial cells

NASA Astrophysics Data System (ADS)

Kovaleva, Vera D.; Uzdensky, Anatoly B.

2016-10-01

Nitric oxide (NO) has been recently demonstrated to enhance apoptosis of glial cells induced by photodynamic therapy (PDT), but to protect glial cells from PDT-induced necrosis in the crayfish stretch receptor, a simple neuroglial preparation that consists of a single mechanosensory neuron enveloped by satellite glial cells. We used the NO-sensitive fluorescent probe 4,5-diaminofluorescein diacetate to study the distribution and dynamics of PDT-induced NO production in the mechanosensory neuron and surrounding glial cells. The NO production in the glial envelope was higher than in the neuronal soma axon and dendrites both in control and in experimental conditions. In dark NO generator, DEA NONOate or NO synthase substrate L-arginine hydrochloride significantly increased the NO level in glial cells, whereas NO scavenger 2-Phenyl-4,4,5,5-tetramethylimidazoline-1-oxyl 3-oxide (PTIO) or inhibitors of NO synthase L-NG-nitro arginine methyl ester and Nω-nitro-L-arginine decreased it. PDT induced the transient increase in NO production with a maximum at 4 to 7 min after the irradiation start followed by its inhibition at 10 to 40 min. We suggested that PDT stimulated neuronal rather than inducible NO synthase isoform in glial cells, and the produced NO could mediate PDT-induced apoptosis.

Inactivation of Paragonimus westermani metacercariae in soy sauce-marinated and frozen freshwater crabs.

PubMed

Kim, Tae Im; Oh, Se-Ra; Dai, Fuhong; Yang, Hyun-Jong; Ha, Sang-Do; Hong, Sung-Jong

2017-03-01

Soy sauce-marinated freshwater crabs (Eriocheir japonicus) are a source of human paragonimiasis. The viability of Paragonimus westermani metacercariae (PwMc) in marinated crabs was investigated in an experimental setting. The PwMc collected from freshwater crayfish were inoculated into freshwater crabs, which were then frozen or marinated in soy sauce. All PwMc in the freshwater crabs were inactivated after freezing for 48 h at -20 °C and after freezing for 12 h at -40 °C. After marinating for 32 days, the survival rate of PwMc in 5% NaCl soy sauce was 50%, in 7.5% NaCl soy sauce it was 33.3%, and in 10.0% NaCl soy sauce it was 31.3%. When marinated for 64 days, all PwMc were inactivated in all experimental groups. These results revealed that freezing and soy sauce marination were detrimental to the survival of PwMc in freshwater crabs. Specifically, freezing crabs for more than 48 h or soaking them in soy sauce containing at least 5.0% NaCl for 64 days can inactivate PwMc. These results can inform the production of the traditional Korean soy sauce-marinated freshwater crabs known as gejang.

A semi-automated method of monitoring dam passage of American Eels Anguilla rostrata

USGS Publications Warehouse

Welsh, Stuart A.; Aldinger, Joni L.

2014-01-01

Fish passage facilities at dams have become an important focus of fishery management in riverine systems. Given the personnel and travel costs associated with physical monitoring programs, automated or semi-automated systems are an attractive alternative for monitoring fish passage facilities. We designed and tested a semi-automated system for eel ladder monitoring at Millville Dam on the lower Shenandoah River, West Virginia. A motion-activated eel ladder camera (ELC) photographed each yellow-phase American Eel Anguilla rostrata that passed through the ladder. Digital images (with date and time stamps) of American Eels allowed for total daily counts and measurements of eel TL using photogrammetric methods with digital imaging software. We compared physical counts of American Eels with camera-based counts; TLs obtained with a measuring board were compared with TLs derived from photogrammetric methods. Data from the ELC were consistent with data obtained by physical methods, thus supporting the semi-automated camera system as a viable option for monitoring American Eel passage. Time stamps on digital images allowed for the documentation of eel passage time—data that were not obtainable from physical monitoring efforts. The ELC has application to eel ladder facilities but can also be used to monitor dam passage of other taxa, such as crayfishes, lampreys, and water snakes.

Distribution of biota in a stream polluted by acid mine-drainage

DOE Office of Scientific and Technical Information (OSTI.GOV)

Warner, R.W.

1971-01-01

Acidic water draining from coal mines has severly restricted the diversity of biota inhabiting Roaring Creek, eastern West Virginia. Polluted reaches of the stream (median pH values ranging from 2.8 to 3.8) were inhabited by 3 to 12 genera of bottom-dwelling invertebrates and 10 to 19 species of periphytic algae. Invertebrates tolerant of the pollution included Sialis sp., chironomus plumosus and other Chironomidae, dytiscid beetles, and Ptilostomis sp. Predominant among the tolerant periphyton were Ulothrix tenerrima, Pinnularia termitina, Eunotia exigua, and Euglena mutabilis. Six other species of algae were tolerant of the acid mine-pollution, but were never numerous. Sections ofmore » Roaring Creek not severely polluted by acid drainage (pH medians of 4.5 or higher) supported diverse communities of 25 or more kinds of benthic animals and 27 or more species of periphytic algae. These stream reaches were inhibited by blackflies, crayfish, mayflies, stoneflies, and many species of caddisflies; these forms did not inhabit the more acidic stream reaches. Because of the complex and varying chemical composition of the acid mine-drainage, and also because of possible physical influences, measurements of pH values in the stream seemed to provide the most reliable, as well as unique, index of the effects of acid mine-drainage on aquatic life.« less

Foraging movements of Audouin’s gull (Larus audouinii) in the Ebro Delta, NW Mediterranean: A preliminary satellite-tracking study

NASA Astrophysics Data System (ADS)

Christel, Isadora; Navarro, Joan; del Castillo, Marcos; Cama, Albert; Ferrer, Xavier

2012-01-01

A knowledge of the foraging strategies of marine predators is essential to understand the intrinsic factors controlling their distribution, abundance and their ecological function within the marine ecosystem. Here, we investigated for the first time the foraging movements and activity patterns of Audouin's gull Larus audouinii by using satellite-tracking data from eight breeding adults in the main colony of the species worldwide (Ebro Delta, NW Mediterranean). Tagged gulls foraged in the marine area close to the breeding colony (62% of foraging locations) and in the terrestrial area of the Ebro Delta (mainly rice fields; 38% of foraging locations). The foraging activity patterns changed significantly throughout the day; lower from dusk through the first half of the night (19-1 h; 32% of active locations) and higher during the rest of the day (1-19 h; 75.5 ± 4.3% of active locations). These results confirm the foraging plasticity of this seabird and, based on previous information about the dietary habits of this species, we hypothesize how its time-dependent activity patterns and habitat use could be associated with variations in the availability of marine food resources (e.g. diel vertical migrations of pelagic fish) and the exploitation of terrestrial resources (e.g. American crayfish Procambarus clarkii).

Mini-titins in striated and smooth molluscan muscles: structure, location and immunological crossreactivity.

PubMed

Vibert, P; Edelstein, S M; Castellani, L; Elliott, B W

1993-12-01

Invertebrate mini-titins are members of a class of myosin-binding proteins belonging to the immunoglobulin superfamily that may have structural and/or regulatory properties. We have isolated mini-titins from three molluscan sources: the striated and smooth adductor muscles of the scallop, and the smooth catch muscles of the mussel. Electron microscopy reveals flexible rod-like molecules about 0.2 micron long and 30 A wide with a distinctive polarity. Antibodies to scallop mini-titin label the A-band and especially the A/I junction of scallop striated muscle myofibrils by indirect immunofluorescence and immuno-electron microscopy. This antibody crossreacts with mini-titins in scallop smooth and Mytilus catch muscles, as well as with proteins in striated muscles from Limulus, Lethocerus (asynchronous flight muscle), and crayfish. It labels the A/I junction (I-region in Lethocerus) in these striated muscles as well as in chicken skeletal muscle. Antibodies to the repetitive immunoglobulin-like regions and also to the kinase domain of nematode twitchin crossreact with scallop mini-titin and label the A-band of scallop myofibrils. Electron microscopy of single molecules shows that antibodies to twitchin kinase bind to scallop mini-titin near one end of the molecule, suggesting how the scallop structure might be aligned with the sequence of nematode twitchin.

Spiking Neural Networks Based on OxRAM Synapses for Real-Time Unsupervised Spike Sorting.

PubMed

Werner, Thilo; Vianello, Elisa; Bichler, Olivier; Garbin, Daniele; Cattaert, Daniel; Yvert, Blaise; De Salvo, Barbara; Perniola, Luca

2016-01-01

In this paper, we present an alternative approach to perform spike sorting of complex brain signals based on spiking neural networks (SNN). The proposed architecture is suitable for hardware implementation by using resistive random access memory (RRAM) technology for the implementation of synapses whose low latency (<1μs) enables real-time spike sorting. This offers promising advantages to conventional spike sorting techniques for brain-computer interfaces (BCI) and neural prosthesis applications. Moreover, the ultra-low power consumption of the RRAM synapses of the spiking neural network (nW range) may enable the design of autonomous implantable devices for rehabilitation purposes. We demonstrate an original methodology to use Oxide based RRAM (OxRAM) as easy to program and low energy (<75 pJ) synapses. Synaptic weights are modulated through the application of an online learning strategy inspired by biological Spike Timing Dependent Plasticity. Real spiking data have been recorded both intra- and extracellularly from an in-vitro preparation of the Crayfish sensory-motor system and used for validation of the proposed OxRAM based SNN. This artificial SNN is able to identify, learn, recognize and distinguish between different spike shapes in the input signal with a recognition rate about 90% without any supervision.

Binary Gene Expression Patterning of the Molt Cycle: The Case of Chitin Metabolism

PubMed Central

Abehsera, Shai; Glazer, Lilah; Tynyakov, Jenny; Plaschkes, Inbar; Chalifa-Caspi, Vered; Khalaila, Isam; Aflalo, Eliahu D.; Sagi, Amir

2015-01-01

In crustaceans, like all arthropods, growth is accompanied by a molting cycle. This cycle comprises major physiological events in which mineralized chitinous structures are built and degraded. These events are in turn governed by genes whose patterns of expression are presumably linked to the molting cycle. To study these genes we performed next generation sequencing and constructed a molt-related transcriptomic library from two exoskeletal-forming tissues of the crayfish Cherax quadricarinatus, namely the gastrolith and the mandible cuticle-forming epithelium. To simplify the study of such a complex process as molting, a novel approach, binary patterning of gene expression, was employed. This approach revealed that key genes involved in the synthesis and breakdown of chitin exhibit a molt-related pattern in the gastrolith-forming epithelium. On the other hand, the same genes in the mandible cuticle-forming epithelium showed a molt-independent pattern of expression. Genes related to the metabolism of glucosamine-6-phosphate, a chitin precursor synthesized from simple sugars, showed a molt-related pattern of expression in both tissues. The binary patterning approach unfolds typical patterns of gene expression during the molt cycle of a crustacean. The use of such a simplifying integrative tool for assessing gene patterning seems appropriate for the study of complex biological processes. PMID:25919476

Exoskeletons across the Pancrustacea: Comparative Morphology, Physiology, Biochemistry and Genetics.

PubMed

Roer, Robert; Abehsera, Shai; Sagi, Amir

2015-11-01

The exoskeletons of pancrustaceans, as typified by decapod crustaceans and insects, demonstrate a high degree of similarity with respect to histology, ultrastructure, function, and composition. The cuticular envelope in insects and the outer epicuticle in crustaceans both serve as the primary barrier to permeability of the exoskeleton, preventing loss of water and ions to the external medium. Prior to and following ecdysis, there is a sequence of expression and synthesis of different proteins by the cuticular epithelium for incorporation into the pre-exuvial and post-exuvial procuticle of insects and the exocuticle and endocuticle of crustaceans. Both exhibit regional differences in cuticular composition, e.g., the articular (intersegmental) membranes of insects and the arthrodial (joint) membranes of crustaceans. The primary difference between these cuticles is the ability to mineralize. Crustaceans' cuticles express a unique suite of proteins that provide for the nucleation and deposition of calcium carbonate. Orthologs of genes discussed in the present review were mined from a recently completed cuticular transcriptome of the crayfish, Cherax quadricarinatus, providing new insights into the nature of these proteins. © The Author 2015. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

Wood in New Zealand's Native Forest Streams. Recent Advances

NASA Astrophysics Data System (ADS)

Mark, M. A.; Davies-Colley, R.

2005-05-01

We conducted a series of research projects to investigate the importance of wood in native forested streams of New Zealand. We examined abundance and geomorphic role of wood in 18 pristine native forest streams (channel width: 3-6 m) throughout New Zealand. Forest type and geographic location had no discernable influence on wood abundance, possibly reflecting the confounding influences of local features (e.g., tree fall regime) and methodology (`snap-shot' survey of a dynamic system). Number (18-66 per 100 m) and dead wood volume (85-470 m3 ha-1) of stream logs were at the high end of the international range. Living trees contributed up to 25% of total wood, and tree ferns were strongly represented (up to 11% of volume). The largest 10% of pieces contributed 75% of the total volume. The importance of the large wood pieces (>10 m3) was explored further with surveys within that watershed containing the site with the greatest wood volume. The largest pieces were rare but seemed relatively uniformly distributed. To explore the biological consequences of stream wood, we studied use of wood-related micro-habitat by the crayfish (Paranephrops planifrons White). Our findings suggest that wood is an important component of New Zealand's forested stream ecosystems.

US cities can manage national hydrology and biodiversity using local infrastructure policy.

PubMed

McManamay, Ryan A; Surendran Nair, Sujithkumar; DeRolph, Christopher R; Ruddell, Benjamin L; Morton, April M; Stewart, Robert N; Troia, Matthew J; Tran, Liem; Kim, Hyun; Bhaduri, Budhendra L

2017-09-05

Cities are concentrations of sociopolitical power and prime architects of land transformation, while also serving as consumption hubs of "hard" water and energy infrastructures. These infrastructures extend well outside metropolitan boundaries and impact distal river ecosystems. We used a comprehensive model to quantify the roles of anthropogenic stressors on hydrologic alteration and biodiversity in US streams and isolate the impacts stemming from hard infrastructure developments in cities. Across the contiguous United States, cities' hard infrastructures have significantly altered at least 7% of streams, which influence habitats for over 60% of North America's fish, mussel, and crayfish species. Additionally, city infrastructures have contributed to local extinctions in 260 species and currently influence 970 indigenous species, 27% of which are in jeopardy. We find that ecosystem impacts do not scale with city size but are instead proportionate to infrastructure decisions. For example, Atlanta's impacts by hard infrastructures extend across four major river basins, 12,500 stream km, and contribute to 100 local extinctions of aquatic species. In contrast, Las Vegas, a similar size city, impacts <1,000 stream km, leading to only seven local extinctions. So, cities have local policy choices that can reduce future impacts to regional aquatic ecosystems as they grow. By coordinating policy and communication between hard infrastructure sectors, local city governments and utilities can directly improve environmental quality in a significant fraction of the nation's streams reaching far beyond their city boundaries.

'Different strokes for different folks': geographically isolated strains of Lymnaea stagnalis only respond to sympatric predators and have different memory forming capabilities.

PubMed

Orr, Michael V; Hittel, Karla; Lukowiak, Ken

2009-07-01

Gaining insight into how natural trait variation is manifest in populations shaped by differential environmental factors is crucial to understanding the evolution, ecology and sensory biology of natural populations. We have demonstrated that lab-reared Lymnaea detect and respond to the scent of a crayfish predator with specific, appropriate anti-predator behavioral responses, including enhanced long-term memory (LTM) formation, and that such predator detection significantly alters the electrophysiological activity of RPeD1, a neuron that is a necessary site for LTM formation. Here we ask: (1) do distinct populations of wild Lymnaea stagnalis respond only to sympatric predators and if so, can these traits be quantified at both the behavioral and neurophysiological levels, and (2) does the presence of a non-sympatric predator elicit anti-predator behaviors including augmentation of LTM? We tested three different populations of wild (i.e. not lab-reared) snails freshly collected from their natural habitat: (1) polders near Utrecht in The Netherlands, (2) six seasonally isolated ponds in the Belly River drainage in southern Alberta, Canada and (3) a 20-year-old human-made dugout pond in southern Alberta. We found strain-specific variations in the ability to form LTM and that only a sympatric predator evoked anti-predatory behaviors, including enhanced LTM formation and changes in RPeD1 activity.

Behavioral responses of anuran larvae to chemical cues of native and introduced predators in the Pacific Northwestern United States

USGS Publications Warehouse

Pearl, Christopher A.; Adams, Michael J.; Schuytema, Gerald S.; Nebeker, A.V.

2003-01-01

We compared behavioral responses of larvae of three Pacific Northwest anurans from different hydroperiods to water borne cues of native and introduced predators. Two native anurans (Pacific Treefrog, Pseudacris regilla, and Northern Red-Legged Frog, Rana aurora aurora) and introduced Bullfrogs (Rana catesbeiana) responded to water conditioned by native Redside Shiners (Richardsonius balteatus) by increasing refuge use. The larvae of the two native anurans differed in their response to introduced predator cues. Rana aurora aurora, which occur in temporary and permanent waters, responded to both introduced Bluegill Sunfish (Lepomis macrochirus) and introduced Crayfish (Procambarus clarkii). Pseudacris regilla, which occur primarily in temporary ponds, did not respond to water borne cues from either introduced predator. The broader responses of R. a. aurora may indicate greater behavioral plasticity or more exposure to novel predators than experienced by P. regilla. Larvae of introduced R. catesbeiana responded strongly to cues from two fish native to the Pacific northwest but did not alter behavior in response to any of five potential predators with which they coexist in their native range. Fish that occur with R. catesbeiana in their native range generally find Bullfrog larvae unpalatable. This pattern suggests that Bullfrog larvae can recognize cues of novel predators that may find them palatable, which could contribute to their success as an invasive species in the region.

Photodynamic impact induces ischemic tolerance in models in vivo and in vitro

NASA Astrophysics Data System (ADS)

Demyanenko, Svetlana; Sharifulina, Svetlana; Berezhnaya, Elena; Kovaleva, Vera; Neginskaya, Maria; Zhukovskaya, Ludmila

2016-04-01

Ischemic tolerance determines resistance to lethal ischemia gained by a prior sublethal stimulus (i.e., preconditioning). We reproduced this effect in two variants. In vitro the preliminary short (5 s) photodynamic treatment (PDT) (photosensitizer Photosens, 10 nM, 30 min preincubation; laser: 670 nm, 100 mW/cm2) significantly reduced the necrosis of neurons and glial cells in the isolated crayfish stretch receptor, which was caused by following 30-min PDT by 66% and 46%, respectively. In vivo PDT of the rat cerebral cortex with hydrophilic photosensitizer Rose Bengal (i.v. administration, laser irradiation: 532 nm, 60 mW/cm2, 3 mm beam diameter, 30 min) caused occlusion of small brain vessels and local photothrombotic infarct (PTI). It is a model of ischemic stroke. Cerebral tissue edema and global necrosis of neurons and glial cells occurred in the infarction core, which was surrounded by a 1.5 mm transition zone, penumbra. The maximal pericellular edema, hypo- and hyperchromia of neurons were observed in penumbra 24 h after PTI. The repeated laser irradiation of the contralateral cerebral cortex also caused PTI but lesser as compared with single PDT. Preliminary unilateral PTI provided ischemic tolerance: at 14 day after second exposure the PTI volume significantly decreased by 24% than in the case of a single exposure. Sensorimotor deficits in PDT-treated rats was registered using the behavioral tests. The preliminary PTI caused the preconditioning effect.

Ecotoxicological impact of Zequanox®, a novel biocide, on selected non-target Irish aquatic species.

PubMed

Meehan, Sara; Shannon, Adam; Gruber, Bridget; Rackl, Sarahann M; Lucy, Frances E

2014-09-01

Effective, species-specific zebra mussel control is needed urgently for Ireland׳s freshwater bodies, which became infested with non-native zebra mussels in the 1990s. Zequanox®, a newly commercialized product for zebra and quagga mussel control, is composed of dead Pseudomonas fluorescens CL 145A cells. This paper describes ecotoxicology tests on three representative native Irish freshwater species: Anodonta (duck mussel), Chironomus plumosus (non-biting midge), and Austropotamobius pallipes (white-clawed crayfish). The species were exposed to Zequanox in a 72-h static renewal toxicity test at concentrations of 100-750mg active ingredient per liter (mga.i./L). Water quality parameters were measured every 12-24h before and after water and product renewal. After 72h, endpoints were reported as LC10, LC50, and LC100. The LC50 values derived were (1) Anodonta: ≥500mga.i./L (2) C. plumosus: 1075mga.i./L, and (3) A. pallipes: ≥750mga.i./L. These results demonstrate that Zequanox does not negatively affect these organisms at the concentration required for >80percent zebra mussel mortality (150mg a.i/L) and the maximum allowable treatment concentration in the United Sates (200mga.i./L). They also show the overall species-specificity of Zequanox, and support its use in commercial facilities and open waters. Copyright © 2014 Elsevier Inc. All rights reserved.

Predation of juvenile salmonids by smallmouth bass and northern squawfish in the Columbia River near Richland, Washington

USGS Publications Warehouse

Tabor, Roger A.; Shively, Rip S.; Poe, Thomas P.

1993-01-01

The importance of juvenile salmonids in the diet of smallmouth bass Micropterus dolomieu and northern squawfish Ptychocheilus oregonensis was examined at a 6-km stretch of the Columbia River. Piscivorous fish were sampled with electrofishing gear on 4 d (May 2–3 and June 20–21, 1990) during emigration of juvenile anadromous salmonids. Sixty-two smallmouth bass and 69 northern squawfish were collected for diet analysis. Juvenile salmonids made up 59% of smallmouth bass diet by weight and were present in 65% of the stomachs of smallmouth bass. By a meal turnover method, smallmouth bass were estimated to consume from 1.4 (May 2–3) to 1.0 (June 20–21) salmonids per predator daily. Crayfish were the dominant prey item (41.4% by weight) of northern squawfish, but juvenile salmonids (28.8%) were also important. Northern squawfish consumed from 0.55 (May 2–3) to 0.34 (June 20–21) salmonids per predator daily. Smallmouth bass and northern squawfish consumed mostly subyearling Chinook salmon Oncorhynchus tshawytscha, which may have been wild Chinook salmon that emigrated downstream from the Hanford reach. Predation rates on salmonids by smallmouth bass are apparently high during spring and early summer because subyearling Chinook salmon are abundant and of suitable forage size and their habitat overlaps with that of smallmouth bass.

Effects of pond draining on biodiversity and water quality of farm ponds.

PubMed

Usio, Nisikawa; Imada, Miho; Nakagawa, Megumi; Akasaka, Munemitsu; Takamura, Noriko

2013-12-01

Farm ponds have high conservation value because they contribute significantly to regional biodiversity and ecosystem services. In Japan pond draining is a traditional management method that is widely believed to improve water quality and eradicate invasive fish. In addition, fishing by means of pond draining has significant cultural value for local people, serving as a social event. However, there is a widespread belief that pond draining reduces freshwater biodiversity through the extirpation of aquatic animals, but scientific evaluation of the effectiveness of pond draining is lacking. We conducted a large-scale field study to evaluate the effects of pond draining on invasive animal control, water quality, and aquatic biodiversity relative to different pond-management practices, pond physicochemistry, and surrounding land use. The results of boosted regression-tree models and analyses of similarity showed that pond draining had little effect on invasive fish control, water quality, or aquatic biodiversity. Draining even facilitated the colonization of farm ponds by invasive red swamp crayfish (Procambarus clarkii), which in turn may have detrimental effects on the biodiversity and water quality of farm ponds. Our results highlight the need for reconsidering current pond management and developing management plans with respect to multifunctionality of such ponds. Efectos del Drenado de Estanques sobre la Biodiversidad y la Calidad del Agua en Estanques de Cultivo. © 2013 Society for Conservation Biology.

Importance of hybridization between indigenous and nonindigenous freshwater species: an overlooked threat to North American biodiversity.

PubMed

Perry, William L; Lodge, David M; Feder, Jeffrey L

2002-04-01

Biodiversity of North American freshwaters is among the greatest in the world. However, due to extensive habitat degradation, pollution, and introductions of nonindigenous species, this biodiversity is also among the most endangered. Unlike habitat degradation and pollution, nonindigenous species represent a permanent loss of biodiversity because their removal or control is often impossible. Most species introduced into nonnative North American ranges, however, are not from Eurasia but have been introduced from geographically isolated regions within North America. Although the ecological effects of introduced species have been widely documented, the effects of hybridization, especially between closely related species, represents an equally serious mechanism of extinction but is much less studied. Identification of which species are likely to hybridize after contact is of critical importance to prevent the further loss of native species. Molecular phylogenetics serves as a powerful tool to identify freshwater species at risk of introgression, if we can assume that genetic distance is a good predictor of the potential for hybridization. Although not a thorough review of all cases of hybridization, this article documents the extent and effects of hybridization in fishes, crayfishes, mussels, and other invertebrates in light of the currently accepted phylogenetic relationships. We suggest this approach may be the first step in addressing the potential threat of hybridization between many of the closely related species in North American fresh waters.

Critical Amino Acids in the Active Site of Meprin Metalloproteinases for Substrate and Peptide Bond Specificity*

PubMed Central

Villa, James P.; Bertenshaw, Greg P.; Bond, Judith S.

2008-01-01

SUMMARY The protease domains of the evolutionarily-related α and ß subunits of meprin metalloproteases are approximately 55% identical at the amino acid level, however, their substrate and peptide bond specificities differ markedly. The meprin ß subunit favors acidic residues proximal to the scissile bond, while the α subunit prefers small or aromatic amino acids flanking the scissile bond. Thus gastrin, a peptide that contains a string of five Glu residues, is an excellent substrate for meprin ß while it is not hydrolyzed by meprin α. Work herein aimed to identify critical amino acids in the meprin active sites that determine the substrate specificity differences. Sequence alignments and homology models, based on the crystal structure of the crayfish astacin, showed electrostatic differences within the meprin active sites. Site-directed mutagenesis of active site residues demonstrated that replacement of a hydrophobic residue by a basic amino acid enabled the meprin α protease to cleave gastrin. The meprin αY199K mutant was most effective; the corresponding mutation of meprin ßK185Y resulted in decreased activity toward gastrin. Peptide cleavage site determinations and kinetic analyses using a variety of peptides extended evidence that meprin αTyr199/ßLys185 are substrate specificity determinants in meprin active sites. These studies shed light on the molecular basis for the substrate specificity differences of astacin metalloproteinases. PMID:12888571

Species- and habitat-specific bioaccumulation of total mercury and methylmercury in the food web of a deep oligotrophic lake.

PubMed

Arcagni, Marina; Juncos, Romina; Rizzo, Andrea; Pavlin, Majda; Fajon, Vesna; Arribére, María A; Horvat, Milena; Ribeiro Guevara, Sergio

2018-01-15

Niche segregation between introduced and native fish in Lake Nahuel Huapi, a deep oligotrophic lake in Northwest Patagonia (Argentina), occurs through the consumption of different prey. Therefore, in this work we analyzed total mercury [THg] and methylmercury [MeHg] concentrations in top predator fish and in their main prey to test whether their feeding habits influence [Hg]. Results indicate that [THg] and [MeHg] varied by foraging habitat and they increased with greater percentage of benthic diet and decreased with pelagic diet in Lake Nahuel Huapi. This is consistent with the fact that the native creole perch, a mostly benthivorous feeder, which shares the highest trophic level of the food web with introduced salmonids, had higher [THg] and [MeHg] than the more pelagic feeder rainbow trout and bentho-pelagic feeder brown trout. This differential THg and MeHg bioaccumulation observed in native and introduced fish provides evidence to the hypothesis that there are two main Hg transfer pathways from the base of the food web to top predators: a pelagic pathway where Hg is transferred from water, through plankton (with Hg in inorganic species mostly), forage fish to salmonids, and a benthic pathway, as Hg is transferred from the sediments (where Hg methylation occurs mostly), through crayfish (with higher [MeHg] than plankton), to native fish, leading to one fold higher [Hg]. Copyright © 2017 Elsevier B.V. All rights reserved.

Mismatched anti-predator behavioral responses in predator-naïve larval anurans.

PubMed

Albecker, Molly; Vance-Chalcraft, Heather D

2015-01-01

Organisms are adept at altering behaviors to balance the tradeoff between foraging and predation risk in spatially and temporally shifting predator environments. In order to optimize this tradeoff, prey need to be able to display an appropriate response based on degree of predation risk. To be most beneficial in the earliest life stages in which many prey are vulnerable to predation, innate anti-predator responses should scale to match the risk imposed by predators until learned anti-predator responses can occur. We conducted an experiment that examined whether tadpoles with no previous exposure to predators (i.e., predator-naive) exhibit innate antipredator behavioral responses (e.g., via refuge use and spatial avoidance) that match the actual risk posed by each predator. Using 7 treatments (6 free-roaming, lethal predators plus no-predator control), we determined the predation rates of each predator on Lithobates sphenocephalus tadpoles. We recorded behavioral observations on an additional 7 nonlethal treatments (6 caged predators plus no-predator control). Tadpoles exhibited innate responses to fish predators, but not non-fish predators, even though two non-fish predators (newt and crayfish) consumed the most tadpoles. Due to a mismatch between innate response and predator consumption, tadpoles may be vulnerable to greater rates of predation at the earliest life stages before learning can occur. Thus, naïve tadpoles in nature may be at a high risk to predation in the presence of a novel predator until learned anti-predator responses provide additional defenses to the surviving tadpoles.

Mismatched anti-predator behavioral responses in predator-naïve larval anurans

PubMed Central

Vance-Chalcraft, Heather D.

2015-01-01

Organisms are adept at altering behaviors to balance the tradeoff between foraging and predation risk in spatially and temporally shifting predator environments. In order to optimize this tradeoff, prey need to be able to display an appropriate response based on degree of predation risk. To be most beneficial in the earliest life stages in which many prey are vulnerable to predation, innate anti-predator responses should scale to match the risk imposed by predators until learned anti-predator responses can occur. We conducted an experiment that examined whether tadpoles with no previous exposure to predators (i.e., predator-naive) exhibit innate antipredator behavioral responses (e.g., via refuge use and spatial avoidance) that match the actual risk posed by each predator. Using 7 treatments (6 free-roaming, lethal predators plus no-predator control), we determined the predation rates of each predator on Lithobates sphenocephalus tadpoles. We recorded behavioral observations on an additional 7 nonlethal treatments (6 caged predators plus no-predator control). Tadpoles exhibited innate responses to fish predators, but not non-fish predators, even though two non-fish predators (newt and crayfish) consumed the most tadpoles. Due to a mismatch between innate response and predator consumption, tadpoles may be vulnerable to greater rates of predation at the earliest life stages before learning can occur. Thus, naïve tadpoles in nature may be at a high risk to predation in the presence of a novel predator until learned anti-predator responses provide additional defenses to the surviving tadpoles. PMID:26664805